
Sample records for surface area ssa

  1. Molecularly-Limited Fractal Surface Area of Mineral Powders

    Directory of Open Access Journals (Sweden)

    Petr Jandacka


    Full Text Available The topic of the specific surface area (SSA of powders is not sufficiently described in the literature in spite of its nontrivial contribution to adsorption and dissolution processes. Fractal geometry provides a way to determine this parameter via relation SSA ~ x(D − 3s(2 − D, where x (m is the particle size and s (m is a scale. Such a relation respects nano-, micro-, or macro-topography on the surface. Within this theory, the fractal dimension 2 ≤ D < 3 and scale parameter s plays a significant role. The parameter D may be determined from BET or dissolution measurements on several samples, changing the powder particle sizes or sizes of adsorbate molecules. If the fractality of the surface is high, the SSA does not depend on the particle size distribution and vice versa. In this paper, the SSA parameter is analyzed from the point of view of adsorption and dissolution processes. In the case of adsorption, a new equation for the SSA, depending on the term (2 − D∙(s2 − sBET/sBET, is derived, where sBET and s2 are effective cross-sectional diameters for BET and new adsorbates. Determination of the SSA for the dissolution process appears to be very complicated, since the fractality of the surface may change in the process. Nevertheless, the presented equations have good application potential.

  2. Ultraviolet radiation (UVR) induces cell-surface Ro/SSA antigen expression by human keratinocytes in vitro: a possible mechanism for the UVR induction of cutaneous lupus lesions

    International Nuclear Information System (INIS)

    Jones, S.K.


    Antinuclear antibodies are useful markers of connective tissue disease. In this study, UVB but not UVA induced the expression of Ro/SSA antigen on keratinocyte surfaces in vitro. This expression was also found with the extractable nuclear antigens RnP and Sm, but not with single or double-stranded DNA. The expression was prevented by blocking protein synthesis, suggesting that it was an active process. The results suggest that UVB exposure may result in the expression of Ro/SSA antigen on the surfaces of basal keratinocytes in vivo. This antigen could then bind circulating antibody leading to the cutaneous lesions in neonatal and subacute cutaneous lupus erythematosus. (Author)

  3. BOREAS AFM-08 ECMWF Hourly Surface and Upper Air Data for the SSA and NSA (United States)

    National Aeronautics and Space Administration — ABSTRACT: Hourly data from the ECMWF operational model from below the surface to the top of the atmosphere, including the model fluxes at the surface, at Candle...

  4. BOREAS AFM-08 ECMWF Hourly Surface and Upper Air Data for the SSA and NSA (United States)

    National Aeronautics and Space Administration — Hourly data from the ECMWF operational model from below the surface to the top of the atmosphere, including the model fluxes at the surface, at Candle Lake,...

  5. BOREAS TF-11 SSA Fen 1996 Water Surface Film Capping Data (United States)

    National Aeronautics and Space Administration — Contains the TF-11 CO2 chamber flux measurements made with the LI-6200 under water surface film conditions and the TF-11 CO2 chamber concentration measurements made...

  6. Snow specific surface area simulation using the one-layer snow model in the Canadian LAnd Surface Scheme (CLASS

    Directory of Open Access Journals (Sweden)

    A. Roy


    Full Text Available Snow grain size is a key parameter for modeling microwave snow emission properties and the surface energy balance because of its influence on the snow albedo, thermal conductivity and diffusivity. A model of the specific surface area (SSA of snow was implemented in the one-layer snow model in the Canadian LAnd Surface Scheme (CLASS version 3.4. This offline multilayer model (CLASS-SSA simulates the decrease of SSA based on snow age, snow temperature and the temperature gradient under dry snow conditions, while it considers the liquid water content of the snowpack for wet snow metamorphism. We compare the model with ground-based measurements from several sites (alpine, arctic and subarctic with different types of snow. The model provides simulated SSA in good agreement with measurements with an overall point-to-point comparison RMSE of 8.0 m2 kg–1, and a root mean square error (RMSE of 5.1 m2 kg–1 for the snowpack average SSA. The model, however, is limited under wet conditions due to the single-layer nature of the CLASS model, leading to a single liquid water content value for the whole snowpack. The SSA simulations are of great interest for satellite passive microwave brightness temperature assimilations, snow mass balance retrievals and surface energy balance calculations with associated climate feedbacks.

  7. The MELiSSA GreenMOSS Study: Preliminary Design Considerations for a Greenhouse Module on the Lunar Surface (United States)

    Lobascio, Cesare; Paille, Christel; Lamantea, Matteo Maria; Boscheri, Giorgio; Rossetti, Vittorio

    Extended human presence on an extraterrestrial planetary surface will be made possible by the development of life support systems affordable in the long term. The key elements to support the goal will be the maximization of closure of air and water cycles, as well as the development of cost-effective and reliable hardware, including a careful strategic effort toward reduction of spare parts and consumables. Regenerative life support systems likely represent the final step toward long term sustainability of a space crew, allowing in situ food production and regeneration of organic waste. Referring to the MELiSSA loop, a key element for food production is the Higher Plant Compartment. The paper focuses on the preliminary design of a Greenhouse at the lunar South Pole, as performed within the “Greenhouse Module for Space System” (GreenMOSS) study, under a contract from the European Space Agency. The greenhouse is in support to a relatively small crew for provision of an energetic food complement. Resources necessary for the greenhouse such as water, carbon dioxide and nitrogen are assumed available, as required. The relevant mass and energy balances for incoming resources should be part of future studies, and should help integrate this element with the interfacing MELISSA compartments. Net oxygen production and harvested crop biomass from the greenhouse system will be quantified. This work presents the results of the two major trade-offs performed as part of this study: artificial vs natural illumination and monocrop vs multicrop solutions. Comparisons among possible design solutions were driven by the ALiSSE metric as far as practicable within this preliminary stage, considering mass and power parameters. Finally, the paper presents the mission duration threshold for determining the convenience of the designed solution with respect to other resources provision strategies

  8. Dynamic characterisation of the specific surface area for fracture networks (United States)

    Cvetkovic, V.


    One important application of chemical transport is geological disposal of high-level nuclear waste for which crystalline rock is a prime candidate for instance in Scandinavia. Interconnected heterogeneous fractures of sparsely fractured rock such as granite, act as conduits for transport of dissolved tracers. Fluid flow is known to be highly channelized in such rocks. Channels imply narrow flow paths, adjacent to essentially stagnant water in the fracture and/or the rock matrix. Tracers are transported along channelised flow paths and retained by minerals and/or stagnant water, depending on their sorption properties; this mechanism is critical for rocks to act as a barrier and ultimately provide safety for a geological repository. The sorbing tracers are retained by diffusion and sorption on mineral surfaces, whereas non-sorbing tracers can be retained only by diffusion into stagnant water of fractures. The retention and transport properties of a sparsely fractured rock will primarily depend on the specific surface area (SSA) of the fracture network which is determined by the heterogeneous structure and flow. The main challenge when characterising SSA on the field-scale is its dependence on the flow dynamics. We first define SSA as a physical quantity and clarify its importance for chemical transport. A methodology for dynamic characterisation of SSA in fracture networks is proposed that relies on three sets of data: i) Flow rate data as obtained by a flow logging procedure; ii) transmissivity data as obtained by pumping tests; iii) fracture network data as obtained from outcrop and geophysical observations. The proposed methodology utilises these data directly as well as indirectly through flow and particle tracking simulations in three-dimensional discrete fracture networks. The methodology is exemplified using specific data from the Swedish site Laxemar. The potential impact of uncertainties is of particular significance and is illustrated for radionuclide

  9. High surface area calcite (United States)

    Schultz, L. N.; Andersson, M. P.; Dalby, K. N.; Müter, D.; Okhrimenko, D. V.; Fordsmand, H.; Stipp, S. L. S.


    Calcite (CaCO3) is important in many fields—in nature, because it is a component of aquifers, oil reservoirs and prospective CO2 storage sites, and in industry, where it is used in products as diverse as paper, toothpaste, paint, plastic and aspirin. It is difficult to obtain high purity calcite with a high surface area but such material is necessary for industrial applications and for fundamental calcite research. Commercial powder is nearly always contaminated with growth inhibitors such as sugars, citrate or pectin and most laboratory synthesis methods deliver large precipitates, often containing vaterite or aragonite. To address this problem, we (i) adapted the method of carbonating a Ca(OH)2 slurry with CO2 gas to develop the first simple, cheap, safe and reproducible procedure using common laboratory equipment, to obtain calcite that reproducibly had a surface area of 14-17 m2/g and (ii) conducted a thorough characterization of the product. Scanning electron microscopy (SEM) revealed nanometer scale, rhombohedral crystals. X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and infrared spectroscopy (IR) confirmed highly crystalline, pure calcite that more closely resembles the dimensions of the biogenic calcite produced by algae in coccoliths than other methods for synthesizing calcite. We suggest that this calcite is useful when purity and high surface area are important.

  10. Synthesis and crystal structures of a novel layered silicate SSA-1 and its microporous derivatives by topotactic transformation. (United States)

    Takahashi, S; Kurita, Y; Ikeda, T; Miyamoto, M; Uemiya, S; Oumi, Y


    The synthesis of a novel layered silicate SSA-1 (SSA: silicate synthesized with a quaternary amine) was achieved in the SiO 2 -H 2 O-TEAOH (TEAOH: tetraethylammonium hydroxide - as an organic structural directing agent) system. The crystal structure of SSA-1 involved two silicate layers composed of bre [10T]-type CBU (Composite Building Unit) and TEAOH in interlayers. The topotactic transformation of SSA-1 by calcination was examined, resulting in a porous material (PML-1: porous material transformed from a layered silicate) with a 108 m 2 g -1 BET surface area and 0.035 cm 3 g -1 pore volume. PML-1 is a siliceous microporous material with silanols in the framework and possesses unique properties, such as hydrophilicity, in spite of all its silica composition. The most reasonable crystal structure of PML-1 was successfully determined on the basis of the crystal structure of SSA-1 by a combination of manual modelling, PXRD pattern simulation, DFT optimization and Rietveld analysis. Additionally, an interlayer expanded siliceous zeolite SSA-1 (IEZ-SSA-1) was also successfully prepared by silylation using trichloro(methyl)silane under acidic conditions. IEZ-SSA-1 showed hydrophilicity or hydrophobicity properties by changing the functional group of the pillar part in the interlayer. Additionally, IEZ-SSA-1 showed a large gas adsorption property (537 m 2 g -1 and 0.21 cm 3 g -1 ).

  11. Experiment Study on Determination of Surface Area of Finegrained Soils by Mercury Intrusion Porosimetry (United States)

    Yan, X. Q.; Zhou, C. Y.; Fang, Y. G.; Lin, L. S.


    The specific surface area (SSA) has a great influence on the physical and chemical properties of fine-grained soils. Determination of specific surface area is an important content for fine-grained soils micro-meso analysis and characteristic research. In this paper, mercury intrusion porosimetry (MIP) was adopted to determine the SSA of fine-grained soils including quartz, kaolinite, bentonite and natural Shenzhen soft clay. The test results show that the average values of SSA obtained by MIP are 0.78m2/g, 11.31m2/g, 57.28m2/g and 27.15m2/g respectively for very fine-grained quartz, kaolin, bentonite and natural Shenzhen soft clay, and that it is feasible to apply MIP to obtain the SSA of fine-grained soils through statistical analysis of 97 samples. Through discussion, it is necessary to consider the state of fine-grained soils such as pore ratio when the SSA of fine-grained soils is determined by MIP.

  12. SSA Disability Claim Data (United States)

    Social Security Administration — The dataset includes fiscal year data for initial claims for SSA disability benefits that were referred to a state agency for a disability determination. Specific...

  13. N2-specific surface area of ZrO2-montmorillonite MK-10 synthesis

    International Nuclear Information System (INIS)

    Muzakky; Imam Proyogo


    A measurements of N 2 -specific surface area of ZrO 2 -montmorillonite MK-10 synthesis have been done. The purpose of this study is to observed the effect of calcination on the a specific surface area (SSA N2 -BET) of ZrO 2 -montmorillonite MK-10 synthesis. Calcination were carried out at a 200°C; 400°C and 700°C. While the observations were made with surface area analyzer (SAA) and transmission electron microscopy (TEM). The measurement results obtained that SSA N2 -BET ZrO 2 -MK-10 obtained at 214 m 2 g -1 for before calcination and 195 m 2 g -1 after calcination at 400°C. The effected of calcination temperature will cause more towards of multilayer system surface, but the distribution of pore volume becomes smaller. Result of visualization of ZrO 2 -MK-10 surface that by means of TEM showed before calcination are more transparent and has a pore more. While calcination at 400°C has a darker impression and became multilayer and have a larger volume. Synthesized of ZrO 2 -MK 10 that using the ethylene glycol precursor have SSA N2 -BET higher than using glycerol is 195.33 m 2 g -1 and more memorable surface of a solid compact and orderly. (author)


    Energy Technology Data Exchange (ETDEWEB)

    Daniel, G.


    The literature has been reviewed in December 2011 for calcination data of plutonium oxide (PuO{sub 2}) from plutonium oxalate Pu(C{sub 2}O{sub 4}){sub 2} precipitation with respect to the PuO{sub 2} specific surface area (SSA). A summary of the literature is presented for what are believed to be the dominant factors influencing SSA, the calcination temperature and time. The PuO{sub 2} from Pu(C{sub 2}O{sub 4}){sub 2} calcination data from this review has been regressed to better understand the influence of calcination temperature and time on SSA. Based on this literature review data set, calcination temperature has a bigger impact on SSA versus time. However, there is still some variance in this data set that may be reflecting differences in the plutonium oxalate preparation or different calcination techniques. It is evident from this review that additional calcination temperature and time data for PuO{sub 2} from Pu(C{sub 2}O{sub 4}){sub 2} needs to be collected and evaluated to better define the relationship. The existing data set has a lot of calcination times that are about 2 hours and therefore may be underestimating the impact of heating time on SSA. SRNL recommends that more calcination temperature and time data for PuO{sub 2} from Pu(C{sub 2}O{sub 4}){sub 2} be collected and this literature review data set be augmented to better refine the relationship between PuO{sub 2} SSA and its calcination parameters.

  15. Properties that influence the specific surface areas of carbon nanotubes and nanofibers. (United States)

    Birch, M Eileen; Ruda-Eberenz, Toni A; Chai, Ming; Andrews, Ronnee; Hatfield, Randal L


    Commercially available carbon nanotubes and nanofibers were analyzed to examine possible relationships between their Brunauer-Emmett-Teller specific surface areas (SSAs) and their physical and chemical properties. Properties found to influence surface area were number of walls/diameter, impurities, and surface functionalization with hydroxyl and carboxyl groups. Characterization by electron microscopy, energy-dispersive X-ray spectrometry, thermogravimetric analysis, and elemental analysis indicates that SSA can provide insight on carbon nanomaterials properties, which can differ vastly depending on synthesis parameters and post-production treatments. In this study, how different properties may influence surface area is discussed. The materials examined have a wide range of surface areas. The measured surface areas differed from product specifications, to varying degrees, and between similar products. Findings emphasize the multiple factors that influence surface area and mark its utility in carbon nanomaterial characterization, a prerequisite to understanding their potential applications and toxicities. Implications for occupational monitoring are discussed.

  16. Effect of Precipitation Conditions on the Specific Surface Area of Neptunium Oxide

    International Nuclear Information System (INIS)



    Neptunium oxalate was precipitated under nominal and bounding HB-Line flowsheet conditions. The nominal case represents expected normal HB-Line operation. The bounding case represents process flowsheet extremes that could occur which are anticipated to decrease particle size and increase surface area. The neptunium oxalate produced under bounding conditions was used to validate the effectiveness of HB-Line calcination conditions. The maximum specific surface area of the neptunium oxide (NpO2) used in gas generation testing was 5.34 m2/g. Experiments were conducted to verify that even under bounding precipitation conditions the SSA of NpO2 produced would remain within the range evaluated during gas generation testing. The neptunium oxalate from nominal and bounding precipitation conditions was calcined at 600 degrees Celsius and 625 degrees Celsius, respectively, to form NpO2. Samples from each batch of neptunium oxalate were calcined for one, two, or four hours. Results indicate that the SSA of NpO2 continues to decrease between one and four hours. After two hours of calcination at 625 degrees Celsius, the SSA of NpO2 from the bounding case meets the surface area requirements for limiting moisture uptake

  17. Soil Specific Surface Area and Non-Singularity of Soil-Water Retention at Low Saturations

    DEFF Research Database (Denmark)

    Arthur, Emmanuel; Tuller, Markus; Møldrup, Per


    The dry end of the soil water characteristic (SWC) is important for modeling vapor flow dynamics and predicting soil properties such as specific surface area (SSA) and clay content (CL). Verification of new instrumentation for rapid measurement of the dry end of the SWC is relevant to avoid long...... equilibration times and potential for hydraulic decoupling. The objectives of this study were to measure both adsorption and desorption branches of the dry end of the SWC for 21 variably-textured Arizona soils using new, fully automated instrumentation (AquaSorp); apply the data to parameterize the Tuller...... and Or (TO) and new single-parameter non-singularity (SPN) models; and evaluate estimates of SSA from water sorption, ethylene glycol monoethyl ether (EGME), and N2–BET methods. The AquaSorp successfully measured water sorption isotherms (∼140 data points) within a reasonably short time (1–3 d). The SPN...

  18. BOREAS TE-18 Biomass Density Image of the SSA (United States)

    National Aeronautics and Space Administration — ABSTRACT: This biomass density image covers almost the entire BOREAS SSA. The pixels for which biomass density is computed include areas that are in conifer land...

  19. BOREAS TE-18 Biomass Density Image of the SSA (United States)

    National Aeronautics and Space Administration — This biomass density image covers almost the entire BOREAS SSA. The pixels for which biomass density is computed include areas that are in conifer land cover classes...

  20. Vertical profile of the specific surface area and density of the snow at Dome C and on a transect to Dumont D'Urville, Antarctica – albedo calculations and comparison to remote sensing products

    Directory of Open Access Journals (Sweden)

    J.-C. Gallet


    Full Text Available The specific surface area (SSA of snow determines in part the albedo of snow surfaces and the capacity of the snow to adsorb chemical species and catalyze reactions. Despite these crucial roles, almost no value of snow SSA are available for the largest permanent snow expanse on Earth, the Antarctic. We report the first extensive study of vertical profiles of snow SSA near Dome C (DC: 75°06' S, 123°20' E, 3233 m a.s.l. on the Antarctic plateau, and at seven sites during the logistical traverse between Dome C and the French coastal base Dumont D'Urville (DDU: 66°40' S, 140°01' E during the Austral summer 2008–2009. We used the DUFISSS system, which measures the IR reflectance of snow at 1310 nm with an integrating sphere. At DC, the mean SSA of the snow in the top 1 cm is 38 m2 kg−1, decreasing monotonically to 14 m2 kg−1 at a depth of 50 cm. Along the traverse, the snow SSA profile is similar to that at DC in the first 600 km from DC. Closer to DDU, the SSA of the top 5 cm is 23 m2 kg−1, decreasing to 19 m2 kg−1 at 50 cm depth. This difference is attributed to wind, which causes a rapid decrease of surface snow SSA, but forms hard windpacks whose SSA decrease more slowly with time. Since light-absorbing impurities are not concentrated enough to affect albedo, the vertical profiles of SSA and density were used to calculate the spectral albedo of the snow for several realistic illumination conditions, using the DISORT radiative transfer model. A preliminary comparison with MODIS data is presented and our calculations and MODIS data show similar trends.

  1. Structure, specific surface area and thermal conductivity of the snowpack around Barrow, Alaska (United States)

    Domine, Florent; Gallet, Jean-Charles; Bock, Josué; Morin, Samuel


    The structure of the snowpack near Barrow was studied in March-April 2009. Vertical profiles of density, specific surface area (SSA) and thermal conductivity were measured on tundra, lakes and landfast ice. The average thickness was 41 cm on tundra and 21 cm on fast ice. Layers observed were diamond dust or recent wind drifts on top, overlaying wind slabs, occasional faceted crystals and melt-freeze crusts, and basal depth hoar layers. The top layer had a SSA between 45 and 224 m2 kg-1. All layers at Barrow had SSAs higher than at many other places because of the geographical and climatic characteristics of Barrow. In particular, a given snow layer was remobilized several times by frequent winds, which resulted in SSA increases each time. The average snow area index (SAI, the dimensionless vertically integrated SSA) on tundra was 3260, higher than in the Canadian High Arctic or in the Alaskan taiga. This high SAI, combined with low snow temperatures, imply that the Barrow snowpack efficiently traps persistent organic pollutants, as illustrated with simple calculations for PCB 28 and PCB 180. The average thermal conductivity was 0.21 Wm-1 K-1, and the average thermal resistance on tundra was 3.25 m2 K W-1. This low value partly explains why the snow-ground interface was cold, around -19°C. The high SAI and low thermal resistance values illustrate the interplay between climate, snow physical properties, and their potential impact on atmospheric chemistry, and the need to describe these relationships in models of polar climate and atmospheric chemistry, especially in a climate change context.

  2. SSA State Agency Workload Data (United States)

    Social Security Administration — The dataset is revised and expanded from 4 to 71 data fields. It includes monthly data from October 2000 onwards for SSA disability cases that were referred to the...

  3. The Critical Role of Experimentation to Further SSA Understanding (United States)

    Donnelly, P.; Ash, A.


    Dstl has developed an approach to explore the challenges of understanding the fundamental principles of SSA through the design and execution of a series of national and international SSA experiments conducted since 2008. These have involved a number of nations within different multi-lateral constructs (such as Combined Space Operations [CSPO] and NATO), and have also served as test case scenarios in support of international SSA research collaboration. It has been found that this experimentally-driven approach has been successful in linking government R&D activities to actual operations with UK MOD; enabling enhanced cooperation with academia through the provision of access to sensors and data; as well as an understanding of the operational imperatives and constraints, not usually available or apparent to these institutions. The experiences of the Dstl team over the past 8 years have yielded a number of lessons learnt that we believe the wider international community would benefit from in relation to effective SSA operations, including how to generate closer relationships between communities across government, industry, academia and operators. This paper describes the overall Dstl approach to a series of SSA experiments designed to inform the UK MOD on the challenges and potential technical solutions related to SSA mission areas. It includes details of the participants, design and execution; and illustrates some major findings of each event to date. Lessons learnt pertinent to the AMOS and wider SSA community are presented that will inform the audience on how this approach may be adopted to meet other SSA scenarios. Finally, it presents the UK roadmap for future experiments identified as possible activities under the CSPO initiative and the EU Space Surveillance and Tracking programme.

  4. Contact area measurements on structured surfaces

    DEFF Research Database (Denmark)

    Kücükyildiz, Ömer Can; Jensen, Sebastian Hoppe Nesgaard; De Chiffre, Leonardo

    In connection with the use of brass specimens featuring structured surfaces in a tribology test, an algorithm was developed for automatic measurement of the contact area by optical means.......In connection with the use of brass specimens featuring structured surfaces in a tribology test, an algorithm was developed for automatic measurement of the contact area by optical means....

  5. Surface moisture estimation in urban areas (United States)

    Jiang, Yitong

    Surface moisture is an important parameter because it modifies urban microclimate and surface layer meteorology. The primary objectives of this paper are: 1) to analyze the impact of surface roughness from buildings on surface moisture in urban areas; and 2) to quantify the impact of surface roughness resulting from urban trees on surface moisture. To achieve the objectives, two hypotheses were tested: 1) the distribution of surface moisture is associated with the structural complexity of buildings in urban areas; and 2) The distribution and change of surface moisture is associated with the distribution and vigor of urban trees. The study area is Indianapolis, Indiana, USA. In the part of the morphology of urban trees, Warren Township was selected due to the limitation of tree inventory data. To test the hypotheses, the research design was made to extract the aerodynamic parameters, such as frontal areas, roughness length and displacement height of buildings and trees from Terrestrial and Airborne LiDAR data, then to input the aerodynamic parameters into the urban surface energy balance model. The methodology was developed for comparing the impact of aerodynamic parameters from LiDAR data with the parameters that were derived empirically from land use and land cover data. The analytical procedures are discussed below: 1) to capture the spatial and temporal variation of surface moisture, daily and hourly Land Surface Temperature (LST) were downscaled from 4 km to 1 km, and 960 m to 30 m, respectively, by regression between LST and various components that impact LST; 2) to estimate surface moisture, namely soil moisture and evapotranspiration (ET), land surfaces were classified into soil, vegetation, and impervious surfaces, using Linear Spectral Mixture Analysis (LSMA); 3) aerodynamic parameters of buildings and trees were extracted from Airborne and Terrestrial LiDAR data; 4) the Temperature-Vegetation-Index (TVX) method, and the Two-Source-Energy-Balance (TSEB

  6. Monitoring System for ALICE Surface Areas

    CERN Document Server

    Demirbasci, Oguz


    I have been at CERN for 12 weeks within the scope of Summer Student Programme working on a monitoring system project for surface areas of the ALICE experiment during this period of time. The development and implementation of a monitoring system for environmental parameters in the accessible areas where a cheap hardware setup can be deployed were aim of this project. This report explains how it was developed by using Arduino, Raspberry PI, WinCC OA and DIM protocol.

  7. Vertical profiles of specific surface area, thermal conductivity and density of mid-latitude, Arctic and Antarctic snow: relationships between snow physics and climat (United States)

    Domine, F.; Arnaud, L.; Bock, J.; Carmagnola, C.; Champollion, N.; Gallet, J.; Lesaffre, B.; Morin, S.; Picard, G.


    We have measured vertical profiles of specific surface area (SSA), thermal conductivity (TC) and density in snow from 12 different climatic regions featuring seasonal snowpacks of maritime, Alpine, taiga and tundra types, on Arctic sea ice, and from ice caps in Greenland and Antarctica. We attempt to relate snow physical properties to climatic variables including precipitation, temperature and its yearly variation, wind speed and its short scale temporal variations. As expected, temperature is a key variable that determines snow properties, mostly by determining the metamorphic regime (temperature gradient or equi-temperature) in conjunction with precipitation. However, wind speed and wind speed distribution also seem to have an at least as important role. For example high wind speeds determine the formation of windpacks of high SSA and high TC instead of depth hoar with lower values of these variables. The distribution of wind speed also strongly affects properties, as for example frequent moderate winds result in frequent snow remobilization, producing snow with higher SSA and lower TC than regions with the same average wind speeds, but with less frequent and more intense wind episodes. These strong effects of climate on snow properties imply that climate change will greatly modify snow properties, which in turn will affect climate, as for example changes in snow SSA modify albedo and changes in TC affect permafrost and the release of greenhouse gases from thawing permafrost. Some of these climate-snow feedbacks will be discussed.

  8. Volumes and surface areas of pendular rings (United States)

    Rose, W.


    A packing of spheres is taken as a suitable model of porous media. The packing may be regular and the sphere size may be uniform, but in general, both should be random. Approximations are developed to give the volumes and surface areas of pendular rings that exist at points of sphere contact. From these, the total free volume and interfacial specific surface area are derived as expressive of the textural character of the packing. It was found that the log-log plot of volumes and surface areas of pendular rings vary linearly with the angle made by the line joining the sphere centers and the line from the center of the largest sphere to the closest edge of the pendular ring. The relationship, moreover, was found not to be very sensitive to variation in the size ratio of the spheres in contact. It also was found that the addition of pendular ring material to various sphere packings results in an unexpected decrease in the surface area of the boundaries that confine the resulting pore space. ?? 1958 The American Institute of Physics.

  9. Estimating surface area in early hominins.

    Directory of Open Access Journals (Sweden)

    Alan Cross

    Full Text Available Height and weight-based methods of estimating surface area have played an important role in the development of the current consensus regarding the role of thermoregulation in human evolution. However, such methods may not be reliable when applied to early hominins because their limb proportions differ markedly from those of humans. Here, we report a study in which this possibility was evaluated by comparing surface area estimates generated with the best-known height and weight-based method to estimates generated with a method that is sensitive to proportional differences. We found that the two methods yield indistinguishable estimates when applied to taxa whose limb proportions are similar to those of humans, but significantly different results when applied to taxa whose proportions differ from those of humans. We also found that the discrepancy between the estimates generated by the two methods is almost entirely attributable to inter-taxa differences in limb proportions. One corollary of these findings is that we need to reassess hypotheses about the role of thermoregulation in human evolution that have been developed with the aid of height and weight-based methods of estimating body surface area. Another is that we need to use other methods in future work on fossil hominin body surface areas.

  10. Osmosis and Surface Area to Volume Ratio. (United States)

    Barrett, D. R. B.


    Describes an experiment designed to help students understand the concepts of osmosis and surface area to volume ratio (SA:VOL). The task for students is to compare water uptake in different sizes of potato cubes and relate differences to their SA:VOL ratios. (JN)

  11. Preliminary approach of the MELiSSA loop energy balance (United States)

    Poulet, Lucie; Lamaze, Brigitte; Lebrun, Jean

    Long duration missions, such as the establishment of permanent bases on the lunar surface or the travel to Mars, require a huge amount of life support consumables (e.g. food, water and oxygen). Current rockets are at the moment unable to launch such a mass from Earth. Consequently Regenerative Life Support Systems are necessary to sustain long-term manned space mission to increase recycling rates and so reduce the launched mass. Thus the European and Canadian research has been concentrating on the MELiSSA (Micro-Ecological Life Support System Alternative) project over the last 20 years. MELiSSA is an Environmental Controlled Life Support System (ECLSS), i.e. a closed regenerative loop inspired of a lake ecosystem. Using light as a source of energy, MELiSSA's goal is the recovery of food, water and oxygen from CO2 and organic wastes, using microorganisms and higher plants. The architecture of a ECLSS depends widely on the mission scenario. To compare several ECLSS architectures and in order to be able to evaluate them, ESA is developing a multi criteria evaluation tool: ALISSE (Advanced LIfe Support System Evaluator). One of these criteria is the energy needed to operate the ECLSS. Unlike other criteria like the physical mass, the energy criterion has not been investigated yet and needs hence a detailed analysis. It will consequently be the focus of this study. The main objective of the work presented here is to develop a dynamic tool able to estimate the energy balance for several configurations of the MELiSSA loop. The first step consists in establishing the energy balance using concrete figures from the MELiSSA Pilot Plant (MPP). This facility located at the Universitat Autonoma de Barcelona (UAB) is aimed at the ground demonstration of the MELiSSA loop. The MELiSSA loop is structured on several subsystems; each of them is characterized by supplies, exhausts and process reactions. For the purpose of this study (i.e. a generic tool) the solver EES (Engineering

  12. On semiautomatic estimation of surface area

    DEFF Research Database (Denmark)

    Dvorak, J.; Jensen, Eva B. Vedel


    . For convex particles, the estimator is equal to four times the area of the support set (flower set) of the particle transect. We study the statistical properties of the flower estimator and compare its performance to that of two discretizations of the flower estimator, namely the pivotal estimator......In this paper, we propose a semiautomatic procedure for estimation of particle surface area. It uses automatic segmentation of the boundaries of the particle sections and applies different estimators depending on whether the segmentation was judged by a supervising expert to be satisfactory....... If the segmentation is correct the estimate is computed automatically, otherwise the expert performs the necessary measurements manually. In case of convex particles we suggest to base the semiautomatic estimation on the so-called flower estimator, a new local stereological estimator of particle surface area...

  13. Characterization of high surface area silicon oxynitrides

    International Nuclear Information System (INIS)

    Lednor, P.W.; DeRuiter, R.; Emeis, K.A.


    In heterogenous catalysis, liquid or gaseous feedstocks are converted over a solid catalyst into more desirable products. Such processes form an essential part of the oil and petrochemical industries. The solid catalyst usually consists of an inorganic phase, with or without metal particles on the surface. Examples include platinum particles on gamma alumina (a reforming catalyst used in oil processing), chromium particles on silica (an ethylene polymerization catalyst) and zeolites or amorphous silica-aluminas (used as solid acids).Oxides have been widely investigated in catalysis, and silica, alumina, and aluminosilicates find application commercially on a large scale. On the other hand, non-oxide materials such as nitrides, carbides and borides have been relatively little investigated. The main reason for this has been the lack of routes to the high surface area forms usually required in catalysis. However, this situation has changed significantly in recent years, due to the interest in high surface area non-oxides as precursors to fully dense ceramics; in this paper, the authors have reviewed synthetic routes to high surface area non-oxides

  14. High Surface Area Tunnels in Hexagonal WO₃. (United States)

    Sun, Wanmei; Yeung, Michael T; Lech, Andrew T; Lin, Cheng-Wei; Lee, Chain; Li, Tianqi; Duan, Xiangfeng; Zhou, Jun; Kaner, Richard B


    High surface area in h-WO3 has been verified from the intracrystalline tunnels. This bottom-up approach differs from conventional templating-type methods. The 3.67 Å diameter tunnels are characterized by low-pressure CO2 adsorption isotherms with nonlocal density functional theory fitting, transmission electron microscopy, and thermal gravimetric analysis. These open and rigid tunnels absorb H(+) and Li(+), but not Na(+) in aqueous electrolytes without inducing a phase transformation, accessing both internal and external active sites. Moreover, these tunnel structures demonstrate high specific pseudocapacitance and good stability in an H2SO4 aqueous electrolyte. Thus, the high surface area created from 3.67 Å diameter tunnels in h-WO3 shows potential applications in electrochemical energy storage, selective ion transfer, and selective gas adsorption.

  15. Estimation of surface area and surface area measure of three-dimensional sets from digitizations

    DEFF Research Database (Denmark)

    Ziegel, Johanna; Kiderlen, Markus


    A local method for estimating surface area and surface area measure of three-dimensional objects from discrete binary images is presented. A weight is assigned to each 2 × 2 × 2 configuration of voxels and the total surface area of an object is given by summation of the local area contributions....... The method is based on an exact asymptotic result that holds for increasing resolution of the digitization. It states that the number of occurrences of a 2 ×  2 × 2 configuration is asymptotically proportional to an integral of its “h-function” with respect to the surface area measure of the object. We find...

  16. High surface area fibrous silica nanoparticles

    KAUST Repository

    Polshettiwar, Vivek


    Disclosed are high surface area nanoparticles that have a fibrous morphology. The nanoparticles have a plurality of fibers, wherein each fiber is in contact with one other fiber and each fiber has a length of between about 1 nm and about 5000 nm. Also disclosed are applications of the nanoparticles of the present invention, and methods of fabrication of the nanoparticles of the present invention.

  17. BOREAS RSS-08 SSA IFC-3 Digitized Stereo Imagery at the OBS, OA, and OJP Sites (United States)

    National Aeronautics and Space Administration — ABSTRACT: The RSS08 team acquired stereo photography from the double-scaffold towers at the Southern Study Area (SSA), Old Black Spruce (OBS), Old Aspen (OA), and...

  18. BOREAS RSS-08 SSA IFC-3 Digitized Stereo Imagery at the OBS, OA, and OJP Sites (United States)

    National Aeronautics and Space Administration — The RSS08 team acquired stereo photography from the double-scaffold towers at the Southern Study Area (SSA), Old Black Spruce (OBS), Old Aspen (OA), and Old Jack...

  19. BOREAS TE-01 SSA Soil Lab Data (United States)

    National Aeronautics and Space Administration — ABSTRACT: This data set provides a set of soil properties for the SSA. The soil samples were collected at sets of soil pits. Major soil properties include soil...

  20. BOREAS TE-01 SSA Soil Lab Data (United States)

    National Aeronautics and Space Administration — This data set provides a set of soil properties for the SSA. The soil samples were collected at sets of soil pits. Major soil properties include soil horizon; dry...

  1. A Simple Proof of Cauchy's Surface Area Formula


    Tsukerman, Emmanuel; Veomett, Ellen


    We give a short and simple proof of Cauchy's surface area formula, which states that the average area of a projection of a convex body is equal to its surface area up to a multiplicative constant in the dimension.

  2. The colour potentials of SSA-containing mortar


    Kappel, Annemette; Ottosen, Lisbeth M.; Kirkelund, Gunvor Marie; Bache, Anja Margrethe; Goltermann, Per


    This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA is with a few exceptions landfilled and thus, wasted.The purpose of the experiments was to examine the influence of SSA and how it affected the colour of mortar samples. SSA was ground in 6 different intervals...

  3. Dicty_cDB: SSA423 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA423 (Link to dictyBase) - - - - SSA423F (Link to Original s...ite) SSA423F 443 - - - - - - Show SSA423 Library SS (Link to library) Clone ID SSA423 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIA...VSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIAAGGAFLIIVFFFI CLCCCCCRRKKDKHYHNIQDDET

  4. Dicty_cDB: SSA581 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA581 (Link to dictyBase) - - - Contig-U12576-1 SSA581Z (Link... to Original site) - - SSA581Z 504 - - - - Show SSA581 Library SS (Link to library) Clone ID SSA581 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dict...SARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT DEDI...QHASARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT D

  5. Adequacy of the default values for skin surface area used for risk assessment and French anthropometric data by a probabilistic approach. (United States)

    Dornic, N; Ficheux, A S; Bernard, A; Roudot, A C


    The notes of guidance for the testing of cosmetic ingredients and their safety evaluation by the Scientific Committee on Consumer Safety (SCCS) is a document dedicated to ensuring the safety of European consumers. This contains useful data for risk assessment such as default values for Skin Surface Area (SSA). A more in-depth study of anthropometric data across Europe reveals considerable variations. The default SSA value was derived from a study on the Dutch population, which is known to be one of the tallest nations in the World. This value could be inadequate for shorter populations of Europe. Data were collected in a survey on cosmetic consumption in France. Probabilistic treatment of these data and analysis of the case of methylisothiazolinone, a sensitizer recently evaluated by a deterministic approach submitted to SCCS, suggest that the default value for SSA used in the quantitative risk assessment might not be relevant for a significant share of the French female population. Others female populations of Southern Europe may also be excluded. This is of importance given that some studies show an increasing risk of developping skin sensitization among women. The disparities in anthropometric data across Europe should be taken into consideration. Copyright © 2017 Elsevier Ltd. All rights reserved.

  6. Method for treatment of a surface area of steel

    NARCIS (Netherlands)

    Bhowmik, S.; Aaldert, P.J.


    The invention relates to a method for treatment of a surface area of steel by polishing said surface area and performing a plasma treatment of said surface area wherein the plasma treatment is performed at at least atmospheric conditions and wherein the plasma treatment is carried out at a power of

  7. Surface areas of fractally rough particles studied by scattering

    International Nuclear Information System (INIS)

    Hurd, A.J.; Schaefer, D.W.; Smith, D.M.; Ross, S.B.; Le Mehaute, A.; Spooner, S.


    The small-angle scattering from fractally rough surfaces has the potential to give information on the surface area at a given resolution. By use of quantitative neutron and x-ray scattering, a direct comparison of surface areas of fractally rough powders was made between scattering and adsorption techniques. This study supports a recently proposed correction to the theory for scattering from fractal surfaces. In addition, the scattering data provide an independent calibration of molecular adsorbate areas

  8. Effect of specific surface area of raw material Fe2O3 on magnetic properties of YIG (United States)

    Huang, Ching-Chien; Zuo, Wei-Zong; Hung, Yung-Hsiung; Huang, Jing-Yi; Kuo, Ming-Feng; Cheng, Chun-Hu


    The effect of specific surface area (SSA) of Fe2O3 was investigated while evaluating the raw material of Y3Fe5O12 (yttrium iron garnet (YIG)) preparation. For YIG ferrite, the specific surface area of Fe2O3, rather than average particle size (D50), was found to markedly affect the mixing homogeneity of powders in the mixing procedure and the magnetic properties. Increasing the specific surface area of Fe2O3 resulted in the increase of the remanence (Br) and squareness ratio (SQR); meanwhile, it also caused an obvious reduction in coercivity (HC) for the sintered specimens. An upgrade in the specific surface area of raw material Fe2O3 could further resulted in a decrease in slurry viscosity in the mixing procedure, which promotes slurry mixing homogeneity and further promotes reactivity in the calcination and sintering processes. Consequently, a larger Br and SQR and a smaller HC were obtained. In addition, good ferromagnetic resonance (FMR) line width (i.e., ΔH) properties were also realized as 36.7 Oe at 3.2 GHz using the selected Fe2O3. As found in this study, the strict control of raw material Fe2O3 is critical in tailoring suitable Br and HC for the YIG ferrite manufacturing process.

  9. Hydraulic and mechanical behavior of landfill clay liner containing SSA in contact with leachate. (United States)

    Zhang, Qian; Lu, Haijun; Liu, Junzhu; Wang, Weiwei; Zhang, Xiong


    Sewage sludge ash (SSA) produced by municipal sludge can be used as a modified additive for clay liner, and improves the working performance of landfill clay liner in contact with leachate. Under the action of landfill leachate, the permeability, shear strength, phase composition, and pore structure of the modified clay are investigated through the flexible wall permeability test, triaxial shear test, thermal gravimetric and differential thermal analysis, and low-temperature nitrogen adsorption test, respectively. The hydraulic conductivity of the modified clay containing 0-5% SSA is in the range of 3.94 × 10 -8 -1.16 × 10 -7  cm/s, and the pollutant concentration of the sample without SSA was higher than others. The shear strength of the modified clay is more than that of the traditional clay liner, the cohesion rate of modified clay increases from 32.5 to 199.91 kPa, and the internal friction angle decreases from 32.5° to 15.6°. Furthermore, the weight loss rates of the samples are 15.69%, 17.92%, 18.06%, and 20.68%, respectively, when the SSA content increases from 0% to 5%. The total pore volume and average pore diameter of the modified clay decrease with the increase in the SSA content, respectively. However, the specific area of the modified clay increases with the increase in the SSA content.

  10. Reuse of sewage sludge ashes (SSA) in cement mixtures: the effect of SSA on the workability of cement mortars. (United States)

    Monzó, J; Payá, J; Borrachero, M V; Girbés, I


    The influence of sewage sludge ash (SSA) on workability of cement mortars has been studied. The irregular morphology of SSA particles produced a decrease of mortar workability. A nonlinear reduction of workability in mortars containing SSA was observed, but when SSA content in mortars was increased the workability reduction was less significant. A superplasticizer is used in order to compensate the decrease of workability produced by SSA. When SSA sized fractions were used, only significant differences in workability for mortars prepared with high water volumes or with the presence of superplasticizer were observed.

  11. Nondestructive, stereological estimation of canopy surface area

    DEFF Research Database (Denmark)

    Wulfsohn, Dvora-Laio; Sciortino, Marco; Aaslyng, Jesper M.


    a canopy using the smooth fractionator, (ii) sampling of leaves from the selected plants using the fractionator, and (iii) area estimation of the sampled leaves using point counting. We apply this procedure to estimate the total area of a chrysanthemum (Chrysanthemum morifolium L.) canopy and evaluate both...

  12. Surface texturing of crystalline silicon and effective area measurement (United States)

    Sun, Tietun; Chen, Dong; Chui, Rongqiang


    In this paper, the surface area of solar cell is determined by the capacitance measurements of MOS structure. The texture etching technology can be controlled according to the change of silicon surface area, furthermore, the textured silicon surface and interface characteristic of solar cell can be studied by measuring the relationship of capacitance and voltage for MOS structure.

  13. Hand surface area as a percentage of body surface area in Asian children: a pilot study. (United States)

    Choi, Hyuk; Park, Man Sik; Lee, Heung-Man


    The hand surface area (HSA) of one hand has been estimated as 1% of the body surface area (BSA). This does change with the patient's age, gender, and body mass index (BMI). There are many HSA studies done on adult populations, but fewer done on children. Our hypothesis in this study is that the general HSA equation for Caucasian adults cannot be applied as accurately to children and Asian people. HSA was defined as the area of the palm without fingers in this study. Children are in a stage of growth. If a child's hand growth ratio is not the same as that of an adult, the result of HSA/BSA calculation could be different. We undertook this study to determine whether or not there were any differences in HSA/BSA among Korean children (7-18 years) and adults (20-60 years), and compared our results with western data. A total of 186 boys aged between 7 and 18 years, were recruited for this study; their HSA was measured, directly. A total of 186 adults aged between 20 and 60 years were selected as well. BSA was calculated only for volunteers in subjects who HSA had been measured. From these results, HSA/BSA was calculated. HSA/BSA ratio of Korean boys was 0.69±0.05%, which was less than 1%. It is suggested that the ratio of the western data may not be applicable to Asian children, particularly, Korean children. HSA/BSA ratio can be applied in administration of drug doses and estimation of the area of burns. Copyright © 2011 Elsevier Ltd and ISBI. All rights reserved.

  14. SurfaceWater Source Protection Areas (SPAs) (United States)

    Vermont Center for Geographic Information — Source Protection Area (SPA) boundaries have been located on RF 24000 & RF 25000 scale USGS topographic maps by Water Supply Division (DEC) and VT Dept of Health...

  15. BOREAS TE-12 SSA Leaf Water Potential Data (United States)

    Hall, Forrest G. (Editor); Curd, Shelaine (Editor); Walter-Shea, Elizabeth A.; Mesarch, Mark A.; Chen, L.; Yang, Litao


    The Boreal Ecosystem-Atmospheric Study (BOREAS) TE-12 (Terrestrial Ecology) team collected water potential data in 1993 and 1994 from aspen, jack pine, and black spruce leaves/needles. Collections were made at the Southern Study Area Nipawin Fen Site (SSA FEN), Young Jack Pine (YJP), Young Aspen (YA), Old Aspen (OA), and Old Black Spruce (OBS) sites. Measurements were made using a pressure chamber on a platform in the field. The data are provided in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  16. The Surface Chemical Properties of Novel High Surface Area Solids ...

    African Journals Online (AJOL)

    during zeolite synthesis.22 Because raw fly ash has large quanti- ties of a host of elements, many of these will act as nucleation sites, which results in many small crystals rather than a few large ones. Acid etching removed the needle-like structures on the particle surfaces, revealing a porous underlying structure. (Fig. 1c).

  17. Surface Area Distribution Descriptor for object matching

    Directory of Open Access Journals (Sweden)

    Mohamed F. Gafar


    Full Text Available Matching 3D objects by their similarity is a fundamental problem in computer vision, computer graphics and many other fields. The main challenge in object matching is to find a suitable shape representation that can be used to accurately and quickly discriminate between similar and dissimilar shapes. In this paper we present a new volumetric descriptor to represent 3D objects. The proposed descriptor is used to match objects under rigid transformations including uniform scaling. The descriptor represents the object by dividing it into shells, acquiring the area distribution of the object through those shells. The computed areas are normalised to make the descriptor scale-invariant in addition to rotation and translation invariant. The effectiveness and stability of the proposed descriptor to noise and variant sampling density as well as the effectiveness of the similarity measures are analysed and demonstrated through experimental results.

  18. Why Do We Need the Derivative for the Surface Area? (United States)

    Hristova, Yulia; Zeytuncu, Yunus E.


    Surface area and volume computations are the most common applications of integration in calculus books. When computing the surface area of a solid of revolution, students are usually told to use the frustum method instead of the disc method; however, a rigorous explanation is rarely provided. In this note, we provide one by using geometric…

  19. Lage-area planar RF plasma productions by surface waves

    International Nuclear Information System (INIS)

    Nonaka, S.


    Large-area rf plasmas are confirmed to be produced by means of RF discharges inside a large-area dielectric tube. The plasma space is 73 cm x 176 cm and 2.5 cm. The plasma is thought to be produced by an odd plasma-surface wave (PSW ο ) in case of using large-area electrodes and by an even plasma-surface wave (PSW ο ) in case of without the electrodes. (author). 7 refs, 4 figs

  20. Intercomparison of retrieval algorithms for the specific surface area of snow from near-infrared satellite data in mountainous terrain, and comparison with the output of a semi-distributed snowpack model

    Directory of Open Access Journals (Sweden)

    A. Mary


    Full Text Available This study compares different methods to retrieve the specific surface area (SSA of snow from satellite radiance measurements in mountainous terrain. It aims at addressing the effect on the retrieval of topographic corrections of reflectance, namely slope and aspect of terrain, multiple reflections on neighbouring slopes and accounting (or not for the anisotropy of snow reflectance. Using MODerate resolution Imaging Spectrometer (MODIS data for six different clear sky scenes spanning a wide range of snow conditions during the winter season 2008–2009 over a domain of 46 × 50 km in the French Alps, we compared SSA retrievals with and without topographic correction, with a spherical or non-spherical snow reflectance model and, in spherical case, with or without anisotropy corrections. The retrieved SSA values were compared to field measurements and to the results of the detailed snowpack model Crocus, fed by driving data from the SAFRAN meteorological analysis. It was found that the difference in terms of surface SSA between retrieved values and SAFRAN-Crocus output was minimal when the topographic correction was taken into account, when using a retrieval method assuming disconnected spherical snow grains. In this case, the root mean square deviation was 9.4 m2 kg−1 and the mean difference was 0.1 m2 kg−1, based on 3170 pairs of observation and simulated values. The added-value of the anisotropy correction was not significant in our case, which may be explained by the presence of mixed pixels and surface roughness. MODIS retrieved data show SSA variations with elevation and aspect which are physically consistent and in good agreement with SAFRAN-Crocus outputs. The variability of the MODIS retrieved SSA within the topographic classes of the model was found to be relatively small (3.9 m2 kg−1. This indicates that semi-distributed snowpack simulations in mountainous terrain with a sufficiently large number of classes provides a

  1. Indexing aortic valve area by body surface area increases the prevalence of severe aortic stenosis

    DEFF Research Database (Denmark)

    Jander, Nikolaus; Gohlke-Bärwolf, Christa; Bahlmann, Edda


    To account for differences in body size in patients with aortic stenosis, aortic valve area (AVA) is divided by body surface area (BSA) to calculate indexed AVA (AVAindex). Cut-off values for severe stenosis are......To account for differences in body size in patients with aortic stenosis, aortic valve area (AVA) is divided by body surface area (BSA) to calculate indexed AVA (AVAindex). Cut-off values for severe stenosis are...

  2. BOREAS TE-1 SSA Soil Lab Data (United States)

    Hall, Forrest G. (Editor); Knapp, David E. (Editor); Nerbas, Tim; Anderson, Darwin


    This data set was collected by TE-1 to provide a set of soil properties for BOREAS investigators in the SSA. The soil samples were collected at sets of soil pits in 1993 and 1994. Each set of soil pits was in the vicinity of one of the five flux towers in the BOREAS SSA. The collected soil samples were sent to a lab, where the major soil properties were determined. These properties include, but are not limited to, soil horizon; dry soil color; pH; bulk density; total, organic, and inorganic carbon; electric conductivity; cation exchange capacity; exchangeable sodium, potassium, calcium, magnesium, and hydrogen; water content at 0.01, 0.033, and 1.5 MPascals; nitrogen; phosphorus; particle size distribution; texture; pH of the mineral soil and of the organic soil; extractable acid; and sulfur. The data are stored in tabular ASCII text files. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  3. Effect of impervious surface area and vegetation changes on mean ...

    African Journals Online (AJOL)

    This land use or land cover changes are also thought to affect the climate of the Tshwane metropolis as is evidenced by heat waves in 2013 and 2014. This paper describes how vegetation and impervious surface area (ISA) or built up areas were classified from Landsat 8 LCDM, 2013, and Landsat 7 ETM+, 2003 images ...

  4. Surface area considerations for corroding N reactor fuel

    International Nuclear Information System (INIS)

    Johnson, A.B. Jr.; Pitner, A.L.


    The N Reactor fuel is corroding at sites where the Zircaloy cladding was damaged when the fuel was discharged from the reactor. Corroding areas are clearly visible on the fuel stored in open cans in the K East Basin. There is a need to estimate the area of the corroding uranium to analyze aspects of fuel behavior as it is transitioned. from current wet storage to dry storage. In this report, the factors that contribute to open-quotes trueclose quotes surface area are analyzed in terms of what is currently known about the N Reactor fuel. Using observations from a visual examinations of the fuel in the K East wet storage facility, a value for the corroding geometric area is estimated. Based on observations of corroding uranium and surface roughness values for other metals, a surface roughness factor is also estimated and applied to the corroding K East fuel to provide an estimated open-quotes trueclose quotes surface area. While the estimated area may be modified as additional data become available from fuel characterization studies, the estimate provides a basis to assess effects of exposed uranium metal surfaces on fuel behavior in operations involved in transitioning from wet to dry storage, during shipment and staging, conditioning, and dry interim storage

  5. Assessment of dialyzer surface in online hemodiafiltration; objective choice of dialyzer surface area

    Directory of Open Access Journals (Sweden)

    Francisco Maduell


    Conclusion: The increase in 40% and 80% of dialyzer surface area entails an increase in convective volume of 6 and 16% respectively, showing minimal differences both in convective volume and clearance capacity when UFC was greater than 45 mL/h/mmHg. It is advisable to optimise dialyser efficiency to the smallest surface area possible, adjusting treatment prescription.

  6. Students' and Teachers' Application of Surface Area to Volume Relationships (United States)

    Taylor, Amy R.; Jones, M. Gail


    The National Science Education Standards emphasize teaching unifying concepts and processes such as basic functions of living organisms, the living environment, and scale (NRC 2011). Scale includes understanding that different characteristics, properties, or relationships within a system might change as its dimensions are increased or decreased (NRC 2011). One such relationship involves surface area to volume which is a pervasive concept that can be found throughout different sciences. This concept is important for students to not only understand the association of the two, but to also be able to apply this relationship in science contexts. The purpose of this study is to investigate the factors that influence the understanding surface area to volume relationships. This study examined middle school students', high school students', and science teachers' logical thinking skills (including proportional reasoning), visual-spatial skills, and understandings of surface area to volume relationships. Regression results indicated that participants' reasoning abilities and components of visual-spatial skills could be possible predictors for one's ability to understand surface area to volume relationships. Implications for teaching scale concepts such as surface area to volume relationships in the science classroom are discussed.

  7. Surface deformation of the secondary former mining areas

    Directory of Open Access Journals (Sweden)

    Tadeusz Głowacki


    Full Text Available The paper discuss the problem of secondary deformation observed on the surface of the land in the area of the old, non-existent copper and coal mines. The authors discuss the formation of the deformation in the final period of the mine, and after his arrest, after the close of any work of protecting the surface area of influence of mining activities. Discusses the reduction of the surface of the example of two disused mines: mining copper “Konrad” in Iwiny and “Thorez” in Walbrzych, an old coal mine. In the first part of the paper discusses a brief history of the creation of old copper basin and the Lower Silesian coal basin. It then discusses the formation of deformation processes in mining areas. Conducting continuous surveying allows you to monitor changes in the formation of land, in the paper indicate the source of the vertical displacements after ending of operation, the closure of the mine and stopped all work safety. In the area of Lower Silesia there are many remnants of disused mines, surface geodetic measurements show a constant activity in post-mining areas and the need to control the formation of the surface.

  8. High surface area Au-SBA-15 and Au-MCM-41 materials synthesis: tryptophan amino acid mediated confinement of gold nanostructures within the mesoporous silica pore walls. (United States)

    Selvakannan, Pr; Mantri, Kshudiram; Tardio, James; Bhargava, Suresh K


    Advantages of confining the gold nanostructures formation within the mesoporous silica pore walls during its silica condensation and consequent improvement in the textural properties such as specific surface area, pore volume, pore diameter have been demonstrated, while retaining gold nanostructures within the silica walls. This has been achieved by tryptophan mediated confinement of gold nanoparticles formation within the condensing silica framework, to obtain Au-SBA-15 (SSA 1247 m(2)/g, V(t)~1.37 cm(3)/g) and Au-MCM-41 (SSA 1287 m(2)/g, V(t)~1.1 cm(3)/g), mesoporous silica materials having the combination of very high surface area from the porous support as well as gold nanoparticles infiltrated silica walls. Choice of tryptophan for this purpose is that it has an indole group, which was known to reduce gold ions to form gold nanoparticles and its amine and carboxylic acid groups, catalyze the hydrolysis of silica precursors in a wide range of pH. These properties have been utilized in restricting the gold nanostructures formation inside the condensing silica phase without affecting the self assembly between the silica precursors and the triblock copolymer (for SBA-15) or cetyltrimethylammonium bromide template (for MCM-41). The polytryptophan and the gold nanostructures, which were encapsulated within the silica framework and upon removal of the template by calcination resulting in the formation mesoporous materials wherein the silica walls become microporous due to the removal of occluded polytryptophan and the resulting microchannels contain very small gold nanostructures. Hence, the resulting materials have very high surface area, high pore volume and narrow pore size distribution as compared to their parent SBA-15, MCM-41 and SBA-15, MCM-41 post functionalized with gold nanoparticles inside the pores. Copyright © 2012 Elsevier Inc. All rights reserved.

  9. Can foot anthropometric measurements predict dynamic plantar surface contact area?

    Directory of Open Access Journals (Sweden)

    Collins Natalie


    Full Text Available Abstract Background Previous studies have suggested that increased plantar surface area, associated with pes planus, is a risk factor for the development of lower extremity overuse injuries. The intent of this study was to determine if a single or combination of foot anthropometric measures could be used to predict plantar surface area. Methods Six foot measurements were collected on 155 subjects (97 females, 58 males, mean age 24.5 ± 3.5 years. The measurements as well as one ratio were entered into a stepwise regression analysis to determine the optimal set of measurements associated with total plantar contact area either including or excluding the toe region. The predicted values were used to calculate plantar surface area and were compared to the actual values obtained dynamically using a pressure sensor platform. Results A three variable model was found to describe the relationship between the foot measures/ratio and total plantar contact area (R2 = 0.77, p R2 = 0.76, p Conclusion The results of this study indicate that the clinician can use a combination of simple, reliable, and time efficient foot anthropometric measurements to explain over 75% of the plantar surface contact area, either including or excluding the toe region.

  10. Biomass-derived nitrogen-doped porous carbons with tailored hierarchical porosity and high specific surface area for high energy and power density supercapacitors (United States)

    Sun, Junting; Niu, Jin; Liu, Mengyue; Ji, Jing; Dou, Meiling; Wang, Feng


    Porous carbon materials with hierarchical structures attract intense interest for the development of high-performance supercapacitors. Herein, we demonstrate a facile and efficient strategy to synthesize nitrogen-doped hierarchically porous carbons with tailored porous structure combined with high specific surface area (SSA), which involves a pre-carbonization and a subsequent carbonization combined with KOH activation of silkworm cocoon precursors. Through adjusting the mass ratio of the activator (KOH) to pre-carbonized precursor in the activation process, the hierarchically porous carbon prepared at the mass ratio of 2 (referred to as NHPC-2) possesses a high defect density and a high SSA of 3386 m2 g-1 as well as the relatively high volumetric proportion of mesopores and macropores (45.5%). As a result, the energy density and power density of the symmetric supercapacitor based on NHPC-2 electrode are as high as 34.41 Wh kg-1 and 31.25 kW kg-1 in organic-solvent electrolyte, and are further improved to 112.1 Wh kg-1 and 23.91 kW kg-1 in ionic-liquid electrolyte.

  11. The colour potentials of SSA-containing mortar

    DEFF Research Database (Denmark)

    Kappel, Annemette; Ottosen, Lisbeth M.; Kirkelund, Gunvor Marie


    is with a few exceptions landfilled and thus, wasted.The purpose of the experiments was to examine the influence of SSA and how it affected the colour of mortar samples. SSA was ground in 6 different intervals and added to mortar mixes by replacing 20% of the cement. An additional focus was to examine...

  12. The Aesthetical quality of SSA-containing mortar and concrete

    DEFF Research Database (Denmark)

    Kappel, Annemette; Kirkelund, Gunvor Marie; Ottosen, Lisbeth M.


    SSA (sewage sludge ash) is resulting ash from the combustion of sewage sludge, and is a method employed at some water treatment plants in order to decrease volume and hygenize the sludge. Today, SSA is with a few exceptions landfilled. As cement production is responsible for app. 5 % of the total...

  13. High surface area electrode for high efficient microbial electrosynthesis (United States)

    Nie, Huarong; Cui, Mengmeng; Lu, Haiyun; Zhang, Tian; Russell, Thomas; Lovley, Derek


    Microbial electrosynthesis, a process in which microorganisms directly accept electrons from an electrode to convert carbon dioxide and water into multi carbon organic compounds, affords a novel route for the generation of valuable products from electricity or even wastewater. The surface area of the electrode is critical for high production. A biocompatible, highly conductive, three-dimensional cathode was fabricated from a carbon nanotube textile composite to support the microorganism to produce acetate from carbon dioxide. The high surface area and macroscale porous structure of the intertwined CNT coated textile ?bers provides easy microbe access. The production of acetate using this cathode is 5 fold larger than that using a planar graphite electrode with the same volume. Nickel-nanowire-modified carbon electrodes, fabricated by microwave welding, increased the surface area greatly, were able to absorb more bacteria and showed a 1.5 fold increase in performance

  14. Particle surface area and bacterial activity in recirculating aquaculture systems

    DEFF Research Database (Denmark)

    Pedersen, Per Bovbjerg; von Ahnen, Mathis; Fernandes, Paulo


    Suspended particles in recirculating aquaculture systems (RAS) provide surface area that can be colonized by bacteria. More particles accumulate as the intensity of recirculation increases thus potentially increasing the bacterial carrying capacity of the systems. Applying a recent, rapid, cultur...... for determining bacterial activity might provide a means for future monitoring and assessment of microbial water quality in aquaculture farming systems......Suspended particles in recirculating aquaculture systems (RAS) provide surface area that can be colonized by bacteria. More particles accumulate as the intensity of recirculation increases thus potentially increasing the bacterial carrying capacity of the systems. Applying a recent, rapid, culture......-independent fluorometric detection method (Bactiquant®) for measuring bacterial activity, the current study explored the relationship between total particle surface area (TSA, derived from the size distribution of particles >5 μm) and bacterial activity in freshwater RAS operated at increasing intensity of recirculation...


    Energy Technology Data Exchange (ETDEWEB)

    Nugent, C. R. [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Mainzer, A.; Masiero, J.; Bauer, J.; Kramer, E.; Sonnett, S. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Wright, E. L. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Grav, T. [Planetary Science Institute, Tucson, AZ (United States)


    The rapid accumulation of thermal infrared observations and shape models of asteroids has led to increased interest in thermophysical modeling. Most of these infrared observations are unresolved. We consider what fraction of an asteroid’s surface area contributes the bulk of the emitted thermal flux for two model asteroids of different shapes over a range of thermal parameters. The resulting observed surface in the infrared is generally more fragmented than the area observed in visible wavelengths, indicating high sensitivity to shape. For objects with low values of the thermal parameter, small fractions of the surface contribute the majority of thermally emitted flux. Calculating observed areas could enable the production of spatially resolved thermal inertia maps from non-resolved observations of asteroids.


    Directory of Open Access Journals (Sweden)

    Johanna Ziegel


    Full Text Available A sampling design of local stereology is combined with a method from digital stereology to yield a novel estimator of surface area based on counts of configurations observed in a digitization of an isotropic 2- dimensional slice with thickness s. As a tool, a result of the second author and J. Rataj on infinitesimal increase of volumes of morphological transforms is refined and used. The proposed surface area estimator is asymptotically unbiased in the case of sets contained in the ball centred at the origin with radius s and in the case of balls centred at the origin with unknown radius. For general shapes bounds for the asymptotic expected relative worst case error are given. A simulation example is discussed for surface area estimation based on 2×2×2-configurations.

  17. High surface area carbon and process for its production

    Energy Technology Data Exchange (ETDEWEB)

    Romanos, Jimmy; Burress, Jacob; Pfeifer, Peter; Rash, Tyler; Shah, Parag; Suppes, Galen


    Activated carbon materials and methods of producing and using activated carbon materials are provided. In particular, biomass-derived activated carbon materials and processes of producing the activated carbon materials with prespecified surface areas and pore size distributions are provided. Activated carbon materials with preselected high specific surface areas, porosities, sub-nm (<1 nm) pore volumes, and supra-nm (1-5 nm) pore volumes may be achieved by controlling the degree of carbon consumption and metallic potassium intercalation into the carbon lattice during the activation process.

  18. Surface barrier silicon detectors with a large active area

    International Nuclear Information System (INIS)

    Kim, Y.; Husimi, K.; Ikeda, Y.; Kim, C.; Ohkawa, S.; Sakai, T.


    Surface barrier silicon detectors with a large active area have been produced by using high resistive n-type silicon crystals, diameters of which are 3 to 5 inches. High quality detectors with a low leakage current and a low noise were achieved by developing the improved surface treatment. Characteristics of detectors obtained are good in energy resolution compared with conventional large area Si(Li) detectors. It has also been confirmed that local dead region is not found from measuring results of photo-pulse injection

  19. Stereological estimation of surface area from digital images

    DEFF Research Database (Denmark)

    Ziegel, Johanna; Kiderlen, Markus


    A sampling design of local stereology is combined with a method from digital stereology to yield a novel estimator of surface area based on counts of configurations observed in a digitization of an isotropic 2- dimensional slice with thickness s. As a tool, a result of the second author and J....... Rataj on infinitesimal increase of volumes of morphological transforms is refined and used. The proposed surface area estimator is asymptotically unbiased in the case of sets contained in the ball centred at the origin with radius s and in the case of balls centred at the origin with unknown radius...

  20. Determining Surface Roughness in Urban Areas Using Lidar Data (United States)

    Holland, Donald


    An automated procedure has been developed to derive relevant factors, which can increase the ability to produce objective, repeatable methods for determining aerodynamic surface roughness. Aerodynamic surface roughness is used for many applications, like atmospheric dispersive models and wind-damage models. For this technique, existing lidar data was used that was originally collected for terrain analysis, and demonstrated that surface roughness values can be automatically derived, and then subsequently utilized in disaster-management and homeland security models. The developed lidar-processing algorithm effectively distinguishes buildings from trees and characterizes their size, density, orientation, and spacing (see figure); all of these variables are parameters that are required to calculate the estimated surface roughness for a specified area. By using this algorithm, aerodynamic surface roughness values in urban areas can then be extracted automatically. The user can also adjust the algorithm for local conditions and lidar characteristics, like summer/winter vegetation and dense/sparse lidar point spacing. Additionally, the user can also survey variations in surface roughness that occurs due to wind direction; for example, during a hurricane, when wind direction can change dramatically, this variable can be extremely significant. In its current state, the algorithm calculates an estimated surface roughness for a square kilometer area; techniques using the lidar data to calculate the surface roughness for a point, whereby only roughness elements that are upstream from the point of interest are used and the wind direction is a vital concern, are being investigated. This technological advancement will improve the reliability and accuracy of models that use and incorporate surface roughness.

  1. Clay mineralogy in different geomorphic surfaces in sugarcane areas (United States)

    Camargo, L.; Marques, J., Jr.


    The crystallization of the oxides and hydroxides of iron and aluminum and kaolinite of clay fraction is the result of pedogenetic processes controlled by the relief. These minerals have influence on the physical and chemical attributes of soil and exhibit spatial dependence. The pattern of spatial distribution is influenced by forms of relief as the geomorphic surfaces. In this sense, the studies aimed at understanding the relationship between relief and the distribution pattern of the clay fraction attributes contribute to the delineation of specific areas of management in the field. The objective of this study was to evaluate the spatial distribution of oxides and hydroxides of iron and aluminum and kaolinite of clay fraction and its relationship with the physical and chemical attributes in different geomorphic surfaces. Soil samples were collected in a transect each 25 m (100 samples) and in the sides of the same (200 samples) as well as an area of 500 ha (1 sample each six hectare). Geomorphic surfaces (GS) in the transect were mapped in detail to support mapping the entire area. The soil samples were taken to the laboratory for chemical, physical, and mineralogical analysis, and the pattern of spatial distribution of soil attributes was obtained by statistics and geostatistics. The GS I is considered the oldest surface of the study area, with depositional character, and a slope ranging from 0 to 4%. GS II and III are considered to be eroded, and the surface II plan a gentle slope that extends from the edge of the surface until the beginning of I and III. The crystallographic characteristics of the oxides and hydroxides of iron and aluminum and kaolinite showed spatial dependence and the distribution pattern corresponding to the limits present of the GS in the field. Surfaces I and II showed the best environments to the degree of crystallinity of hematite and the surface III to the greatest degree of crystallinity of goethite agreeing to the pedoenvironment

  2. ESA-SSA Review of Space Weather Measurement Requirements (United States)

    Luntama, Juha-Pekka; Glover, Alexi; Hilgers, Alain


    The ESA Space Situational Awareness (SSA) Preparatory Programme was started in 2009. The objective of the programme is to support the European independent utilisation of and access to space. The first phase of the ESA SSA system development will be finished in 2012 and the next phase is foreseen to be started after the ESA Ministerial Council meeting in November 2012. The definition of measurement requirements for the Space Weather Segment (SWE) of the ESA SSA system has been based on the space weather service requirements defined the by expected users of the system. This document, SSA SWE Customer Requirements Document (CRD), has been defined in a iterative process together with the members of the SSA User Representative Group (URG) and the delegates representing the European states participating the programme. Based on the SWE CRD, ESA with the support of the European industry has produced two documents: SSA SWE System Requirements Document (SRD) and SSA SWE Product Specification (PS). SWE PS contains the requirements for the measurements data required by the SSA SWE system. The SWE PS document has been recently rigorously reviewed by the SSA URG in the framework of the SSA System Requirements Review (SRR). The support provided by the Steering Board of the ESA Space Weather Working Team (SWWT) in this review was extremely useful. The members of the SWWT SB representing the scientific community and the provisional service providers were able to give very detailed comments regarding the measurement requirements for accuracy, cadence, timeliness, etc. As these parameters will be provisional design and cost drivers for the ESA SSA system, definition of the appropriate values at this point in the programme is crucial. This paper provides an overview of the measurement requirements for the SWE Segment of the ESA SSA Programme. The paper discusses the requirement definition process, the customer and service provider inputs, and the critical requirements as they have

  3. Indexing Glomerular Filtration Rate to Body Surface Area

    DEFF Research Database (Denmark)

    Redal-Baigorri, Belén; Rasmussen, Knud; Heaf, James Goya


    BACKGROUND: Kidney function is mostly expressed in terms of glomerular filtration rate (GFR). A common feature is the expression as ml/min per 1.73 m(2) , which represents the adjustment of the individual kidney function to a standard body surface area (BSA) to allow comparison between individuals...

  4. Plasma Creatinine, Age and Body Surface Area in Nigerian Children ...

    African Journals Online (AJOL)

    In a bid to establish reference values for plasma creatinine in children and adolescents using age, and body surface area (BSA), 462 apparently healthy Nigerian children/adolescents aged one day to 15 years were studied. They were recruited from well baby clinics, as well as primary and secondary schools. Plasma ...

  5. Evaluation of five formulae for estimating body surface area of ...

    African Journals Online (AJOL)

    Background: Physiological functions are often assessed by standardizing for body surface area (BSA) to avoid excessive variation in calculations in pediatric practice. Aim: To explore the suitability of existing formulae for estimating the BSA of Nigerian children. Subjects and Methods: This cross‑sectional study involved ...

  6. (Impervious) Surfaces on the Microclimate of Urban Area

    African Journals Online (AJOL)

    The present paper shows the considerable impacts of both vegetated and synthetic surfaces on the microclimate of urban area. Vegetation of a particular place affects the microclimate through reduced solar radiation and lower air temperature due to shading and evapotranspiration. Lower air temperatures are essential ...

  7. Installation and performance evaluation of an indigenous surface area analyser

    International Nuclear Information System (INIS)

    Pillai, S.N.; Solapurkar, M.N.; Venkatesan, V.; Prakash, A.; Khan, K.B.; Kumar, Arun; Prasad, R.S.


    An indigenously available surface area analyser was installed inside glove box and checked for its performance by analyzing uranium oxide and thorium oxide powders at RMD. The unit has been made ready for analysis of Plutonium oxide powders after incorporating several important features. (author)

  8. Influence of Ear Surface Area on Heat Tolerance of Composite ...

    African Journals Online (AJOL)

    Low correlation (r = 0.12) was observed between body weight and ear width. There were no correlations between ear width, respiratory rates and pulse rate. However, a residual correlation (r = -0.03) was obtained between ear width and body temperature. Large ear surface area in composite rabbits enhances better ...

  9. Assessment of large aperture scintillometry for large-area surface ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 126; Issue 5. Assessment of large aperture scintillometry for large-area surface energy fluxes over an irrigated cropland in north India. Abhishek Danodia V K Sehgal N R Patel R Dhakar J Mukherjee S K Saha A Senthil Kumar. Volume 126 Issue 5 July 2017 Article ...

  10. BOREAS HYD-8 DEM Data Over the NSA-MSA and SSA-MSA in the UTM Projection (United States)

    Wang, Xue-Wen; Hall, Forrest G. (Editor); Knapp, David E. (Editor); Band, L. E.; Smith, David E. (Technical Monitor)


    The BOREAS HYD-8 team focused on describing the scaling behavior of water and carbon flux processes at local and regional scales. These DEMs were produced from digitized contours at a cell resolution of 100 meters. Vector contours of the area were used as input to a software package that interpolates between contours to create a DEM representing the terrain surface. The vector contours had a contour interval of 25 feet. The data cover the BOREAS MSAs of the SSA and NSA and are given in a UTM map projection. Most of the elevation data from which the DEM was produced were collected in the 1970s or 1980s. The data are stored in binary, image format files. The data files are available on a CD-ROM (see document number 20010000884) or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  11. Surface water and groundwater interaction in Marala - Khanki area, Punjab

    International Nuclear Information System (INIS)

    Akram, W.; Ahmad, M.; Latif, Z.; Tariq, J.A.; Malik, M.R.


    Isotope hydrological investigations were carried out in two selected areas of Indus Basin viz. Haripur Area and Chashma- Taunsa Area for elucidating various aspects of surface water and groundwater interaction. Groundwater samples were collected on seasonal basis (low and high river discharge periods) while surface water samples were collected more frequently (weekly or monthly basis). Isotopic data suggested that there is no contribution of surface water to groundwater recharge in Haripur Area and rain is the prevailing source of groundwater recharge. The data further revealed that isotopic values of the Haripur pocket of Tarbela Lake are higher than those of Main Lake / Indus River meaning that there is a significant contribution of base flow in this pocket. Indus River appeared to be the dominant source of groundwater recharge at most of the locations in Chashma- Taunsa Area. Isotopic data of Indus River showed an increase at Taunsa as compared to Chashma in low flow period indicating the high contribution of base flow at this point in time. Stable isotopes were successfully used to quantify the base flow contribution. (author)

  12. Growth of contact area between rough surfaces under normal stress (United States)

    Stesky, R. M.; Hannan, S. S.


    The contact area between deforming rough surfaces in marble, alabaster, and quartz was measured from thin sections of surfaces bonded under load with low viscosity resin epoxy. The marble and alabaster samples had contact areas that increased with stress at an accelerating rate. This result suggests that the strength of the asperity contacts decreased progressively during the deformation, following some form of strain weakening relationship. This conclusion is supported by petrographic observation of the thin sections that indicate that much of the deformation was cataclastic, with minor twinning of calcite and kinking of gypsum. In the case of the quartz, the observed contact area was small and increased approximately linearly with normal stress. Only the irreversible cataclastic deformation was observed; however strain-induced birefringence and cracking of the epoxy, not observed with the other rocks, suggests that significant elastic deformation occurred, but recovered during unloading.

  13. Remote Control Southern Hemisphere SSA Observatory (United States)

    Ritchie, I.; Pearson, M.; Sang, J.


    EOS Space Systems (EOSSS) is a research and development company which has developed custom observatories, camera and telescope systems for space surveillance since 1996, as well as creating several evolutions of systems control software for control of observatories and laser tracking systems. Our primary reserach observatory is the Space Reserach Centre (SRC) at Mount Stromlo Asutralia. The current SRC control systems are designed such that remote control can be offered for real time data collection, noise filtering and flexible session management. Several imaging fields of view are available simultaneously for tracking orbiting objects, with real time imaging to Mag 18. Orbiting objects can have the centroids post processed into orbital determination/ orbital projection (OD/OP) elements. With or without laser tracking of orbiting objects, they can be tracked in terminator conditions and their OD/OP data created, then enhanced by proprietary methods involving ballistic coefficient estimation and OD convergence pinning, using a priori radar elements. Sensors in development include a thermal imager for satellite thermal signature detection. Extending laser tracking range by use of adaptive optics beam control is also in development now. This Southern Hemisphere observatory is in a unique position to facilitate the study of space debris, either stand-alone or as part of a network such as Falcon. Current national and international contracts will enhance the remote control capabilities further, creating a resource ready to go for a wide variety of SSA missions.

  14. The colour potentials of SSA-containing mortar

    DEFF Research Database (Denmark)

    Kappel, Annemette; Ottosen, Lisbeth M.; Kirkelund, Gunvor Marie


    is with a few exceptions landfilled and thus, wasted.The purpose of the experiments was to examine the influence of SSA and how it affected the colour of mortar samples. SSA was ground in 6 different intervals and added to mortar mixes by replacing 20% of the cement. An additional focus was to examine...... the possibilities to accentuate the colours of the hardened mortar by using paper cuttings in the production of the samples. The result of the experiments showed that a colour scale can be developed from ground SSA, and that paper may have the potential of providing divers textural qualities when it is used...

  15. Tropical cyclone rainfall area controlled by relative sea surface temperature. (United States)

    Lin, Yanluan; Zhao, Ming; Zhang, Minghua


    Tropical cyclone rainfall rates have been projected to increase in a warmer climate. The area coverage of tropical cyclones influences their impact on human lives, yet little is known about how tropical cyclone rainfall area will change in the future. Here, using satellite data and global atmospheric model simulations, we show that tropical cyclone rainfall area is controlled primarily by its environmental sea surface temperature (SST) relative to the tropical mean SST (that is, the relative SST), while rainfall rate increases with increasing absolute SST. Our result is consistent with previous numerical simulations that indicated tight relationships between tropical cyclone size and mid-tropospheric relative humidity. Global statistics of tropical cyclone rainfall area are not expected to change markedly under a warmer climate provided that SST change is relatively uniform, implying that increases in total rainfall will be confined to similar size domains with higher rainfall rates.

  16. Spectral theory of infinite-area hyperbolic surfaces

    CERN Document Server

    Borthwick, David


    This text introduces geometric spectral theory in the context of infinite-area Riemann surfaces, providing a comprehensive account of the most recent developments in the field. For the second edition the context has been extended to general surfaces with hyperbolic ends, which provides a natural setting for development of the spectral theory while still keeping technical difficulties to a minimum. All of the material from the first edition is included and updated, and new sections have been added. Topics covered include an introduction to the geometry of hyperbolic surfaces, analysis of the resolvent of the Laplacian, scattering theory, resonances and scattering poles, the Selberg zeta function, the Poisson formula, distribution of resonances, the inverse scattering problem, Patterson-Sullivan theory, and the dynamical approach to the zeta function. The new sections cover the latest developments in the field, including the spectral gap, resonance asymptotics near the critical line, and sharp geometric constan...

  17. Thermal Desorption Analysis of Effective Specific Soil Surface Area (United States)

    Smagin, A. V.; Bashina, A. S.; Klyueva, V. V.; Kubareva, A. V.


    A new method of assessing the effective specific surface area based on the successive thermal desorption of water vapor at different temperature stages of sample drying is analyzed in comparison with the conventional static adsorption method using a representative set of soil samples of different genesis and degree of dispersion. The theory of the method uses the fundamental relationship between the thermodynamic water potential (Ψ) and the absolute temperature of drying ( T): Ψ = Q - aT, where Q is the specific heat of vaporization, and a is the physically based parameter related to the initial temperature and relative humidity of the air in the external thermodynamic reservoir (laboratory). From gravimetric data on the mass fraction of water ( W) and the Ψ value, Polyanyi potential curves ( W(Ψ)) for the studied samples are plotted. Water sorption isotherms are then calculated, from which the capacity of monolayer and the target effective specific surface area are determined using the BET theory. Comparative analysis shows that the new method well agrees with the conventional estimation of the degree of dispersion by the BET and Kutilek methods in a wide range of specific surface area values between 10 and 250 m2/g.

  18. BOREAS TF-01 SSA-OA Soil Characteristics Data (United States)

    National Aeronautics and Space Administration — ABSTRACT: Data collected in support of the effort to characterize and interpret soil information at the SSA-OA tower site in 1994. Data collected include soil...

  19. BOREAS TF-01 SSA-OA Soil Characteristics Data (United States)

    National Aeronautics and Space Administration — Data collected in support of the effort to characterize and interpret soil information at the SSA-OA tower site in 1994. Data collected include soil respiration,...

  20. TiSSA eelkonverents doktorantidele Tallinnas / Koidu Saame

    Index Scriptorium Estoniae

    Saame, Koidu


    Tallinna Ülikoolis toimunud TiSSA doktorantide eelkonverentsist 22.-24. aug. 2010.a. Doktorantide ettekannetest. Esinesid: Hans-Uwe Otto, Andriy Yuryev, Tiina Naarits, Ivar Tröner, Koidu Saame, Maija Jäppinen, Janissa Miettinen

  1. Data over the SSA in Raster Format and AEAC Projection (United States)

    National Aeronautics and Space Administration — GIS layers that describe the soils of the BOREAS SSA. Original data were submitted as vector layers that were then gridded by BOREAS staff to a 30-meter pixel size...

  2. Data over the SSA in Raster Format and AEAC Projection (United States)

    National Aeronautics and Space Administration — ABSTRACT: GIS layers that describe the soils of the BOREAS SSA. Original data were submitted as vector layers that were then gridded by BOREAS staff to a 30-meter...

  3. Solvent accessible surface area (ASA) of simulated phospholipid membranes

    DEFF Research Database (Denmark)

    Tuchsen, E.; Jensen, Morten Østergaard; Westh, P.


    The membrane-solvent interface has been investigated through calculations of the solvent accessible surface area (ASA) for simulated membranes of DPPC and POPE. For DPPC at 52 degreesC we found an ASA of 126 +/- 8 Angstrom(2) per lipid molecule, equivalent to twice the projected lateral area......, even the most exposed parts of the PC head-group show average ASAs of less than half of its maximal or 'fully hydrated' value. The average ASA of a simulated POPE membrane was 96 +/- 7 Angstrom(2) per lipid. The smaller value than for DPPC reflects much lower ASA of the ammonium ion, which is partially...... compensated by increased exposure of the ethylene and phosphate moieties. The ASA of the polar moieties Of (PO4, NH3 and COO) constitutes 65% of the total accessible area for POPE, making this interface more polar than that of DPPC. It is suggested that ASA information can be valuable in attempts...

  4. The surface aerosol optical properties in the urban area of Nanjing, west Yangtze River Delta, China (United States)

    Zhuang, Bingliang; Wang, Tijian; Liu, Jane; Li, Shu; Xie, Min; Han, Yong; Chen, Pulong; Hu, Qiduo; Yang, Xiu-qun; Fu, Congbin; Zhu, Jialei


    Observational studies of aerosol optical properties are useful for reducing uncertainties in estimations of aerosol radiative forcing and forecasting visibility. In this study, the observed near-surface aerosol optical properties in urban Nanjing are analysed from March 2014 to February 2016. Results show that near-surface urban aerosols in Nanjing are mainly from local emissions and the surrounding regions. They have lower loadings but are more scattering than aerosols in most cities in China. The annual mean aerosol extinction coefficient (EC), single-scattering albedo (SSA) and asymmetry parameter (ASP) at 550 nm are 381.96 Mm-1, 0.9 and 0.57, respectively. The aerosol absorption coefficient (AAC) is about 1 order of magnitude smaller than its scattering coefficient (SC). However, the absorbing aerosol has a larger Ångström exponent (AAE) value, 1.58 at 470/660 nm, about 0.2 larger than the scattering aerosols (SAE). All the aerosol optical properties follow a near-unimodal pattern, and their values are mostly concentrated around their averages, accounting for more than 60 % of the total samplings. Additionally, they have substantial seasonality and diurnal variations. High levels of SC and AAC all appear in winter due to higher aerosol and trace gas emissions. AAE (ASP) is the smallest (largest) in summer, possibly because of high relative humidity (RH) which also causes considerably larger SC and smaller SAE, although intensive gas-to-particle transformation could produce a large number of finer scattering aerosols in this season. Seasonality of EC is different from the columnar aerosol optical depth. Larger AACs appear during the rush hours of the day while SC and back-scattering coefficient (Bsp) only peak in the early morning. Aerosols are fresher in the daytime than at night-time, leading to their larger Ångström exponent and smaller ASP. Different temporal variations between AAC and SC cause the aerosols to be more absorbing (smaller SSA) in autumn

  5. Metal-organic framework materials with ultrahigh surface areas (United States)

    Farha, Omar K.; Hupp, Joseph T.; Wilmer, Christopher E.; Eryazici, Ibrahim; Snurr, Randall Q.; Gomez-Gualdron, Diego A.; Borah, Bhaskarjyoti


    A metal organic framework (MOF) material including a Brunauer-Emmett-Teller (BET) surface area greater than 7,010 m.sup.2/g. Also a metal organic framework (MOF) material including hexa-carboxylated linkers including alkyne bond. Also a metal organic framework (MOF) material including three types of cuboctahedron cages fused to provide continuous channels. Also a method of making a metal organic framework (MOF) material including saponifying hexaester precursors having alkyne bonds to form a plurality of hexa-carboxylated linkers including alkyne bonds and performing a solvothermal reaction with the plurality of hexa-carboxylated linkers and one or more metal containing compounds to form the MOF material.

  6. Asymptotic variance of grey-scale surface area estimators

    DEFF Research Database (Denmark)

    Svane, Anne Marie

    Grey-scale local algorithms have been suggested as a fast way of estimating surface area from grey-scale digital images. Their asymptotic mean has already been described. In this paper, the asymptotic behaviour of the variance is studied in isotropic and sufficiently smooth settings, resulting...... in a general asymptotic bound. For compact convex sets with nowhere vanishing Gaussian curvature, the asymptotics can be described more explicitly. As in the case of volume estimators, the variance is decomposed into a lattice sum and an oscillating term of at most the same magnitude....

  7. Rapid assessment of populations trends of invasive species: Singular Spectrum Analysis (SSA

    Directory of Open Access Journals (Sweden)

    DANA, ED


    Full Text Available Singular Spectrum Analysis (SSA is a powerful analytical approach for biodi-versity management. Its main advan-tages are due to its intuitive processing and visualization, since mathematical workflow is conceptually similar to the widely accepted Principal Components Analysis. Detailed analyses of popula-tion trends with mathematical tools are often difficult to achieve for managers by a number of reasons (large numbers or areas monitored, large number of species, insufficient statistics skills, strong knowledge level in demographic analyses, etc.. SSA has been used since the 1970’s in signal processing to clarify signal vs. noisy information, but it has also been used in climate change analy-sis and other developmental areas. Be-sides, SSA is a rapid-learning method for technicians and managers with medium level of mathematical knowledge. Free software in Unix environment is avail-able. Unfortunately, no free and friendly software is available for Win-dows SO. Although R package may offer solutions for really advanced users, it does not fit real work situations for managers of biological invasions. Cater-pillar (Gistat Group, Ltd is by now, the best option found by the author in terms of price, facility for results inter-pretation and time consumed in learn-ing. The main disadvantage is the poor content of tutorial files

  8. Overcoming the reference large-area sources non-uniformity in surface area monitor calibration

    Energy Technology Data Exchange (ETDEWEB)

    Junior, Iremar Alves S.; Siqueira, Paulo de T.D.; Xavier, Marcs; Nascimento, Eduardo do; Potiens, Maria da Penha A., E-mail:, E-mail:, E-mail:, E-mail:, E-mail: [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)


    This paper describes a study using MCNP5 simulations, a Monte Carlo based radiation transport code, in order to evaluate the possibility of using reference large-area sources that do not meet the uniformity recommendations of the ISO 8769:2010 in surface contamination monitors calibration. {sup 14}C, {sup 36}Cl, {sup 99}Tc, {sup 137}Cs and {sup 90}Sr + {sup 90}Y large area reference sources were simulated as well as the setup and the detector probe. Simulations were carried out for both uniform and non-uniform surface distributions. In the case of uniform distribution, specific weights for each region were considered, as obtained in the uniformity evaluation measurements. To each simulation, it was considered the average number of signals generated in each detector probe, i.e., it was determined the fraction of stories depositing energy in the corresponding gas filled region of the detector. Simulations results show differences in detection efficiency values up to 15%. (author)

  9. Anti-Ro52 antibody level is an important marker of fetal congenital heart block risk in anti-Ro/SSA antibody positive pregnancy. (United States)

    Miyasato-Isoda, Mai; Waguri, Masako; Yamada, Yuko; Miyano, Akira; Wada, Yoshinao


    The aims of this study are to determine the incidence of congenital heart block (CHB) in the Japanese population and identify maternal factors predicting fetal CHB in anti-Ro/SSA antibody positive pregnancy. A retrospective study was performed using 52,147 clinical records of pregnancies followed in a single center. For 183 anti-Ro/SSA antibody-positive women, anti-Ro52 and Ro60 antibodies were measured, and the odds of CHB in relation to maternal clinical features were calculated by multivariate analysis. The receiver-operating characteristic (ROC) curves for predicting CHB were constructed for the titers of anti-Ro/SSA, anti-Ro52 and anti-Ro60 antibodies. Fetal CHB occurred in two pregnancies among those without known risks such as positive anti-Ro/SSA antibody or previous CHB-affected pregnancy, suggesting an incidence similar to that in Caucasian populations. As for the anti-Ro/SSA antibody positive pregnancies, the titers of anti-Ro/SSA, anti-Ro52 and anti-Ro60 antibodies were independent risk factors for fetal CHB and the use of corticosteroids before 18 gestational weeks was an independent protective factor. The area under the ROC was 0.84, 0.73 and 0.74 for anti-Ro52, anti-Ro60 and anti-Ro/SSA antibodies, respectively. CHB occurred in two among approximately 50,000 pregnancies without known risks such as positive anti-Ro/SSA antibody or previous delivery of CHB-affected babies. Measurement of anti-Ro52 antibody levels may be helpful in extracting a risk group of delivering CHB infants in the anti-Ro/SSA antibody positive pregnancy.

  10. The colour potentials of SSA-containing mortar:the long version


    Kappel, Annemette; Ottosen, Lisbeth M.; Kirkelund, Gunvor Marie; Bache, Anja Margrethe; Goltermann, Per


    This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA is with a few exceptions landfilled and thus, wasted.The purpose of the experiments was to examine the influence of SSA and how it affected the colour of mortar samples. SSA was ground in 6 different intervals...

  11. Error bounds for surface area estimators based on Crofton's formula

    DEFF Research Database (Denmark)

    Kiderlen, Markus; Meschenmoser, Daniel


    According to Crofton’s formula, the surface area S(A) of a sufficiently regular compact set A in R^d is proportional to the mean of all total projections pA (u) on a linear hyperplane with normal u, uniformly averaged over all unit vectors u. In applications, pA (u) is only measured in k directio...... in the sense that the relative error of the surface area estimator is very close to the minimal error....... and the mean is approximated by a finite weighted sum S(A) of the total projections in these directions. The choice of the weights depends on the selected quadrature rule. We define an associated zonotope Z (depending only on the projection directions and the quadrature rule), and show that the relative error...... S (A)/S (A) is bounded from below by the inradius of Z and from above by the circumradius of Z. Applying a strengthened isoperimetric inequality due to Bonnesen, we show that the rectangular quadrature rule does not give the best possible error bounds for d = 2. In addition, we derive asymptotic...

  12. Hierarchical nitrogen-doped porous carbon with high surface area derived from endothelium corneum gigeriae galli for high-performance supercapacitor

    International Nuclear Information System (INIS)

    Hong, Xiaoting; Hui, K.S.; Zeng, Zhi; Hui, K.N.; Zhang, Luojiang; Mo, Mingyue; Li, Min


    Highlights: • Porous carbons were prepared using endothelium corneum gigeriae galli as precursor. • Surface and structural properties strongly depend on carbonization temperatures. • Resultant carbons possess nitrogen heteroatom and high surface areas. • ECGG-900 sample exhibits excellent electrochemical capacitive performances. - Abstract: Endothelium corneum gigeriae galli derived 3D hierarchical nitrogen-doped porous carbon was for the first time prepared by preliminary carbonization at 450 °C and final KOH activation at high temperatures. The surface and structural properties of the as-synthesized samples are analyzed with Brunauer–Emmett–Teller surface analyzer apparatus, X-Ray Diffractometer, scanning electron microscopy, transmission electron microscopy, X-ray photoelectron spectrometer. The electrochemical performances are analyzed by cyclic voltammetry, galvanostatic charge/discharge cycling and electrochemical impedance spectroscopy. The obtained results show that the sample carbonized at 900 °C possesses the SSA of 2149.9 m 2 g −1 , average micropore diameter of 1.78 nm, and exhibits the highest initial specific capacitance of 198.0 F g −1 at current density of 1 A g −1 in 6 M KOH solution. It retains good specific capacitance retention of 91.6% after 3000 charge/discharge cycles at current density of 2 A g −1

  13. Clinical and Pathological Roles of Ro/SSA Autoantibody System

    Directory of Open Access Journals (Sweden)

    Ryusuke Yoshimi


    Full Text Available Anti-Ro/SSA antibodies are among the most frequently detected autoantibodies against extractable nuclear antigens and have been associated with systemic lupus erythematosus (SLE and Sjögren's syndrome (SS. Although the presence of these autoantibodies is one of the criteria for the diagnosis and classification of SS, they are also sometimes seen in other systemic autoimmune diseases. In the last few decades, the knowledge of the prevalence of anti-Ro/SSA antibodies in various autoimmune diseases and symptoms has been expanded, and the clinical importance of these antibodies is increasing. Nonetheless, the pathological role of the antibodies is still poorly understood. In this paper, we summarize the milestones of the anti-Ro/SSA autoantibody system and provide new insights into the association between the autoantibodies and the pathogenesis of autoimmune diseases.

  14. Arctic Region Space Weather Customers and SSA Services

    DEFF Research Database (Denmark)

    Høeg, Per; Kauristi, Kirsti; Wintoft, Peter

    and communication can be established without errors resulting from Space Weather effects. An ESA project have identified and clarified, how the products of the four ESA Space Weather Expert Service Centres (SWE) in the ESA Space Situational Awareness Programme (SSA), can contribute to the requirements of SSA...... services in Arctic, and how new products and services need to be developed and implemented in the roadmap of SWE for Arctic region network services. An important element in the project is the end-user requirements and needs in the public and commercial sector. A detailed user-survey and interviews with key......-companies in the region have been performed. The outcome has been analysed in view of the present SWE system, and products and suggestions to a roadmap for the development of coming Arctic region SSA services, have been established....

  15. Method for producing high surface area chromia materials for catalysis (United States)

    Gash, Alexander E [Brentwood, CA; Satcher, Joe [Patterson, CA; Tillotson, Thomas [Tracy, CA; Hrubesh, Lawrence [Pleasanton, CA; Simpson, Randall [Livermore, CA


    Nanostructured chromium(III)-oxide-based materials using sol-gel processing and a synthetic route for producing such materials are disclosed herein. Monolithic aerogels and xerogels having surface areas between 150 m.sup.2/g and 520 m.sup.2/g have been produced. The synthetic method employs the use of stable and inexpensive hydrated-chromium(III) inorganic salts and common solvents such as water, ethanol, methanol, 1-propanol, t-butanol, 2-ethoxy ethanol, and ethylene glycol, DMSO, and dimethyl formamide. The synthesis involves the dissolution of the metal salt in a solvent followed by an addition of a proton scavenger, such as an epoxide, which induces gel formation in a timely manner. Both critical point (supercritical extraction) and atmospheric (low temperature evaporation) drying may be employed to produce monolithic aerogels and xerogels, respectively.

  16. Fully automated algorithm for wound surface area assessment. (United States)

    Deana, Alessandro Melo; de Jesus, Sérgio Henrique Costa; Sampaio, Brunna Pileggi Azevedo; Oliveira, Marcelo Tavares; Silva, Daniela Fátima Teixeira; França, Cristiane Miranda


    Worldwide, clinicians, dentists, nurses, researchers, and other health professionals need to monitor the wound healing progress and to quantify the rate of wound closure. The aim of this study is to demonstrate, step by step, a fully automated numerical method to estimate the size of the wound and the percentage damaged relative to the body surface area (BSA) in images, without the requirement for human intervention. We included the formula for BSA in rats in the algorithm. The methodology was validated in experimental wounds and human ulcers and was compared with the analysis of an experienced pathologist, with good agreement. Therefore, this algorithm is suitable for experimental wounds and burns and human ulcers, as they have a high contrast with adjacent normal skin. © 2013 by the Wound Healing Society.

  17. Electromagnetic surface waves for large-area RF plasma productions between large-area planar electrodes

    International Nuclear Information System (INIS)

    Nonaka, S.


    Recently, large-area plasma production has been tested by means of a 13.56 MHz radio-frequency (RF) discharge between a pair of large-area planar electrodes, approximately 0.5 m x 1.4 m, as one of the semiconductor technologies for fabrication of large-area amorphous silicon solar cells in the ''Sunshine Project'' of the Agency of Industrial Science and Technology in Japan. We also confirmed long plasma production between a pair of long electrodes. In this paper, normal electromagnetic (EM) waves propagating in a region between a planar waveguide with one plasma and two dielectric layers are analyzed in order to study the feasibility of large-area plasma productions by EM wave-discharges between a pair of large-area RF electrodes larger than the half-wavelength of RF wave. In conclusion, plasmas higher than an electron plasma frequency will be produced by an odd TMoo surface mode. (author) 4 refs., 3 figs

  18. Human cortical areas involved in perception of surface glossiness. (United States)

    Wada, Atsushi; Sakano, Yuichi; Ando, Hiroshi


    Glossiness is the visual appearance of an object's surface as defined by its surface reflectance properties. Despite its ecological importance, little is known about the neural substrates underlying its perception. In this study, we performed the first human neuroimaging experiments that directly investigated where the processing of glossiness resides in the visual cortex. First, we investigated the cortical regions that were more activated by observing high glossiness compared with low glossiness, where the effects of simple luminance and luminance contrast were dissociated by controlling the illumination conditions (Experiment 1). As cortical regions that may be related to the processing of glossiness, V2, V3, hV4, VO-1, VO-2, collateral sulcus (CoS), LO-1, and V3A/B were identified, which also showed significant correlation with the perceived level of glossiness. This result is consistent with the recent monkey studies that identified selective neural response to glossiness in the ventral visual pathway, except for V3A/B in the dorsal visual pathway, whose involvement in the processing of glossiness could be specific to the human visual system. Second, we investigated the cortical regions that were modulated by selective attention to glossiness (Experiment 2). The visual areas that showed higher activation to attention to glossiness than that to either form or orientation were identified as right hV4, right VO-2, and right V3A/B, which were commonly identified in Experiment 1. The results indicate that these commonly identified visual areas in the human visual cortex may play important roles in glossiness perception. Copyright © 2014. Published by Elsevier Inc.

  19. Assessment of Surface Area Characteristics of Dental Implants with Gradual Bioactive Surface Treatment (United States)

    Czan, Andrej; Babík, Ondrej; Miklos, Matej; Záušková, Lucia; Mezencevová, Viktória


    Since most of the implant surface is in direct contact with bone tissue, shape and integrity of said surface has great influence on successful osseointegration. Among other characteristics that predetermine titanium of different grades of pureness as ideal biomaterial, titanium shows high mechanical strength making precise miniature machining increasingly difficult. Current titanium-based implants are often anodized due to colour coding. This anodized layer has important functional properties for right usage and also bio-compatibility of dental implants. Physical method of anodizing and usage of anodizing mediums has a significant influence on the surface quality and itself functionality. However, basic requirement of the dental implant with satisfactory properties is quality of machined surface before anodizing. Roughness, for example, is factor affecting of time length of anodizing operation and so whole productivity. The paper is focused on monitoring of surface and area characteristics, such as roughness or surface integrity after different cutting conditions of miniature machining of dental implants and their impact on suitability for creation of satisfactory anodized layer with the correct biocompatible functional properties.

  20. Surface ozone in the urban area of Manaus, Amazonas, Brazil (United States)

    Souza, R. A. F. D.; Costa, P. S.; Silva, C.; Godoi, R. M.; Martin, S. T.; Tota, J.; Barbosa, H. M.; Pauliquevis, T.; Ferreira De Brito, J.; Artaxo, P.; Manzi, A. O.; Wolf, S. A.; Cirino, G. G.


    When nitrogen oxides from vehicle and industrial emissions mix with volatile organic compounds from trees and plants with exposure to sunlight, a chemical reaction occurs contributing to ground-level ozone pollution. The preliminary results of the surface ozone study in urban area of Manaus, Amazonas State, Brazil, are presented for the first intensive operating period (IOP1) of the GoAmazon experiment (February/March 2014). Photochemical ozone production was found to be a regular process, with an afternoon maximum of the ozone mixing ratio of lower than 20 ppbv for cloudy days or clear sky weather. Typical ozone concentrations at mid-day were low (about 10 ppb). On the other hand, several high-value ozone episodes with surface ozone mixing ratios up to three times larger were registered during the dry season of 2013 (September/October). At the beginning of the wet season, the ozone concentration in Manaus decreased significantly, but diurnal variations can be found during the days with rainfall and other fast changes of meteorological conditions. Possible explanations of the nature of pulsations are discussed. Photochemical ozone production by local urban plumes of Manaus is named as a first possible source of the ozone concentration and biomass burning or power plant emissions are suggested as an alternative or an additional source.

  1. Estimating the surface area of birds: using the homing pigeon (Columba livia as a model

    Directory of Open Access Journals (Sweden)

    Cristina R. Perez


    Full Text Available Estimation of the surface area of the avian body is valuable for thermoregulation and metabolism studies as well as for assessing exposure to oil and other surface-active organic pollutants from a spill. The use of frozen carcasses for surface area estimations prevents the ability to modify the posture of the bird. The surface area of six live homing pigeons in the fully extended flight position was estimated using a noninvasive method. An equation was derived to estimate the total surface area of a pigeon based on its body weight. A pigeon's surface area in the fully extended flight position is approximately 4 times larger than the surface area of a pigeon in the perching position. The surface area of a bird is dependent on its physical position, and, therefore, the fully extended flight position exhibits the maximum area of a bird and should be considered the true surface area of a bird.



    Hong Shen


    The concepts of curve profile, curve intercept, curve intercept density, curve profile area density, intersection density in containing intersection (or intersection density relied on intersection reference), curve profile intersection density in surface (or curve intercept intersection density relied on intersection of containing curve), and curve profile area density in surface (AS) were defined. AS expressed the amount of curve profile area of Y phase in the unit containing surface area, S...

  3. Moving to 3D: relationships between coral planar area, surface area and volume. (United States)

    House, Jenny E; Brambilla, Viviana; Bidaut, Luc M; Christie, Alec P; Pizarro, Oscar; Madin, Joshua S; Dornelas, Maria


    Coral reefs are a valuable and vulnerable marine ecosystem. The structure of coral reefs influences their health and ability to fulfill ecosystem functions and services. However, monitoring reef corals largely relies on 1D or 2D estimates of coral cover and abundance that overlook change in ecologically significant aspects of the reefs because they do not incorporate vertical or volumetric information. This study explores the relationship between 2D and 3D metrics of coral size. We show that surface area and volume scale consistently with planar area, albeit with morphotype specific conversion parameters. We use a photogrammetric approach using open-source software to estimate the ability of photogrammetry to provide measurement estimates of corals in 3D. Technological developments have made photogrammetry a valid and practical technique for studying coral reefs. We anticipate that these techniques for moving coral research from 2D into 3D will facilitate answering ecological questions by incorporating the 3rd dimension into monitoring.

  4. 20 CFR 411.630 - Is SSA's decision final? (United States)


    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Is SSA's decision final? 411.630 Section 411.630 Employees' Benefits SOCIAL SECURITY ADMINISTRATION THE TICKET TO WORK AND SELF-SUFFICIENCY PROGRAM Ticket to Work Program Dispute Resolution Disputes Between Beneficiaries and Employment Networks § 411...

  5. 20 CFR 411.660 - Is SSA's decision final? (United States)


    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Is SSA's decision final? 411.660 Section 411.660 Employees' Benefits SOCIAL SECURITY ADMINISTRATION THE TICKET TO WORK AND SELF-SUFFICIENCY PROGRAM Ticket to Work Program Dispute Resolution Disputes Between Employment Networks and Program Managers § 411...

  6. Evaluating Options for Civil Space Situational Awareness (SSA) (United States)

    Lal, B.; Carioscia, S. A.

    In recent years, the number of active satellites and human-made orbital space debris has increased dramatically. An expansion of activities in space, as is currently being proposed by many commercial and international entities, is expected to further exacerbate this challenge. The 18th Space Control Squadron under the Department of Defense (DOD) United States Strategic Command provides space situational awareness (SSA) services to users outside the national security community at no cost. International and commercial users demand better SSA service than is currently feasible, and the demand comes at a time when DOD is under pressure to better prepare for and respond to growing space-based threats to national security. Concerned about the possibility of overextending across conflicting missions in a fiscally constrained environment, some DOD officials have publicly noted a desire to move SSA services not related to national security out of DOD purview. Responding to a request from the Federal Aviation Administration (FAA) Office of Commercial Space Transportation (AST), researchers at the Science and Technology Policy Institute (STPI) identified and evaluated potential approaches for providing SSA services for civil and commercial operations in space. In this paper, we summarize the report [1] and present the pros and cons of four approaches to the provision of civil SSA services in the United States: (1) maintaining status quo through continued provision by DOD; (2) provision by a civil government entity; (3) industry self-provision; and (4) provision by an international organization. Within the second approach, assuming the provision of SSA by a civil agency, STPI further identified and discussed four options: (1) civil agency service capability embedded within DOD; (2) independent civil service capability, using DOD software and systems; (3) independent civil service capability, using commercial software and systems; and (4) the government certifies non

  7. Extent of Stream Burial and Relationships to Watershed Area, Topography, and Impervious Surface Area

    Directory of Open Access Journals (Sweden)

    Roy E. Weitzell


    Full Text Available Stream burial—the routing of streams through culverts, pipes, and concrete lined channels, or simply paving them over—is common during urbanization, and disproportionately affects small, headwater streams. Burial undermines the physical and chemical processes governing life in streams, with consequences for water quality and quantity that may amplify from headwaters to downstream receiving waters. Knowledge of the extent of stream burial is critical for understanding cumulative impacts to stream networks, and for future decision-making allowing for urban development while protecting ecosystem function. We predicted stream burial across the urbanizing Potomac River Basin (USA for each 10-m stream segment in the basin from medium-resolution impervious cover data and training observations obtained from high-resolution aerial photography in a GIS. Results were analyzed across a range in spatial aggregation, including counties and independent cities, small watersheds, and regular spatial grids. Stream burial was generally correlated with total impervious surface area (ISA, with areas exhibiting ISA above 30% often subject to elevated ratios of stream burial. Recurring patterns in burial predictions related to catchment area and topographic slope were also detected. We discuss these results in the context of physiographic constraints on stream location and urban development, including implications for environmental management of aquatic resources.

  8. Climatologies at high resolution for the earth's land surface areas (United States)

    Karger, Dirk Nikolaus; Conrad, Olaf; Böhner, Jürgen; Kawohl, Tobias; Kreft, Holger; Soria-Auza, Rodrigo Wilber; Zimmermann, Niklaus E.; Linder, H. Peter; Kessler, Michael


    High-resolution information on climatic conditions is essential to many applications in environmental and ecological sciences. Here we present the CHELSA (Climatologies at high resolution for the earth's land surface areas) data of downscaled model output temperature and precipitation estimates of the ERA-Interim climatic reanalysis to a high resolution of 30 arc sec. The temperature algorithm is based on statistical downscaling of atmospheric temperatures. The precipitation algorithm incorporates orographic predictors including wind fields, valley exposition, and boundary layer height, with a subsequent bias correction. The resulting data consist of a monthly temperature and precipitation climatology for the years 1979-2013. We compare the data derived from the CHELSA algorithm with other standard gridded products and station data from the Global Historical Climate Network. We compare the performance of the new climatologies in species distribution modelling and show that we can increase the accuracy of species range predictions. We further show that CHELSA climatological data has a similar accuracy as other products for temperature, but that its predictions of precipitation patterns are better.

  9. Surface Rupture Effects on Earthquake Moment-Area Scaling Relations (United States)

    Luo, Yingdi; Ampuero, Jean-Paul; Miyakoshi, Ken; Irikura, Kojiro


    Empirical earthquake scaling relations play a central role in fundamental studies of earthquake physics and in current practice of earthquake hazard assessment, and are being refined by advances in earthquake source analysis. A scaling relation between seismic moment ( M 0) and rupture area ( A) currently in use for ground motion prediction in Japan features a transition regime of the form M 0- A 2, between the well-recognized small (self-similar) and very large (W-model) earthquake regimes, which has counter-intuitive attributes and uncertain theoretical underpinnings. Here, we investigate the mechanical origin of this transition regime via earthquake cycle simulations, analytical dislocation models and numerical crack models on strike-slip faults. We find that, even if stress drop is assumed constant, the properties of the transition regime are controlled by surface rupture effects, comprising an effective rupture elongation along-dip due to a mirror effect and systematic changes of the shape factor relating slip to stress drop. Based on this physical insight, we propose a simplified formula to account for these effects in M 0- A scaling relations for strike-slip earthquakes.

  10. Non-traditional Sensor Tasking for SSA: A Case Study (United States)

    Herz, A.; Herz, E.; Center, K.; Martinez, I.; Favero, N.; Clark, C.; Therien, W.; Jeffries, M.

    Industry has recognized that maintaining SSA of the orbital environment going forward is too challenging for the government alone. Consequently there are a significant number of commercial activities in various stages of development standing-up novel sensors and sensor networks to assist in SSA gathering and dissemination. Use of these systems will allow government and military operators to focus on the most sensitive space control issues while allocating routine or lower priority data gathering responsibility to the commercial side. The fact that there will be multiple (perhaps many) commercial sensor capabilities available in this new operational model begets a common access solution. Absent a central access point to assert data needs, optimized use of all commercial sensor resources is not possible and the opportunity for coordinated collections satisfying overarching SSA-elevating objectives is lost. Orbit Logic is maturing its Heimdall Web system - an architecture facilitating “data requestor” perspectives (allowing government operations centers to assert SSA data gathering objectives) and “sensor operator” perspectives (through which multiple sensors of varying phenomenology and capability are integrated via machine -machine interfaces). When requestors submit their needs, Heimdall’s planning engine determines tasking schedules across all sensors, optimizing their use via an SSA-specific figure-of-merit. ExoAnalytic was a key partner in refining the sensor operator interfaces, working with Orbit Logic through specific details of sensor tasking schedule delivery and the return of observation data. Scant preparation on both sides preceded several integration exercises (walk-then-run style), which culminated in successful demonstration of the ability to supply optimized schedules for routine public catalog data collection – then adapt sensor tasking schedules in real-time upon receipt of urgent data collection requests. This paper will provide a

  11. 30 CFR 912.764 - Process for designating areas unsuitable for surface coal mining operations. (United States)


    ... surface coal mining operations. 912.764 Section 912.764 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE IDAHO § 912.764 Process for designating areas unsuitable for surface coal mining... coal mining and reclamation operations. ...

  12. 30 CFR 941.761 - Areas designated unsuitable for surface coal mining by act of Congress. (United States)


    ... WITHIN EACH STATE SOUTH DAKOTA § 941.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal...

  13. 30 CFR 937.761 - Areas designated unsuitable for surface coal mining by Act of Congress. (United States)


    ... WITHIN EACH STATE OREGON § 937.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal...

  14. 30 CFR 905.761 - Areas designated unsuitable for surface coal mining by act of Congress. (United States)


    ... WITHIN EACH STATE CALIFORNIA § 905.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal...

  15. 30 CFR 910.761 - Areas designated unsuitable for surface coal mining by Act of Congress. (United States)


    ... WITHIN EACH STATE GEORGIA § 910.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal...

  16. 30 CFR 903.761 - Areas designated unsuitable for surface coal mining by act of Congress. (United States)


    ... WITHIN EACH STATE ARIZONA § 903.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, applies to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal...

  17. 30 CFR 939.761 - Areas designated unsuitable for surface coal mining by Act of Congress. (United States)


    ... WITHIN EACH STATE RHODE ISLAND § 939.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal...

  18. 30 CFR 922.761 - Areas designated unsuitable for surface coal mining by act of Congress. (United States)


    ... WITHIN EACH STATE MICHIGAN § 922.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal...

  19. 30 CFR 921.761 - Areas designated unsuitable for surface coal mining by Act of Congress. (United States)


    ... WITHIN EACH STATE MASSACHUSETTS § 921.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal...

  20. 30 CFR 912.761 - Areas designated unsuitable for surface coal mining by act of Congress. (United States)


    ... WITHIN EACH STATE IDAHO § 912.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal...

  1. 30 CFR 947.761 - Areas designated unsuitable for surface coal mining by act of Congress. (United States)


    ... WITHIN EACH STATE WASHINGTON § 947.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal...

  2. 30 CFR 942.761 - Areas designated unsuitable for surface coal mining by act of Congress. (United States)


    ... WITHIN EACH STATE TENNESSEE § 942.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal...

  3. 30 CFR 903.762 - Criteria for designating areas as unsuitable for surface coal mining operations. (United States)


    ... for surface coal mining operations. 903.762 Section 903.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE ARIZONA § 903.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining...

  4. 30 CFR 922.762 - Criteria for designating areas as unsuitable for surface coal mining operations. (United States)


    ... for surface coal mining operations. 922.762 Section 922.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE MICHIGAN § 922.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining...

  5. 30 CFR 937.762 - Criteria for designating areas as unsuitable for surface coal mining operations. (United States)


    ... for surface coal mining operations. 937.762 Section 937.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE OREGON § 937.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining...

  6. 30 CFR 912.762 - Criteria for designating areas as unsuitable for surface coal mining operations. (United States)


    ... for surface coal mining operations. 912.762 Section 912.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE IDAHO § 912.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining...

  7. 30 CFR 910.762 - Criteria for designating areas as unsuitable for surface coal mining operations. (United States)


    ... for surface coal mining operations. 910.762 Section 910.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE GEORGIA § 910.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining...

  8. 3-D image-based numerical computations of snow permeability: links to specific surface area, density, and microstructural anisotropy

    Directory of Open Access Journals (Sweden)

    N. Calonne


    Full Text Available We used three-dimensional (3-D images of snow microstructure to carry out numerical estimations of the full tensor of the intrinsic permeability of snow (K. This study was performed on 35 snow samples, spanning a wide range of seasonal snow types. For several snow samples, a significant anisotropy of permeability was detected and is consistent with that observed for the effective thermal conductivity obtained from the same samples. The anisotropy coefficient, defined as the ratio of the vertical over the horizontal components of K, ranges from 0.74 for a sample of decomposing precipitation particles collected in the field to 1.66 for a depth hoar specimen. Because the permeability is related to a characteristic length, we introduced a dimensionless tensor K*=K/res2, where the equivalent sphere radius of ice grains (res is computed from the specific surface area of snow (SSA and the ice density (ρi as follows: res=3/(SSA×ρi. We define K and K* as the average of the diagonal components of K and K*, respectively. The 35 values of K* were fitted to snow density (ρs and provide the following regression: K = (3.0 ± 0.3 res2 exp((−0.0130 ± 0.0003ρs. We noted that the anisotropy of permeability does not affect significantly the proposed equation. This regression curve was applied to several independent datasets from the literature and compared to other existing regression curves or analytical models. The results show that it is probably the best currently available simple relationship linking the average value of permeability, K, to snow density and specific surface area.

  9. Overview of Human-Centric Space Situational Awareness (SSA) Science and Technology (S&T) (United States)

    Ianni, J.; Aleva, D.; Ellis, S.


    A number of organizations, within the government, industry, and academia, are researching ways to help humans understand and react to events in space. The problem is both helped and complicated by the fact that there are numerous data sources that need to be planned (i.e., tasked), collected, processed, analyzed, and disseminated. A large part of the research is in support of the Joint Space Operational Center (JSpOC), National Air and Space Intelligence Center (NASIC), and similar organizations. Much recent research has been specifically targeting the JSpOC Mission System (JMS) which has provided a unifying software architecture. This paper will first outline areas of science and technology (S&T) related to human-centric space situational awareness (SSA) and space command and control (C2) including: 1. Object visualization - especially data fused from disparate sources. Also satellite catalog visualizations that convey the physical relationships between space objects. 2. Data visualization - improve data trend analysis as in visual analytics and interactive visualization; e.g., satellite anomaly trends over time, space weather visualization, dynamic visualizations 3. Workflow support - human-computer interfaces that encapsulate multiple computer services (i.e., algorithms, programs, applications) into a 4. Command and control - e.g., tools that support course of action (COA) development and selection, tasking for satellites and sensors, etc. 5. Collaboration - improve individuals or teams ability to work with others; e.g., video teleconferencing, shared virtual spaces, file sharing, virtual white-boards, chat, and knowledge search. 6. Hardware/facilities - e.g., optimal layouts for operations centers, ergonomic workstations, immersive displays, interaction technologies, and mobile computing. Secondly we will provide a survey of organizations working these areas and suggest where more attention may be needed. Although no detailed master plan exists for human

  10. Analysis on the spatial structure of Shanghai tourism industry using the SSA method

    Directory of Open Access Journals (Sweden)

    LIU Jinwei


    Full Text Available This paper utilizes SSA method to calculate the comparative advantage of tourism industry over the other main departments in the tertiary industry in Shanghai from 2000 to 2010.The research results indicate that the structural advantage and competitive of Shanghai tourism industry are obvious,being stronger than the financial,real estate.While the developing levels among different districts are in great difference.The central metropolitan area has a higher gross value and more commercial patterns,and makes more contribution to the whole city tourism than those in suburb area;while its developing speed is slowing down.In the suburb area the gross value in tourism industry is lower,but it is increasing faster than those in urban area.The tourism industry in this area is facing with some problems as the changes in the development pattern,the cooperation of different tourism enterprises.

  11. Effect of impervious surface area and vegetation changes on mean ...

    African Journals Online (AJOL)

    adeniyi adeyemi

    sprawl and this has contributed to increase in surface temperature. Keyword: Thematic indices, surface temperature, Landsat, vegetation, ISA, Tshwane Metropolis. 1. Introduction. Globally, rapid increase in population in major cities has led to urban sprawl at an unprecedented rate which is, according to the analysis and ...

  12. Automatic Satellite Telemetry Analysis for SSA using Artificial Intelligence Techniques (United States)

    Stottler, R.; Mao, J.

    In April 2016, General Hyten, commander of Air Force Space Command, announced the Space Enterprise Vision (SEV) ( The SEV addresses increasing threats to space-related systems. The vision includes an integrated approach across all mission areas (communications, positioning, navigation and timing, missile warning, and weather data) and emphasizes improved access to data across the entire enterprise and the ability to protect space-related assets and capabilities. "The future space enterprise will maintain our nation's ability to deliver critical space effects throughout all phases of conflict," Hyten said. Satellite telemetry is going to become available to a new audience. While that telemetry information should be valuable for achieving Space Situational Awareness (SSA), these new satellite telemetry data consumers will not know how to utilize it. We were tasked with applying AI techniques to build an infrastructure to process satellite telemetry into higher abstraction level symbolic space situational awareness and to initially populate that infrastructure with useful data analysis methods. We are working with two organizations, Montana State University (MSU) and the Air Force Academy, both of whom control satellites and therefore currently analyze satellite telemetry to assess the health and circumstances of their satellites. The design which has resulted from our knowledge elicitation and cognitive task analysis is a hybrid approach which combines symbolic processing techniques of Case-Based Reasoning (CBR) and Behavior Transition Networks (BTNs) with current Machine Learning approaches. BTNs are used to represent the process and associated formulas to check telemetry values against anticipated problems and issues. CBR is used to represent and retrieve BTNs that represent an investigative process that should be applied to the telemetry in certain circumstances

  13. The Ro/SSA Complex in Systemic Lupus Erythematosus Patients


    Do Nascimento, Noelle Mariane


    In this work the involved mechanisms between Ro/SSA complex, composed also by the tripartite motif 21 (TRIM21alpha) and trove domain 2 (TROVE2) proteins, with respect to systemic lupus erythematosus (SLE) autoantibodies is studied. The work is divided in three chapters: I- In vitro and in silico analysis of the molecular recognition between lupus autoantibodies and TRIM21alpha Fc Receptor ; II- In vitro evidence of bipolar-bridged immune TROVE2 complexes in the pathogenesis of systemic lupus ...

  14. Effects of synthesis conditions on structure and surface properties of SmMn{sub 2}O{sub 5} mullite-type oxide

    Energy Technology Data Exchange (ETDEWEB)

    Thampy, Sampreetha; Ibarra, Venessa; Lee, Yun-Ju [Department of Materials Science and Engineering, University of Texas at Dallas, Richardson, TX 75080 (United States); McCool, Geoffrey [Nanostellar Inc., 3696 Haven Avenue, Redwood City, CA 94063 (United States); Cho, Kyeongjae [Department of Materials Science and Engineering, University of Texas at Dallas, Richardson, TX 75080 (United States); Hsu, Julia W.P., E-mail: [Department of Materials Science and Engineering, University of Texas at Dallas, Richardson, TX 75080 (United States)


    Highlights: • Investigate the effects of calcination temperature and precipitation pH on crystallinity, phase purity, particle size, surface composition, and NO adsorption capacity of SmMn{sub 2}O{sub 5}. • High calcination temperature increases mullite phase purity but decreases specific surface area (SSA). • Mullite phase purity is independent of pH while SSA monotonically increases. • SSA and surface Mn/Sm ratio determine NO uptake. - Abstract: A mixed-phase compound that contains SmMn{sub 2}O{sub 5} mullite-type oxides has been reported to display excellent catalytic activity for nitric oxide (NO) oxidation. Here we investigate the effects of calcination temperature and precipitation pH on structural, physical, chemical, and surface properties of SmMn{sub 2}O{sub 5}. As the calcination temperature increases from 750 °C to 1000 °C, mullite phase purity increases from 74% to 100%, while specific surface area (SSA) decreases from 23.6 m{sup 2}/g to 5.1 m{sup 2}/g with particle size increases correspondingly. Mullite phase purity (87%) is independent of pH between 8.5–10.4, whereas SSA monotonically increases from 12.5 m{sup 2}/g at pH 8.1 to 27.4 m{sup 2}/g at pH 13. X-ray photoelectron spectroscopy (XPS) studies reveal that the surface Mn/Sm ratio is similar to the bulk value and is unaffected by calcination temperature and pH values up to 10.4, whereas sample precipitated at pH 13 is surface-rich in Sm. NO chemisorption studies show that the SSA and surface Mn/Sm ratio determine NO uptake by SmMn{sub 2}O{sub 5} mullite oxides.

  15. Systematic Sustainability Assessment (SSA) Tool for Hydroelectric Project in Malaysia (United States)

    Turan, Faiz Mohd; Johan, Kartina


    Sustainably developed and managed hydropower has enormous potential to contribute to global sustainability goals. It is known that hydroelectricity contributing small amounts to greenhouse gas emissions and other atmospheric pollutants. However, developing the remaining hydroelectric potential offers many challenges, and public pressure and expectations on the environmental and social performance of hydroelectric tend to increase over time. This paper aims to develop Systematic Sustainability Assessment (SSA) Tool that promotes and guides more sustainable hydroelectric projects in the context of Malaysia. The proposed SSA tool which not only provide a quality and quantitative report of sustainability performance but also act as Self-Assessment Report (SAR) to provide roadmap to achieve greater level of sustainability in project management for continuous improvement. It is expected to provide a common language that allow government, civil society, financial institutions and the hydroelectric sector to talk about and evaluate sustainability issues. The advantage of SSA tool is it can be used at any stage of hydroelectric development, from the earliest planning stages right through to operation.

  16. SMAPVEX12 Surface Roughness Data for Agricultural Area V001 (United States)

    National Aeronautics and Space Administration — This data set contains surface roughness data collected at several agricultural sites as a part of the Soil Moisture Active Passive Validation Experiment 2012...

  17. High-surface-area silica nanospheres (KCC-1) with a fibrous morphology

    KAUST Repository

    Polshettiwar, Vivek


    Fibrous nanosilica: A new family of high-surface-area silica nanospheres (KCC-1) have been prepared (see picture). KCC-1 features excellent physical properties, including high surface area, unprecedented fibrous surface morphology, high thermal (up to 950 °C) and hydrothermal stabilities, and high mechanical stability. Copyright © 2010 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Lung deposited surface area concentrations in a street canyon (United States)

    Kuuluvainen, Heino; Hietikko, Riina; Järvinen, Anssi; Saukko, Erkka; Irjala, Matti; Niemi, Jarkko V.; Timonen, Hilkka; Keskinen, Jorma; Rönkkö, Topi


    Street canyons are interesting environments with respect to the dispersion of traffic emissions and human exposure. Pedestrians may be exposed to relatively high concentrations of fine particles and the vertical dispersion affects the human exposure above the ground level in buildings. Previously, particle concentrations have been measured in street canyons at a few different heights (Marini et al., 2015). The information on the lung deposited surface area (LDSA) concentration, which is a relevant metric for the negative health effects, is very limited even at the ground level of street canyons (Kuuluvainen et al., 2016). More information especially on the vertical dispersion and the ground level concentrations is needed, for instance, for the use of urban planning and the design of ventilation systems in buildings. Measurements were carried out in a busy street canyon in Helsinki, Finland, at an urban super-site measurement station (Mäkelänkatu 50). The data included vertical concentration profiles measured in an intensive measurement campaign with a Partector (Naneos GmbH) installed into a drone, long-term measurements with an AQ Urban particle sensor (Pegasor Ltd.), and an extensive comparison measurement in the field with different devices measuring the LDSA. These devices were an AQ Urban, Partector, DiSCmini (Testo AG), NSAM (TSI Inc.), and an ELPI+ (Dekati Ltd.). In addition, continuous measurements of gas phase components, particle size distributions, and meteorology were run at the supersite. The vertical profile measurements were con-ducted in November 2016 during two days. In the measurements, the drone was flown from the ground level to an altitude of 50 or 100 m, which is clearly above the roof level of the buildings. Altogether, 48 up-and-down flights were conducted during the two days. The vertical profiles were supported by continuous measurements at the ground level on both sides of the street canyon. The long-term measurements were conducted

  19. Military Surface Grid Areas: Atlantic / Gulf of Mexico (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A regular pattern of polygons that represent arbitrary delineations of an Operating Area (OPAREA). The team worked with the Navy to provide this...

  20. 30 CFR 910.764 - Process for designating areas unsuitable for surface coal mining operations. (United States)


    ... surface coal mining operations. 910.764 Section 910.764 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR PROGRAMS FOR THE CONDUCT OF SURFACE MINING OPERATIONS WITHIN EACH STATE GEORGIA § 910.764 Process for designating areas unsuitable for surface coal mining...

  1. 30 CFR 937.764 - Process for designating areas unsuitable for surface coal mining operations. (United States)


    ... surface coal mining operations. 937.764 Section 937.764 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR PROGRAMS FOR THE CONDUCT OF SURFACE MINING OPERATIONS WITHIN EACH STATE OREGON § 937.764 Process for designating areas unsuitable for surface coal mining...

  2. 30 CFR 947.762 - Criteria for designating areas as unsuitable for surface coal mining operations. (United States)


    ... for surface coal mining operations. 947.762 Section 947.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations. ...

  3. 30 CFR 921.762 - Criteria for designating areas as unsuitable for surface coal mining operations. (United States)


    ... for surface coal mining operations. 921.762 Section 921.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mine operations. ...

  4. 30 CFR 922.764 - Process for designating areas unsuitable for surface coal mining operations. (United States)


    ... surface coal mining operations. 922.764 Section 922.764 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR PROGRAMS FOR THE CONDUCT OF SURFACE MINING OPERATIONS WITHIN EACH STATE MICHIGAN § 922.764 Process for designating areas unsuitable for surface coal mining...

  5. 30 CFR 942.764 - Process for designating areas unsuitable for surface coal mining operations. (United States)


    ... surface coal mining operations. 942.764 Section 942.764 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE TENNESSEE § 942.764 Process for designating areas unsuitable for surface coal mining... Mining Operations, shall apply to surface coal mining and reclamation operations. (b) The Secretary shall...

  6. 30 CFR 941.764 - Process for designating areas unsuitable for surface coal mining operations. (United States)


    ... surface coal mining operations. 941.764 Section 941.764 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR PROGRAMS FOR THE CONDUCT OF SURFACE MINING OPERATIONS WITHIN EACH STATE SOUTH DAKOTA § 941.764 Process for designating areas unsuitable for surface coal mining...

  7. 30 CFR 941.762 - Criteria for designating areas as unsuitable for surface coal mining operations. (United States)


    ... for surface coal mining operations. 941.762 Section 941.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mine operations. ...

  8. 30 CFR 939.764 - Process for designating areas unsuitable for surface coal mining operations. (United States)


    ... surface coal mining operations. 939.764 Section 939.764 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR PROGRAMS FOR THE CONDUCT OF SURFACE MINING OPERATIONS WITHIN EACH STATE RHODE ISLAND § 939.764 Process for designating areas unsuitable for surface coal mining...

  9. 30 CFR 933.762 - Criteria for designating areas as unsuitable for surface coal mining operations. (United States)


    ... for surface coal mining operations. 933.762 Section 933.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designation Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations. ...

  10. 30 CFR 939.762 - Criteria for designating areas as unsuitable for surface coal mining operations. (United States)


    ... for surface coal mining operations. 939.762 Section 939.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations. ...

  11. 30 CFR 905.762 - Criteria for designating areas as unsuitable for surface coal mining operations. (United States)


    ... for surface coal mining operations. 905.762 Section 905.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining operations. ...

  12. Surface albedo measurements in Mexico City metropolitan area

    Energy Technology Data Exchange (ETDEWEB)

    Castro, T; Mar, B; Longoria, R; Ruiz Suarez, L. G [Centro de Ciencias de la Atmosfera, UNAM, Mexico, D.F. (Mexico); Morales, L [Instituto de Geografia, UNAM, Mexico, D.F. (Mexico)


    Optical and thermal properties of soils are important input data for the meteorological and photochemical modules of air quality models. As development of these models increase on spatial resolution good albedo data become more important. In this paper measurements of surface albedo of UV (295-385 nm) and visible (450-550 nm) radiation are reported for different urban and rural surfaces in the vicinity of Mexico City. It was found for the downtown zone and average albedo value of 0.05 which is in very good agreement with reported values for urban surfaces. Our albedo values measured in UV region for grey cement and green grass are of 0.10 and 0.009, respectively, and quite similar to those found at the literature of 0.11 and 0.008 for those type of surfaces. [Spanish] Las propiedades opticas y termicas de suelos son datos importantes para los modulos meteorologicos y fotoquimicos de los modelos de calidad del aire. Conforme aumenta la resolucion espacial del modelo se vuelve mas importante contar con buenos datos de albedo. En este articulo se presentan mediciones de albedo superficial de radiacion Ultravioleta (295-385 nm) y visible (450-550 nm) para diferentes superficies urbanas. Los valores medidos de albedo en la region UV para cemento gris y pasto verde son de 0.10 y 0.009, respectivamente, y son muy similares a los reportados en la literatura, 0.11 y 0.008 para este tipo de superficies.

  13. Large Area Diamond Tribological Surfaces with Negligible Wear in Extreme Environments, Phase I (United States)

    National Aeronautics and Space Administration — In Phase I we propose to demonstrate the processing of very large area diamond sliding bearings and tribological surfaces. The bearings and surfaces will experience...

  14. Possibilities of surface waters monitoring at mining areas using UAV (United States)

    Lisiecka, Ewa; Motyka, Barbara; Motyka, Zbigniew; Pierzchała, Łukasz; Szade, Adam


    The selected, remote measurement methods are discussed, useful for determining surface water properties using mobile unmanned aerial platforms (UAV). The possibilities of using this type of solutions in the scope of measuring spatial, physicochemical and biological parameters of both natural and anthropogenic water reservoirs, including flood polders, water-filled pits, settling tanks and mining sinks were analyzed. Methods of remote identification of the process of overgrowing this type of ecosystems with water and coastal plant formations have also been proposed.

  15. The Effect of 200 MPa Pressure on Specific Surface Area of Clay

    Directory of Open Access Journals (Sweden)

    Koszela-Marek Ewa


    Full Text Available The paper presents the results of laboratory studies of the 200 MPa pressure effect on specific surface area of clay. The original high-pressure investigation stand was used for the pressure tests. Determination of the specific surface area was performed by the methylene blue adsorption method. The results of the specific surface area test were compared for non-pressurized clays and for clays pressured in a high-pressure chamber. It was found that the specific surface area of pressurized soil clearly increased. This shows that some microstructural changes take place in the soil skeleton of clays.

  16. Estimating the surface area of birds: using the homing pigeon (Columba livia) as a model. (United States)

    Perez, Cristina R; Moye, John K; Pritsos, Chris A


    Estimation of the surface area of the avian body is valuable for thermoregulation and metabolism studies as well as for assessing exposure to oil and other surface-active organic pollutants from a spill. The use of frozen carcasses for surface area estimations prevents the ability to modify the posture of the bird. The surface area of six live homing pigeons in the fully extended flight position was estimated using a noninvasive method. An equation was derived to estimate the total surface area of a pigeon based on its body weight. A pigeon's surface area in the fully extended flight position is approximately 4 times larger than the surface area of a pigeon in the perching position. The surface area of a bird is dependent on its physical position, and, therefore, the fully extended flight position exhibits the maximum area of a bird and should be considered the true surface area of a bird. © 2014. Published by The Company of Biologists Ltd | Biology Open.

  17. Comparison of diffusion charging and mobility-based methods for measurement of aerosol agglomerate surface area. (United States)

    Ku, Bon Ki; Kulkarni, Pramod


    We compare different approaches to measure surface area of aerosol agglomerates. The objective was to compare field methods, such as mobility and diffusion charging based approaches, with laboratory approach, such as Brunauer, Emmett, Teller (BET) method used for bulk powder samples. To allow intercomparison of various surface area measurements, we defined 'geometric surface area' of agglomerates (assuming agglomerates are made up of ideal spheres), and compared various surface area measurements to the geometric surface area. Four different approaches for measuring surface area of agglomerate particles in the size range of 60-350 nm were compared using (i) diffusion charging-based sensors from three different manufacturers, (ii) mobility diameter of an agglomerate, (iii) mobility diameter of an agglomerate assuming a linear chain morphology with uniform primary particle size, and (iv) surface area estimation based on tandem mobility-mass measurement and microscopy. Our results indicate that the tandem mobility-mass measurement, which can be applied directly to airborne particles unlike the BET method, agrees well with the BET method. It was also shown that the three diffusion charging-based surface area measurements of silver agglomerates were similar within a factor of 2 and were lower than those obtained from the tandem mobility-mass and microscopy method by a factor of 3-10 in the size range studied. Surface area estimated using the mobility diameter depended on the structure or morphology of the agglomerate with significant underestimation at high fractal dimensions approaching 3.

  18. Assessment of large aperture scintillometry for large-area surface ...

    Indian Academy of Sciences (India)


    This study defines that large aperture scintillometer is robust instrument which can evaluate energy flux over a large area with a long term series time domain. Moreover, further studied should be conducted to use in crop simulation modelling, developing of new model with calibration and validation of remote sensing energy ...

  19. Production characteristics of lettuce Lactuca sativa L. in the frame of the first crop tests in the Higher Plant Chamber integrated into the MELiSSA Pilot Plant (United States)

    Tikhomirova, Natalia; Lawson, Jamie; Stasiak, Michael; Dixon, Mike; Paille, Christel; Peiro, Enrique; Fossen, Arnaud; Godia, Francesc

    Micro-Ecological Life Support System Alternative (MELiSSA) is an artificial closed ecosystem that is considered a tool for the development of a bioregenerative life support system for manned space missions. One of the five compartments of MELiSSA loop -Higher Plant Chamber was recently integrated into the MELiSSA Pilot Plant facility at Universitat Aut`noma deo Barcelona. The main contributions expected by integration of this photosynthetic compartment are oxygen, water, vegetable food production and CO2 consumption. Production characteristics of Lactuca sativa L., as a MELiSSA candidate crop, were investigated in this work in the first crop experiments in the MELiSSA Pilot Plant facility. The plants were grown in batch culture and totaled 100 plants with a growing area 5 m long and 1 m wide in a sealed controlled environment. Several replicates of the experiments were carried out with varying duration. It was shown that after 46 days of lettuce cultivation dry edible biomass averaged 27, 2 g per plant. However accumulation of oxygen in the chamber, which required purging of the chamber, and decrease in the food value of the plants was observed. Reducing the duration of the tests allowed uninterrupted test without opening the system and also allowed estimation of the crop's carbon balance. Results of productivity, tissue composition, nutrient uptake and canopy photosynthesis of lettuce regardless of test duration are discussed in the paper.

  20. Tritium in Precipitation, Surface and Groundwaters in the Zagreb Area

    International Nuclear Information System (INIS)

    Horvatincic, N.; Baresic, J.; Sironic, A.; Krajcar Bronic, I.; Obelic, B.


    Radioactive isotope tritium (3H) and stable isotopes of hydrogen (2H/1H) and oxygen (18O/16O) were measured in Sava River, precipitation and groundwater at 3 monitoring wells (piezometers) and 1 production well of the Petrusevec aquifer, close to the Sava River. Samples were collected monthly during 2010. The investigation is included in the Regional IAEA Project RER/8/016 Using Environmental Isotopes for Evaluation of Streamwater/Groundwater Interactions in Selected Aquifers in the Danube Basin. Sava River is a tributary of Danube River and the aim of the investigation is to determine the influence of surface stream of Sava River to the groundwater of aquifer used for water exploitation. In this work only 3H results were presented. 3H was measured by liquid scintillation counter Quantulus 1220, using electrolytic enrichment for all samples. 3H activity in precipitation showed slight seasonal fluctuation between 4 TU and 14 TU, with higher values in summer. 3H activity of Sava River and groundwater of the Petrusevec aquifer followed 3H of precipitation till May 2010. Significant increase of 3H in Sava River was observed in June, (199 @ 20) TU, and in the next month it fell down at 6 TU. Increase of 3H was also observed in groundwater but with damped response (maximum 60 TU) and with delay of 2 - 3 months related to Sava River. Different response of different piezometers and the well indicated the different infiltration times of surface water of Sava River to groundwater of the Petrusevec aquifer. The increased 3H activity in surface and groundwaters was caused by release of tritiated water from the Krsko Nuclear Power Plant, 30 km upstream from Zagreb. The results of 3H, 2H/1H and 18O/16O measurements will be used to determine the infiltration time of groundwater of the Petrusevec aquifer using conceptual and mathematical models. (author)

  1. ESA's SSA Programme: Activities in Space Surveillance and Tracking (United States)

    Flohrer, T.; Krag, H.

    Today, satellites and space-based systems are indispensable for the provision of critical services. Understanding and forecasting the space environment, especially space weather, near-Earth objects, and the population of space debris is needed to protect our space-based infrastructure. The rapidly growing number of smaller satellites and maturing plans for deploying large constellations of satellites further increase the need for reliable and timely information on the space object population. Since 2009 the European Space Agency (ESA) has been undertaking an Space Situational Awareness (SSA) Program with three segments Space Weather (SWE), Near Earth Objects (NEO) and Space Surveillance and Tracking (SST). Period 3 of the program has been approved at the ESA Ministerial Council in December 2016 for a 3-year period starting 2017. A total of 19 member states of ESA participate in the SSA program, of which 11 subscribed to the SST segment. In SST, the development of the technologies for detection, cataloguing and follow-up of space objects, and of the derived applications for conjunction event prediction, re-entry predictions, and fragmentation event detection are considered as the first important steps towards an European SST capability. To achieve this goal, ESA is focusing on research and development, supporting national initiatives, and staying complementary with other European approaches in SST. It is expected that in Europe a demand for larger, cross-national SST components and technology developments arises to ensure interoperability of systems. Examples of planned activities are space-based SST sensors, processing software, facilitating data exchange mechanisms, and common data processing techniques and formats. With the activities of the SSA program ESA’s expertise will be further exploited in supporting the research, development, and coordination of space-related technologies in a multinational environment, and in assessing and maturing the relevant

  2. On application of the SSA method in the pulsating combustion studies (United States)

    Berg, I. A.; Porshnev, S. V.; Oshchepkova, V. Y.


    Pulsating combustion is among combustion control methods used to suppress formation of NOx. An upgraded automatic setup with a direct gas injection burner was used for pulsating torch studies. Experiments resulted in obtaining time series of torch area changing in longitudinal section. Singular Spectral Analysis method (SSA) upgraded to allow for choosing the size of the window was used. Spectra of the extracted components of the time series demonstrate that they contain periodic components that match the fuel supply valve on/off cycle frequency. When increasing the control frequency the spectrum of the extracted component of the time series gets broader. With further frequency increase, the spectrum approaches that of no control action and the system operates in quasi-continuous mode. The results correspond to the results obtained earlier through the spectrum analysis that confirms the phenomenon of periodic change of the torch core area in the longitudinal section under pulsating supply of fuel.

  3. Large area optical mapping of surface contact angle. (United States)

    Dutra, Guilherme; Canning, John; Padden, Whayne; Martelli, Cicero; Dligatch, Svetlana


    Top-down contact angle measurements have been validated and confirmed to be as good if not more reliable than side-based measurements. A range of samples, including industrially relevant materials for roofing and printing, has been compared. Using the top-down approach, mapping in both 1-D and 2-D has been demonstrated. The method was applied to study the change in contact angle as a function of change in silver (Ag) nanoparticle size controlled by thermal evaporation. Large area mapping reveals good uniformity for commercial Aspen paper coated with black laser printer ink. A demonstration of the forensic and chemical analysis potential in 2-D is shown by uncovering the hidden CsF initials made with mineral oil on the coated Aspen paper. The method promises to revolutionize nanoscale characterization and industrial monitoring as well as chemical analyses by allowing rapid contact angle measurements over large areas or large numbers of samples in ways and times that have not been possible before.

  4. BLM National Surface Management Agency: Area Polygons, Withdrawal Area Polygons, and Special Public Purpose Withdrawal Area Polygons (United States)

    Federal Geographic Data Committee — The SMA implementation is comprised of one feature dataset, with several polygon feature classes, rather than a single feature class. SurfaceManagementAgency: The...

  5. Cyclic Brunn-Minkowski Inequalities for p -affine surface area | Zhao ...

    African Journals Online (AJOL)

    In 2010, Werner and Ye extended the denition for mixed p-affine surface area to all real numbers p. Following this, we establish some isoperimetric inequalities for the general mixed p-affine surface area. The results in special cases yield some of the recent results on inequalities of this type. Mathematics Subject ...

  6. 30 CFR 933.761 - Areas designated unsuitable for surface coal mining by Act of Congress. (United States)


    ... WITHIN EACH STATE NORTH CAROLINA § 933.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated Unsuitable for Coal Mining by Act of Congress, with the exception of §§ 761.11(c) and 761.12(f)(1), shall apply to surface coal mining and reclamation...

  7. Surface and subsurface conditions in permafrost areas - a literature review

    International Nuclear Information System (INIS)

    Vidstrand, Patrik


    This report contains a summary of some of the information within existing technical and scientific literature on permafrost. Permafrost is viewed as one of the future climate driven process domains that may exist in Scandinavia, and that may give rise to significantly different surface and subsurface conditions than the present. Except for changes in the biosphere, permafrost may impact hydraulic, mechanical, and chemical subsurface processes and conditions. Permafrost and its influences on the subsurface conditions are thus of interest for the performance and safety assessments of deep geological waste repositories. The definition of permafrost is 'ground that stays at or below 0 deg C for at least two consecutive years'. Permafrost will effect the geological subsurface to some depth. How deep the permafrost may grow is a function of the heat balance, thermal conditions at the surface and within the ground, and the geothermal heat flux from the Earth's inner parts. The main chapters of the report summaries the knowledge on permafrost evolution, occurrence and distribution, and extracts information concerning hydrology and mechanical and chemical impacts due to permafrost related conditions. The results of a literature review are always dependent on the available literature. Concerning permafrost there is some literature available from investigations in the field of long-term repositories and some from mining industries. However, reports of these investigations are few and the bulk of permafrost literature comes from the science departments concerned with surficial processes (e.g. geomorphology, hydrology, agriculture, etc) and from engineering concerns, such as foundation of constructions and pipeline design. This focus within the permafrost research inevitably yields a biased but also an abundant amount of information on localised surficial processes and a limited amount on regional and deep permafrost characteristics. Possible conclusions are that there is

  8. Surface and subsurface conditions in permafrost areas - a literature review

    Energy Technology Data Exchange (ETDEWEB)

    Vidstrand, Patrik [Bergab, Goeteborg (Sweden)


    This report contains a summary of some of the information within existing technical and scientific literature on permafrost. Permafrost is viewed as one of the future climate driven process domains that may exist in Scandinavia, and that may give rise to significantly different surface and subsurface conditions than the present. Except for changes in the biosphere, permafrost may impact hydraulic, mechanical, and chemical subsurface processes and conditions. Permafrost and its influences on the subsurface conditions are thus of interest for the performance and safety assessments of deep geological waste repositories. The definition of permafrost is 'ground that stays at or below 0 deg C for at least two consecutive years'. Permafrost will effect the geological subsurface to some depth. How deep the permafrost may grow is a function of the heat balance, thermal conditions at the surface and within the ground, and the geothermal heat flux from the Earth's inner parts. The main chapters of the report summaries the knowledge on permafrost evolution, occurrence and distribution, and extracts information concerning hydrology and mechanical and chemical impacts due to permafrost related conditions. The results of a literature review are always dependent on the available literature. Concerning permafrost there is some literature available from investigations in the field of long-term repositories and some from mining industries. However, reports of these investigations are few and the bulk of permafrost literature comes from the science departments concerned with surficial processes (e.g. geomorphology, hydrology, agriculture, etc) and from engineering concerns, such as foundation of constructions and pipeline design. This focus within the permafrost research inevitably yields a biased but also an abundant amount of information on localised surficial processes and a limited amount on regional and deep permafrost characteristics. Possible conclusions are that

  9. Target surface area effects on hot electron dynamics from high intensity laser-plasma interactions (United States)

    Zulick, C.; Raymond, A.; McKelvey, A.; Chvykov, V.; Maksimchuk, A.; Thomas, A. G. R.; Willingale, L.; Yanovsky, V.; Krushelnick, K.


    Reduced surface area targets were studied using an ultra-high intensity femtosecond laser in order to determine the effect of electron sheath field confinement on electron dynamics. X-ray emission due to energetic electrons was imaged using a {K}α imaging crystal. Electrons were observed to travel along the surface of wire targets, and were slowed mainly by the induced fields. Targets with reduced surface areas were correlated with increased hot electron densities and proton energies. Hybrid Vlasov-Fokker-Planck simulations demonstrated increased electric sheath field strength in reduced surface area targets.

  10. Measurement of the specific surface area of loose copper deposit by electrochemical methods

    Directory of Open Access Journals (Sweden)

    E. A. Dolmatova


    Full Text Available In the work the surface area of the electrode with dispersed copper deposit obtained within 30 seconds was evaluated by techniques of chronopotentiometry (CPM and impedance spectroscopy. In method CPM the electrode surface available for measurement depends on the value of the polarizing current. At high currents during the transition time there is a change of surface relief that can not determine the full surface of loose deposit. The electrochemical impedance method is devoid of this shortcoming since the measurements are carried out in indifferent electrolyte in the absence of current. The area measured by the impedance is tens of times higher than the value obtained by chronopotentiometry. It is found that from a solution containing sulfuric acid the deposits form with a high specific surface area. Based on these data it was concluded that the method of impedance spectroscopy can be used to measure in situ the surface area of the dispersed copper deposits.

  11. The protection of urban areas from surface wastewater pollutions

    Directory of Open Access Journals (Sweden)

    Vialkova Elena


    Full Text Available In this paper it considered the problem of collection, treatment and discharge into waters of rain and melted wastewater. To reduce the load on the combined sewer system, there are engineering solutions collect rain and melt water for use in the irrigation of lawns and green spaces. Research carried out at the department “Water supply and sanitation”, (Russia, confirm the high pollution concentrations of meltwater and rainfall in urban arias. Series of measurements of heavy metal in rainwater runoff carried out in Hungary demonstrates clearly the differences in concentrations in the function of distance from the edge of the road. Also differences are introduced between pollution concentrations in runoff water from within and outside urban traffic roads. The quality of snow cover, forming meltwater is observed to be changing in dependence on roadway location. Quality characteristics of surface runoff and its sediments can be effectively improved with super-high frequency radiation (SHF treatment which is presented in this paper.

  12. 30 CFR 905.764 - Process for designating areas unsuitable for surface coal mining operations. (United States)


    ... surface coal mining operations. 905.764 Section 905.764 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE CALIFORNIA § 905.764 Process for designating areas unsuitable for surface coal mining... coal mining operations beginning one year after the effective date of this program. ...

  13. 30 CFR 947.764 - Process for designating areas unsuitable for surface coal mining operations. (United States)


    ... surface coal mining operations. 947.764 Section 947.764 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE WASHINGTON § 947.764 Process for designating areas unsuitable for surface coal mining... coal mining and reclamation operations. (b) The Secretary shall notify the Washington Department of...

  14. 30 CFR 903.764 - Process for designating areas unsuitable for surface coal mining operations. (United States)


    ... surface coal mining operations. 903.764 Section 903.764 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE ARIZONA § 903.764 Process for designating areas unsuitable for surface coal mining... coal mining operations beginning June 24, 1996, one year after the effective date of this program. ...

  15. BOREAS TE-1 SSA-Fen Soil Profile Nutrient Data (United States)

    Papagno, Andrea; Anderson, Darwin; Newcomer, Jeffrey A. (Editor); Hall, Forrest G. (Editor)


    The BOREAS TE-1 team collected various data to characterize the soil-plant systems in the BOREAS SSA. Particular emphasis was placed on nutrient biochemistry, the stores and transfers of organic carbon, and how the characteristics were related to measured methane fluxes. The overall traniect in the Prince Albert National Park (Saskatchewan, Canada) included the major plant communities and related soils that occurred in that section of the boreal forest. Soil physical, chemical, and biological measurements along the transect were used to characterize the static environment, which allowed them to be related to methane fluxes. Chamber techniques were used to provide a measure of methane production/uptake. Chamber measurements coupled with flask sampling were used to determine the seasonality of methane fluxes. This particular data set contains soil profile measurements of various nutrients at the SSA-Fen site. The data were collected from 23-May to 21-Oct- 1994. The data are stored in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  16. Surface Area, and Oxidation Effects on Nitridation Kinetics of Silicon Powder Compacts (United States)

    Bhatt, R. T.; Palczer, A. R.


    Commercially available silicon powders were wet-attrition-milled from 2 to 48 hr to achieve surface areas (SA's) ranging from 1.3 to 70 sq m/g. The surface area effects on the nitridation kinetics of silicon powder compacts were determined at 1250 or 1350 C for 4 hr. In addition, the influence of nitridation environment, and preoxidation on nitridation kinetics of a silicon powder of high surface area (approximately equals 63 sq m/g) was investigated. As the surface area increased, so did the percentage nitridation after 4 hr in N2 at 1250 or 1350 C. Silicon powders of high surface area (greater than 40 sq m/g) can be nitrided to greater than 70% at 1250 C in 4 hr. The nitridation kinetics of the high-surface-area powder compacts were significantly delayed by preoxidation treatment. Conversely, the nitridation environment had no significant influence on the nitridation kinetics of the same powder. Impurities present in the starting powder, and those accumulated during attrition milling, appeared to react with the silica layer on the surface of silicon particles to form a molten silicate layer, which provided a path for rapid diffusion of nitrogen and enhanced the nitridation kinetics of high surface area silicon powder.

  17. Environmental and geochemical assessment of surface sediments on irshansk ilmenite deposit area

    Directory of Open Access Journals (Sweden)

    Наталия Олеговна Крюченко


    Full Text Available It is revealed the problem of pollution of surface sediments of Irshansk ilmenite deposit area of various chemical elements hazard class (Mn, V, Ba, Ni, Co, Cr, Mo, Cu, Pb, Zn. It is determined its average content in surface sediments of various functional areas (forest and agricultural land, flood deposits, reclaimed land, calculated geochemical criteria, so given ecological and geochemical assessment of area

  18. Changes in the Surface Area of Glaciers in Northern Eurasia (United States)

    Khromova, T.; Nosenko, G.


    Glaciers are widely recognized as key indicators of climate change. Recent evidence suggests an acceleration of glacier mass loss in several key mountain regions. Glacier recession implies the landscape changes in the glacial zone, origin of new lakes and activation of natural disaster processes, catastrophic mudflows, ice avalanches, outburst floods, and etc. The presence of glaciers in itself threats to human life, economic activity and growing infrastructure. Economical and recreational human activity in mountain regions requires relevant information on snow and ice objects. Absence or inadequacy of such information results in financial and human losses. A more comprehensive evaluation of glacier changes is imperative to assess ice contributions to global sea level rise and the future of water resources from glacial basins. One of the urgent steps is a full inventory of all ice bodies, their volume and changes The first estimation of glaciers state and glaciers distribution in the big part of Northern Eurasia has been done in the USSR Glacier Inventory published in 1966 -1980 as a part of IHD activity. The Inventory is based on topographic maps and air photos and reflects the status of the glaciers in 1957-1970y. There is information about 23796 glaciers with area of 78222.3 km2 in the Inventory. It covers 23 glacier systems on Northern Eurasia. In the 80th the USSR Glacier Inventory has been transformed in the digital form as a part of the World Glacier Inventory. Recent satellite data provide a unique opportunity to look again at these glaciers and to evaluate changes in glacier extent for the second part of XX century. In the paper we report about 15 000 glaciers outlines for Caucasus, Pamir, Tien-Shan, Altai, Syntar-Khayata, Cherskogo Range, Kamchatka and Russian Arctic which have been derived from ASTER and Landsat imagery and could be used for glacier changes evaluation. The results show that glaciers are retreating in all these regions. There is, however

  19. Development of cortical thickness and surface area in autism spectrum disorder

    Directory of Open Access Journals (Sweden)

    Vincent T. Mensen


    Full Text Available Autism spectrum disorder (ASD is a neurodevelopmental disorder often associated with changes in cortical volume. The constituents of cortical volume – cortical thickness and surface area – have separable developmental trajectories and are related to different neurobiological processes. However, little is known about the developmental trajectories of cortical thickness and surface area in ASD. In this magnetic resonance imaging (MRI study, we used an accelerated longitudinal design to investigate the cortical development in 90 individuals with ASD and 90 typically developing controls, aged 9 to 20 years. We quantified cortical measures using the FreeSurfer software package, and then used linear mixed model analyses to estimate the developmental trajectories for each cortical measure. Our primary finding was that the development of surface area follows a linear trajectory in ASD that differs from typically developing controls. In typical development, we found a decline in cortical surface area between the ages of 9 and 20 that was absent in ASD. We found this pattern in all regions where developmental trajectories for surface area differed between groups. When we applied a more stringent correction that takes the interdependency of measures into account, this effect on cortical surface area retained significance for left banks of superior temporal sulcus, postcentral area, and right supramarginal area. These areas have previously been implicated in ASD and are involved in the interpretation and processing of audiovisual social stimuli and distinction between self and others. Although some differences in cortical volume and thickness were found, none survived the more stringent correction for multiple testing. This study underscores the importance of distinguishing between cortical surface area and thickness in investigating cortical development, and suggests the development of cortical surface area is of importance to ASD.

  20. Specific surface area of a crushed welded tuff before and after aqueous dissolution (United States)

    Reddy, M.M.; Claassen, H.C.


    Specific surface areas were measured for several reference minerals (anorthoclase, labradorite and augite), welded tuff and stream sediments from Snowshoe Mountain, near Creede, Colorado. Crushed and sieved tuff had an unexpectedly small variation in specific surface area over a range of size fractions. Replicate surface area measurements of the largest and smallest tuff particle size fractions examined (1-0.3 mm and <0.212 mm) were 2.3 ?? 0.2 m2/g for each size fraction. Reference minerals prepared in the same way as the tuff had smaller specific surface areas than that of the tuff of the same size fraction. Higher than expected tuff specific surface areas appear to be due to porous matrix. Tuff, reacted in solutions with pH values from 2 to 6, had little change in specific surface area in comparison with unreacted tuff. Tuff, reacted with solutions having high acid concentrations (0.1 M hydrochloric acid or sulfuric-hydrofluoric acid), exhibited a marked increase in specific surface area compared to unreacted tuff. ?? 1994.

  1. Effect of specific surface area of MWCNTS on surface roughness and delamination in drilling Epoxy/Glass Fabric Composite (United States)

    Ponnuvel, S.; Ananth, M. Prem


    In this study the effect of specific surface area of the MWCNTs on the drilled hole qualities was investigated. Epoxy araldite LY556 with hardener HY951 and E-glass coarse plain weave fabric are used for the fabrication of reference material (specimen A). Multi-WalledCarbon Nanotubes (MWCNTs) with diameters fabrication of study materials, namely specimen B and specimen C respectively. In specimen B the epoxy resin was filled with MWCNTs having a specific surface area >500 m2 g‑1. MWCNTs in specimen C had a specific surface area >110 m2 g‑1. Drilling experiments were conducted on all the three specimens. Two dimensional delamination factor and the surface roughness of the inner wall of the drilled holes were investigated using Grey Relational Analysis (GRA) and Analysis of variance (ANOVA). Two dimensional delamination factor showed better performance from specimen B and specimen C in comparison with specimen A suggesting improvement in the bonding between epoxy and the glass fiber in the presence of MWCNTs. Similar observations were made for surface roughness of the inner wall of the drilled holes at 1250 rpm. Whereas the presence of MWCNTs (Specimen B and specimen C) produced poor surface finish at 500 rpm in comparison with specimen A. Variations in the hole quality characteristics between specimen B and specimen C was marginal with better observations in specimen C.

  2. Large-area electromagnetic enhancement by a resonant excitation of surface waves on a metallic surface with periodic subwavelength patterns. (United States)

    Zhang, Xin; Liu, Haitao; Zhong, Ying


    We theoretically investigate the electromagnetic enhancement on a metallic surface patterned with periodic subwavelength structures. Fully-vectorial calculations show a large-area electromagnetic enhancement (LAEE) on the surface, which strongly contrasts with the previously reported "hot spots" that occur in specific tiny regions and which relieves the rigorous requirement of the nano-scale location of sample molecules. The LAEE allows for designing more practicable substrates for many enhanced-spectra applications. By building up microscopic models, the LAEE is shown due to a resonant excitation of surface waves that include both the surface plasmon polariton (SPP) and a quasi-cylindrical wave (QCW). The surface waves propagate on the substrate over a long distance and thus greatly enlarge the area of electromagnetic enhancement compared to the nano-sized hot spots caused by localized modes. Gain medium is introduced to further strengthen the large-area surface-wave resonance, with which an enhancement factor (EF) of electric-field intensity up to a few thousands is achieved.

  3. MELiSSA Food Characterization general approach and current status (United States)

    Weihreter, Martin; Chaerle, Laury; Secco, Benjamin; Molders, Katrien; van der Straeten, Dominique; Duliere, Eric; Pieters, Serge; Maclean, Heather; Dochain, Denis; Quinet, Muriel; Lutts, Stanley; Graham, Thomas; Stasiak, Michael; Rondeau Vuk, Theresa; Zheng, Youbin; Dixon, Mike; Laniau, Martine; Larreture, Alain; Timsit, Michel; Aronne, Giovanna; Barbieri, Giancarlo; Buonomo, Roberta; Veronica; Paradiso, Roberta; de Pascale, Stafania; Galbiati, Massimo; Troia, A. R.; Nobili, Matteo; Bucchieri, Lorenzo; Page, Valérie; Feller, Urs; Lasseur, Christophe

    Higher plants play an important role in closed ecological life support systems as oxygen pro-ducers, carbon dioxide and water recyclers, and as a food source. For an integration of higher plant chambers into the MELiSSA (Micro Ecological Life Support System Alternative) loop, a detailed characterization and optimization of the full food production and preparation chain is needed. This implies the prediction and control of the nutritional quality of the final products consumed by the crew, the prediction of the wastes quality and quantity produced along the chain for further waste treatment (MELiSSA waste treatment) and the optimization of overall efficiencies. To reach this goal several issues have to be studied in an integrated manner: the physiological responses of crops to a range of environmental parameters, crop yield efficiencies and respective ratio and composition of edible and inedible biomass, the processability and storability of the produced food and last but not least composition of wastes in view of further degradation (fiber content). Within the Food Characterization (FC) project several compar-ative plant growth bench tests were carried out to obtain preliminary data regarding these aspects. Four pre-selected cultivars of each of the four energy-rich crops with worldwide usage -wheat, durum wheat, potato and soybean -were grown under well-characterized environmental conditions. The different cultivars of each species are screened for their performance in view of a closed loop application by parameter ranking. This comprises the characterization of edi-ble/inedible biomass ratio, nutritional quality, processability and overall performance under the specific conditions of hydroponic cultivation and artificial illumination. A second closely linked goal of the FC project is to develop a mechanistic physiological plant model, which will ease the integration of higher plants compartments in the MELiSSA concept by virtue of its predictive abilities

  4. Human Decision Processes: Implications for SSA Support Tools (United States)

    Picciano, P.


    Despite significant advances in computing power and artificial intelligence (AI), few critical decisions are made without a human decision maker in the loop. Space Situational Awareness (SSA) missions are both critical and complex, typically adhering to the human-in-the-loop (HITL) model. The collection of human operators injects a needed diversity of expert knowledge, experience, and authority required to successfully fulfill SSA tasking. A wealth of literature on human decision making exists citing myriad empirical studies and offering a varied set of prescriptive and descriptive models of judgment and decision making (Hastie & Dawes, 2001; Baron, 2000). Many findings have been proven sufficiently robust to allow information architects or system/interface designers to take action to improve decision processes. For the purpose of discussion, these concepts are bifurcated in two groups: 1) vulnerabilities to mitigate, and 2) capabilities to augment. These vulnerabilities and capabilities refer specifically to the decision process and should not be confused with a shortcoming or skill of a specific human operator. Thus the framing of questions and orders, the automated tools with which to collaborate, priming and contextual data, and the delivery of information all play a critical role in human judgment and choice. Evaluating the merits of any decision can be elusive; in order to constrain this discussion, ‘rational choice' will tend toward the economic model characteristics such as maximizing utility and selection consistency (e.g., if A preferred to B, and B preferred to C, than A should be preferred to C). Simple decision models often encourage one to list the pros and cons of a decision, perhaps use a weighting schema, but one way or another weigh the future benefit (or harm) of making a selection. The result (sought by the rationalist models) should drive toward higher utility. Despite notable differences in researchers' theses (to be discussed in the full

  5. Rapid fabrication of large-area, corrosion-resistant superhydrophobic Mg alloy surfaces. (United States)

    Xu, Wenji; Song, Jinlong; Sun, Jing; Lu, Yao; Yu, Ziyuan


    A superhydrophobic magnesium (Mg) alloy surface was successfully fabricated via a facile electrochemical machining process, and subsequently covered with a fluoroalkylsilane (FAS) film. The surface morphologies and chemical compositions were investigated using a scanning electron microscope (SEM) equipped with an energy-dispersive spectroscopy (EDS) and a Fourier-transform infrared spectrophotometer (FTIR). The results show hierarchal rough structures and an FAS film with a low surface energy on the Mg alloy surfaces, which confers good superhydrophobicity with a water contact angle of 165.2° and a water tilting angle of approximately 2°. The processing conditions, such as the processing time and removal rate per unit area at a constant removal mass per unit area, were investigated to determine their effects on the superhydrophobicity. Interestingly, when the removal mass per unit area is constant at approximately 11.10 mg/cm(2), the superhydrophobicity does not change with the removal rate per unit area. Therefore, a superhydrophobic Mg alloy surface can be rapidly fabricated based on this property. A large-area superhydrophobic Mg alloy surface was also fabricated for the first time using a small-area moving cathode. The corrosion resistance and durability of the superhydrophobic surfaces were also examined.

  6. Relationship between Mineral Soil Surface Area and the Biological Degradation of Biosolids Added to Soil

    Directory of Open Access Journals (Sweden)

    Dongqi Wen


    Full Text Available Geochemical and biological processes that operate in the soil matrix and on the soil surface are important to the degradation of biosolids in soil. Due to the large surface area of soils it is assumed that the microbial ecology is associated with mineral soil surface area. The total mineral surface areas were determined for soils from eight different fields selected from a long term study (1972–2006 of annual biosolids application to 41 fields in central Illinois varying in size from 3.6 to 66 ha. The surface areas for the soils varied from 1 to 9 m2/g of soil. The biological degradation rates for the eight soils were determined using a biological degradation rate model (DRM and varied from 0.02 to 0.20/year−1. Regression analysis revealed that the degradation rate was positively associated with mineral soil surface area (1 m2/g produces 0.018 year−1 increase in the degradation rate. The annual soil sequestration rate was calculated to increase from 1% to 6% when the soil total surface area increased from 1 to 9 m2/g of soil. Therefore, land application of biosolids is an effective way to enhance carbon sequestration in soils and reduce greenhouse gas emissions.

  7. Comparative analysis of surface soil moisture retrieval using VSWI and TVDI in karst areas (United States)

    Yan, Hongbo; Zhou, Guoqing; Lu, Xianjian


    Vegetation Supply Water Index (VSWI) and Temperature Vegetation dryness Index (TVDI) are two most commonly used methods for surface soil moisture (SSM) retrieval using electromagnetic spectrum of visible, near infrared and thermal infrared band. Both of them take into account the effect of vegetation index (VI) and surface temperature (Ts) on SSM. A comparative analysis of the ability and effect of the two methods for SSM retrieval in karst areas was carried out, using the remote sensing data of Landsat 8 OLI_TIRS. The study area is located in Guilin, which is a typical karst area. The experimental results show that TVDI is more suitable for SSM retrieval in karst areas.

  8. Influence of Ecological Factors on Estimation of Impervious Surface Area Using Landsat 8 Imagery

    Directory of Open Access Journals (Sweden)

    Yuqiu Jia


    Full Text Available Estimation of impervious surface area is important to the study of urban environments and social development, but surface characteristics, as well as the temporal, spectral, and spatial resolutions of remote sensing images, influence the estimation accuracy. To investigate the effects of regional environmental characteristics on the estimation of impervious surface area, we divided China into seven sub-regions based on climate, soil type, feature complexity, and vegetation phenology: arid and semi-arid areas, Huang-Huai-Hai winter wheat production areas, typical temperate regions, the Pearl River Delta, the middle and lower reaches of the Yangtze River, typical tropical and subtropical regions, and the Qinghai Tibet Plateau. Impervious surface area was estimated from Landsat 8 images of five typical cities, including Yinchuan, Shijiazhuang, Shenyang, Ningbo, and Kunming. Using the linear spectral unmixing method, impervious and permeable surface areas were determined at the pixel-scale based on end-member proportions. We calculated the producer’s accuracy, user’s accuracy, and overall accuracy to assess the estimation accuracy, and compared the accuracies among images acquired from different seasons and locations. In tropical and subtropical regions, vegetation canopies can confound the identification of impervious surfaces and, thus, images acquired in winter, early spring, and autumn are most suitable; estimations in the Pearl River Delta, the middle and lower reaches of the Yangtze River are influenced by soil, vegetation phenology, vegetation canopy, and water, and images acquired in spring, summer, and autumn provide the best results; in typical temperate areas, images acquired from spring to autumn are most effective for estimations; in winter wheat-growing areas, images acquired throughout the year are suitable; and in arid and semi-arid areas, summer and early autumn, during which vegetation is abundant, are the optimal seasons for

  9. 20 CFR 411.330 - How will SSA evaluate an EN's performance? (United States)


    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false How will SSA evaluate an EN's performance? 411.330 Section 411.330 Employees' Benefits SOCIAL SECURITY ADMINISTRATION THE TICKET TO WORK AND SELF-SUFFICIENCY PROGRAM Employment Networks § 411.330 How will SSA evaluate an EN's performance? (a) We will...

  10. 77 FR 43639 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA... (United States)


    ...)/Department of Veterans Affairs (VA), Veterans Benefits Administration (VBA))--Match Number 1008 AGENCY: SSA... of an existing computer matching program that we are currently conducting with VA/VBA. DATES: We will... Benefits Administration (VBA) A. Participating Agencies SSA and VA/VBA. B. Purpose of the Matching Program...

  11. 77 FR 54943 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA... (United States)


    ...)/Department of Veterans Affairs (VA), Veterans Benefits Administration (VBA))--Match Number 1309 AGENCY: SSA... of an existing computer matching program that we are currently conducting with VA/VBA. DATES: We will... Benefits Administration (VBA). A. Participating Agencies SSA and VA/VBA. B. Purpose of the Matching Program...

  12. Isolated anti-Ro/SSA thrombocytopenia: a rare feature of neonatal ...

    African Journals Online (AJOL)

    We report a rare case of isolated thrombocytopenia related to anti-Ro/SSA antibodies. The mother was followed for unlabeled familial thrombocytopenia. The mother had positive anti-Ro/SSA antibodies. She was asymptomatic without skin lesions or other criteria neither of systemic lupus erythematosus nor other connective ...

  13. CLPX-Satellite: EO-1 Hyperion Surface Reflectance, Snow-Covered Area, and Grain Size (United States)

    National Aeronautics and Space Administration — This data set consists of apparent surface reflectance, subpixel snow-covered area and grain size collected from the Hyperion hyperspectral imager. The Hyperion...

  14. Interdependence between body surface area and ultraviolet B dose in vitamin D production

    DEFF Research Database (Denmark)

    Bogh, M K B; Schmedes, Anne; Philipsen, P A


    Ultraviolet (UV) B radiation increases serum vitamin D level expressed as 25-hydroxyvitamin-D(3) [25(OH)D], but the relationship to body surface area and UVB dose needs investigation.......Ultraviolet (UV) B radiation increases serum vitamin D level expressed as 25-hydroxyvitamin-D(3) [25(OH)D], but the relationship to body surface area and UVB dose needs investigation....

  15. Estimation of surface area concentration of workplace incidental nanoparticles based on number and mass concentrations (United States)

    Park, J. Y.; Ramachandran, G.; Raynor, P. C.; Kim, S. W.


    Surface area was estimated by three different methods using number and/or mass concentrations obtained from either two or three instruments that are commonly used in the field. The estimated surface area concentrations were compared with reference surface area concentrations (SAREF) calculated from the particle size distributions obtained from a scanning mobility particle sizer and an optical particle counter (OPC). The first estimation method (SAPSD) used particle size distribution measured by a condensation particle counter (CPC) and an OPC. The second method (SAINV1) used an inversion routine based on PM1.0, PM2.5, and number concentrations to reconstruct assumed lognormal size distributions by minimizing the difference between measurements and calculated values. The third method (SAINV2) utilized a simpler inversion method that used PM1.0 and number concentrations to construct a lognormal size distribution with an assumed value of geometric standard deviation. All estimated surface area concentrations were calculated from the reconstructed size distributions. These methods were evaluated using particle measurements obtained in a restaurant, an aluminum die-casting factory, and a diesel engine laboratory. SAPSD was 0.7-1.8 times higher and SAINV1 and SAINV2 were 2.2-8 times higher than SAREF in the restaurant and diesel engine laboratory. In the die casting facility, all estimated surface area concentrations were lower than SAREF. However, the estimated surface area concentration using all three methods had qualitatively similar exposure trends and rankings to those using SAREF within a workplace. This study suggests that surface area concentration estimation based on particle size distribution (SAPSD) is a more accurate and convenient method to estimate surface area concentrations than estimation methods using inversion routines and may be feasible to use for classifying exposure groups and identifying exposure trends.

  16. Estimation of surface area concentration of workplace incidental nanoparticles based on number and mass concentrations

    International Nuclear Information System (INIS)

    Park, J. Y.; Ramachandran, G.; Raynor, P. C.; Kim, S. W.


    Surface area was estimated by three different methods using number and/or mass concentrations obtained from either two or three instruments that are commonly used in the field. The estimated surface area concentrations were compared with reference surface area concentrations (SA REF ) calculated from the particle size distributions obtained from a scanning mobility particle sizer and an optical particle counter (OPC). The first estimation method (SA PSD ) used particle size distribution measured by a condensation particle counter (CPC) and an OPC. The second method (SA INV1 ) used an inversion routine based on PM1.0, PM2.5, and number concentrations to reconstruct assumed lognormal size distributions by minimizing the difference between measurements and calculated values. The third method (SA INV2 ) utilized a simpler inversion method that used PM1.0 and number concentrations to construct a lognormal size distribution with an assumed value of geometric standard deviation. All estimated surface area concentrations were calculated from the reconstructed size distributions. These methods were evaluated using particle measurements obtained in a restaurant, an aluminum die-casting factory, and a diesel engine laboratory. SA PSD was 0.7–1.8 times higher and SA INV1 and SA INV2 were 2.2–8 times higher than SA REF in the restaurant and diesel engine laboratory. In the die casting facility, all estimated surface area concentrations were lower than SA REF . However, the estimated surface area concentration using all three methods had qualitatively similar exposure trends and rankings to those using SA REF within a workplace. This study suggests that surface area concentration estimation based on particle size distribution (SA PSD ) is a more accurate and convenient method to estimate surface area concentrations than estimation methods using inversion routines and may be feasible to use for classifying exposure groups and identifying exposure trends.

  17. Changes in the intestinal microvillous surface area during reproduction and ageing in the female rat.


    Pénzes, L; Regius, O


    A morphometric study has been undertaken of the changes that occur in the microvillous surface area of young, pregnant, lactating, old and senescent rats. It has been shown that the microvilli are organelles with a quite stable conformation and that they exhibit no large scale dimensional changes throughout almost the entire life span. Lactation, however, does induce an apparent increase in microvillous surface area which may be associated with the significant changes which occur to the struc...

  18. Relationship between specific surface area and spatial correlation functions for anisotropic porous media

    Energy Technology Data Exchange (ETDEWEB)

    Berryman, J.G.


    A result of Debye, Anderson, and Brumberger (P. Debye, H. R. Anderson, Jr., and H. Brumberger, J. Appl. Phys. 28, 679 (1957)) for isotropic porous media states that the derivative of the two-point spatial correlation at the origin is equal to minus one-quarter of the specific surface area. This result is generalized for nonisotropic media by noting that the angular average of the anisotropic two-point spatial correlation function has the same relationship to the specific surface area.

  19. Arrhythmogenicity of Anti-Ro/SSA Antibodies in Patients With Torsades de Pointes. (United States)

    Lazzerini, Pietro Enea; Yue, Yuankun; Srivastava, Ujala; Fabris, Frank; Capecchi, Pier Leopoldo; Bertolozzi, Iacopo; Bacarelli, Maria Romana; Morozzi, Gabriella; Acampa, Maurizio; Natale, Mariarita; El-Sherif, Nabil; Galeazzi, Mauro; Laghi-Pasini, Franco; Boutjdir, Mohamed


    In patients with autoimmune disease, anti-Ro/SSA antibodies (anti-Ro/SSA) are responsible for a novel autoimmune-associated long-QT syndrome by targeting the hERG potassium channel and inhibiting the related current (IKr). Because anti-Ro/SSA are also present in a significant proportion of healthy subjects and may be associated with torsades de pointes (TdP) arrhythmia, we tested the hypothesis that anti-Ro/SSA may represent a silent risk factor in patients developing TdP. Twenty-five consecutive patients who experienced TdP were prospectively collected independent of ongoing therapies and concomitant diseases. Anti-Ro/SSA were detected by fluoroenzyme immunoassay, immuno-Western blotting, and line-blot immunoassay. Purified IgGs from anti-Ro/SSA-positive and anti-Ro/SSA-negative patients were tested on IKr using HEK293 cells stably expressing the hERG channel. As expected, in TdP patients, many known corrected QT interval-prolonging risk factors were simultaneously present, including hypokalemia that was the most common (52%). Anti-Ro/SSA were present in 60% of the subjects, mostly the anti-Ro/SSA-52-kD subtype detected by immuno-Western blotting only. A history of autoimmune disease was found in only 2 of anti-Ro/SSA-positive patients. Experimental data demonstrated that purified anti-Ro/SSA-positive IgGs significantly inhibited IKr and cross reacted with hERG-channel proteins. Moreover, anti-Ro/SSA-positive sera exhibited high reactivity with a peptide corresponding to the hERG-channel pore-forming region. Anti-Ro/SSA may represent a clinically silent novel risk factor for TdP development via an autoimmune-mediated electrophysiological interference with the hERG channel. We propose that TdP patients may benefit from specific anti-Ro/SSA testing even in the absence of autoimmune diseases as immunomodulating therapies may be effective in shortening corrected QT interval and reducing TdP recurrence risk. © 2016 American Heart Association, Inc.

  20. Lake Chad Total Surface Water Area as Derived from Land Surface Temperature and Radar Remote Sensing Data

    Directory of Open Access Journals (Sweden)

    Frederick Policelli


    Full Text Available Lake Chad, located in the middle of the African Sahel belt, underwent dramatic decreases in the 1970s and 1980s leaving less than ten percent of its 1960s surface water extent as open water. In this paper, we present an extended record (dry seasons 1988–2016 of the total surface water area of the lake (including both open water and flooded vegetation derived using Land Surface Temperature (LST data (dry seasons 2000–2016 from the NASA Terra MODIS sensor and EUMETSAT Meteosat-based LST measurements (dry seasons 1988–2001 from an earlier study. We also examine the total surface water area for Lake Chad using radar data (dry seasons 2015–2016 from the ESA Sentinel-1a mission. For the limited number of radar data sets available to us (18 data sets, we find on average a close match between the estimates from these data and the corresponding estimates from LST, though we find spatial differences in the estimates using the two types of data. We use these spatial differences to adjust the record (dry seasons 2000–2016 from MODIS LST. Then we use the adjusted record to remove the bias of the existing LST record (dry seasons 1988–2001 derived from Meteosat measurements and combine the two records. From this composite, extended record, we plot the total surface water area of the lake for the dry seasons of 1988–1989 through 2016–2017. We find for the dry seasons of 1988–1989 to 2016–2017 that the maximum total surface water area of the lake was approximately 16,800 sq. km (February and May, 2000, the minimum total surface water area of the lake was approximately 6400 sq. km (November, 1990, and the average was approximately 12,700 sq. km. Further, we find the total surface water area of the lake to be highly variable during this period, with an average rate of increase of approximately 143 km2 per year.

  1. Geohydrology and susceptibility of major aquifers to surface contamination in Alabama, area 7 (United States)

    Mooty, W.S.


    The geohydrology and susceptibility of the seven major aquifers to surface contamination in Area 7 - Bibb, Dallas, Hale, Perry, and Wilcox Counties, are described. Aquifers in the northern part of the study area are in Paleozoic limestones and dolomite formations. Deposits in the central part of the study area are predominately of Cretaceous age and contain the Coker, Gordo, and Eutaw aquifers. Although the southern part of the study area has many deposits of Tertiary age, the Ripley Formation of Cretaceous age is the major aquifer. Contamination of any of the major aquifers is improbable because the majority of the recharge area for the primary aquifers is woodland, pasture, or farmland. Downdip from their outcrops, the major aquifers in the study area are protected from land surface contamination by relatively impermeable layers of clay and chalk. The aquifers that are highly susceptible to contamination are the ones in the limestone and dolomite formations in northern Bibb County. Sinkholes exist in the recharge area of these formations and could provide a direct link for contaminates from the land surface to the water table. An area northeast of the Selma well field is also highly susceptible to contamination. The Eutaw Formation in this area is overlain by alluvial deposits that could increase recharge to the aquifer by slowing the runoff rate of surface water. (USGS)

  2. Changes in Thickness and Surface Area of the Human Cortex and Their Relationship with Intelligence

    NARCIS (Netherlands)

    Schnack, Hugo G.; Van Haren, Neeltje E M; Brouwer, Rachel M.; Evans, Alan; Durston, Sarah; Boomsma, Dorret I.; Kahn, René S.; Hulshoff Pol, Hilleke E.


    Changes in cortical thickness over time have been related to intelligence, but whether changes in cortical surface area are related to general cognitive functioning is unknown. We therefore examined the relationship between intelligence quotient (IQ) and changes in cortical thickness and surface

  3. Greenland surface mass-balance observations from the ice-sheet ablation area and local glaciers

    DEFF Research Database (Denmark)

    Machguth, Horst; Thomsen, Henrik H.; Weidick, Anker


    Glacier surface mass-balance measurements on Greenland started more than a century ago, but no compilation exists of the observations from the ablation area of the ice sheet and local glaciers. Such data could be used in the evaluation of modelled surface mass balance, or to document changes in g...

  4. Greenland surface mass-balance observations from the ice-sheet ablation area and local glaciers

    NARCIS (Netherlands)

    Machguth, Horst; Thomsen, Henrik H.; Weidick, Anker; Ahlstrøm, Andreas P.; Abermann, Jakob; Andersen, Morten L.; Andersen, Signe B.; Bjørk, Anders A.; Box, Jason E.; Braithwaite, Roger J.; Bøggild, Carl E.; Citterio, Michele; Clement, Poul; Colgan, William; Fausto, Robert S.; Gleie, Karin; Gubler, Stefanie; Hasholt, Bent; Hynek, Bernhard; Knudsen, Niels T.; Larsen, Signe H.; Mernild, Sebastian H.; Oerlemans, Johannes; Oerter, Hans; Olesen, Ole B.; Smeets, C. J P Paul; Steffen, Konrad; Stober, Manfred; Sugiyama, Shin; Van As, Dirk; Van Den Broeke, Michiel R.; Van De Wal, Roderik S W


    Glacier surface mass-balance measurements on Greenland started more than a century ago, but no compilation exists of the observations from the ablation area of the ice sheet and local glaciers. Such data could be used in the evaluation of modelled surface mass balance, or to document changes in

  5. Impaired clearance of apoptotic cardiocytes is linked to anti-SSA/Ro and -SSB/La antibodies in the pathogenesis of congenital heart block. (United States)

    Clancy, Robert M; Neufing, Petra J; Zheng, Ping; O'Mahony, Marguerita; Nimmerjahn, Falk; Gordon, Tom P; Buyon, Jill P


    The role of cardiocytes in physiologic removal of apoptotic cells and the subsequent effect of surface binding by anti-SSA/Ro and -SSB/La antibodies was addressed. Initial experiments evaluated induction of apoptosis by extrinsic and intrinsic pathways. Nuclear injury and the translocation of SSA/Ro and SSB/La antigens to the fetal cardiocyte plasma membrane were common downstream events of Fas and TNF receptor ligation, requiring caspase activation. As assessed by phase-contrast and confirmed by confocal microscopy, coculturing of healthy cardiocytes with cardiocytes rendered apoptotic via extrinsic pathways revealed a clearance mechanism that to our knowledge has not previously been described. Cultured fetal cardiocytes expressed phosphatidylserine receptors (PSRs), as did cardiac tissue from a fetus with congenital heart block (CHB) and an age-matched control. Phagocytic uptake was blocked by anti-PSR antibodies and was significantly inhibited following preincubation of apoptotic cardiocytes with chicken and murine anti-SSA/Ro and -SSB/La antibodies, with IgG from an anti-SSA/Ro- and -SSB/La-positive mother of a CHB child, but not with anti-HLA class I antibody. In a murine model, anti-Ro60 bound and inhibited uptake of apoptotic cardiocytes from wild-type but not Ro60-knockout mice. Our results suggest that resident cardiocytes participate in physiologic clearance of apoptotic cardiocytes but that clearance is inhibited by opsonization via maternal autoantibodies, resulting in accumulation of apoptotic cells, promoting inflammation and subsequent scarring.

  6. Models of bedrock surface and overburden thickness over Olkiluoto island and nearby sea area

    Energy Technology Data Exchange (ETDEWEB)

    Moenkkoenen, H. [WSP Finland Oy, Helsinki (Finland)


    In this report, a model of bedrock surface and a model of overburden thickness over the Olkiluoto Island and the nearby sea area are presented. Also in purpose to produce material for biosphere and radionuclide transport modelling, stratigraphy models of different sediment layers were created at two priority areas north and south of the Olkiluoto Island. The work concentrated on the collection and description of available data of bedrock surface and overburden thickness. Because the information on the bedrock surface and overburden is collected from different sources and is based on a number of types of data the quality and applicability of data sets varies. Consequently also the reliability in different parts of the models varies. Input data for the bedrock surface and overburden thickness models include 2928 single points and additional outcrops observations (611 polygons) in the modelled area. In addition, the input data include 173 seismic refraction lines (6534 points) and acousticseismic sounding lines (26655 points from which 13721 points are located in model area) in the Olkiluoto offshore area. The average elevation of bedrock surface in area is 2.1 metres above the sea level. The average thickness of overburden is 2.5 metres varying typically between 2 - 4 metres. Thickest overburden covers (approximately 16 metres) of terrestrial area are located at the western end of the Olkiluoto Island and in sea basin south of the island. (orig.)

  7. Estimation of cerebral surface area using vertical sectioning and magnetic resonance imaging: a stereological study. (United States)

    Acer, Niyazi; Cankaya, Mehmet Niyazi; Işçi, Oznur; Baş, Orhan; Camurdanoğlu, Mehmet; Turgut, Mehmet


    Stereological techniques using isotropic uniform random and vertical uniform random sections have been used for surface area estimation. However, there are a few studies in which the surface area of the brain is estimated using the vertical section technique in a stereological approach. The objective of the current study was to apply the vertical section technique using cycloid test probes for estimation of cerebral surface area in magnetic resonance imaging (MRI). In this study, cerebral surface areas were estimated in a total of 13 young subjects (6 males, 7 females) who were free of any neurological symptoms and signs. The means (+/-S.D.) of the surface areas were 1619.92+/-140. 97 cm (2), 1625.69+/-147. 58 cm(2) and 1674.69+/-160. 60 cm(2) for 36, 18 and 12 vertical sections, respectively. The mean coefficient of error obtained by applying cycloid test lines that use a 2. 8-cm ratio of area associated with each cycloid was estimated at 0.05). In addition, the three models correlated well with each other. From these results, it is concluded that the vertical section technique is an unbiased, efficient and reliable method and is ideally suited to in vivo examination of MRI data for estimating the surface area of the brain. Hence, we suggest that estimation of surface area using MRI and stereology may be clinically relevant for assessing cortical atrophy as well as for investigating the structure and function of cerebral hemispheres. Copyright 2009 Elsevier B.V. All rights reserved.

  8. Application of stereological methods to estimate post-mortem brain surface area using 3T MRI

    DEFF Research Database (Denmark)

    Furlong, Carolyn; García-Fiñana, Marta; Puddephat, Michael


    The Cavalieri and Vertical Sections methods of design based stereology were applied in combination with 3 tesla (i.e. 3T) Magnetic Resonance Imaging (MRI) to estimate cortical and subcortical volume, area of the pial surface, area of the grey-white matter boundary, and thickness of the cerebral c...

  9. 78 FR 16564 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Personnel Management... (United States)


    ... (SSN) verification to our Master Files of SSN Holders and SSN Applications. The Federal Register designation for the SSA file is Master Files of SSN Holders and SSN Applications, SSA/OSR, 60-0058. Those...

  10. Large Differences between Glaciers 3D Surface Extents and 2D Planar Areas in Central Tianshan

    Directory of Open Access Journals (Sweden)

    Xianwei Wang


    Full Text Available Most glaciers in China lie in high mountainous environments and have relatively large surface slopes. Common analyses consider glaciers’ projected areas (2D Area in a two-dimensional plane, which are much smaller than glacier’s topographic surface extents (3D Area. The areal difference between 2D planar areas and 3D surface extents exceeds −5% when the glacier’s surface slope is larger than 18°. In this study, we establish a 3D model in the Muzart Glacier catchment using ASTER GDEM data. This model is used to quantify the areal difference between glaciers’ 2D planar areas and their 3D surface extents in various slope zones and elevation bands by using the second Chinese Glacier Inventory (CGI2. Finally, we analyze the 2D and 3D area shrinking rate between 2007 and 2013 in Central Tianshan using glaciers derived from Landsat images by an object-based classification approach. This approach shows an accuracy of 89% when it validates by comparison of glaciers derived from Landsat and high spatial resolution GeoEye images. The extracted glaciers in 2007 also have an agreement of 89% with CGI2 data in the Muzart Glacier catchment. The glaciers’ 3D area is 34.2% larger than their 2D area from CGI2 in the Muzart Glacier catchment and by 27.9% in the entire Central Tianshan. Most underestimation occurs in the elevation bands of 4000–5000 m above sea level (a.s.l.. The 3D glacier areas reduced by 30 and 115 km2 between 2007 and 2013 in the Muzart Glacier catchment and Central Tianshan, being 37.0% and 27.6% larger than their 2D areas reduction, respectively. The shrinking rates decrease with elevation increase.

  11. Greenland surface mass-balance observations from the ice-sheet ablation area and local glaciers

    DEFF Research Database (Denmark)

    Machguth, Horst; Thomsen, Henrik H.; Weidick, Anker


    Glacier surface mass-balance measurements on Greenland started more than a century ago, but no compilation exists of the observations from the ablation area of the ice sheet and local glaciers. Such data could be used in the evaluation of modelled surface mass balance, or to document changes...... in glacier melt independently from model output. Here, we present a comprehensive database of Greenland glacier surface mass-balance observations from the ablation area of the ice sheet and local glaciers. The database spans the 123 a from 1892 to 2015, contains a total of similar to 3000 measurements from......-term time series of which there are only two exceeding 20 a. We use the data to analyse uncertainties in point measurements of surface mass balance, as well as to estimate surface mass-balance profiles for most regions of Greenland....

  12. Planar spatial correlations, anisotropy, and specific surface area of stationary random porous media

    International Nuclear Information System (INIS)

    Berryman, J.G.


    An earlier result of the author showed that an anisotropic spatial correlation function of a random porous medium could be used to compute the specific surface area when it is stationary as well as anisotropic by first performing a three-dimensional radial average and then taking the first derivative with respect to lag at the origin. This result generalized the earlier result for isotropic porous media of Debye et al. [J. Appl. Phys. 28, 679 (1957)]. The present article provides more detailed information about the use of spatial correlation functions for anisotropic porous media and in particular shows that, for stationary anisotropic media, the specific surface area can be related to the derivative of the two-dimensional radial average of the correlation function measured from cross sections taken through the anisotropic medium. The main concept is first illustrated using a simple pedagogical example for an anisotropic distribution of spherical voids. Then, a general derivation of formulas relating the derivative of the planar correlation functions to surface integrals is presented. When the surface normal is uniformly distributed (as is the case for any distribution of spherical voids), our formulas can be used to relate a specific surface area to easily measurable quantities from any single cross section. When the surface normal is not distributed uniformly (as would be the case for an oriented distribution of ellipsoidal voids), our results show how to obtain valid estimates of specific surface area by averaging measurements on three orthogonal cross sections. One important general observation for porous media is that the surface area from nearly flat cracks may be underestimated from measurements on orthogonal cross sections if any of the cross sections happen to lie in the plane of the cracks. This result is illustrated by taking the very small aspect ratio (penny-shaped crack) limit of an oblate spheroid, but holds for other types of flat surfaces as well

  13. BOREAS HYP-8 DEM Data Over The NSA-MSA and SSA-MSA in The AEAC Projection (United States)

    Knapp, David E.; Hall, Forrest G. (Editor); Wang, Xue-Wen; Band, L. E.; Smith, David E. (Technical Monitor)


    These data were derived from the original Digital Elevation Models (DEMs) produced by the Boreal Ecosystem-Atmosphere Study (BOREAS) Hydrology (HYD)-8 team. The original DEMs were in the Universal Transverse Mercator (UTM) projection, while this product is projected in the Albers Equal-Area Conic (AEAC) projection. The pixel size of the data is 100 meters, which is appropriate for the 1:50,000-scale contours from which the DEMs were made. The original data were compiled from information available in the 1970s and 1980s. This data set covers the two Modeling Sub-Areas (MSAs) that are contained within the Southern Study Area (SSA) and the Northern Study Area (NSA). The data are stored in binary, image format files. The DEM data over the NSA-MSA and SSA-MSA in the AEAC projection are available from the Earth Observing System Data and Information System (EOSDIS) Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC). The data files are available on a CD-ROM (see document number 20010000884).

  14. Pore scale heterogeneity in the mineral distribution and surface area of porous rocks (United States)

    Lai, Peter; Moulton, Kevin; Krevor, Samuel


    There are long-standing challenges in characterizing reactive transport in porous media at scales larger than individual pores. This hampers the prediction of the field-scale impact of geochemical processes on fluid flow [1]. This is a source of uncertainty for carbon dioxide injection, which results in a reactive fluid-rock system, particularly in carbonate rock reservoirs. A potential cause is the inability of the continuum approach to incorporate the impact of heterogeneity in pore-scale reaction rates. This results in part from pore-scale heterogeneities in surface area of reactive minerals [2,3]. The objective of this study was to quantify heterogeneity in reactive surface and observe the extent of its non-normal character. In this study we describe our work in using micron-scale x-ray imaging and other spectroscopic techniques for the purpose of describing the statistical distribution of reactive surface area within a porous medium, and identifying specific mineral phases and their distribution in 3-dimensions. Using in-house image processing techniques and auxilary charactersation with thin section, electron microscope and spectroscopic techniques we quantified the surface area of each mineral phase in the x-ray CT images. This quantification was validated against nitrogen BET surface area and backscattered electron imaging measurements of the CT-imaged samples. Distributions in reactive surface area for each mineral phase were constructed by calculating surface areas in thousands of randomly selected subvolume images of the total sample, each normalized to the pore volume in that image. In all samples, there is little correlation between the reactive surface area fraction and the volumetric fraction of a mineral in a bulk rock. Berea sandstone was far less heterogeneous and has a characteristic pore size at which a surface area distribution may be used to quantify heterogeneity. In carbonates, heterogeneity is more complex and surface area must be

  15. Technology of surface wastewater purification, including high-rise construction areas (United States)

    Tsyba, Anna; Skolubovich, Yury


    Despite on the improvements in the quality of high-rise construction areas and industrial wastewater treatment, the pollution of water bodies continues to increase. This is due to the organized and unorganized surface untreated sewage entry into the reservoirs. The qualitative analysis of some cities' surface sewage composition is carried out in the work. Based on the published literature review, the characteristic contamination present in surface wastewater was identified. The paper proposes a new technology for the treatment of surface sewage and presents the results of preliminary studies.

  16. Estimating surface fluxes over the north Tibetan Plateau area with ASTER imagery

    Directory of Open Access Journals (Sweden)

    Weiqiang Ma


    Full Text Available Surface fluxes are important boundary conditions for climatological modeling and Asian monsoon system. The recent availability of high-resolution, multi-band imagery from the ASTER (Advanced Space-borne Thermal Emission and Reflection radiometer sensor has enabled us to estimate surface fluxes to bridge the gap between local scale flux measurements using micrometeorological instruments and regional scale land-atmosphere exchanges of water and heat fluxes that are fundamental for the understanding of the water cycle in the Asian monsoon system. A parameterization method based on ASTER data and field observations has been proposed and tested for deriving surface albedo, surface temperature, Normalized Difference Vegetation Index (NDVI, Modified Soil Adjusted Vegetation Index (MSAVI, vegetation coverage, Leaf Area Index (LAI, net radiation flux, soil heat flux, sensible heat flux and latent heat flux over heterogeneous land surface in this paper. As a case study, the methodology was applied to the experimental area of the Coordinated Enhanced Observing Period (CEOP Asia-Australia Monsoon Project (CAMP on the Tibetan Plateau (CAMP/Tibet, located at the north Tibetan Plateau. The ASTER data of 24 July 2001, 29 November 2001 and 12 March 2002 was used in this paper for the case of summer, winter and spring. To validate the proposed methodology, the ground-measured surface variables (surface albedo and surface temperature and land surface heat fluxes (net radiation flux, soil heat flux, sensible heat flux and latent heat flux were compared to the ASTER derived values. The results show that the derived surface variables and land surface heat fluxes in three different months over the study area are in good accordance with the land surface status. Also, the estimated land surface variables and land surface heat fluxes are in good accordance with ground measurements, and all their absolute percentage difference (APD is less than 10% in the validation sites

  17. Satellite remotely-sensed land surface parameters and their climatic effects on urban areas (United States)

    Zoran, M.; Savastru, R.; Savastru, D.; Ciobanu, M.; Tautan, M. N.; Miclos, S.


    Rapid urbanization transforms the natural landscape to anthropogenic urban land and changes surface biogeophysical characteristics.Urban growth affects the ecology of cities in a number of ways, such as eliminating and fragmenting native habitats, modifying local climate conditions, and generating anthropogenic pollutants.Urbanization has changed many landscapes throughout the world with serious ecological consequences.To understand the ecology of urban systems, it is necessary to quantify the spatial and temporal patterns of urbanization, which often requires dynamic modeling and spatial analysis. Geospatial information provided by satellite remote sensing sensors and biogeophysical field data are very useful for urban landuse-landcover dynamics and impacts analysis. The spatial and spectral variability of urban environments present fundamental challenges to deriving accurate remote sensing information for urban areas. By integrating high-resolution and medium-resolution satellite imagery with other geospatial information, have been investigated several land surface parameters including impervious surfaces and land surface temperatures for Bucharest metropolitan area in Romania. Percent impervious surface was used to quantitatively define the spatial extent and development density of urban land use. Land surface temperatures were retrieved by using a single band algorithm that processes both thermal infrared satellite data and total atmospheric water vapour content. Land surface temperatures have been analysed for different land use and land cover categories both in urban as well as in periurban areas. Because of the removal of vegetative cover and the reduction in evaporation over urban impervious surfaces, the urban heterogeneity of land surface and associated spatial extents influence surface thermal conditions. In situ meteorological data were integrated to assess regional climatic conditions. The spatial structure of surface heating influenced by landscape

  18. Pore scale heterogeneity in the mineral distribution and reactive surface area of rocks (United States)

    Lai, P. E.; Krevor, S. C.


    There are long-standing challenges in characterizing reactive transport in porous media at scales larger than individual pores. This hampers the prediction of the field-scale impact of geochemical processes on fluid flow [1]. This is a source of uncertainty for CO2 injection, which results in a reactive fluid-rock system, particularly in carbonate rock reservoirs. A potential cause is the inability of the continuum approach to incorporate the impact of heterogeneity in pore-scale reaction rates. This results in part from pore-scale heterogeneities in surface area of reactive minerals [2,3]. In this study we have created μm resolution 3D images of 3 sandstone and 4 carbonate rocks using x-ray microtomography. Using in-house image processing techniques and auxiliary characterisation with thin section, electron microscope and spectroscopic techniques we quantified the surface area of each mineral phase in the x-ray CT images. This quantification was validated against N2 BET surface area and He porosity measurements of the imaged samples. Distributions in reactive surface area for each mineral phase were constructed by calculating surface areas in thousands of randomly selected subvolume images of the total sample, each normalized to the pore volume in that image. In all samples, there is little correlation between the reactive surface area fraction and the volumetric fraction of a mineral in a bulk rock. Berea sandstone was far less heterogeneous and has a characteristic pore size at which a surface area distribution may be used to quantify heterogeneity. In carbonates, heterogeneity is more complex and surface area must be characterized at multiple length scales for an accurate description of reactive transport. [1] Maher, Steefel, Depaolo and Vianni (2006) Geochimica et Cosmochimica Acta, 70, 337-363 [2] Landrot, Ajo-Franklin, Yang, Cabrini and Steefel (2012) Chemical Geology 318-319, 113-125 [3] Li, Peters and Celia (2007) American Journal of Science 307, 1146

  19. Variability of silver fir (Abies alba Mill. cones – variability structure of scale surface area

    Directory of Open Access Journals (Sweden)

    Aniszewska Monika


    Full Text Available This study was conducted on a batch of closed silver fir cones from Jawor Forest District and a mixture of scales from the seed extraction facility Grotniki. The scales were divided into three size classes corresponding to the bottom, middle and upper part of the cones and their area was measured with the Multi Scan Base v.18.03 software. Based on the sum of the inner and outer surface area of all scales, we then determined the total area of evaporation from the cones. In addition, the area of protruding scales was measured for differently sized scales from different parts of the cones. Previous studies have shown that the average outer surface of a closed cone, calculated as the sum of protruding scales, accounts for 10% of the outer surface of an open cone. Pictures of both scale surfaces with the internal seed bed and the external protrusions were taken using a scanning electron microscope. We noticed significant differences in dimension and shape of the channels and trichomes on the scale surface. On the inner side of the scales, we found a high diversity of trichomes of different lengths, whilst the outer side contained channels. Presumably, these characteristics affect the rate of water loss from the cones during desiccation and separation of the seed. In-depth knowledge on the evaporative surfaces of fir cones and scale structure will be helpful for optimizing the industrial processes of seed extraction.

  20. Evaluating polymer degradation with complex mixtures using a simplified surface area method. (United States)

    Steele, Kandace M; Pelham, Todd; Phalen, Robert N


    Chemical-resistant gloves, designed to protect workers from chemical hazards, are made from a variety of polymer materials such as plastic, rubber, and synthetic rubber. One material does not provide protection against all chemicals, thus proper polymer selection is critical. Standardized testing, such as chemical degradation tests, are used to aid in the selection process. The current methods of degradation ratings based on changes in weight or tensile properties can be expensive and data often do not exist for complex chemical mixtures. There are hundreds of thousands of chemical products on the market that do not have chemical resistance data for polymer selection. The method described in this study provides an inexpensive alternative to gravimetric analysis. This method uses surface area change to evaluate degradation of a polymer material. Degradation tests for 5 polymer types against 50 complex mixtures were conducted using both gravimetric and surface area methods. The percent change data were compared between the two methods. The resulting regression line was y = 0.48x + 0.019, in units of percent, and the Pearson correlation coefficient was r = 0.9537 (p ≤ 0.05), which indicated a strong correlation between percent weight change and percent surface area change. On average, the percent change for surface area was about half that of the weight change. Using this information, an equivalent rating system was developed for determining the chemical degradation of polymer gloves using surface area.

  1. Study of measurement methods of ultrafine aerosols surface-area for characterizing occupational exposure

    International Nuclear Information System (INIS)

    Bau, S.


    This work aims at improving knowledge on ultrafine aerosols surface-area measurement. Indeed, the development of nano-technologies may lead to occupational exposure to airborne nano-structured particles, which involves a new prevention issue. There is currently no consensus concerning what parameter (mass, surface-area, number) should be measured. However, surface-area could be a relevant metric, since it leads to a satisfying correlation with biological effects when nano-structured particles are inhaled. Hence, an original theoretical work was performed to position the parameter of surface-area in relation to other aerosol characteristics. To investigate measurement techniques of nano-structured aerosols surface-area, the experimental facility CAIMAN (Characterization of Instruments for the Measurement of Aerosols of Nano-particles) was designed and built. Within CAIMAN, it is possible to produce nano-structured aerosols with varying and controlled properties (size, concentration, chemical nature, morphology, state-of-charge), stable and reproducible in time. The generated aerosols were used to experimentally characterize the response of the instruments in study (NSAM and AeroTrak 9000 TSI, LQ1-DC Matter Engineering). The response functions measured with monodisperse aerosols show a good agreement with the corresponding theoretical curves in a large size range, from 15 to 520 nm. Furthermore, hypotheses have been formulated to explain the reasonable biases observed when measuring poly-disperse aerosols. (author)

  2. Analysis of relationships between NDVI and land surface temperature in coastal area (United States)

    Ning, Jicai; Gao, Zhiqiang; Chen, Maosi


    Using Landsat 5 Thematic Mapper and Landsat 8 Operational Land Imager and Thermal Infrared Sensor imagery of the Yellow River Delta, this study analyzed the relationships between NDVI and LST (land surface temperature). Six Landsat images comprising two time series were used to calculate the land surface temperature and correlated vegetation indices. The Yellow River Delta area has expanded substantially because of the deposited sediment carried from upstream reaches of the river. Between 1986 and 2015, approximately 35% of the land use area of the Yellow River Delta has been transformed into salterns and aquaculture ponds. Overall, land use conversion has occurred primarily from poorly utilized land into highly utilized land. To analyze the variation of land surface temperature, a mono-window algorithm was applied to retrieve the regional land surface temperature. The results showed bilinear correlation between land surface temperature and the vegetation indices (i.e., Normalized Difference Vegetation Index, Adjusted-Normalized Vegetation Index, Soil-Adjusted Vegetation Index, and Modified Soil-Adjusted Vegetation Index). Generally, values of the vegetation indices greater than the inflection point mean the land surface temperature and the vegetation indices are correlated negatively, and vice versa. Land surface temperature in coastal areas is affected considerably by local seawater temperature and weather conditions.

  3. Relationship among land surface temperature and LUCC, NDVI in typical karst area. (United States)

    Deng, Yuanhong; Wang, Shijie; Bai, Xiaoyong; Tian, Yichao; Wu, Luhua; Xiao, Jianyong; Chen, Fei; Qian, Qinghuan


    Land surface temperature (LST) can reflect the land surface water-heat exchange process comprehensively, which is considerably significant to the study of environmental change. However, research about LST in karst mountain areas with complex topography is scarce. Therefore, we retrieved the LST in a karst mountain area from Landsat 8 data and explored its relationships with LUCC and NDVI. The results showed that LST of the study area was noticeably affected by altitude and underlying surface type. In summer, abnormal high-temperature zones were observed in the study area, perhaps due to karst rocky desertification. LSTs among different land use types significantly differed with the highest in construction land and the lowest in woodland. The spatial distributions of NDVI and LST exhibited opposite patterns. Under the spatial combination of different land use types, the LST-NDVI feature space showed an obtuse-angled triangle shape and showed a negative linear correlation after removing water body data. In summary, the LST can be retrieved well by the atmospheric correction model from Landsat 8 data. Moreover, the LST of the karst mountain area is controlled by altitude, underlying surface type and aspect. This study provides a reference for land use planning, ecological environment restoration in karst areas.

  4. Surface Area of Patellar Facets: Inferential Statistics in the Iraqi Population

    Directory of Open Access Journals (Sweden)

    Ahmed Al-Imam


    Full Text Available Background. The patella is the largest sesamoid bone in the body; its three-dimensional complexity necessitates biomechanical perfection. Numerous pathologies occur at the patellofemoral unit which may end in degenerative changes. This study aims to test the presence of statistical correlation between the surface areas of patellar facets and other patellar morphometric parameters. Materials and Methods. Forty dry human patellae were studied. The morphometry of each patella was measured using a digital Vernier Caliper, electronic balance, and image analyses software known as ImageJ. The patellar facetal surface area was correlated with patellar weight, height, width, and thickness. Results. Inferential statistics proved the existence of linear correlation of total facetal surface area and patellar weight, height, width, and thickness. The correlation was strongest for surface area versus patellar weight. The lateral facetal area was found persistently larger than the medial facetal area, the p value was found to be <0.001 (one-tailed t-test for right patellae, and another significant p value of < 0.001 (one-tailed t-test was found for left patellae. Conclusion. These data are vital for the restoration of the normal biomechanics of the patellofemoral unit; these are to be consulted during knee surgeries and implant designs and can be of an indispensable anthropometric, interethnic, and biometric value.

  5. Correlating humidity-dependent ionically conductive surface area with transport phenomena in proton-exchange membranes. (United States)

    He, Qinggang; Kusoglu, Ahmet; Lucas, Ivan T; Clark, Kyle; Weber, Adam Z; Kostecki, Robert


    The objective of this effort was to correlate the local surface ionic conductance of a Nafion 212 proton-exchange membrane with its bulk and interfacial transport properties as a function of water content. Both macroscopic and microscopic proton conductivities were investigated at different relative humidity levels, using direct-current voltammetry and current-sensing atomic force microscopy (CSAFM). We were able to identify small ion-conducting domains that grew with humidity at the surface of the membrane. Numerical analysis of the surface ionic conductance images recorded at various relative humidity levels helped determine the fractional area of ion-conducting active sites. A simple square-root relationship between the fractional conducting area and observed interfacial mass-transport resistance was established. Furthermore, the relationship between the bulk ionic conductivity and surface ionic conductance pattern of the Nafion membrane was examined.

  6. Correlating Humidity-Dependent Ionically Conductive Surface Area with Transport Phenomena in Proton-Exchange Membranes

    Energy Technology Data Exchange (ETDEWEB)

    He, Qinggang; Kusoglu, Ahmet; Lucas, Ivan T.; Clark, Kyle; Weber, Adam Z.; Kostecki, Robert


    The objective of this effort was to correlate the local surface ionic conductance of a Nafion? 212 proton-exchange membrane with its bulk and interfacial transport properties as a function of water content. Both macroscopic and microscopic proton conductivities were investigated at different relative humidity levels, using electrochemical impedance spectroscopy and current-sensing atomic force microscopy (CSAFM). We were able to identify small ion-conducting domains that grew with humidity at the surface of the membrane. Numerical analysis of the surface ionic conductance images recorded at various relative humidity levels helped determine the fractional area of ion-conducting active sites. A simple square-root relationship between the fractional conducting area and observed interfacial mass-transport resistance was established. Furthermore, the relationship between the bulk ionic conductivity and surface ionic conductance pattern of the Nafion? membrane was examined.

  7. Geohydrology and susceptibility of major aquifers to surface contamination in Alabama; area 11 (United States)

    Castleberry, R.D.; Moreland, R.S.; Scott, J.C.


    This report delineates and describes the geohydrology and susceptibility of major aquifers to contamination in Butler, Conecuh, Covington, Crenshaw, Escambia, and Monroe Counties, Alabama. The major aquifers are the Pliocene-Miocene, Upper Floridan, Lisbon, Nanafalia-Clayton, and Providence-Ripley. The largest pumping centers in the area are Andalusia and Monroeville, where groundwater use is about 5 and 4 million gal/day, respectively. Estimated maximum withdrawal in 1987 for all uses in the area was about 44 million gal/day. Depressions have developed in the potentiometric surfaces of the Lisbon aquifer near Andalusia and Opp, the Nanafalia-Clayton aquifer near Luverne, Andalusia, Beatrice, and Monroeville, and the Providence-Ripley aquifer at Greenville. Significant declines in the potentiometric surfaces of the other major aquifers are not apparent. Recharge areas for all major aquifers are susceptible to contamination, but the probability of contamination of the Lisbon, Nanafalia-Clayton, and Providence-Ripley aquifers is low because the recharge areas are remote from areas of the withdrawal. The depressions in the recharge area for the Upper Floridan aquifer and the area where the Pliocene-Miocene aquifer is overlain by the gravelly sands of the Citronelle Formation are highly susceptible to contamination from the surface. (USGS)

  8. Microbiology of the surface water samples in the high background radiation areas of Ramsar, Iran

    International Nuclear Information System (INIS)

    Motamedifar, Mohammad; Zamani, Khosrow; Sedigh, Hadi; Mortazavi, Seyed Mohammad Javad; Taeb, Shahram; Haghani, M.; Mortazavi, Seyed Ali Reza; Soofi, Amir


    Residents of high background radiation areas of Ramsar have lived in these areas for many generations and received radiation doses much higher than the dose limit recommended by ICRP for radiation workers. The radioactivity of the high background radiation areas of Ramsar is reported to be due to 226 Ra and its decay products, which have been brought to the surface by the waters of hot springs. Over the past years the department has focused on different aspects of the health effects of the elevated levels of natural radiation in Ramsar. This study was aimed to perform a preliminary investigation on the bioeffects of exposure to elevated levels of natural radiation on the microbiology of surface water samples. Water samples were collected from surface water streams in Talesh Mahalleh district, Ramsar as well as a nearby area with normal levels of background radiation. Only two strains of bacteria, that is, Providencia stuartii and Shimwellia blattae, could be isolated from the water samples collected from high background radiation areas, while seven strains (Escherichia coli, Enterobacter asburiae, Klebsiella pneumoniae, Shigella dysenteriae, Buttiauxella agerstis, Tatumella punctuata and Raoultella ornithinolytica) were isolated from the water samples collected from normal background radiation areas. All the bacteria isolated from water samples of high and normal background radiation areas were sensitive to ultraviolet radiation, heat, betadine, alcohol, and deconex. Although other investigators have reported that bacteria isolated from hot springs show radioresistance, the results reported here do not reveal any adaptive response. (author)

  9. A Three-Dimensional Enormous Surface Area Aluminum Microneedle Array with Nanoporous Structure


    Chen, Po Chun; Hsieh, Sheng Jen; Chen, Chien Chon; Zou, Jun


    We proposed fabricating an aluminum microneedle array with a nanochannel structure on the surface by combining micromachining, electrolyte polishing, and anodization methods. The microneedle array provides a three-dimensional (3D) structure that possesses several hundred times more surface area than a traditional nanochannel template. Therefore, the microneedle array can potentially be used in many technology applications. This 3D microneedle array device can not only be used for painless inj...

  10. Area-averaged surface fluxes and their time-space variability over the FIFE experimental domain (United States)

    Smith, E. A.; Hsu, A. Y.; Crosson, W. L.; Field, R. T.; Fritschen, L. J.; Gurney, R. J.; Kanemasu, E. T.; Kustas, W. P.; Nie, D.; Shuttleworth, W. J.


    The underlying mean and variance properties of surface net radiation, sensible-latent heat fluxes and soil heat flux are studied over the densely instrumented grassland region encompassing FIFE. Flux variability is discussed together with the problem of scaling up to area-averaged fluxes. Results are compared and contrasted for cloudy and clear situations and examined for the influence of surface-induced biophysical controls (burn and grazing treatments) and topographic controls (aspect ratios and slope factors).

  11. DMSA scan nomograms for renal length and area: Related to patient age and to body weight, height or surface area

    International Nuclear Information System (INIS)

    Hassan, I.M.; Que, L.; Rutland, M.D.


    Aim: To create nomograms for renal size as measured from DMSA renal studies, and to test the nomograms for their ability to separate normal from abnormal kidneys. Method: Renal length was measured from posterior oblique views and renal area from posterior views. Results from 253 patients with bilateral normal kidneys were used to create nomograms for renal size relative to patient age, body height, weight or body surface area (BSA). The nomograms enclosed 95% of the normal kidneys, thus indicating the range for 95% confidence limits, and hence the specificity. Each nomogram was then tested against 46 hypertrophied kidneys and 46 damaged kidneys. Results: The results from nomograms of renal length and renal area, compared to age, body height, body weight and BSA are presented. For each nomogram, the range is presented as a fraction of the mean value, and the number of abnormal kidneys (hypertrophied or damaged) outside the normal range is presented as a percentage (indicating the sensitivity). Conclusion: Renal Area was no better than renal length for detecting abnormal kidneys. Patient age was the least useful method of normalisation. BSA normalisation produced the best results most frequently (narrower ranges and highest detection of abnormal kidneys)

  12. Heavy metal contamination in surface runoff sediments of the urban area of Vilnius, Lithuania

    Directory of Open Access Journals (Sweden)

    Gytautas Ignatavičius


    Full Text Available Surface runoff from urbanized territories carries a wide range of pollutants. Sediments in untreated runoff from direct discharge stormwater systems significantly contribute to urban waterway pollution. In this study, heavy metal (Pb, Zn, Cu, Cr, Ba, As and Fe contamination in surface runoff sediments of the urban area of the city of Vilnius was investigated. The surface runoff sediment samples were collected from seven dischargers with the highest volume rate of water flow and concentrations of suspended solids. The geospatial analysis of the distribution of heavy metals shows that there are several active pollution sources supplying the dischargers with contaminated sediments. Most of these areas are located in the central part of the city and in old town with intense traffic. Principal components analysis and t-test results clearly depicted the significantly different chemical compositions of winter and autumn surface sediment samples. The sampling approach and assessment of results provide a useful tool to examine the contamination that is generated in urban areas, distinguish pollution sources and give a better understanding of the importance of permeable surfaces and green areas.

  13. Dye-Sensitized Solar Cells Based on High Surface Area Nanocrystalline Zinc Oxide Spheres

    Directory of Open Access Journals (Sweden)

    Pavuluri Srinivasu


    Full Text Available High surface area nanocrystalline zinc oxide material is fabricated using mesoporous nanostructured carbon as a sacrificial template through combustion process. The resulting material is characterized by XRD, N2 adsorption, HR-SEM, and HR-TEM. The nitrogen adsorption measurement indicates that the materials possess BET specific surface area ca. 30 m2/g. Electron microscopy images prove that the zinc oxide spheres possess particle size in the range of 0.12 μm–0.17 μm. The nanocrystalline zinc oxide spheres show 1.0% of energy conversion efficiency for dye-sensitized solar cells.

  14. Volumes, Masses, and Surface Areas for Shippingport LWBR Spent Nuclear Fuel in a DOE SNF Canister

    International Nuclear Information System (INIS)

    J.W. Davis


    The purpose of this calculation is to estimate volumes, masses, and surface areas associated with (a) an empty Department of Energy (DOE) 18-inch diameter, 15-ft long spent nuclear fuel (SNF) canister, (b) an empty DOE 24-inch diameter, 15-ft long SNF canister, (c) Shippingport Light Water Breeder Reactor (LWBR) SNF, and (d) the internal basket structure for the 18-in. canister that has been designed specifically to accommodate Seed fuel from the Shippingport LWBR. Estimates of volumes, masses, and surface areas are needed as input to structural, thermal, geochemical, nuclear criticality, and radiation shielding calculations to ensure the viability of the proposed disposal configuration

  15. Pore Scale Heterogeneity in the Mineral Distribution, Surface Area and Adsorption in Porous Rocks (United States)

    Lai, P. E. P.; Krevor, S. C.


    The impact of heterogeneity in chemical transport and reaction is not understood in continuum (Darcy/Fickian) models of reactive transport. This is manifested in well-known problems such as scale dependent dispersion and discrepancies in reaction rate observations made at laboratory and field scales [1]. Additionally, this is a source of uncertainty for carbon dioxide injection, which produces a reactive fluid-rock system particularly in carbonate rock reservoirs. A potential cause is the inability of the continuum approach to incorporate the impact of heterogeneity in pore-scale reaction rates. This results in part from pore-scale heterogeneities in surface area of reactive minerals [2, 3]. We use x-ray micro tomography to describe the non-normal 3-dimensional distribution of reactive surface area within a porous medium according to distinct mineral groups. Using in-house image processing techniques, thin sections, nitrogen BET surface area, backscattered electron imaging and energy dispersive spectroscopy, we compare the surface area of each mineral phase to those obtained from x-ray CT imagery. In all samples, there is little correlation between the reactive surface area fraction and the volumetric fraction of a mineral in a bulk rock. Berea sandstone was far less heterogeneous and has a characteristic pore size at which a surface area distribution may be used to quantify heterogeneity. In carbonates, heterogeneity is more complex and surface area must be characterized at multiple length scales for an accurate description of reactive transport. We combine the mineral specific surface area characterisation to dynamic tomography, imaging the flow of water and solutes, to observe flow dependent and mineral specific adsorption. The observations may contribute to the incorporation of experimentally based statistical descriptions of pore scale heterogeneity in reactive transport into upscaled models, moving it closer to predictive capabilities for field scale

  16. A process to enhance the specific surface area and capacitance of hydrothermally reduced graphene oxide

    KAUST Repository

    Alazmi, Amira


    The impact of post-synthesis processing in reduced graphene oxide materials for supercapacitor electrodes has been analyzed. A comparative study of vacuum, freeze and critical point drying was carried out for hydrothermally reduced graphene oxide demonstrating that the optimization of the specific surface area and preservation of the porous network are critical to maximize its supercapacitance performance. As described below, using a supercritical fluid as the drying medium, unprecedented values of the specific surface area (364 m2 g−1) and supercapacitance (441 F g−1) for this class of materials have been achieved.

  17. Observation of contact area of bubbles with heating surface in pool boiling of water under microgravity

    International Nuclear Information System (INIS)

    Suzuki, K.; Kawamura, H.; Suzuki, M.; Takahashi, S.; Abe, Y.


    Burnout heat flux was measured in subcooled pool boiling of water under attached boiling bubbles on heating surface with bubble holding plate in ground experiment. A thin stainless flat plate was employed for heating surface. The experimental setup and the heating procedures were same as used in reduced gravity experiment performed by a parabolic flight of jet aircraft. Same burnout heat flux as in the reduced gravity was obtained by adjusting the clearance between the bubble holder and the heating surface. They were 100 ∝ 400 percent higher than the widely accepted existing theories. As extending heating time longer than the reduced gravity duration until burnout occurred, burnout heat flux decreased gradually and became a constant value calculated from the existing theories. In a result of observing contact area of boiling bubbles with transparent heating surface, the contact area was smaller in quick heating time than that in long time heating at same heat flux. The experimental results suggest in microgravity that liquid layer is remained between rapidly expanded bubbles and heating surface. In microgravity experiment by a drop shaft facility, contact area of bubbles with heating surface increased considerably at starting of microgravity. (orig.)

  18. City landscape changes effects on land surface temperature in Bucharest metropolitan area (United States)

    Savastru, Dan M.; Zoran, Maria A.; Savastru, Roxana S.; Dida, Adrian I.


    This study investigated the influences of city land cover changes and extreme climate events on land surface temperature in relationship with several biophysical variables in Bucharest metropolitan area of Romania through satellite and in-situ monitoring data. Remote sensing data from IKONOS, Landsat TM/ETM+ and time series MODIS Terra/Aqua and NOAA AVHRR sensors have been used to assess urban land cover- temperature interactions over 2000 - 2016 period. Time series Thermal InfraRed (TIR) satellite remote sensing data in synergy with meteorological data (air temperatureAT, precipitations, wind, solar radiation, etc.) were applied mainly for analyzing land surface temperature (LST) pattern and its relationship with surface landscape characteristics, assessing urban heat island (UHI), and relating urban land cover temperatures (LST). The land surface temperature, a key parameter for urban thermal characteristics analysis, was also analyzed in relation with the Normalized Difference Vegetation Index (NDVI) at city level. Results show that in the metropolitan area ratio of impervious surface in Bucharest increased significantly during investigated period, the intensity of urban heat island and heat wave events being most significant. The correlation analyses revealed that, at the pixel-scale, LST and AT possessed a strong positive correlation with percent impervious surfaces and negative correlation with vegetation abundances at metropolitan scale respectively. The NDVI was significantly correlated with precipitation. The spatial average air temperatures in urban test areas rise with the expansion of the urban size.

  19. Description of surface systems. Preliminary site description Simpevarp sub area - Version 1.2

    International Nuclear Information System (INIS)

    Lindborg, Tobias


    Swedish Nuclear Fuel and Waste Management Co is currently conducting site characterisation in the Simpevarp area. The area is divided into two subareas, the Simpevarp and the Laxemar subarea. The two subareas are surrounded by a common regional model area, the Simpevarp area. This report describes both the regional area and the subareas. This report is an interim version (model version 1.2) of the description of the surface systems at the Simpevarp area, and should be seen as a background report to the site description of the Simpevarp area, version 1.2, SKB-R--05-08. The basis for this description is quality-assured field data available in the SKB SICADA and GIS databases, together with generic data from the literature. The Surface system, here defined as everything above the bedrock, comprises a number of separate disciplines (e.g. hydrology, geology, topography, oceanography and ecology). Each discipline has developed descriptions and models for a number of properties that together represent the site description. The current methodology for developing the surface system description and the integration to ecosystem models is documented in a methodology strategy report SKB-R--03-06. The procedures and guidelines given in that report were followed in this report. Compared with version 1.1 of the surface system description SKB-R--04-25, this report presents considerable additional features, especially in the ecosystem description (Chapter 4) and in the description of the surface hydrology (Section 3.4). A first attempt has also been made to connect the flow of matter (carbon) between the different ecosystems into an overall ecosystem model at a landscape level. A summarised version of this report is also presented in SKB-R--05-08 together with geological-, hydrogeological-, transport properties-, thermal properties-, rock mechanics- and hydrogeochemical descriptions

  20. Description of surface systems. Preliminary site description Simpevarp sub area - Version 1.2

    Energy Technology Data Exchange (ETDEWEB)

    Lindborg, Tobias (ed.)


    Swedish Nuclear Fuel and Waste Management Co is currently conducting site characterisation in the Simpevarp area. The area is divided into two subareas, the Simpevarp and the Laxemar subarea. The two subareas are surrounded by a common regional model area, the Simpevarp area. This report describes both the regional area and the subareas. This report is an interim version (model version 1.2) of the description of the surface systems at the Simpevarp area, and should be seen as a background report to the site description of the Simpevarp area, version 1.2, SKB-R--05-08. The basis for this description is quality-assured field data available in the SKB SICADA and GIS databases, together with generic data from the literature. The Surface system, here defined as everything above the bedrock, comprises a number of separate disciplines (e.g. hydrology, geology, topography, oceanography and ecology). Each discipline has developed descriptions and models for a number of properties that together represent the site description. The current methodology for developing the surface system description and the integration to ecosystem models is documented in a methodology strategy report SKB-R--03-06. The procedures and guidelines given in that report were followed in this report. Compared with version 1.1 of the surface system description SKB-R--04-25, this report presents considerable additional features, especially in the ecosystem description (Chapter 4) and in the description of the surface hydrology (Section 3.4). A first attempt has also been made to connect the flow of matter (carbon) between the different ecosystems into an overall ecosystem model at a landscape level. A summarised version of this report is also presented in SKB-R--05-08 together with geological-, hydrogeological-, transport properties-, thermal properties-, rock mechanics- and hydrogeochemical descriptions.

  1. Evaporation and wetted area of single droplets on waxy and hairy leaf surfaces. (United States)

    Zhu, H; Yu, Y; Ozkan, H E; Derksen, R C; Krause, C R


    Understanding the evaporation of pesticide droplets and wetting of Leaf surfaces can increase foliar application efficiency and reduce pesticide use. Evaporation time and wetted area of single pesticide droplets on hairy and waxy geranium leaf surfaces were measured under the controlled conditions for five droplet sizes and three relative humidities. The sprays used to form droplets included water, a nonionic colloidal polymer drift retardant, an alkyl polyoxyethylene surfactant, and an insecticide. Adding the surfactant into spray mixtures greatly increased droplet wetted area on the surfaces while droplet evaporation time was greatly reduced. Adding the drift retardant into spray mixture slightly increased the droplet evaporation time and the wetted area. Also, droplets had Longer evaporation times on waxy leaves than on hairy leaves for all droplet diameters and all relative humidity conditions. Increasing relative humidity could increase the droplet evaporation time greatly but did not change the the wetted area. The droplet evaporation time and wetted area increased exponentially as the droplet size increased. Therefore, droplet size, surface characteristics of the target, relative humidity, and chemical composition of the spray mixtures (water alone, pesticide, additives) should be included as important factors that affect the efficacy and efficiency of pesticide applications.

  2. Transparent self-cleaning lubricant-infused surfaces made with large-area breath figure patterns (United States)

    Zhang, Pengfei; Chen, Huawei; Zhang, Liwen; Ran, Tong; Zhang, Deyuan


    Nepenthes pitcher inspired slippery lubricant-infused porous surfaces greatly impact the understanding of liquid-repellent surfaces construction and have attracted extensive attention in recent years due to their potential applications in self-cleaning, anti-fouling, anti-icing, etc. In this work, we have successfully fabricated transparent slippery lubricant-infused surfaces based on breath figure patterns (BFPs). Large-area BFPs with interconnected pores were initially formed on the glass substrate and then a suitable lubricant was added onto the surfaces. The interconnected pores in BFPs were able to hold the lubricant liquid in place and form a stable liquid/solid composite surface capable of repelling a variety of liquids. The liquid-repellent surfaces show extremely low critical sliding angles for various liquids, thus providing the surfaces with efficient self-cleaning property. It was also found that the liquid droplets' sliding behaviors on the surfaces were significantly influenced by the tilting angle of the substrate, liquid volume, liquid chemical properties, and pore sizes of the surfaces.

  3. VBA SSA Acc To Fed Rec Online (SAFRO) - Also known as Veterans Benefit Administration Query (VBAQ). (United States)

    Social Security Administration — The purpose of this query is to provide SSA field office personnel with real-time access to military discharge data from the VA BIRLS database. This information is...

  4. Shock Hazard Prevention through Self-Healing Insulative Coating on SSA Metallic Bearings, Phase II (United States)

    National Aeronautics and Space Administration — The space suit assembly (SSA) contains metallic bearings at the wrist, neck, and waist, which are exposed to space environment, and pose a potential shock hazard....

  5. Resonance assignments for the substrate binding domain of Hsp70 chaperone Ssa1 from Saccharomyces cerevisiae. (United States)

    Hu, Wanhui; Wu, Huiwen; Zhang, Hong; Gong, Weibin; Perrett, Sarah


    Hsp70 chaperone proteins play crucial roles in the cell. Extensive structural and functional studies have been performed for bacterial and mammalian Hsp70s. Ssa1 from Saccharomyces cerevisiae is a member of the Hsp70 family. In vivo and biochemical studies on Ssa1 have revealed that it regulates prion propagation and the cell cycle. However, no structural data has been obtained for Ssa1 up to now. Here we report the almost complete (96 %) (1)H, (13)C, (15)N backbone and side chain NMR assignment of the 18.8 kDa Ssa1 substrate binding domain. The construct includes residues 382-554, which corresponds to the entire substrate binding domain and two following α-helices in homologous structures. The secondary structure predicted from the assigned chemical shifts is consistent with that of homologous Hsp70 substrate binding domains.

  6. BOREAS TE-18 Landsat TM Physical Classification Image of the SSA (United States)

    National Aeronautics and Space Administration — ABSTRACT: The objective of this classification is to provide BOREAS investigators with a data product that characterizes the land cover of the SSA. A Landsat-5 TM...

  7. Surface area and the seabed area, volume, depth, slope, and topographic variation for the world's seas, oceans, and countries. (United States)

    Costello, Mark John; Cheung, Alan; De Hauwere, Nathalie


    Depth and topography directly and indirectly influence most ocean environmental conditions, including light penetration and photosynthesis, sedimentation, current movements and stratification, and thus temperature and oxygen gradients. These parameters are thus likely to influence species distribution patterns and productivity in the oceans. They may be considered the foundation for any standardized classification of ocean ecosystems and important correlates of metrics of biodiversity (e.g., species richness and composition, fisheries). While statistics on ocean depth and topography are often quoted, how they were derived is rarely cited, and unless calculated using the same spatial resolution the resulting statistics will not be strictly comparable. We provide such statistics using the best available resolution (1-min) global bathymetry, and open source digital maps of the world's seas and oceans and countries' Exclusive Economic Zones, using a standardized methodology. We created a terrain map and calculated sea surface and seabed area, volume, and mean, standard deviation, maximum, and minimum, of both depth and slope. All the source data and our database are freely available online. We found that although the ocean is flat, and up to 71% of the area has a ocean volume exceeds 1.3 billion km(3) (or 1.3 sextillion liters), and sea surface and seabed areas over 354 million km(2). We propose the coefficient of variation of slope as an index of topographic heterogeneity. Future studies may improve on this database, for example by using a more detailed bathymetry, and in situ measured data. The database could be used to classify ocean features, such as abyssal plains, ridges, and slopes, and thus provide the basis for a standards based classification of ocean topography.

  8. Possible role of anti-SSA/Ro antibodies in the pathogenesis of pulmonary hypertension

    Directory of Open Access Journals (Sweden)

    Kelsey Guerreso


    Conclusion: It is known that pulmonary hypertension has association with autoimmune diseases, however no clear markers yet exist. Anti-SSA/Ro antibodies have been rarely described in cases of pulmonary disease, and less so in pulmonary hypertension. This case describes a unique association between isolated pulmonary hypertension and anti-SSA/Ro antibody, thereby illustrating the need to investigate this autoantibody and others in the pathogenesis of autoimmune pulmonary hypertension.

  9. Newborn infant with maternal anti-SSA antibody-induced complete heart block accompanying cardiomyopathy. (United States)

    Iida, Midori; Inamura, Noboru; Takeuchi, Makoto


    Newborn case of maternal anti-SSA antibody-induced congenital complete heart block (CCHB) accompanying cardiomyopathy is presented. Unexpectedly, she died of ventricular tachycardia, not bradycardia, 6 days after birth. Autopsy revealed left ventricular cardiomyopathy with endocardial fibroelastosis. Thus, when evaluating fetal cardiac performance in cases of maternal anti-SSA antibody-induced CCHB, it is necessary to pay attention to myocardial attributes such as endocardial hyperplasia.

  10. Impact of microstructure evolution on the difference between geometric and reactive surface areas in natural chalk (United States)

    Yang, Y.; Bruns, S.; Stipp, S. L. S.; Sørensen, H. O.


    The coupling between flow and mineral dissolution drives the evolution of many natural and engineered flow systems. Pore surface changes as microstructure evolves but this transient behaviour has traditionally been difficult to model. We combined a reactor network model with experimental, greyscale tomography data to establish the morphological grounds for differences among geometric, reactive and apparent surface areas in dissolving chalk. This approach allowed us to study the effects of initial geometry and macroscopic flow rate independently. The simulations showed that geometric surface, which represents a form of local transport heterogeneity, increases in an imposed flow field, even when the porous structure is chemically homogeneous. Hence, the fluid-reaction coupling leads to solid channelisation, which further results in fluid focusing and an increase in geometric surface area. Fluid focusing decreases the area of reactive surface and the residence time of reactant, both contribute to the over-normalisation of reaction rate. In addition, the growing and merging of microchannels, near the fluid entrance, contribute to the macroscopic, fast initial dissolution rate of rocks.

  11. Changes in thickness and surface area of the human cortex and their relationship with intelligence. (United States)

    Schnack, Hugo G; van Haren, Neeltje E M; Brouwer, Rachel M; Evans, Alan; Durston, Sarah; Boomsma, Dorret I; Kahn, René S; Hulshoff Pol, Hilleke E


    Changes in cortical thickness over time have been related to intelligence, but whether changes in cortical surface area are related to general cognitive functioning is unknown. We therefore examined the relationship between intelligence quotient (IQ) and changes in cortical thickness and surface over time in 504 healthy subjects. At 10 years of age, more intelligent children have a slightly thinner cortex than children with a lower IQ. This relationship becomes more pronounced with increasing age: with higher IQ, a faster thinning of the cortex is found over time. In the more intelligent young adults, this relationship reverses so that by the age of 42 a thicker cortex is associated with higher intelligence. In contrast, cortical surface is larger in more intelligent children at the age of 10. The cortical surface is still expanding, reaching its maximum area during adolescence. With higher IQ, cortical expansion is completed at a younger age; and once completed, surface area decreases at a higher rate. These findings suggest that intelligence may be more related to the magnitude and timing of changes in brain structure during development than to brain structure per se, and that the cortex is never completed but shows continuing intelligence-dependent development. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail:

  12. Ambient pressure dried tetrapropoxysilane-based silica aerogels with high specific surface area (United States)

    Parale, Vinayak G.; Han, Wooje; Jung, Hae-Noo-Ree; Lee, Kyu-Yeon; Park, Hyung-Ho


    In the present paper, we report the synthesis of tetrapropoxysilane (TPOS)-based silica aerogels with high surface area and large pore volume. The silica aerogels were prepared by a two-step sol-gel process followed by surface modification via a simple ambient pressure drying approach. In order to minimize drying shrinkage and obtain hydrophobic aerogels, the surface of the alcogels was modified using trichloromethylsilane as a silylating agent. The effect of the sol-gel compositional parameters on the polymerization of aerogels prepared by TPOS, one of the precursors belonging to the Si(OR)4 family, was reported for the first time. The oxalic acid and NH4OH concentrations were adjusted to achieve good-quality aerogels with high surface area, low density, and high transparency. Controlling the hydrolysis and condensation reactions of the TPOS precursor turned out to be the most important factor to determine the pore characteristics of the aerogel. Highly transparent aerogels with high specific surface area (938 m2/g) and low density (0.047 g/cm3) could be obtained using an optimized TPOS/MeOH molar ratio with appropriate concentrations of oxalic acid and NH4OH.

  13. Quality of surface-water supplies in the Triangle area of North Carolina, water year 2008 (United States)

    Giorgino, M.J.; Rasmussen, R.B.; Pfeifle, C.A.


    Surface-water supplies are important sources of drinking water for residents in the Triangle area of North Carolina, which is located within the upper Cape Fear and Neuse River Basins. Since 1988, the U.S. Geological Survey and a consortium of governments have tracked water-quality conditions and trends in several of the area's water-supply lakes and streams. This report summarizes data collected through this cooperative effort, known as the Triangle Area Water Supply Monitoring Project, during October 2007 through September 2008. Major findings for this period include:

  14. Minimal area surfaces dual to Wilson loops and the Mathieu equation

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Changyu; He, Yifei; Kruczenski, Martin [Department of Physics and Astronomy, Purdue University, 525 Northwestern Avenue, W. Lafayette, IN, 47907-2036 (United States)


    The AdS/CFT correspondence relates Wilson loops in N=4 SYM to minimal area surfaces in AdS{sub 5}×S{sup 5} space. Recently, a new approach to study minimal area surfaces in AdS{sub 3}⊂AdS{sub 5} was discussed based on a Schroedinger equation with a periodic potential determined by the Schwarzian derivative of the shape of the Wilson loop. Here we use the Mathieu equation, a standard example of a periodic potential, to obtain a class of Wilson loops such that the area of the dual minimal area surface can be computed analytically in terms of eigenvalues of such equation. As opposed to previous examples, these minimal surfaces have an umbilical point (where the principal curvatures are equal) and are invariant under λ-deformations. In various limits they reduce to the single and multiple wound circular Wilson loop and to the regular light-like polygons studied by Alday and Maldacena. In this last limit, the periodic potential becomes a series of deep wells each related to a light-like segment. Small corrections are described by a tight-binding approximation. In the circular limit they are well approximated by an expansion developed by A. Dekel. In the particular case of no umbilical points they reduce to a previous solution proposed by J. Toledo. The construction works both in Euclidean and Minkowski signature of AdS{sub 3}.

  15. Minimal area surfaces dual to Wilson loops and the Mathieu equation (United States)

    Huang, Changyu; He, Yifei; Kruczenski, Martin


    The AdS/CFT correspondence relates Wilson loops in {N}=4 SYM to minimal area surfaces in AdS 5 × S 5 space. Recently, a new approach to study minimal area surfaces in AdS 3 ⊂ AdS 5 was discussed based on a Schroedinger equation with a periodic potential determined by the Schwarzian derivative of the shape of the Wilson loop. Here we use the Mathieu equation, a standard example of a periodic potential, to obtain a class of Wilson loops such that the area of the dual minimal area surface can be computed analytically in terms of eigenvalues of such equation. As opposed to previous examples, these minimal surfaces have an umbilical point (where the principal curvatures are equal) and are invariant under λ-deformations. In various limits they reduce to the single and multiple wound circular Wilson loop and to the regular light-like polygons studied by Alday and Maldacena. In this last limit, the periodic potential becomes a series of deep wells each related to a light-like segment. Small corrections are described by a tight-binding approximation. In the circular limit they are well approximated by an expansion developed by A. Dekel. In the particular case of no umbilical points they reduce to a previous solution proposed by J. Toledo. The construction works both in Euclidean and Minkowski signature of AdS 3.

  16. Lp-dual affine surface area forms of Busemann–Petty type problems

    Indian Academy of Sciences (India)

    (Math. Sci.) Vol. 125, No. 1, February 2015, pp. 71–77. c Indian Academy of Sciences. Lp-dual affine surface area forms of Busemann–Petty type problems ..... problem in three dimensions,. Ann. Math. 140(2) (1994) 435–447. [4] Gardner R J, Geometric tomography, 2nd edn (2006) (Cambridge, UK: Cambridge Univ. Press).

  17. Specific surface area behavior of a dissolving population of particles. Augmenting Mercer Dissolution Theory

    International Nuclear Information System (INIS)

    Scripsick, R.C.; Rothenberg, S.J.


    Specific surface area (Sp) measurements were made on two uranium oxide aerosol materials before and after in vitro dissolution studies were performed on the materials. The results of these Sp measurements were evaluated relative to predictions made from extending Mercer dissolution theory to describe the Sp behavior of a dissolving population of particles

  18. Periodic Mesoporous Organosilica Nanocubes with Ultrahigh Surface Areas for Efficient CO2 Adsorption (United States)

    Wei, Yong; Li, Xiaomin; Zhang, Renyuan; Liu, Yong; Wang, Wenxing; Ling, Yun; El-Toni, Ahmed Mohamed; Zhao, Dongyuan


    Ultrahigh surface area single-crystals of periodic mesoporous organosilica (PMOs) with uniform cubic or truncated-cubic morphology and organic/inorganic components homogeneously distributed over the whole frameworks have successfully been prepared by a sol-gel surfactant-templating method. By tuning the porous feature and polymerization degree, the surface areas of the obtained PMO nanocubes can reach as high as 2370 m2/g, which is the highest for silica-based mesoporous materials. The ultrahigh surface area of the obtained PMO single crystals is mainly resulted from abundant micropores in the mesoporous frameworks. Furthermore, the diameter of the nanocubes can also be well controlled from 150 to 600 nm. The materials show ultrahigh CO2 adsorption capacity (up to 1.42 mmol/g at 273 K) which is much higher than other porous silica materials and comparable to some carbonaceous materials. The adsorption of CO2 into the PMO nanocubes is mainly in physical interaction, therefore the adsorption-desorption process is highly reversible and the adsorption capacity is much dependent on the surface area of the materials. Moreover, the selectivity is also very high (~11 times to N2) towards CO2 adsorption.

  19. Area densitometry using rotating Scheimpflug photography for posterior capsule opacification and surface light scattering analyses. (United States)

    Minami, Keiichiro; Honbo, Masato; Mori, Yosai; Kataoka, Yasushi; Miyata, Kazunori


    To compare area densitometry analysis using rotating Scheimpflug photography in quantifications of posterior capsule opacification (PCO) and surface light scattering with previous anterior-segment analyzer measurement. Miyata Eye Hospital, Miyazaki, Japan. Prospective observational case series. Scheimpflug images of eyes with foldable intraocular lenses (IOLs) were obtained using rotating and fixed Scheimpflug photography. Area densitometry on the posterior and anterior surfaces was conducted for PCO and surface light scattering analyses, respectively, with an identical area size. Correlation between two measurements was analyzed using linear regression. The study included 105 eyes of 74 patients who received IOLs 1 to 18 years (mean, 4.9 ± 4.5 years) postoperatively. In the PCO analysis on the posterior IOL surface, there was a significant correlation between the two measurements (P photography exhibited saturation due to intensive scatterings. Area densitometry combined with a rotating Scheimpflug photography was exchangeable to previously established densitometry measurement, and allowed successive evaluation in longer-term observations. Copyright © 2015 ASCRS and ESCRS. Published by Elsevier Inc. All rights reserved.

  20. Characterization of pigment-leached antifouling coatings using BET surface area measurements and mercury porosimetry

    DEFF Research Database (Denmark)

    Kiil, Søren; Dam-Johansen, Kim


    In this work BET surface area measurements and mercury porosimetry are used to characterize leached layers formed when seawater-soluble pigments (Cu2O and ZnO) dissolve during accelerated leaching of simple antifouling coatings. Measurements on single-pigment coatings show that an increasing...

  1. Surface area of lactose and lactose granulates on consolidation and compaction

    NARCIS (Netherlands)

    Riepma, Klaas Alouis


    This dissertation discusses the effect of short time storage at different conditions on the strength and the specific BET surface area of lactose tablets. In addition, some aspects are studied of the consolidation and compaction properties of crystalline lactose fractions in heterogeneous systems.

  2. Dose banding as an alternative to body surface area-based dosing of chemotherapeutic agents

    NARCIS (Netherlands)

    E. Chatelut (Etienne); M.L. White-Koning (M.); A.H.J. Mathijssen (Ron); F. Puisset (F.); S.D. Baker (Sharyn); A. Sparreboom (Alex)


    textabstractBackground: Dose banding is a recently suggested dosing method that uses predefined ranges (bands) of body surface area (BSA) to calculate each patients dose by using a single BSA-value per band. Thus, drugs with sufficient long-term stability can be prepared in advance. The main

  3. High surface area carbon for bifunctional air electrodes applied in zinc-air batteries

    Energy Technology Data Exchange (ETDEWEB)

    Arai, H. [on leave from NTT Laboratories (Japan); Mueller, S.; Haas, O. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)


    Bifunctional air electrodes with high surface area carbon substrates showed low reduction overpotential, thus are promising for enhancing the energy efficiency and power capability of zinc-air batteries. The improved performance is attributed to lower overpotential due to diffusion of the reaction intermediate, namely the peroxide ion. (author) 1 fig., 2 refs.

  4. A method for increasing the surface area of perovskite-type oxides

    Indian Academy of Sciences (India)

    combustion of methane at different temperatures (450–600oC) has been thoroughly investigated. The hydrothermal treatments result in the activation of the perovskite oxides by increasing their surface area very markedly. Keywords. ABO3-type perovskite oxides; LaCoO3; LaMnO3; hydrothermal treatment; catalytic ...

  5. Should blood flow during cardiopulmonary bypass be individualized more than to body surface area?

    DEFF Research Database (Denmark)

    Thomassen, Sisse Anette; Larsson, A; Andreasen, Jan Jesper

    Blood flow during cardiopulmonary bypass (CPB) is calculated on body surface area (BSA). Increasing comorbidity, age and weight of today's cardiac patients question this calculation as it may not reflect individual metabolic requirement. The hypothesis was that a measured cardiac index (CI) prior...... not improve cerebral and systemic oxygenation compared to a blood flow based on BSA....

  6. Mapping surface flow in low gradient areas with thermal remote sensing

    DEFF Research Database (Denmark)

    Prinds, Christian; Petersen, Rasmus Jes; Greve, Mogens Humlekrog

    Thermal infrared (TIR) imagery has long been used for mapping groundwater-surface water interactions and mainly for locating areas of groundwater seepage in lakes and shorelines (Rundquist et al. 1985, Banks et al. 1996). In this study, we used the method for locating discharge from tile drains...

  7. A method for increasing the surface area of perovskite-type oxides

    Indian Academy of Sciences (India)

    700oC (v), 800oC ( ) and without water treatment (U). The increase in the surface area of the perovskite-type oxides and the observed decrease in the crystal size by the steam treatment at 350–800oC are expected because of the recrystallization during the high temperature hydrothermal treatment depending upon the.

  8. Amylolytic hydrolysis of native starch granules affected by granule surface area. (United States)

    Kim, J C; Kong, B W; Kim, M J; Lee, S H


    Initial stage of hydrolysis of native starch granules with various amylolytic enzymes, alpha-amylase from Bacillus subtilis, glucoamylase I (GA-I) and II (GA-II) from Aspergillus niger, and beta-amylase from sweet potato showed that the reaction was apparently affected by a specific surface area of the starch granules. The ratios of the reciprocal of initial velocity of each amylolytic hydrolysis for native potato and maize starch to that for rice with the amylolytic enzymes were nearly equivalent to the ratio of surface area per mass of the 2 starch granules to that of rice, that is, 6.94 and 2.25, respectively. Thus, the reciprocal of initial velocity of each enzymatic hydrolysis as expressed in a Lineweaver-Burk plot was a linear function of the reciprocal of surface area for each starch granule. As a result, it is concluded that amylolytic hydrolysis of native starch granules is governed by the specific surface area, not by the mass concentration, of each granule.

  9. Specific surface area effect on adsorption of chlorpyrifos and TCP by soils and modeling (United States)

    The adsorption of chlorpyrifos and TCP (3,5,6, trichloro-2-pyridinol) was determined in four soils (Mollisol, Inceptisol, Entisol, Alfisol) having different specific surface areas (19–84 m2/g) but rather similar organic matter content (2.4–3.5%). Adsorption isotherms were derived from batch equilibr...

  10. Preparation of MgO Catalytic Support in Shaped Mesoporous High Surface Area Form

    Czech Academy of Sciences Publication Activity Database

    Gulková, Daniela; Šolcová, Olga; Zdražil, Miroslav


    Roč. 76, 1-3 (2004), s. 137-149 ISSN 1387-1811 R&D Projects: GA AV ČR IAA4072306 Institutional research plan: CEZ:AV0Z4072921 Keywords : MgO support * sigh Surface area * texture Subject RIV: CC - Organic Chemistry Impact factor: 2.093, year: 2004

  11. Thermal stability of porous sol-gel phosphosilicates and their surface area stabilisation by lanthanum addition

    NARCIS (Netherlands)

    Falco, Lorena; De Mendonca, Mariana Van Den Tempel; Mercadal, Juan J.; Zarubina, Valeriya; Melián-Cabrera, Ignacio


    The thermal stability of porous sol-gel phosphosilicates was studied by comparing the textural features upon calcination between 400 and 550 °C. A significant loss of surface area and pore volume were observed; the first is due to thermal coarsening of the nanoparticles, and the pore volume

  12. Allometric relationships for surface area and dry mass of young Norway spruce aboveground organs

    Czech Academy of Sciences Publication Activity Database

    Pokorný, Radek; Tomášková, Ivana

    53 2007, č. 12 (2007), s. 548-554 ISSN 1212-4834 R&D Projects: GA MŽP(CZ) SP/2D1/93/07 Institutional research plan: CEZ:AV0Z60870520 Keywords : allometry * biomass, * Picea abies * sapwood * surface area Subject RIV: GK - Forestry

  13. Estimating the surface area of non-convex particles from central planar sections

    DEFF Research Database (Denmark)

    Thórisdóttir, Ólöf; H.Rafati, Ali; Kiderlen, Markus

    . The Morse type estimator is well suited for computer assisted confocal microscopy and we demonstrate its practicability in a biological application: the surface area estimation of the nuclei of giant-cell glioblastoma from microscopy images. We also present an interactive software that allows the user...

  14. Flow analysis of water-powder mixtures: Application to specific surface area and shape factor

    NARCIS (Netherlands)

    Hunger, Martin; Brouwers, Jos


    This paper addresses the characterization of powder materials with respect to their application in concrete. Given that powders provide by far highest percentage of specific surface area in a concrete mix, their packing behavior and water demand is of vital interest for the design of concrete. They

  15. Turbostratic boron nitride coated on high-surface area metal oxide templates

    DEFF Research Database (Denmark)

    Klitgaard, Søren Kegnæs; Egeblad, Kresten; Brorson, M.


    Boron nitride coatings on high-surface area MgAl2O4 and Al2O3 have been synthesized and characterized by transmission electron microscopy and by X-ray powder diffraction. The metal oxide templates were coated with boron nitride using a simple nitridation in a flow of ammonia starting from ammonium...

  16. Condensation-Enhanced Self-Assembly as a Route to High Surface Area alpha-Aluminas

    NARCIS (Netherlands)

    Perez, Lidia Lopez; Zarubina, Valeriya; Heeres, Hero Jan; Melian-Cabrera, Ignacio


    High surface area nanosized alpha-alumina has been obtained by thermally treating a sol-gel-derived mesophase at 1200 degrees C; the mesophase was synthesized by a sol-gel route involving evaporation induced self-assembly (EISA) of a hydrolyzed gel from Al-tri-sec-butoxide in s-BuOH in the presence

  17. Strong and tough cellulose nanopaper with high specific surface area and porosity. (United States)

    Sehaqui, Houssine; Zhou, Qi; Ikkala, Olli; Berglund, Lars A


    In order to better understand nanostructured fiber networks, effects from high specific surface area of nanofibers are important to explore. For cellulose networks, this has so far only been achieved in nonfibrous regenerated cellulose aerogels. Here, nanofibrillated cellulose (NFC) is used to prepare high surface area nanopaper structures, and the mechanical properties are measured in tensile tests. The water in NFC hydrogels is exchanged to liquid CO2, supercritical CO2, and tert-butanol, followed by evaporation, supercritical drying, and sublimation, respectively. The porosity range is 40-86%. The nanofiber network structure in nanopaper is characterized by FE-SEM and nitrogen adsorption, and specific surface area is determined. High-porosity TEMPO-oxidized NFC nanopaper (56% porosity) prepared by critical point drying has a specific surface area as high as 482 m(2) g(-1). The mechanical properties of this nanopaper structure are better than for many thermoplastics, but at a significantly lower density of only 640 kg m(-3). The modulus is 1.4 GPa, tensile strength 84 MPa, and strain-to-failure 17%. Compared with water-dried nanopaper, the material is softer with substantiallly different deformation behavior.

  18. Escaping the correction for body surface area when calculating glomerular filtration rate in children

    Energy Technology Data Exchange (ETDEWEB)

    Piepsz, Amy; Tondeur, Marianne [CHU St. Pierre, Department of Radioisotopes, Brussels (Belgium); Ham, Hamphrey [University Hospital Ghent, Department of Nuclear Medicine, Ghent (Belgium)


    {sup 51}Cr ethylene diamine tetraacetic acid ({sup 51}Cr EDTA) clearance is nowadays considered as an accurate and reproducible method for measuring glomerular filtration rate (GFR) in children. Normal values in function of age, corrected for body surface area, have been recently updated. However, much criticism has been expressed about the validity of body surface area correction. The aim of the present paper was to present the normal GFR values, not corrected for body surface area, with the associated percentile curves. For that purpose, the same patients as in the previous paper were selected, namely those with no recent urinary tract infection, having a normal left to right {sup 99m}Tc MAG3 uptake ratio and a normal kidney morphology on the early parenchymal images. A single blood sample method was used for {sup 51}Cr EDTA clearance measurement. Clearance values, not corrected for body surface area, increased progressively up to the adolescence. The percentile curves were determined and allow, for a single patient, to estimate accurately the level of non-corrected clearance and the evolution with time, whatever the age. (orig.)

  19. Uncovering surface area and micropores in almond shell biochars by rainwater wash (United States)

    Biochars have been considered for adsorption of contaminants in soil and water, as well as conditioning and improving soil quality. One important property of the biochar is surface area in the pores of the biochar. Biochars were created from almond shells from two almond varieties with different ash...

  20. GillespieSSA: Implementing the Gillespie Stochastic Simulation Algorithm in R

    Directory of Open Access Journals (Sweden)

    Mario Pineda-Krch


    Full Text Available The deterministic dynamics of populations in continuous time are traditionally described using coupled, first-order ordinary differential equations. While this approach is accurate for large systems, it is often inadequate for small systems where key species may be present in small numbers or where key reactions occur at a low rate. The Gillespie stochastic simulation algorithm (SSA is a procedure for generating time-evolution trajectories of finite populations in continuous time and has become the standard algorithm for these types of stochastic models. This article presents a simple-to-use and flexible framework for implementing the SSA using the high-level statistical computing language R and the package GillespieSSA. Using three ecological models as examples (logistic growth, Rosenzweig-MacArthur predator-prey model, and Kermack-McKendrick SIRS metapopulation model, this paper shows how a deterministic model can be formulated as a finite-population stochastic model within the framework of SSA theory and how it can be implemented in R. Simulations of the stochastic models are performed using four different SSA Monte Carlo methods: one exact method (Gillespie's direct method; and three approximate methods (explicit, binomial, and optimized tau-leap methods. Comparison of simulation results confirms that while the time-evolution trajectories obtained from the different SSA methods are indistinguishable, the approximate methods are up to four orders of magnitude faster than the exact methods.

  1. Surface water and groundwater interaction in selected areas of Indus basin

    International Nuclear Information System (INIS)

    Akram, W.; Ahmad, M.; Tariq, J.A.; Latif, Z.; Malik, M.R.


    Isotope hydrological investigations were carried out in Marala-Khanki Area of Punjab for elucidating various aspects of surface water and groundwater interaction. Groundwater samples were collected on seasonal basis (low and high river discharge periods) while surface water (Chenab River) samples were collected more frequently (weekly or monthly basis). Isotopic data suggested that there is no significant contribution of surface water to groundwater recharge in Marala-Khanki Area and rain is the prevailing source of groundwater recharge. The data further revealed that isotopic values of Tarbala lake are higher than those of main lake. Indus river meaning that there is significant contribution of base flow in this pocket. Isotopic data of Indus river showed an increase at Tunsa as compared to Chashma in flow period indicating the high contribution of base flow at this point in time. Stable isotopes were successfully used to quantify the base flow contribution. (author)

  2. A Three-Dimensional Enormous Surface Area Aluminum Microneedle Array with Nanoporous Structure

    Directory of Open Access Journals (Sweden)

    Po Chun Chen


    Full Text Available We proposed fabricating an aluminum microneedle array with a nanochannel structure on the surface by combining micromachining, electrolyte polishing, and anodization methods. The microneedle array provides a three-dimensional (3D structure that possesses several hundred times more surface area than a traditional nanochannel template. Therefore, the microneedle array can potentially be used in many technology applications. This 3D microneedle array device can not only be used for painless injection or extraction, but also for storage, highly sensitive detection, drug delivery, and microelectrodes. From the calculation we made, the microneedle array not only increases surface area, but also enlarges the capacity of the device. Therefore, the microneedle array can further be used on many detecting, storing, or drug delivering applications.

  3. A Three-Dimensional Enormous Surface Area Aluminum Microneedle Array with Nanoporous Structure

    International Nuclear Information System (INIS)

    Chen, P.Ch.; Zou, J.; Hsieh, Sh.J.; Chen, Ch.Ch.


    We proposed fabricating an aluminum micro needle array with a nano channel structure on the surface by combining micromachining, electrolyte polishing, and anodization methods. The micro needle array provides a three-dimensional (3D) structure that possesses several hundred times more surface area than a traditional nano channel template. Therefore, the micro needle array can potentially be used in many technology applications. This 3D micro needle array device can not only be used for painless injection or extraction, but also for storage, highly sensitive detection, drug delivery, and microelectrodes. From the calculation we made, the micro needle array not only increases surface area, but also enlarges the capacity of the device. Therefore, the micro needle array can further be used on many detecting, storing, or drug delivering applications.

  4. Seeded on-surface supramolecular growth for large area conductive donor-acceptor assembly. (United States)

    Goudappagouda; Chithiravel, Sundaresan; Krishnamoorthy, Kothandam; Gosavi, Suresh W; Babu, Sukumaran Santhosh


    Charge transport features of organic semiconductor assemblies are of paramount importance. However, large-area extended supramolecular structures of donor-acceptor combinations with controlled self-assembly pathways are hardly accessible. In this context, as a representative example, seeded on-surface supramolecular growth of tetrathiafulvalene and tetracyano-p-quinodimethane (TTF-TCNQ) using active termini of solution-formed sheaves has been introduced to form an extended assembly. We demonstrate for the first time, the creation of a large-area donor-acceptor assembly on the surface, which is practically very tedious, using a seeded, evaporation-assisted growth process. The excellent molecular ordering in this assembly is substantiated by its good electrical conductivity (~10⁻² S cm⁻¹). The on-surface assembly via both internally formed and externally added sheaf-like seeds open new pathways in supramolecular chemistry and device applications.

  5. Investigation on large-area fabrication of vivid shark skin with superior surface functions (United States)

    Chen, Huawei; Zhang, Xin; Ma, Lingxi; Che, Da; Zhang, Deyuan; Sudarshan, T. S.


    Shark skin has attracted worldwide attention because of its superior drag reduction, antifouling performance induced from its unique surface morphology. Although the vivid shark skin has been fabricated by a bio-replicated micro-imprinting approach in previous studies and superior drag reduction effect has been validated in water tunnel, continuous large-area fabrication is still an obstacle to wide apply. In this paper, one novel bio-replication coating technology is proposed for large-area transfer of shark skin based on rapid UV curable paint. Apart from design of coating system, bio-replication accuracy of surface morphology was validated about 97% by comparison between shark skin template and coating surface morphology. Finally, the drag reduction and anti-fouling function of coating surface were tested in water tunnel and open algae pond respectively. Drag reduction rate of coating surface was validated about 12% higher and anti-fouling was proved to about hundred times ameliorate, all of which are more excellent than simple 2D riblet surface.

  6. Fire-induced albedo change and surface radiative forcing in sub-Saharan Africa savanna ecosystems: Implications for the energy balance (United States)

    Dintwe, Kebonye; Okin, Gregory S.; Xue, Yongkang


    Surface albedo is a critical parameter that controls surface energy balance. In dryland ecosystems, fires play a significant role in decreasing surface albedo, resulting in positive radiative forcing. Here we investigate the long-term effect of fire on surface albedo. We devised a method to calculate short-, medium-, and long-term effect of fire-induced radiative forcing and their relative effects on energy balance. We used Moderate Resolution Imaging Spectroradiometer (MODIS) data in our analysis, covering different vegetation classes in sub-Saharan Africa (SSA). Our analysis indicated that mean short-term fire-induced albedo change in SSA was -0.022, -0.035, and -0.041 for savannas, shrubland, and grasslands, respectively. At regional scale, mean fire-induced albedo change in savannas was -0.018 and -0.024 for northern sub-Saharan of Africa and the southern hemisphere Africa, respectively. The short-term mean fire-induced radiative forcing in burned areas in sub-Saharan Africa (SSA) was 5.41 W m-2, which contributed continental and global radiative forcings of 0.25 and 0.058 W m-2, respectively. The impact of fire in surface albedo has long-lasting effects that varies with vegetation type. The long-term energetic effects of fire-induced albedo change and associated radiative forcing were, on average, more than 19 times greater across SSA than the short-term effects, suggesting that fires exerted far more radiative forcing than previously thought. Taking into account the actual duration of fire's effect on surface albedo, we conclude that the contribution of SSA fires, globally and throughout the year, is 0.12 W m-2. These findings provide crucial information on possible impact of fire on regional climate variability.

  7. Perfluorinated compounds in soil, surface water, and groundwater from rural areas in eastern China. (United States)

    Chen, Shu; Jiao, Xing-Chun; Gai, Nan; Li, Xiao-Jie; Wang, Xiao-Chun; Lu, Guo-Hui; Piao, Hai-Tao; Rao, Zhu; Yang, Yong-Liang


    Little research on perfluorinated compounds (PFCs) has been conducted in rural areas, although rural PFC sources are less complicated than in urban and industrial areas. To determine the levels and geographical distribution of 17 PFC compounds, samples of soil, surface water, and groundwater were collected from eight rural areas in eastern China. The total PFC concentrations (∑PFCs) in soils ranged from 0.34 to 65.8 ng/g ∑PFCs in surface waters ranged from 7.0 to 489 ng/L and ∑PFCs in groundwater ranged from 5.3 to 615 ng/L. Ratios of perfluorononanoic acid/perfluorooctanoic acid (PFNA/PFOA), perfluoro-n-butyric acid/perfluorooctanoic acid (PFBA/PFOA), and perfluoroheptanoic acid/perfluorooctanoic acid (PFHpA/PFOA) in rainwater increased due to the fluorine chemical plants in the surrounding rural and urban areas, suggesting that atmospheric precipitation may carry PFCs and their precursors from the fluorochemical industrial area to the adjacent rural areas. Copyright © 2015 Elsevier Ltd. All rights reserved.

  8. Burning velocity and flame surface area in high Karlovitz number flames (United States)

    Lapointe, Simon; Cheng, Lionel; Blanquart, Guillaume


    Accurate knowledge of the burning velocity of turbulent flames is of importance for many combustion devices. For low Karlovitz number flames, Damkohler proposed that the ratio of turbulent to laminar flame speed is proportional to the ratio of turbulent to laminar flame surface area. In recent DNS studies, it has been observed that Damkolher's scaling for low Karlovitz number flames still holds for high Karlovitz number flames. However, recent experimental studies have reported notable differences between global burning velocities and flame surface area measurements. In this work, the numerical and experimental results are further analyzed to explain the apparent contradiction. Emphasis is placed on identifying and quantifying potential experimental limitations at high Karlovitz numbers. More specifically, experimental flame surface measurements typically use binarized PLIF images. These images are two-dimensional and their resolution is limited by that of the PLIF system. The implications of using a two-dimensional iso-contour and the effects of the image resolution are assessed through post-processing of DNS datasets. Furthermore, the effects of integral length scale, Karlovitz number, and differential diffusion on the flame surface area are considered separately.

  9. Area Estimation of Deep-Sea Surfaces from Oblique Still Images.

    Directory of Open Access Journals (Sweden)

    Frederico Carvalho Dias

    Full Text Available Estimating the area of seabed surfaces from pictures or videos is an important problem in seafloor surveys. This task is complex to achieve with moving platforms such as submersibles, towed or remotely operated vehicles (ROV, where the recording camera is typically not static and provides an oblique view of the seafloor. A new method for obtaining seabed surface area estimates is presented here, using the classical set up of two laser devices fixed to the ROV frame projecting two parallel lines over the seabed. By combining lengths measured directly from the image containing the laser lines, the area of seabed surfaces is estimated, as well as the camera's distance to the seabed, pan and tilt angles. The only parameters required are the distance between the parallel laser lines and the camera's horizontal and vertical angles of view. The method was validated with a controlled in situ experiment using a deep-sea ROV, yielding an area estimate error of 1.5%. Further applications and generalizations of the method are discussed, with emphasis on deep-sea applications.

  10. Nanotechnological Advances in Catalytic Thin Films for Green Large-Area Surfaces

    Directory of Open Access Journals (Sweden)

    Suzan Biran Ay


    Full Text Available Large-area catalytic thin films offer great potential for green technology applications in order to save energy, combat pollution, and reduce global warming. These films, either embedded with nanoparticles, shaped with nanostructuring techniques, hybridized with other systems, or functionalized with bionanotechnological methods, can include many different surface properties including photocatalytic, antifouling, abrasion resistant and mechanically resistive, self-cleaning, antibacterial, hydrophobic, and oleophobic features. Thus, surface functionalization with such advanced structuring methods is of significance to increase the performance and wide usage of large-area thin film coatings specifically for environmental remediation. In this review, we focus on methods to increase the efficiency of catalytic reactions in thin film and hence improve the performance in relevant applications while eliminating high cost with the purpose of widespread usage. However, we also include the most recent hybrid architectures, which have potential to make a transformational change in surface applications as soon as high quality and large area production techniques are available. Hence, we present and discuss research studies regarding both organic and inorganic methods that are used to structure thin films that have potential for large-area and eco-friendly coatings.

  11. The reliability of three psoriasis assessment tools: Psoriasis area and severity index, body surface area and physician global assessment. (United States)

    Bożek, Agnieszka; Reich, Adam


    A wide variety of psoriasis assessment tools have been proposed to evaluate the severity of psoriasis in clinical trials and daily practice. The most frequently used clinical instrument is the psoriasis area and severity index (PASI); however, none of the currently published severity scores used for psoriasis meets all the validation criteria required for an ideal score. The aim of this study was to compare and assess the reliability of 3 commonly used assessment instruments for psoriasis severity: the psoriasis area and severity index (PASI), body surface area (BSA) and physician global assessment (PGA). On the scoring day, 10 trained dermatologists evaluated 9 adult patients with plaque-type psoriasis using the PASI, BSA and PGA. All the subjects were assessed twice by each physician. Correlations between the assessments were analyzed using the Pearson correlation coefficient. Intra-class correlation coefficient (ICC) was calculated to analyze intra-rater reliability, and the coefficient of variation (CV) was used to assess inter-rater variability. Significant correlations were observed among the 3 scales in both assessments. In all 3 scales the ICCs were > 0.75, indicating high intra-rater reliability. The highest ICC was for the BSA (0.96) and the lowest one for the PGA (0.87). The CV for the PGA and PASI were 29.3 and 36.9, respectively, indicating moderate inter-rater variability. The CV for the BSA was 57.1, indicating high inter-rater variability. Comparing the PASI, PGA and BSA, it was shown that the PGA had the highest inter-rater reliability, whereas the BSA had the highest intra-rater reliability. The PASI showed intermediate values in terms of interand intra-rater reliability. None of the 3 assessment instruments showed a significant advantage over the other. A reliable assessment of psoriasis severity requires the use of several independent evaluations simultaneously.

  12. A Study of Impermeable Surfaces in the Greater Washington, D.C. Area


    O'Connor, Mary; Chase-Walsh, Sarah; Cerquiera, Stephen


    The Washington D.C. area, like many cities, is covered with impermeable surfaces. With millions of cars on the roads every year, runoff is a major problem for the Potomac and the Anacostia rivers, which both empty into the Chesapeake Bay. Large buildings, constant construction, and an extensive highway system contribute to and expedite runoff. We will examine the amount of change in impermeable surfaces throughout the years and the effect runoff has on these two rivers. We also want to look a...

  13. The triazine-based porous organic polymer: Novel synthetic strategy for high specific surface area

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jin Kuen [Dept. of Chemistry, Hankuk University of Foreign Studies, Yongin (Korea, Republic of)


    A new type of microporous polymer has been successively synthesized via a simple polycondensation reaction with the 2,4-diaminotriazine moiety and dianhydride monomer. Diaminotriazine moieties in M1 especially can provide effective branching sites, resulting in high surface areas up to 1150 m{sup 2} /g. In addition, the specific pore structure of the polyimide POP in its solid state can be modified by the surface activation method. Therefore, it can be expected that the resulting material will be a promising candidate for gas storage, and with this synthetic strategy, various type of derivatives will also be optimized.

  14. Impervious Surfaces Alter Soil Bacterial Communities in Urban Areas: A Case Study in Beijing, China. (United States)

    Hu, Yinhong; Dou, Xiaolin; Li, Juanyong; Li, Feng


    The rapid expansion of urbanization has caused land cover change, especially the increasing area of impervious surfaces. Such alterations have significant effects on the soil ecosystem by impeding the exchange of gasses, water, and materials between soil and the atmosphere. It is unclear whether impervious surfaces have any effects on soil bacterial diversity and community composition. In the present study, we conducted an investigation of bacterial communities across five typical land cover types, including impervious surfaces (concrete), permeable pavement (bricks with round holes), shrub coverage ( Buxus megistophylla Levl. ), lawns ( Festuca elata Keng ex E. Alexeev ), and roadside trees ( Sophora japonica Linn. ) in Beijing, to explore the response of bacteria to impervious surfaces. The soil bacterial communities were addressed by high-throughput sequencing of the bacterial 16S rRNA gene. We found that Proteobacteria , Actinobacteria , Acidobacteria , Bacteroidetes , Chloroflexi , and Firmicutes were the predominant phyla in urban soils. Soil from impervious surfaces presented a lower bacterial diversity, and differed greatly from other types of land cover. Soil bacterial diversity was predominantly affected by Zn, dissolved organic carbon (DOC), and soil moisture content (SMC). The composition of the bacterial community was similar under shrub coverage, roadside trees, and lawns, but different from beneath impervious surfaces and permeable pavement. Variance partitioning analysis showed that edaphic properties contributed to 12% of the bacterial community variation, heavy metal pollution explained 3.6% of the variation, and interaction between the two explained 33% of the variance. Together, our data indicate that impervious surfaces induced changes in bacterial community composition and decrease of bacterial diversity. Interactions between edaphic properties and heavy metals were here found to change the composition of the bacterial community and diversity

  15. Impervious Surfaces Alter Soil Bacterial Communities in Urban Areas: A Case Study in Beijing, China

    Directory of Open Access Journals (Sweden)

    Yinhong Hu


    Full Text Available The rapid expansion of urbanization has caused land cover change, especially the increasing area of impervious surfaces. Such alterations have significant effects on the soil ecosystem by impeding the exchange of gasses, water, and materials between soil and the atmosphere. It is unclear whether impervious surfaces have any effects on soil bacterial diversity and community composition. In the present study, we conducted an investigation of bacterial communities across five typical land cover types, including impervious surfaces (concrete, permeable pavement (bricks with round holes, shrub coverage (Buxus megistophylla Levl., lawns (Festuca elata Keng ex E. Alexeev, and roadside trees (Sophora japonica Linn. in Beijing, to explore the response of bacteria to impervious surfaces. The soil bacterial communities were addressed by high-throughput sequencing of the bacterial 16S rRNA gene. We found that Proteobacteria, Actinobacteria, Acidobacteria, Bacteroidetes, Chloroflexi, and Firmicutes were the predominant phyla in urban soils. Soil from impervious surfaces presented a lower bacterial diversity, and differed greatly from other types of land cover. Soil bacterial diversity was predominantly affected by Zn, dissolved organic carbon (DOC, and soil moisture content (SMC. The composition of the bacterial community was similar under shrub coverage, roadside trees, and lawns, but different from beneath impervious surfaces and permeable pavement. Variance partitioning analysis showed that edaphic properties contributed to 12% of the bacterial community variation, heavy metal pollution explained 3.6% of the variation, and interaction between the two explained 33% of the variance. Together, our data indicate that impervious surfaces induced changes in bacterial community composition and decrease of bacterial diversity. Interactions between edaphic properties and heavy metals were here found to change the composition of the bacterial community and

  16. Can We Trust Real Time Measurements of Lung Deposited Surface Area Concentrations in Dust from Powder Nanomaterials?

    DEFF Research Database (Denmark)

    Levin, Marcus; Witschger, Olivier; Bau, Sebastien


    A comparison between various methods for real-time measurements of lung deposited surface area (LDSA) using spherical particles and powder dust with specific surface area ranging from 0.03 to 112 m2 g-1 was conducted. LDSA concentrations measured directly using Nanoparticle Surface Area Monitor...... (NSAM) and Aerotrak and were compared to LDSA concentrations recalculated from size distribution measurements using Electrical Low Pressure Impactor (ELPI) and Fast Mobility Particle Sizer (FMPS). FMPS and ELPI measurements were also compared to dust surface area concentrations estimated from...... gravimetrical filter measurements and specific surface areas. Measurement of LDSA showed very good correlation in measurements of spherical particles (R2 > 0.97, Ratio 1.0 to 1.04). High surface area nanomaterial powders showed a fairly reliable correlation between NSAM and Aerotrak (R2 0...

  17. Use of surface area computations to describe atom-atom interactions. (United States)

    de La Cruz, X; Calvo, M


    Accessible surface (ASA) and atomic contact (ACA) areas are powerful tools for protein structure analysis. However, their use for analysis purposes could be extended if a relationship between them and protein stability could be found. At present, this is the case only for ASAs, which have been used to assess the contribution of the hydrophobic effect to protein stability. In the present work we study whether there is a relationship between atomic contact areas and the free energy associated to atom-atom interactions. We utilise a model in which the contribution of atomic interactions to protein stability is expressed as a linear function of the accessible surface area buried between atom pairs. We assess the validity of this hypothesis, using a set of 124 lysozyme mutants (Matthews, 1995, Adv Protein Chem, 249-278) for which both the X-ray structure and the experimental stability are known. We tested this assumption for residue representations with increasing numbers of atom types. Our results indicate that for simple residue representations, with only 4 to 5 atom types, there is not a clear linear relationship between stability and buried accessible area. However, this relationship is observed for representations with 6 to 9 atom types, where gross heterogeneities in the atom type definition are eliminated. Finally, we also study a version of the linear model in which the atom- atom interactions are represented utilising a simple function for the buried accessible area, which may be useful for protein structure prediction studies.

  18. [Distribution Characteristics of Fluoroquinolones Antibiotics in Surface Water and Groundwater from Typical Areas in A City]. (United States)

    Cui, Ya-feng; He, Jiang-tao; Su, Si-hui; Yang, Lei; Qiao, Xiao-cui


    In order to investigate the characteristics of 5 typical kinds of fluoroquinolones (FQs) pollution in waters from a city, surface water and groundwater samples from main drainage rivers and typical areas were collected, respectively. The conventional test and FQs concentrations analysis of the water samples were conducted. The results showed the concentration and composition of FQs in groundwater differed substantially from those in surface water. The average concentration of FQs in surface water was 789.1 ng x L(-1) with the main components of ofloxacin (OFL) and lomefloxacin (LOM). This value was higher than the average concentration of FQs in groundwater: 342.7 ng x L(-1) with the main components of norfloxacin (NOR) and lomefloxacin (LOM). The enrofloxacin (ENR) exhibited relatively lower levels in both surface water and groundwater as compared to others. The highest FQs concentrations in surface water were found in trenches, followed by tributaries and the main stream. For groundwater, FQs concentrations were relatively higher in the sewage riverside. A decreasing trend of FQs concentration was monitored with the increasing distance of sampling points to the drainage rivers and all components mentioned above showed similar changing trends. The results of this study preliminarily indicated that FQs in groundwater along the riverside probably came from the surface water.

  19. Effect of preparation surface area on the clinical outcome of full veneer crowns in dogs. (United States)

    Riehl, Jessica; Soukup, Jason W; Collins, Caitlyn; Siverling, Sarah; Ploeg, Heidi-Lynn; Snyder, Christopher J


    Crown therapy is commonly used in veterinary medicine to provide support to teeth which have previously fractured, received root canal therapy, have significant wear, or experienced other detrimental removal of tooth substance. As with several aspects of veterinary medicine, many of the recommendations or guidelines for crown therapy originate from human dentistry, which are then transferred to veterinary patients. Due to the significant difference in the anatomy of teeth and function of the oral cavity between humans and dogs, these guidelines need to be studied to determine the appropriateness of their use in veterinary patients. This article evaluates the relationship between surface area of the preparation and clinical outcome of full veneer crown therapy of the canine tooth in dogs. Although there appeared to be a positive relationship between preparations with greater surface area and successful clinical outcome, it was not found to be statistically significant.

  20. Phenomenological study of aerosol dry deposition in urban area: surface properties, turbulence and local meteorology influences

    International Nuclear Information System (INIS)

    Roupsard, P.


    Aerosol dry deposition is not much known for urban areas due to the lack of data. Knowledge on this phenomenon is necessary to understand pollutant fluxes in cities and to estimate inhabitant exposition to ionizing radiation of radioactive aerosols. A data providing could enable to enhance dry deposition models for these areas. An original experimental approach is performed to study submicron aerosol dry deposition on urban surfaces. Wind tunnel coupled to in situ experiments give results to study different physical phenomenon governing dry deposition. Dry deposition velocities are measured using aerosol tracers. These data are associated to turbulent and meteorological measured conditions. This database permits to classify the principal physical phenomenon for each experiment type. Finally, different phenomenon must be considered for chronic and acute exposition of urban surfaces to atmospheric particles. (author)

  1. Effect of perfusate hematocrit on urea permeability-surface area in isolated dog lung

    International Nuclear Information System (INIS)

    Parker, R.E.; Roselli, R.J.; Haselton, F.R.; Harris, T.R.


    Seven dog lower left lung lobes were statically inflated and perfused at a constant rate for each lobe with a perfusate in which the hematocrit was altered over a wide range. The permeability-surface area of urea was calculated from multiple indicator dilution curves using two separate injectates for each hematocrit level. One injectate contained only 125 I-albumin as the vascular reference tracer and the other contained both 51 Cr-erythrocytes and 125 I-albumin as the vascular reference tracers; both contained [ 14 C]urea as the permeating tracer. The results strongly indicate that the phenomenon of erythrocyte trapping of urea does not affect the calculation of urea permeability-surface area product provided the appropriate albumin-erythrocyte composite reference tracer is utilized in its calculation

  2. Surface area of lactose and lactose granulates on consolidation and compaction


    Riepma, Klaas Alouis


    This dissertation discusses the effect of short time storage at different conditions on the strength and the specific BET surface area of lactose tablets. In addition, some aspects are studied of the consolidation and compaction properties of crystalline lactose fractions in heterogeneous systems. The crystalline lactose types used are: a-lactose monohydrate, anhydrous a-lactose, crystalline B-lactose and roller dried B-lactose. ... Zie: Summary

  3. Synthesis of high-surface-area spinel-type MgAl2O4 nanoparticles ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 40; Issue 1. Synthesis of high-surface-area spinel-type MgAl 2 O 4 nanoparticles by [Al(sal) 2 (H 2 O) 2 ] 2 [Mg(dipic) 2 ] and [Mg(H 2 O) 6 ][Al(ox) 2 (H 2 O) 2 ] 2 ·5H 2 O: influence of inorganic precursor type. Volume 40 Issue 1 February 2017 pp 45-53 ...

  4. Sensitivity analysis of the surface water- groundwater interaction for the sandy area of the Netherlands


    Gomez del Campo, E.; Jousma, G.; Massop, H.T.L.


    The "Sensitivity Analysis of the Surface Water- Groundwater Interaction for the Sandy Area of the Netherlands" was carried out in the framework of a bilateral research project in support of the implementation of a nationwide geohydrological information system (REGIS) in the Netherlands. This project, conducted in cooperation between the TNO Institute for Applied Scientific Research (IGG-TNO) and !he Winand Staring Centre for Integrated Land, Soil and Water Research (SC-DLO), is aimed at defin...

  5. Formula and Scale for Body Surface Area Estimation in High-Risk Infants


    Ahn, Youngmee


    Advances in medical technology and the health sciences have lead to a rapid increase in the prevalence and morbidity of high-risk infants with chronic or permanent sequels such as the birth of early preterm infants. A suitable formula is therefore needed for body surface area (BSA) estimation for high-risk infants to more accurately devise therapeutic regimes in clinical practice. A cohort study involving 5014 high-risk infants was conducted to develop a suitable formula for estimating BSA us...

  6. High-Surface-Area Porous Platinum Electrodes for Enhanced Charge Transfer


    Hu Yelin; Yella Aswani; Guldin Stefan; Schreier Marcel; Stellacci Francesco; Grätzel Michael; Stefik Morgan


    Cobalt based electrolytes are highly tunable and have pushed the limits of dye sensitized solar cells enabling higher open circuit voltages and new record effi ciencies. However the performance of these electrolytes and a range of other electrolytes suffer from slow electron transfer at platinum counter electrodes. High surface area platinum would enhance catalysis but pure platinum structures are too expensive in practice. Here a material effi cient host guest architecture is developed that ...

  7. n-Alkylamine-assisted preparation of a high surface area vanadyl phosphate/tetraethylorthosilicate nanocomposite

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, João Paulo L., E-mail: [Departamento de Química, Faculdade de Filosofia, Ciências e Letras de Ribeirão Preto, Universidade de São Paulo, Av. Bandeirantes 3900, Ribeirão Preto, SP 14040-901 (Brazil); Zampronio, Elaine C.; Oliveira, Herenilton P. [Departamento de Química, Faculdade de Filosofia, Ciências e Letras de Ribeirão Preto, Universidade de São Paulo, Av. Bandeirantes 3900, Ribeirão Preto, SP 14040-901 (Brazil)


    Graphical abstract: CuK{sub α} X-ray diffraction patterns of the VP, VPOc, VPOcT, VPOcT200 and VPOcT500. Highlights: ► TEOS and octylamine incorporation into the VP was achieved by expanding the lamellar. ► The specific surface area increased from 15 m{sup 2} g{sup −1} in VP to 237 m{sup 2} g{sup −1} in VPOcT. ► The VPOcT exhibited thermal resistance up to 200 °C in air. ► Upon thermal treatment up to 500 °C, the surface area increased to 838 m{sup 2} g{sup −1}. -- Abstract: We have developed a vanadyl phosphate/tetraethylorthosilicate (VPO/TEOS) nanocomposite comprised of silicate chains interleaved with VPO layers, prepared by using an n-alkylamines such as octylamine as the structure directing agent. The nanocomposites were synthesized by reacting amine-intercalated vanadyl phosphate with tetraethylorthosilicate via the soft chemistry approach. The synthetic procedure encompassed the exfoliation of the layered vanadyl phosphate as well as the reorganization of this exfoliated solid into a mesostructured lamellar phase with the same V–P–O connectivity as in the original matrix. TEOS incorporation into the vanadyl phosphate was achieved by expanding the lamellar structure with n-alkylamine (Δd = 13 Å with n-octylamine). The specific surface area increased from 15 m{sup 2} g{sup −1} in the vanadyl phosphate matrix to 237 m{sup 2} g{sup −1} in VPOcT, and the isotherm curves revealed the characteristic hysteresis of mesoporous materials. Upon thermal treatment up to 500 °C, the surface area increased to 837 m{sup 2} g{sup −1}, which is suitable for catalytic purposes.

  8. Growth of Hierarchically Structured High-Surface Area Alumina on FeCrAl Alloy Wires

    Directory of Open Access Journals (Sweden)

    Chandni Rallan


    Full Text Available The formation of metastable alumina phases due to the oxidation of commercial FeCrAl alloy wires (0.5 mm thickness at various temperatures and time periods has been examined. Samples were isothermally oxidised in air using a thermogravimetric analyzer (TGA. The morphology of the oxidised samples was analyzed using an Electronic Scanning Electron Microscope (ESEM and X-ray on the surface analysis was done using an Energy Dispersive X-Ray (EDX analyzer. The technique of X-Ray Diffraction (XRD was used to characterize the phase of the oxide growth. The entire study showed that it was possible to grow high-surface area gamma alumina on the FeCrAl alloy wire surfaces when isothermally oxidised above 800°C over several hours.

  9. Description of climate, surface hydrology, and near-surface hydrogeology. Preliminary site description. Forsmark area - version 1.2

    Energy Technology Data Exchange (ETDEWEB)

    Johansson, Per-Olof [Artesia Grundvattenkonsult AB, Stockholm (Sweden); Werner, Kent [SWECO VIAK AB/Golder Associates AB, Stockholm (Sweden); Bosson, Emma; Berglund, Sten [Swedish Nuclear Fuel and Waste Management Co., Stockholm (Sweden); Juston, John [DBE Sweden, Uppsala (Sweden)


    The Swedish Nuclear Fuel and Waste Management Company (SKB) is conducting site investigations at two different locations, the Forsmark and Simpevarp areas, with the objective of siting a geological repository for spent nuclear fuel. The results from the investigations at the sites are used as a basic input to the development of Site Descriptive Models (SDM). The SDM shall summarise the current state of knowledge of the site, and provide parameters and models to be used in further analyses within Safety Assessment, Repository Design and Environmental Impact Assessment. The present report is a background report describing the meteorological conditions and the modelling of surface hydrology and near-surface hydrogeology in support of the Forsmark version 1.2 SDM based on the data available in the Forsmark 1.2 'data freeze' (July 31, 2004). The groundwater is very shallow, with groundwater levels within one meter below ground as an annual mean for almost all groundwater monitoring wells. Also, the annual groundwater level amplitude is less than 1.5 m for most wells. The shallow groundwater levels mean that there is a strong interaction between evapotranspiration, soil moisture and groundwater. In the modelling, surface water and near-surface groundwater divides are assumed to coincide. The small-scale topography implies that many local, shallow groundwater flow systems are formed in the Quaternary deposits, overlaying more large-scale flow systems associated with groundwater flows at greater depths. Groundwater level time series from wells in till and bedrock within the same areas show a considerably higher groundwater level in the till than in the bedrock. The observed differences in levels are not fully consistent with the good hydraulic contact between overburden and bedrock indicated by the hydraulic tests in the Quaternary deposits. However, the relatively lower groundwater levels in the bedrock may be caused by the horizontal to sub-horizontal highly

  10. How Much Global Burned Area Can Be Forecast on Seasonal Time Scales Using Sea Surface Temperatures? (United States)

    Chen, Yang; Morton, Douglas C.; Andela, Niels; Giglio, Louis; Randerson, James T.


    Large-scale sea surface temperature (SST) patterns influence the interannual variability of burned area in many regions by means of climate controls on fuel continuity, amount, and moisture content. Some of the variability in burned area is predictable on seasonal timescales because fuel characteristics respond to the cumulative effects of climate prior to the onset of the fire season. Here we systematically evaluated the degree to which annual burned area from the Global Fire Emissions Database version 4 with small fires (GFED4s) can be predicted using SSTs from 14 different ocean regions. We found that about 48 of global burned area can be forecast with a correlation coefficient that is significant at a p burning. Continental regions where burned area had a higher degree of predictability included equatorial Asia, where 92% of the burned area exceeded the correlation threshold, and Central America, where 86% of the burned area exceeded this threshold. Pacific Ocean indices describing the El Nino-Southern Oscillation were more important than indices from other ocean basins, accounting for about 1/3 of the total predictable global burned area. A model that combined two indices from different oceans considerably improved model performance, suggesting that fires in many regions respond to forcing from more than one ocean basin. Using OCI-burned area relationships and a clustering algorithm, we identified 12 hotspot regions in which fires had a consistent response to SST patterns. Annual burned area in these regions can be predicted with moderate confidence levels, suggesting operational forecasts may be possible with the aim of improving ecosystem management.

  11. [Distribution, surface and protected area of palm-swamps in Costa Rica and Nicaragua]. (United States)

    Serrano-Sandí, Juan; Bonilla-Murillo, Fabian; Sasa, Mahmood


    In Central America, palm swamps are known collectively as yolillales. These wetlands are usually dominated by the raffia palm Raphia taedigera, but also by the royal palm Manicaria saccifera and -in lower extensions- by the American oil palm Elaeis oleifera. The yolillales tend to be poor in woody species and are characteristic of regions with high rainfall and extensive hydroperiods, so they remain flooded most of the year. The dominance of large raffia palm leaves in the canopy, allow these environments to be distinguishable in aerial photographs, which consequently has helped to map them along most of their distribution. However, while maps depicting yolillales are available, the extent of their surface area, perimeter and connectivity remains poorly understood. This is particularly true for yolillales in Costa Rica and Nicaragua, countries that share a good proportion of palm dominated swaps in the Rio San Juan Basin. In addition, it is not known the actual area of these environments that is under any category of protection according to the conservation systems of both countries. As a first step to catalog yolillal wetlands in Costa Rica and Nicaragua, this paper evaluates cartographic maps to delineate yolillales in the region. A subsample of yolillales mapped in this study were visited and we geo-referenced them and evaluate the extent and condition of the swamp. A total of 110 883.2ha are classified as yolillales in Nicaragua, equivalent to 22% of wetland surface area recorded for that country (excluding the Cocibolca and Xolothn Lakes). In Costa Rica, 53 931.3ha are covered by these palm dominated swamps, which represent 16.24% of the total surface area covered by wetlands. About 47% of the area covered by yolillales in Nicaragua is under some category of protection, the largest extensions protected by Cerro Silva, Laguna Tale Sulumas and Indio Maiz Nature Reserves. In Costa Rica, 55.5% of the area covered by yolillal is located within protected areas

  12. Geographical altitude, size, mass and body surface area in children (1-4 years) in the Province of Jujuy (Argentina). (United States)

    Román, Estela María; Bejarano, Ignacio Felipe; Alfaro, Emma Laura; Abdo, Guadalupe; Dipierri, José Edgardo


    Highland child populations show low growth rates. To evaluate the variation of size, mass and body surface area of Jujenean infants (1-4 years) as a function of geographic altitude. Nutritional status of 8059 healthy infants was determined based on weight and height data; body mass index, ponderal index, body surface area, body surface area/mass and ectomorphy were calculated. Variables were standardized with a provincial mean and WHO references. Data were grouped by age, sex and geographic altitude: Highlands (≥2500 masl) and Lowlands (children differ in size, mass and body surface area based on the geographical altitude and adverse nutritional and socioeconomic factors.

  13. Kilohertz Electrical Stimulation Nerve Conduction Block: Effects of Electrode Surface Area. (United States)

    Patel, Yogi A; Kim, Brian S; Rountree, William S; Butera, Robert J


    Kilohertz electrical stimulation (KES) induces repeatable and reversible conduction block of nerve activity and is a potential therapeutic option for various diseases and disorders resulting from pathological or undesired neurological activity. However, successful translation of KES nerve block to clinical applications is stymied by many unknowns, such as the relevance of the onset response, acceptable levels of waveform contamination, and optimal electrode characteristics. We investigated the role of electrode geometric surface area on the KES nerve block threshold using 20- and 40-kHz current-controlled sinusoidal KES. Electrodes were electrochemically characterized and used to characterize typical KES waveforms and electrode charge characteristics. KES nerve block amplitudes, onset duration, and recovery of normal conduction after delivery of the KES were evaluated along with power requirements for effective KES nerve block. Results from this investigation demonstrate that increasing electrode geometric surface area provides for a more power-efficient KES nerve block. Reductions in block threshold by increased electrode surface area were found to be KES-frequency-dependent, with block thresholds and average power consumption reduced by greater than two times with 20-kHz KES waveforms and greater than three times for 40-kHz KES waveforms.

  14. Detailed effects of particle size and surface area on 222Rn emanation of a phosphate rock. (United States)

    Haquin, Gustavo; Yungrais, Zohar; Ilzycer, Danielle; Zafrir, Hovav; Weisbrod, Noam


    The dependency of radon emanation on soil texture was investigated using the closed chamber method. Ground phosphate rock with a large specific surface area was analyzed, and the presence of inner pores, as well as a high degree of roughness and heterogeneity in the phosphate particles, was found. The average radon emanation of the dry phosphate was 0.145 ± 0.016. The emanation coefficient was highest (0.169 ± 0.019) for the smallest particles (210 μm). The reduction rate followed an inverse power law. As expected, a linear dependence between the emanation coefficient and the specific surface area was found, being lower than predicted for the large specific surface area. This was most likely due to an increase in the embedding effect of radon atoms in adjacent grains separated by micropores. Results indicate that knowledge of grain radium distribution is crucial to making accurate emanation predictions. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Preparation of high surface area and high conductivity polyaniline nanoparticles using chemical oxidation polymerization technique (United States)

    Budi, S.; Yusmaniar; Juliana, A.; Cahyana, U.; Purwanto, A.; Imaduddin, A.; Handoko, E.


    In this work, polyaniline nanoparticles were synthesized using a chemical oxidation polymerization technique. The ammonium peroxydisulfate (APS)/aniline ratio, APS dropping time, and polymerization temperature were optimized to increase the surface area and conductivity of the polyaniline.The Fourier-transform infrared (FTIR) spectrum confirmed the formation of emeraldine salt polyaniline. X-ray diffraction (XRD) patterns indicated that amorphous and crystalline phases of the polyaniline were formed with crystallinity less than 40%. Scanning electron microscope (SEM) micrographs showed that the finest nanoparticles with uniform size distribution were obtained at the polymerization temperature of 0°C. A surface area analyzer (SAA) showed that the highest Brunauer-Emmett-Teller surface area (SBET ) of 42.14 m2/gwas obtained from an APS/aniline ratio of 0.75 with a dropping time of 0 s at a polymerization temperature of 0°C. A four-point probe measurement conducted at 75–300K indicated relatively high conductivity of the semiconductor characteristic of the polyaniline.

  16. Effects of acid treatment on the clay palygorskite: XRD, surface area, morphological and chemical composition

    Energy Technology Data Exchange (ETDEWEB)

    Xavier, Katiane Cruz Magalhaes; Santos, Maria do Socorro Ferreira dos; Santos, Maria Rita Morais Chaves; Oliveira, Marilia Evelyn Rodrigues; Osajima, Josy Antevelli; Silva Filho, Edson Cavalcanti da [Universidade Federal do Piaui (UFPI), Teresina, PI (Brazil); Carvalho, Maria Wilma Nunes Cordeiro, E-mail: [Universidade Federal de Campina Grande (UFCG), PB (Brazil)


    The palygorskite is an aluminum-magnesium silicate that has a fibrous morphology. Their physicochemical characteristics are the result of high surface area, porosity and thermal resistance which make it an attractive adsorbent. Its adsorption capacity can be increased through chemical reactions and/or heat treatments. The objective of this work is to verify the effects of acid activation on the palygorskite, treated with HCl at 90 °C at concentrations of 2, 4 and 6 mol L{sup -1} in 2 and 4 hours, with clay/acid solution ratio 1 g 10 mL{sup -1} and characterized by techniques: XRF, XRD and surface area. A significant increase in specific surface area was observed in the sample treated with HCl at the concentration 6 mol L{sup -1}. The changes were more pronounced at stricter concentrations of acidity, with decreasing intensity of reflection of the clay indicated in the XRD. These changes were confirmed in the XRF with the leaching of some oxides and with increasing concentration of SiO{sub 2}. (author)

  17. Relationship Between the Surface Area to Volume Ratio and Temperature across Geologic Time in Ostracods (United States)

    Jackson, C.; Zaroff, S.; Heim, N. A.; Payne, J.


    In 1877 Joseph Allen proposed that endothermic terrestrial organisms would have lower surface area to volume ratios (SAVR) in colder climates and higher SAVRs in warmer climates. With a smaller surface area compared to volume, organisms can retain more heat in cold climates. We tested to see if this principle applied to ostracods, a type of ectothermic marine invertebrate. We hypothesised that Allen's rule applies to ostracods, as Allen's rule has been demonstrated in frogs (Alho 2011), which are also ectotherms . We used the linear dimensions of the three major carapace axes of ostracod holotypes to estimate the SAVR. We compared ostracod SAVRs with paleotemperatures from Royer et al. (2004). We found that there was a correlation between surface area and temperature; it is a small, but statistically significant correlation (adj. R2=0.0167). This means that as temperature increased, the SAVR also increased. We also found a negative correlation between ostracod SAVR to geologic time(adj. R2=0.0114), which shows us that as time has gone on, ostracod SAVR has decreased. We then plotted the correlation coefficient of SAVR to temperature over geologic time to explore trends in the strength of Allen's rule. For most of time there was no relationship but during the Devonian, Allen's Rule did explain the trend. In short, temperature does explain some of the correlation between the SAVR and temperature, but it is likely there were other environmental factors affecting this relationship.

  18. Mineral paragenesis on Mars: The roles of reactive surface area and diffusion. (United States)

    Fairén, Alberto G; Gil-Lozano, Carolina; Uceda, Esther R; Losa-Adams, Elisabeth; Davila, Alfonso F; Gago-Duport, Luis


    Geochemical models of secondary mineral precipitation on Mars generally assume semiopen systems (open to the atmosphere but closed at the water-sediment interface) and equilibrium conditions. However, in natural multicomponent systems, the reactive surface area of primary minerals controls the dissolution rate and affects the precipitation sequences of secondary phases, and simultaneously, the transport of dissolved species may occur through the atmosphere-water and water-sediment interfaces. Here we present a suite of geochemical models designed to analyze the formation of secondary minerals in basaltic sediments on Mars, evaluating the role of (i) reactive surface areas and (ii) the transport of ions through a basalt sediment column. We consider fully open conditions, both to the atmosphere and to the sediment, and a kinetic approach for mineral dissolution and precipitation. Our models consider a geochemical scenario constituted by a basin (i.e., a shallow lake) where supersaturation is generated by evaporation/cooling and the starting point is a solution in equilibrium with basaltic sediments. Our results show that cation removal by diffusion, along with the input of atmospheric volatiles and the influence of the reactive surface area of primary minerals, plays a central role in the evolution of the secondary mineral sequences formed. We conclude that precipitation of evaporites finds more restrictions in basaltic sediments of small grain size than in basaltic sediments of greater grain size.

  19. Surface water areas significantly impacted 2014 dengue outbreaks in Guangzhou, China

    International Nuclear Information System (INIS)

    Tian, Huaiyu; Huang, Shanqian; Zhou, Sen; Bi, Peng; Yang, Zhicong; Li, Xiujun; Chen, Lifan; Cazelles, Bernard; Yang, Jing; Luo, Lei; Jing, Qinlong; Yuan, Wenping; Pei, Yao; Sun, Zhe; Yue, Tianxiang; Kwan, Mei-Po


    Dengue transmission in urban areas is strongly influenced by a range of biological and environmental factors, yet the key drivers still need further exploration. To better understand mechanisms of environment–mosquito–urban dengue transmission, we propose an empirical model parameterized and cross-validated from a unique dataset including viral gene sequences, vector dynamics and human dengue cases in Guangzhou, China, together with a 36-year urban environmental change maps investigated by spatiotemporal satellite image fusion. The dengue epidemics in Guangzhou are highly episodic and were not associated with annual rainfall over time. Our results indicate that urban environmental changes, especially variations in surface area covered by water in urban areas, can substantially alter the virus population and dengue transmission. The recent severe dengue outbreaks in Guangzhou may be due to the surge in an artificial lake construction, which could increase infection force between vector (mainly Aedes albopictus) and host when urban water area significantly increased. Impacts of urban environmental change on dengue dynamics may not have been thoroughly investigated in the past studies and more work needs to be done to better understand the consequences of urbanization processes in our changing world. - Highlights: • Urban dengue outbreak is associated with water area in Guangzhou, 1978–2014. • Surface water area can alter population size of dengue virus in urban area. • Urban dengue outbreak is not associated with annual rainfall in Guangzhou. • Spatiotemporal satellite image fusion can investigate urban environmental change. • Urban environmental change could induce virus, vector, and dengue epidemic change.

  20. Potential effects of groundwater and surface water contamination in an urban area, Qus City, Upper Egypt (United States)

    Abdalla, Fathy; Khalil, Ramadan


    The potential effects of anthropogenic activities, in particular, unsafe sewage disposal practices, on shallow groundwater in an unconfined aquifer and on surface water were evaluated within an urban area by the use of hydrogeological, hydrochemical, and bacteriological analyses. Physicochemical and bacteriological data was obtained from forty-five sampling points based on33 groundwater samples from variable depths and 12 surface water samples. The pollution sources are related to raw sewage and wastewater discharges, agricultural runoff, and wastewater from the nearby Paper Factory. Out of the 33 groundwater samples studied, 17 had significant concentrations of NO3-, Cl- and SO42-, and high bacteria counts. Most of the water samples from the wells contained high Fe, Mn, Pb, Zn, Cd, and Cr. The majority of surface water samples presented high NO3- concentrations and high bacteria counts. A scatter plot of HCO3- versus Ca indicates that 58% of the surface water samples fall within the extreme contamination zone, while the others are within the mixing zone; whereas 94% of groundwater samples showed evidence of mixing between groundwater and wastewater. The bacteriological assessment showed that all measured surface and groundwater samples contained Escherichia coli and total coliform bacteria. A risk map delineated four classes of contamination, namely, those sampling points with high (39.3%), moderate (36.3%), low (13.3%), and very low (11.1%) levels of contamination. Most of the highest pollution points were in the middle part of the urban area, which suffers from unmanaged sewage and industrial effluents. Overall, the results demonstrate that surface and groundwater in Qus City are at high risk of contamination by wastewater since the water table is shallow and there is a lack of a formal sanitation network infrastructure. The product risk map is a useful tool for prioritizing zones that require immediate mitigation and monitoring.

  1. Continued decrease of open surface water body area in Oklahoma during 1984-2015. (United States)

    Zou, Zhenhua; Dong, Jinwei; Menarguez, Michael A; Xiao, Xiangming; Qin, Yuanwei; Doughty, Russell B; Hooker, Katherine V; David Hambright, K


    Oklahoma contains the largest number of manmade lakes and reservoirs in the United States. Despite the importance of these open surface water bodies to public water supply, agriculture, thermoelectric power, tourism and recreation, it is unclear how these water bodies have responded to climate change and anthropogenic water exploitation in past decades. In this study, we used all available Landsat 5 and 7 images (16,000 scenes) from 1984 through 2015 and a water index- and pixel-based approach to analyze the spatial-temporal variability of open surface water bodies and its relationship with climate and water exploitation. Specifically, the areas and numbers of four water body extents (the maximum, year-long, seasonal, and average extents) were analyzed to capture variations in water body area and number. Statistically significant downward trends were found in the maximum, year-long, and annual average water body areas from 1984 through 2015. Furthermore, these decreases were mainly attributed to the continued shrinking of large water bodies (>1km 2 ). There were also significant decreases in maximum and year-long water body numbers, which suggested that some of the water bodies were vanishing year by year. However, remarkable inter-annual variations of water body area and number were also found. Both water body area and number were positively related to precipitation, and negatively related to temperature. Surface water withdrawals mainly influenced the year-long water bodies. The smaller water bodies have a higher risk of drying under a drier climate, which suggests that small water bodies are more vulnerable under climate-warming senarios. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. Anti-Ro/SSA antibodies and cardiac arrhythmias in the adult: facts and hypotheses. (United States)

    Lazzerini, P E; Capecchi, P L; Laghi-Pasini, F


    It is well established that the passive trans-placental passage of anti-Ro/SSA antibodies from mother to foetus is associated with the risk to develop an uncommon syndrome named neonatal lupus (NLE), where the congenital heart block represents the most severe clinical feature. Recent evidence demonstrated that also adult heart, classically considered invulnerable to the anti-Ro/SSA antibodies, may represent a target of the arrhythmogenicity of these autoantibodies. In particular, the prolongation of the QTc interval appears the most frequent abnormality observed in adults with circulating anti-Ro/SSA antibodies, with some data suggesting an association with an increased risk of ventricular arrhythmias, also life threatening. Moreover, even though the association between anti-Ro/SSA antibodies and conduction disturbances is undoubtedly less evident in adults than in infants, from the accurate dissection of the literature data the possibility arises that sometimes also the adult cardiac conduction tissue may be affected by such antibodies. The exact arrhythmogenic mechanisms involved in foetus/newborns and adults, respectively, have not been completely clarified as yet. However, increasing evidence suggests that anti-Ro/SSA antibodies may trigger rhythm disturbances through an inhibiting cross-reaction with several cardiac ionic channels, particularly the calcium channels (L-type and T-type), but also the potassium channel hERG, whose different expression and involvement in the cardiac electrophysiology during lifespan might account for the occurrence of age-related differences.

  3. Decadal changes of surface elevation over permafrost area estimated using reflected GPS signals (United States)

    Liu, Lin; Larson, Kristine M.


    Conventional benchmark-based survey and Global Positioning System (GPS) have been used to measure surface elevation changes over permafrost areas, usually once or a few times a year. Here we use reflected GPS signals to measure temporal changes of ground surface elevation due to dynamics of the active layer and near-surface permafrost. Applying the GPS interferometric reflectometry technique to the multipath signal-to-noise ratio data collected by a continuously operating GPS receiver mounted deep in permafrost in Barrow, Alaska, we can retrieve the vertical distance between the antenna and reflecting surface. Using this unique kind of observables, we obtain daily changes of surface elevation during July and August from 2004 to 2015. Our results show distinct temporal variations at three timescales: regular thaw settlement within each summer, strong interannual variability that is characterized by a sub-decadal subsidence trend followed by a brief uplift trend, and a secular subsidence trend of 0.26 ± 0.02 cm year-1 during 2004 and 2015. This method provides a new way to fully utilize data from continuously operating GPS sites in cold regions for studying dynamics of the frozen ground consistently and sustainably over a long time.

  4. Cryptic oxygen oases: Hypolithic photosynthesis in hydrothermal areas and implications for Archean surface oxidation (United States)

    Havig, J. R.; Hamilton, T. L.


    Mounting geochemical evidence suggests microorganisms capable of oxygenic photosynthesis (e.g., Cyanobacteria) colonized Archean continental surfaces, driving oxidative weathering of detrital pyrites prior to the 2.5 Ga great oxidation event. Modern terrestrial environments dominated by single-celled phototrophs include hydrothermal systems (e.g., Yellowstone National Park) and hypolithic communities found in arid to hyper-arid deserts (e.g., McMurdo Dry Valleys of Antarctica, Atacama Desert of Chile). Recent work indicates terrestrial hydrothermal systems date back at least as far as 3.5 Ga. Here, we explore phototrophic communities in both hypolithic (sub-sinter) and hydrothermal (subaqueous and subaerial) environments in Yellowstone National Park as potential analogs to Archean continental surfaces. Hydrothermal sub-sinter environments provide ideal conditions for phototrophic microbial communities, including blocking of harmful UV radiation, trapping and retention of moisture, and protection from erosion by rain and surface runoff. Hypolithic communities in geothermal settings were similar in both composition and carbon uptake rates to nearby hot spring communities. We hypothesize that hydrothermal area hypolithic communities represent modern analogs of phototrophic microbial communities that colonized Archean continental surfaces, producing oxygen locally and facilitating microbially-mediated pyrite oxidation prior to the presence of free oxygen in the global atmosphere. These results have implications for oxidation of the early Earth surface, the search for biosignatures in the rock record, as well as for potential harbors of past life on Mars and the search for life on Exoplanets.

  5. Correlation between surface reconstruction and polytypism in InAs nanowire selective area epitaxy (United States)

    Liu, Ziyang; Merckling, Clement; Rooyackers, Rita; Richard, Olivier; Bender, Hugo; Mols, Yves; Vila, María; Rubio-Zuazo, Juan; Castro, Germán R.; Collaert, Nadine; Thean, Aaron; Vandervorst, Wilfried; Heyns, Marc


    The mechanism of widely observed intermixing of wurtzite and zinc-blende crystal structures in InAs nanowire (NW) grown by selective area epitaxy (SAE) is studied. We demonstrate that the crystal structure in InAs NW grown by SAE can be controlled using basic growth parameters, and wurtzitelike InAs NWs are achieved. We link the polytypic InAs NWs SAE to the reconstruction of the growth front (111)B surface. Surface reconstruction study of InAs (111) substrate and the following homoepitaxy experiment suggest that (111) planar defect nucleation is related to the (1 × 1) reconstruction of InAs (111)B surface. In order to reveal it more clearly, a model is presented to correlate growth temperature and arsenic partial pressure with InAs NW crystal structure. This model considers the transition between (1 × 1) and (2 × 2) surface reconstructions in the frame of adatom atoms adsorption/desorption, and the polytypism is thus linked to reconstruction quantitatively. The experimental data fit well with the model, which highly suggests that surface reconstruction plays an important role in the polytypism phenomenon in InAs NWs SAE.

  6. Corrective Action Decision Document for Corrective Action Unit 417: Central Nevada Test Area Surface, Nevada

    International Nuclear Information System (INIS)


    This Corrective Action Decision Document (CADD) identifies and rationalizes the U.S. Department of Energy, Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 417: Central Nevada Test Area Surface, Nevada, under the Federal Facility Agreement and Consent Order. Located in Hot Creek Valley in Nye County, Nevada, and consisting of three separate land withdrawal areas (UC-1, UC-3, and UC-4), CAU 417 is comprised of 34 corrective action sites (CASs) including 2 underground storage tanks, 5 septic systems, 8 shaker pad/cuttings disposal areas, 1 decontamination facility pit, 1 burn area, 1 scrap/trash dump, 1 outlier area, 8 housekeeping sites, and 16 mud pits. Four field events were conducted between September 1996 and June 1998 to complete a corrective action investigation indicating that the only contaminant of concern was total petroleum hydrocarbon (TPH) which was found in 18 of the CASs. A total of 1,028 samples were analyzed. During this investigation, a statistical approach was used to determine which depth intervals or layers inside individual mud pits and shaker pad areas were above the State action levels for the TPH. Other related field sampling activities (i.e., expedited site characterization methods, surface geophysical surveys, direct-push geophysical surveys, direct-push soil sampling, and rotosonic drilling located septic leachfields) were conducted in this four-phase investigation; however, no further contaminants of concern (COCs) were identified. During and after the investigation activities, several of the sites which had surface debris but no COCs were cleaned up as housekeeping sites, two septic tanks were closed in place, and two underground storage tanks were removed. The focus of this CADD was to identify CAAs which would promote the prevention or mitigation of human exposure to surface and subsurface soils with contaminant

  7. Investigation on the growth of DAST crystals of large surface area for THz applications

    International Nuclear Information System (INIS)

    Vijay, R. Jerald; Melikechi, N.; Thomas, Tina; Gunaseelan, R.; Arockiaraj, M. Antony; Sagayaraj, P.


    Graphical abstract: It is evident from the photographs that the crystal tend to grow as a needle (Fig. 1a) in the lower concentration region (2–3 g/200 mL); whereas, in the high concentration region (5 g/200 mL) though there is a marked enlargement in the size of the crystal, the morphology of the resulting DAST crystal is slightly irregular (Fig. 1d) in nature. Among the four concentrations employed, best result was obtained with the DAST–methanol solution of concentration 4 g/200 mL; which resulted in the DAST crystal of large surface area (270 mm 2 ) with high transparency and nearly square shape (Fig. 1c) in a growth period of 20–25 days. Highlights: ► DAST crystals of different sizes are obtained for different concentrations. ► The main focus is to grow DAST crystals with large surface area. ► Structural, optical, thermal and mechanical properties are investigated. - Abstract: The growth of high quality 4-N,N-dimethylamino-4-N-methyl-stilbazoliumtosylate (DAST) crystal with large surface area is reported by adopting the slope nucleation coupled slow evaporation method (SNM-SE). The structure and composition of the crystal are studied by single crystal X-ray diffraction and CHN analyses. The linear optical properties are investigated by UV–vis absorption. The melting point and thermal behavior of DAST are investigated using differential scanning calorimetric (DSC) and thermogravimetric analyses (TGA). The Vickers microhardness number (VHN) and work hardening coefficient of the grown crystal have been determined. The surface features of the DAST crystal are analyzed by scanning electron microscopy (SEM) and it confirmed the presence of narrow line defects (NLDs) in the sample.

  8. Clay Mineralogy Studies of Soils Located on Different Geomorphic Surfaces in Jabalbarez-Jiroft Area

    Directory of Open Access Journals (Sweden)

    naser boroumand


    Full Text Available Introduction: Soil and geomorphology are closely related to each other. That is why considering geomorphic concepts in soil genesis and classification studies may cause a better understanding of soil genesis processes. Paleosols with argillic horizons were investigated on stable pediment surfaces in Jiroft area, central Iran, by Sanjari et al. (2011. They found that secondary gypsum and calcium carbonate were accumulated in mantled pediments, but moving down the slope toward lowlands, salts more soluble than gypsum have been accumulated. Clay mineralogy in soil researches helps to better studying soil genesis and development. A quantitative and qualitative study of clay minerals together with their structural composition provides valuable data on the absorption, fixation, and desorption of different cations in soils. Smectite, chlorite, illite, vermiculite, kaolinite, palygorskite, and sepiolite were reported as dominant clay minerals found in arid and semi-arid areas. The objectives of the present study are to evaluate the clay mineralogy of Jabalbarez-Jiroft soils on different geomorphic surfaces. Materials and Methods: The study area was located in Jabalbarez, 200 Km south Kerman, Central Iran. Fig. 1 showed the exact location of study area. Soil temperature and moisture regimes of the area were thermic and aridic, respectively. Hill, rock pediment, mantled pediment and piedmont alluvial plain landforms were identified, using aerial photo interpretation, topography and geological map observation, in addition to detailed field works. Air-dried soil samples were crushed and passed through a 2-mm sieve. Routine physicochemical analyses wereperformed on the samples. Undisturbed soil samples from the Bt horizon of pedons 4, 5 and 6 were chosen for micromorphology investigations. Beside, eight samples including A and C2 horizons of pedon 1, A and Bt horizon of pedon 3, Bt and Bw horizons of pedon 4, and Bt and C horizon of pedon 5 were selected for

  9. MELiSSA celebrates 25 years of research into life support

    International Nuclear Information System (INIS)


    MELiSSA (Micro-Ecological Life Support System Alternative) is a collaborative project with the European Space Agency ESA and various other scientific partners. The objective of MELiSSA is to develop a system that is able to provide manned space missions with food, drinking water and oxygen autonomously in space. Drinkable water and oxygen are currently being made in the international space station ISS by filtering waste water and by electrolysing water. However, such physiochemical technologies do not offer a solution for food. The MELiSSA project intends to reuse waste products, which include CO2, water, stools and urine from the astronauts, and even the perspiration moisture in the cabin and to transfer these into food through the use of micro-organisms.

  10. Influence of Alkali Treatment on the Surface Area of Aluminium Dross

    Directory of Open Access Journals (Sweden)

    N. S. Ahmad Zauzi


    Full Text Available Aluminium dross is an industrial waste from aluminium refining industry and classified as toxic substances. However, the disposal of dross as a waste is a burden to aluminium manufacturer industries due to its negative effects to the ecosystem, surface, and ground water. Therefore the purpose of this study is to evaluate the influence of sodium hydroxide (NaOH on the surface area and pore size of aluminium dross. There were 3 stages in the treatment activities, which were leaching, precipitation, and calcination process. The optimum result from this study was the surface area of aluminium dross increases from 10.1 m2/g up to 80.0 m2/g at 40°C, 1% NaOH, and 15-minute reaction time. Thus, aluminium dross has a potential to be converted into other useful material such as catalyst and absorbent. The benefit of this research is that the hazardous industrial waste can be turned into wealth to be used in other applications such as in catalytic activities and absorber in waste water treatment. Further investigation on the physicochemical of aluminium dross with different acid or alkali should be conducted to get deeper understanding on the aluminium dross as a catalyst-type material.

  11. Characteristics of surface O{sub 3} over Qinghai Lake area in Northeast Tibetan Plateau, China

    Energy Technology Data Exchange (ETDEWEB)

    Shen, Zhenxing, E-mail: [Department of Environmental Sciences and Engineering, Xi' an Jiaotong University, Xi' an (China); Key Lab of Aerosol, SKLLQG, Institute of Earth Environment, Chinese Academy of Sciences, Xi' an (China); Cao, Junji [Key Lab of Aerosol, SKLLQG, Institute of Earth Environment, Chinese Academy of Sciences, Xi' an (China); Zhang, Leiming [Air Quality Research Division, Environment Canada, Toronto (Canada); Zhao, Zhuzi [Key Lab of Aerosol, SKLLQG, Institute of Earth Environment, Chinese Academy of Sciences, Xi' an (China); Dong, Jungang [School of Architecture, Xi' an University of Architecture and Technology, Xi' an 710055 (China); Wang, Linqing [Department of Environmental Sciences and Engineering, Xi' an Jiaotong University, Xi' an (China); Wang, Qiyuan; Li, Guohui; Liu, Suixin [Key Lab of Aerosol, SKLLQG, Institute of Earth Environment, Chinese Academy of Sciences, Xi' an (China); Zhang, Qian [Department of Environmental Sciences and Engineering, Xi' an Jiaotong University, Xi' an (China)


    Surface O{sub 3} was monitored continuously during Aug. 12, 2010 to Jul. 21, 2011 at a high elevation site (3200 m above sea level) in Qinghai Lake area (36°58′37″N, 99°53′56″E) in Northeast Tibetan Plateau, China. Daily average O{sub 3} ranged from 21.8 ppbv to 65.3 ppbv with an annual average of 41.0 ppbv. Seasonal average of O{sub 3} followed a decreasing order of summer > autumn > spring > winter. Diurnal variations of O{sub 3} showed low concentrations during daytime and high concentrations during late night and early morning. An intensive campaign was also conducted during Aug. 13–31, 2010 to investigate correlations between meteorological or chemical conditions and O{sub 3}. It was found that O{sub 3} was poorly correlated with solar radiation due to the insufficient NO{sub x} in the ambient air, thus limiting O{sub 3} formation under strong solar radiation. In contrast, high O{sub 3} levels always coincided with strong winds, suggesting that stratospheric O{sub 3} and long range transport might be the main sources of O{sub 3} in this rural area. Back-trajectory analysis supported this hypothesis and further indicated the transport of air masses from northwest, northeast and southeast directions. - Highlights: • Surface O{sub 3} was measured in Qinghai Lake area in Northeast Tibetan Plateau, China. • The O{sub 3} chemical formation was under a strong NOx-limited in Qinghai Lake areas. • Stratospheric O{sub 3} and transport might be the main sources of O{sub 3} in this area.

  12. Characteristics of surface O3 over Qinghai Lake area in Northeast Tibetan Plateau, China

    International Nuclear Information System (INIS)

    Shen, Zhenxing; Cao, Junji; Zhang, Leiming; Zhao, Zhuzi; Dong, Jungang; Wang, Linqing; Wang, Qiyuan; Li, Guohui; Liu, Suixin; Zhang, Qian


    Surface O 3 was monitored continuously during Aug. 12, 2010 to Jul. 21, 2011 at a high elevation site (3200 m above sea level) in Qinghai Lake area (36°58′37″N, 99°53′56″E) in Northeast Tibetan Plateau, China. Daily average O 3 ranged from 21.8 ppbv to 65.3 ppbv with an annual average of 41.0 ppbv. Seasonal average of O 3 followed a decreasing order of summer > autumn > spring > winter. Diurnal variations of O 3 showed low concentrations during daytime and high concentrations during late night and early morning. An intensive campaign was also conducted during Aug. 13–31, 2010 to investigate correlations between meteorological or chemical conditions and O 3 . It was found that O 3 was poorly correlated with solar radiation due to the insufficient NO x in the ambient air, thus limiting O 3 formation under strong solar radiation. In contrast, high O 3 levels always coincided with strong winds, suggesting that stratospheric O 3 and long range transport might be the main sources of O 3 in this rural area. Back-trajectory analysis supported this hypothesis and further indicated the transport of air masses from northwest, northeast and southeast directions. - Highlights: • Surface O 3 was measured in Qinghai Lake area in Northeast Tibetan Plateau, China. • The O 3 chemical formation was under a strong NOx-limited in Qinghai Lake areas. • Stratospheric O 3 and transport might be the main sources of O 3 in this area

  13. Assessment of mercury erosion by surface water in Wanshan mercury mining area. (United States)

    Dai, ZhiHui; Feng, Xinbin; Zhang, Chao; Shang, Lihai; Qiu, Guangle


    Soil erosion is a main cause of land degradation, and in its accelerated form is also one of the most serious ecological environmental problems. Moreover, there are few studies on migration of mercury (Hg) induced by soil erosion in seriously Hg-polluted districts. This paper selected Wanshan Hg mining area, SW China as the study area. Revised universal soil loss equation (RUSLE) and Geographic information system (GIS) methods were applied to calculate soil and Hg erosion and to classify soil erosion intensity. Our results show that the soil erosion rate can reach up to 600,884tkm(-2)yr(-1). Surfaces associated with very slight and extremely severe erosion include 76.6% of the entire land in Wanshan. Furthermore, the cumulative erosion rates in the area impacted by extremely severe erosion make up 90.5% of the total. On an annual basis, Hg surface erosion load was predicted to be 505kgyr(-1) and the corresponding mean migration flux of Hg was estimated to be 3.02kgkm(-2)yr(-1). The erosion loads of Hg resulting from farmland and meadow soil were 175 and 319kgyr(-1) respectively, which were enhanced compared to other landscape types due to the fact that they are generally located in the steep zones associated with significant reclamation. Contributing to establish a mass balance of Hg in Wanshan Hg mining area, this study supplies a dependable scientific basis for controlling soil and water erosion in the local ecosystems. Land use change is the most effective way for reducing Hg erosion load in Wanshan mining area. Copyright © 2013 Elsevier Inc. All rights reserved.

  14. Surface deformation of active volcanic areas retrieved with the SBAS-DInSAR technique: an overview

    Directory of Open Access Journals (Sweden)

    G. Zeni


    Full Text Available This paper presents a comprehensive overview of the surface deformation retrieval capability of the Differential Synthetic Aperture Radar Interferometry (DInSAR algorithm, referred to as Small BAseline Subset (SBAS technique, in the context of active volcanic areas. In particular, after a brief description of the algorithm some experiments relevant to three selected case-study areas are presented. First, we concentrate on the application of the SBAS algorithm to a single-orbit scenario, thus considering a set of SAR data composed by images acquired on descending orbits by the European Remote Sensing (ERS radar sensors and relevant to the Long Valley caldera (eastern California area. Subsequently, we address the capability of the SBAS technique in a multipleorbit context by referring to Mt. Etna volcano (southern Italy test site, with respect to which two different ERS data set, composed by images acquired both on ascending and descending orbits, are available. Finally, we take advantage of the capability of the algorithm to work in a multi-platform scenario by jointly exploiting two different sets of SAR images collected by the ERS and the Environment Satellite (ENVISAT radar sensors in the Campi Flegrei caldera (southern Italy area. The presented results demonstrate the effectiveness of the algorithm to investigate the deformation field in active volcanic areas and the potential of the DInSAR methodologies within routine surveillance scenario.

  15. Visualization of Lake Mead Surface Area Changes from 1972 to 2009

    Directory of Open Access Journals (Sweden)

    David M. Atkinson


    Full Text Available For most of the last decade, the south-western portion of the United States has experienced a severe and enduring drought. This has caused serious concerns about water supply and management in the region. In this research, 30 orthorectified Landsat satellite images from the United States Geological Service (USGS Earth Explorer archive were analyzed for the 1972 to 2009 period. The images encompassed Lake Mead (a major reservoir in this region and were examined for changes in water surface area. Decadal lake area minimums/maximums were achieved in 1972/1979, 1981/1988, 1991/1998, and 2009/2000. The minimum lake area extent occurred in 2009 (356.4 km2, while the maximum occurred in 1998 (590.6 km2. Variable trends in water level and lake area were observed throughout the analysis period, however progressively lower values were observed since 2000. The Landsat derived lake areas show a very strong relationship with actual measured water levels at the Hoover Dam. Yearly water level variations at the dam vary minimally from the satellite derived estimates. A complete (yearly record of satellite images may have helped to reduce the slight deviations in the time series.

  16. Estimating Surface Area of Sponges and Marine Gorgonians as Indicators of Habitat Availability on Caribbean Coral Reefs (United States)

    Surface area and topographical complexity are fundamental attributes of shallow tropical coral reefs and can be used to estimate habitat for fish and invertebrates. This study presents empirical methods for estimating surface area provided by sponges and gorgonians in the Central...

  17. Groundwater impact on surface water quality and nutrient loads in lowland polder catchments: monitoring the greater Amsterdam area

    NARCIS (Netherlands)

    Yu, L.; Rozemeijer, J.; Breukelen, B.M. van; Ouboter, M.; Vlugt, C. van der; Broers, H.P.


    The Amsterdam area, a highly manipulated delta area formed by polders and reclaimed lakes, struggles with high nutrient levels in its surface water system. The polders receive spatially and temporally variable amounts of water and nutrients via surface runoff, groundwater seepage, sewer leakage, and

  18. Groundwater impacts on surface water quality and nutrient loads in lowland polder catchments : Monitoring the greater Amsterdam area

    NARCIS (Netherlands)

    Yu, Liang; Rozemeijer, Joachim; van Breukelen, B.M.; Ouboter, Maarten; Van Der Vlugt, Corné; Broers, Hans Peter


    The Amsterdam area, a highly manipulated delta area formed by polders and reclaimed lakes, struggles with high nutrient levels in its surface water system. The polders receive spatially and temporally variable amounts of water and nutrients via surface runoff, groundwater seepage, sewer leakage,

  19. Atomic layer deposition of highly dispersed Pt nanoparticles on a high surface area electrode backbone for electrochemical promotion of catalysis

    NARCIS (Netherlands)

    Hajar, Y.; di Palma, V.; Kyriakou, V.; Verheijen, M. A.; Baranova, E. A.; Vernoux, P.; Kessels, W. M. M.; Creatore, M.; van de Sanden, M. C. M.; Tsampas, M. N.


    A novel catalyst design for electrochemical promotion of catalysis (EPOC) is proposed which overcomes the main bottlenecks that limit EPOC commercialization, i.e., the low dispersion and small surface area of metal catalysts. We have increased the surface area by using a porous composite electrode

  20. Characteristics of PAHs adsorbed on street dust and the correlation with specific surface area and TOC. (United States)

    Wang, Chengkun; Li, Yingxia; Liu, Jingling; Xiang, Li; Shi, Jianghong; Yang, Zhifeng


    Street dust was collected from five roads with different traffic volumes in the metropolitan area of Beijing and separated into five size fractions. Concentrations of polycyclic aromatic hydrocarbons (PAHs) adsorbed on street dust in different size ranges and their correlation with specific surface area and total organic carbon (TOC) were investigated. Results show that the concentration of 16-PAHs of sieved samples ranges from 0.27 to 1.30 mg/kg for all the sampling sites. Particles smaller than 40 mum in diameter have the highest 16-PAHs concentration among all of the size ranges for street dust from the four sampling sites with vehicles running on. PAHs with three or four rings account for 68% of the overall 16-PAHs on average. Remarkable positive correlation exists between 16-PAHs concentration and specific surface area with R(2) values from 0.7 to 0.96 for the four sampling sites with vehicles running on. The relationship between the concentration of 16-PAHs and TOC is less clear.

  1. Minimal area surfaces in AdS n+1 and Wilson loops (United States)

    He, Yifei; Huang, Changyu; Kruczenski, Martin


    The AdS/CFT correspondence relates the expectation value of Wilson loops in N = 4 SYM to the area of minimal surfaces in AdS 5. In this paper we consider minimal area surfaces in generic Euclidean AdS n+1 using the Pohlmeyer reduction in a similar way as we did previously in Euclidean AdS 3. As in that case, the main obstacle is to find the correct parameterization of the curve in terms of a conformal parameter. Once that is done, the boundary conditions for the Pohlmeyer fields are obtained in terms of conformal invariants of the curve. After solving the Pohlmeyer equations, the area can be expressed as a boundary integral involving a generalization of the conformal arc-length, curvature and torsion of the curve. Furthermore, one can introduce the λ-deformation symmetry of the contours by a simple change in the conformal invariants. This determines the λ-deformed contours in terms of the solution of a boundary linear problem. In fact the condition that all λ deformed contours are periodic can be used as an alternative to solving the Pohlmeyer equations and is equivalent to imposing the vanishing of an infinite set of conserved charges derived from integrability.

  2. Monitoring of the Earth's surface deformation in the area of water dam Zarnowiec (United States)

    Mojzes, Marcel; Wozniak, Marek; Habel, Branislav; Macak, Marek


    Mathematical and physical research directly motivates geodetic community which can provide very accurate measurements for testing of the proposed models Earth's surface motion near the water dams should be monitored due to the security of the area. This is a process which includes testing of existing models and their physical parameters. Change of the models can improve the practical results for analyzing the trends of motion in the area of upper reservoir of water dam Zarnowiec. Since 1998 Warsaw University of Technology realized a research focused on the horizontal displacements of the upper reservoir of water dam Zarnowiec. The 15 selected control points located on the upper reservoir crown of the water dam were monitored by classical distance measurements. It was found out that changes in the object's geometry occur due to the variation of the water level. The control measurements of the changes in the object's geometry occurring during the process of emptying and filling of the upper reservoir of water dam were compared with the deformations computed using improved Boussinesqués method programmed in the software MATLAB and ANSYS for elastic and isotropic half space as derivation of suitable potentials extended to the loaded region. The details and numerical results of this process are presented This presentation was prepared within the project "National Centre for Diagnostic of the Earth's Surface Deformations in the Area of Slovakia", ITMS code: 26220220108.

  3. BOREAS TE-1 Soils Data Over The SSA Tower Sites in Raster Format (United States)

    Hall, Forrest G. (Editor); Anderson, Darwin; Knapp, David E.


    The BOREAS TE-1 team collected various data to characterize the soil-plant systems in the BOREAS SSA. This data set was gridded from vector layers of soil maps that were received from Dr. Darwin Anderson (TE-1), who did the original soil mapping in the field during 1994. The vector layers were gridded into raster files that cover approximately 1 square kilometer over each of the tower sites in the SSA. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  4. The importance of the active surface area of graphite materials in the first lithium intercalation

    Energy Technology Data Exchange (ETDEWEB)

    Novak, P.; Ufheil, J.; Buqa, H. [Paul Scherrer Institut, Electrochemistry Laboratory, CH-5232 Villigen PSI (Switzerland); Krumeich, F. [ETH Zuerich, Laboratory of Inorganic Chemistry, CH-8093 Zurich (Switzerland); Spahr, M.E.; Goers, D.; Wilhelm, H.; Vix-Guterl, C. [TIMCAL SA, CH-6743 Bodio TI (Switzerland); Dentzer, J.; Gadiou, R. [Institut de Chimie des Surfaces et Interfaces, CNRS UPR 9069, F-68057 Mulhouse Cedex (France)


    When lithium is intercalated into graphite in ethylene carbonate (EC) containing electrolytes, solvent co-intercalation leading to the exfoliation of the graphite structure could occur. The exfoliation can be suppressed if an efficient solid electrolyte interphase (SEI, a passivation layer) is formed. Here we study the role played by the active surface area (ASA) of graphite materials during their first electrochemical reduction. ASA (related to the presence of defects at the carbon surface) appears as a critical graphite surface parameter influencing the surface passivation mechanism and the graphite exfoliation. The ASA of TIMREX {sup registered} SLX50 synthetic graphite was modified by thermal treatment in argon and air. The electrochemical performance was characterized in 1 M LiPF{sub 6}, EC:DMC electrolyte and post mortem analyses were performed by SEM imaging. It turned out that a decrease of the graphite ASA, i.e., an increase of the graphite structural order, hinders the formation of the passivation layer and favors the exfoliation process. In contrast, the exfoliation of the same graphite can be suppressed if its ASA is increased for example by air treatment. The ASA of the graphite kinetically controls the formation of an efficient SEI film and accordingly the irreversible charge loss is much lower in the case of graphite with a high ASA value. (author)

  5. Blasting injuries in surface mining with emphasis on flyrock and blast area security

    Energy Technology Data Exchange (ETDEWEB)

    Bajpayee, T.S.; Rehak, T.R.; Mowrey, G.L.; Ingram, D.K. [NIOSH, Pittsburgh, PA (USA). Pittsburgh Research Lab.


    Blasting is a hazardous component of surface mining. Serious injuries and fatalities result from improper judgment or practice during rock blasting. This paper describes several fatal injury case studies, analyzes causative factors, and emphasizes preventive measures. During the 21-year period from 1978 to 1998, the mean yearly explosive-related injuries (fatal and nonfatal) for surface coal mines was 8.86 (95% CI: 6.38-11.33), and for surface metal/nonmetal mines 10.76 (95% CI: 8.39-13.14). Flyrock and lack of blast area security accounted for 68.2% of these injuries. Case studies indicate that the causative factors for fatal injuries are primarily personal and task-related and to some extent environmental. A reduction in the annual injuries in surface coal mines was observed during the 10-year period of 1989-1998 (5.80 (95% CI: 2.71-8.89)) compared to the previous 10-year period of 1979-1988 (10.90 (95% CI: 7.77-14.14)). However, such reduction was not noticed in the metal/nometal sector (i.e., 9.30 (95% CI: 6.84-11.76) for the period 1989-1998 compared with 11.00 (95% CI: 7.11-14.89) for the period 1979-1988). Discussion of case studies during safety meetings will help to mitigate fatal injuries and derive important payoffs in terms of lower risks and costs of injuries.

  6. Analysis and Application of River Surface Line in Hilly Area based on Hec-ras Model

    Directory of Open Access Journals (Sweden)

    Yang Congshan


    Full Text Available For example—Cixian Fuyang River Regulation Project. Due to the character that Fuyang River is located in hilly areas of Cixian, we use the Hex-ras software to calculate the status of the river water surface line for the goal of determining the final treatment plan. We maintain the present situation of the river channel design as principle, select the most appropriate pushed water level and roughnessas the basic, and we combine the classification calculation of crossing structures of backwater and the encryption calculation section to get the more accurate result. We compare the water level elevation and the calculation of cross strait, analyze the design parameters, calculate repeated the water line section, analyze the rationality of the design plan, and then finally determine the applicability of Hex-rac software in the large continuous variation of cross section of embankment of river river surface line.

  7. Dissolution Effects on Specific Surface Area, Particle Size, and Porosity of Pentelic Marble. (United States)

    Orkoula, Malvina G.; Koutsoukos, Petros G.


    Dissolution of natural stone such as marble is not limited to its surface. The porous structure, known to play an important role in stone decay, is also affected by the conditions of dissolution. In the present work, the changes in pore size distribution of Pentelic marble particles accompanying chemical dissolution in undersaturated solutions and at alkaline pH 8.25 were investigated. The specific surface area and the mesopore distribution of the Pentelic marble tested showed a pronounced decrease to very low values. On the other hand, the sizes of macropores exhibited a tendency to increase with the extent of dissolution due either to dissolution in the interior of the pores or to fusion of small pores into larger. Furthermore, the number of small particles decreased significantly, reaching complete disappearance, depending on the extent of dissolution. At the same time, the relative number of particles of intermediate size increased. Copyright 2001 Academic Press.

  8. GC/MS Analysis of Pesticides in the Ferrara Area (Italy) Surface Water: A Chemometric Study

    International Nuclear Information System (INIS)

    Pasti, L.; Dondi, F.; Nava, E.; Morelli, M.; Bignami, S.


    The development of a network to monitor surface waters is a critical element in the assessment, restoration and protection of water quality. In this study, concentrations of 42 pesticides - determined by GC-MS on samples from 11 points along the Ferrara area rivers - have been analyzed by chemometric tools. The data were collected over a three-year period (2002-2004). Principal component analysis of the detected pesticides was carried out in order to define the best spatial locations for the sampling points. The results obtained have been interpreted in view of agricultural land use. Time series data regarding pesticide contents in surface waters has been analyzed using the Autocorrelation function. This chemometric tool allows for seasonal trends and makes it possible to optimize sampling frequency in order to detect the effective maximum pesticide content

  9. Adsorption of neon and tetrafluoromethane on carbon nanohorn aggregates: differences in specific surface area values (United States)

    Krungleviciute, Vaiva; Yudasaka, Masako; Iijima, Sumio; Migone, Aldo


    We have measured adsorption isotherms for two different adsorbates, neon and tetrafluoromethane, on dahlia-like carbon nanohorn aggregates. The experiments were performed at similar relative temperatures for both gases. The measurements were conducted to explore the effect of adsorbate diameter on the behavior of the resulting adsorbed systems. We measured the effective specific surface area value of the nanohorn sample using both gases, and we found that this quantity was about 22% smaller when we determined this quantity using tetrafluoromethane, the larger molecule. Isosteric heat and binding energy values were also determined from our measurements. We will compare our experimental results with those from a computer simulation study performed by Prof. M. Calbi. The simulations help us understand the source of the observed differences in the measured specific surface values, as well as the coverage dependence of the isosteric heat of adsorption for both gases.

  10. Tuning Porosity and Surface Area in Mesoporous Silicon for Application in Li-Ion Battery Electrodes. (United States)

    Cook, John B; Kim, Hyung-Seok; Lin, Terri C; Robbennolt, Shauna; Detsi, Eric; Dunn, Bruce S; Tolbert, Sarah H


    This work aims to improve the poor cycle lifetime of silicon-based anodes for Li-ion batteries by tuning microstructural parameters such as pore size, pore volume, and specific surface area in chemically synthesized mesoporous silicon. Here we have specifically produced two different mesoporous silicon samples from the magnesiothermic reduction of ordered mesoporous silica in either argon or forming gas. In situ X-ray diffraction studies indicate that samples made in Ar proceed through a Mg 2 Si intermediate, and this results in samples with larger pores (diameter ≈ 90 nm), modest total porosity (34%), and modest specific surface area (50 m 2 g -1 ). Reduction in forming gas, by contrast, results in direct conversion of silica to silicon, and this produces samples with smaller pores (diameter ≈ 40 nm), higher porosity (41%), and a larger specific surface area (70 m 2 g -1 ). The material with smaller pores outperforms the one with larger pores, delivering a capacity of 1121 mAh g -1 at 10 A g -1 and retains 1292 mAh g -1 at 5 A g -1 after 500 cycles. For comparison, the sample with larger pores delivers a capacity of 731 mAh g -1 at 10 A g -1 and retains 845 mAh g -1 at 5 A g -1 after 500 cycles. The dependence of capacity retention and charge storage kinetics on the nanoscale architecture clearly suggests that these microstructural parameters significantly impact the performance of mesoporous alloy type anodes. Our work is therefore expected to contribute to the design and synthesis of optimal mesoporous architectures for advanced Li-ion battery anodes.

  11. Improved capacity to evaluate changes in intestinal mucosal surface area using mathematical modeling. (United States)

    Greig, Chasen J; Cowles, Robert A


    Quantification of intestinal mucosal growth typically relies on morphometric parameters, commonly villus height, as a surrogate for presumed changes in mucosal surface area (MSA). We hypothesized that using mathematical modeling based on multiple unique measurements would improve discrimination of the effects of interventions on MSA compared to standard measures. To determine the ability of mathematical modeling to resolve differences in MSA, a mouse model with enhanced serotonin (5HT) signaling known to stimulate mucosal growth was used. 5-HT signaling is potentiated by targeting the serotonin reuptake transporter (SERT) molecule. Selective serotonin reuptake inhibitor-treated wild-type (WT-SSRI), SERT-knockout (SERTKO), and wild-type C57Bl/6 (WT) mice were used. Distal ileal sections were H&E-stained. Villus height (VH), width (VW), crypt width (CW), and bowel diameter were used to calculate surface area enlargement factor (SEF) and MSA. VH alone for SERTKO and SSRI was significantly increased compared to WT, without a difference between SERTKO and WT-SSRI. VW and CW were significantly decreased for both SERTKO and WT-SSRI compared to WT, and VW for WT-SSRI was also decreased compared to SERTKO. These changes increased SEF and MSA for SERTKO and WT-SSRI compared to WT. Additionally, SEF and MSA were significantly increased for WT-SSRI compared to SERTKO. Mathematical modeling provides a valuable tool for differentiating changes in intestinal MSA. This more comprehensive assessment of surface area does not appear to correlate linearly with standard morphometric measures and represents a more comprehensive method for discriminating between therapies aimed at increasing functional intestinal mucosa. © 2017 Wiley Periodicals, Inc.

  12. Size-Dependent Specific Surface Area of Nanoporous Film Assembled by Core-Shell Iron Nanoclusters

    Directory of Open Access Journals (Sweden)

    Jiji Antony


    Full Text Available Nanoporous films of core-shell iron nanoclusters have improved possibilities for remediation, chemical reactivity rate, and environmentally favorable reaction pathways. Conventional methods often have difficulties to yield stable monodispersed core-shell nanoparticles. We produced core-shell nanoclusters by a cluster source that utilizes combination of Fe target sputtering along with gas aggregations in an inert atmosphere at 7∘C. Sizes of core-shell iron-iron oxide nanoclusters are observed with transmission electron microscopy (TEM. The specific surface areas of the porous films obtained from Brunauer-Emmett-Teller (BET process are size-dependent and compared with the calculated data.

  13. Fabrication of large-area hydrophobic surfaces with femtosecond-laser-structured molds (United States)

    Wu, P. H.; Cheng, C. W.; Chang, C. P.; Wu, T. M.; Wang, J. K.


    Fast replication of large-area femtosecond-laser-induced surface micro/nanostructures on plastic parts by injection molding is demonstrated. An STAVAX steel mold insert is irradiated by femtosecond laser pulses with linear or circular polarization to form periodic-like nanostructures or nanostructure-covered conical microstructures. It was then used for the process of thermal injection molding. The process provides high-volume manufacturing means to generate hydrophobic enhanced plastic parts, which is expected to be widely used in consumables and chemical/biomedical device industries.

  14. Understanding the growth mechanism of carbon nanotubes via the ``cluster volume to surface area" model (United States)

    Mandati, Sreekanth; Kunstmann, Jens; Boerrnert, Felix; Schoenfelder, Ronny; Ruemmeli, Mark; Kar, Kamal K.; Cuniberti, Gianaurelio


    The influence of mixed catalysts for the high yield production of carbon nanotubes (CNTs) has been studied systematically. Based on extensive experimental data a ``Catalyst Volume to Surface Area'' (CVSA) model was developed to understand the influence of the process parameters on the yield and CNT diameter distribution [1]. In our study, we present a refined version of the CVSA model developed by combining experiments and simulations. We discuss our current understanding of the growth mechanism and how the model might be used to increase CNT yields by using mixed catalysts.[4pt] [1] S. Tetali et al., ACS Nano (2009), DOI: 10.1021/nn9012548.

  15. Radioecological state of some surface water systems of contaminated areas of both Gomel and Mogilev Regions

    International Nuclear Information System (INIS)

    Datskevich, P. I.; Komissariv, F. D.; Khvale', O. D.; Basharina, L. P.; Lobach, I. L.


    The radioecological situation of different ecosystems of Belarus and their components has been analysed. Such components of the surface water ecosystems as water, suspensions, sediments and soils of water-collection areas were used for the investigation of the content of cesium 137 and strontium 90. The received data were given since 1990. The content of cesium 137 and strontium 90 in the components of water ecosystems was counted in the laboratory conditions by means of standard methods of beta radiometry, semiconductor gamma spectrometry and radiochemistry. The error of measurement of radioactivity was not higher than 25 and 35% for cesium 137 and strontium 90 accordingly. Water ecosystems were distinguished by the state of contamination of water-collection areas and hydrological parameters. These and some other reasons considered in the article influence on the character of cesium 137 and strontium 90 behaviour in water ecosystems

  16. Long term change of diurnal cycle in surface air temperature over Tokyo metropolitan area (United States)

    Hara, M.; Shimada, T.


    Tokyo Metropolitan area (i.e. southern part of Kanto district) is known for one of the hottest areas in summer in Japan. Especially in Saitama prefecture (north of Tokyo), the daily maximum surface air temperature (SAT) at screen height sometimes reached in 40 C. In the last decade, the summer heat environment in Japan is getting worse, and the number of emergency transportations due to heat stroke is rapidly increasing. In this study, we evaluate regional climate change due to some factors, such as land use / land cover changes. To evaluate the regional climate change, we performed analysis of observed data and a series of past climate simulations using the Weather Research and Forecasting (WRF) model with high horizontal resolution, including an urban canopy sub-model.

  17. Dose-area product and entrance surface dose in paediatric radiography

    Energy Technology Data Exchange (ETDEWEB)

    Servomaa, A.; Komppa, T.; Parviainen, T.; Heikkilae, M. [STUK - Radiation and Nuclear Safety Authority, Helsinki (Finland)


    Dose-area products (DAP) in paediatric radiography were measured in four university hospitals in Finland. The entrance surface dose (ESD) was calculated from the measured DAP value for each radiographic projection. The purpose was to combine the results with other European studies for development of diagnostic reference levels for paediatric X-ray examinations. The study included 740 paediatric patients, and a total of 1500 single projections were recorded, including 660 projections from extremities. Results were compared with recommended best practices and diagnostic reference levels for ESD. Ratios of DAP to ESD were studied to estimate the levels of DAP corresponding to recommended ESD reference levels. It is desirable for practical purposes that diagnostic reference levels for radiographic projections are also expressed in terms of dose-area product. (orig.)

  18. Surface Area Variability of a North-Central Tanzanian Crater Lake

    Directory of Open Access Journals (Sweden)

    Lindsey Higgins


    Full Text Available A history of modern (1973–2015 surface area variability for Lake Basotu in north-central Tanzania has been reconstructed using archived Landsat images from the dry season between June and October. This record was compared to local weather data as well as larger scale weather patterns. The lake has been in a state of decline interrupted by major flood events since the beginning of the satellite record. From 1973 to 1997, the lake area was between 0.97 km2 and 4.28 km2. Lake extent abruptly increased to 13.86 km2 in 1998, when a co-occurrence of El Niño and a positive Indian Ocean Dipole led to extensive flooding. It is hypothesized that local agricultural practices leading to soil erosion and subsequent basin sedimentation have most likely increased the sensitivity of Lake Basotu to climatic fluctuations.

  19. On the relationship between enamel band complexity and occlusal surface area in Equids (Mammalia, Perissodactyla

    Directory of Open Access Journals (Sweden)

    Nicholas A. Famoso


    Full Text Available Enamel patterns on the occlusal surfaces of equid teeth are asserted to have tribal-level differences. The most notable example compares the Equini and Hipparionini, where Equini have higher crowned teeth with less enamel-band complexity and less total occlusal enamel than Hipparionini. Whereas previous work has successfully quantified differences in enamel band shape by dividing the length of enamel band by the square root of the occlusal surface area (Occlusal Enamel Index, OEI, it was clear that OEI only partially removes the effect of body size. Because enamel band length scales allometrically, body size still has an influence on OEI, with larger individuals having relatively longer enamel bands than smaller individuals. Fractal dimensionality (D can be scaled to any level, so we have used it to quantify occlusal enamel complexity in a way that allows us to get at an accurate representation of the relationship between complexity and body size. To test the hypothesis of tribal-level complexity differences between Equini and Hipparionini, we digitally traced a sample of 98 teeth, one tooth per individual; 31 Hipparionini and 67 Equini. We restricted our sampling to the P3-M2 to reduce the effect of tooth position. After calculating the D of these teeth with the fractal box method which uses the number of boxes of various sizes to calculate the D of a line, we performed a t-test on the individual values of D for each specimen, comparing the means between the two tribes, and a phylogenetically informed generalized least squares regression (PGLS for each tribe with occlusal surface area as the independent variable and D as the dependent variable. The slopes of both PGLS analyses were compared using a t-test to determine if the same linear relationship existed between the two tribes. The t-test between tribes was significant (p < 0.0001, suggesting different D populations for each lineage. The PGLS for Hipparionini was a positive but not

  20. Surface water areas significantly impacted 2014 dengue outbreaks in Guangzhou, China. (United States)

    Tian, Huaiyu; Huang, Shanqian; Zhou, Sen; Bi, Peng; Yang, Zhicong; Li, Xiujun; Chen, Lifan; Cazelles, Bernard; Yang, Jing; Luo, Lei; Jing, Qinlong; Yuan, Wenping; Pei, Yao; Sun, Zhe; Yue, Tianxiang; Kwan, Mei-Po; Liu, Qiyong; Wang, Ming; Tong, Shilu; Brownstein, John S; Xu, Bing


    Dengue transmission in urban areas is strongly influenced by a range of biological and environmental factors, yet the key drivers still need further exploration. To better understand mechanisms of environment-mosquito-urban dengue transmission, we propose an empirical model parameterized and cross-validated from a unique dataset including viral gene sequences, vector dynamics and human dengue cases in Guangzhou, China, together with a 36-year urban environmental change maps investigated by spatiotemporal satellite image fusion. The dengue epidemics in Guangzhou are highly episodic and were not associated with annual rainfall over time. Our results indicate that urban environmental changes, especially variations in surface area covered by water in urban areas, can substantially alter the virus population and dengue transmission. The recent severe dengue outbreaks in Guangzhou may be due to the surge in an artificial lake construction, which could increase infection force between vector (mainly Aedes albopictus) and host when urban water area significantly increased. Impacts of urban environmental change on dengue dynamics may not have been thoroughly investigated in the past studies and more work needs to be done to better understand the consequences of urbanization processes in our changing world. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

  1. BOREAS HYD-03 SSA/OLD Aspen DBH Data (United States)

    National Aeronautics and Space Administration — ABSTRACT: The BOREAS HYD-03 team collected several data sets related to the hydrology of forested areas. This data set contains measurements of tree diameter at...

  2. Impacts of urban land-surface forcing on ozone air quality in the Seoul metropolitan area

    Directory of Open Access Journals (Sweden)

    Y.-H. Ryu


    Full Text Available Modified local meteorology owing to heterogeneities in the urban–rural surface can affect urban air quality. In this study, the impacts of urban land-surface forcing on ozone air quality during a high ozone (O3 episode in the Seoul metropolitan area, South Korea, are investigated using a high-resolution chemical transport model (CMAQ. Under fair weather conditions, the temperature excess (urban heat island significantly modifies boundary layer characteristics/structures and local circulations. The modified boundary layer and local circulations result in an increase in O3 levels in the urban area of 16 ppb in the nighttime and 13 ppb in the daytime. Enhanced turbulence in the deep urban boundary layer dilutes pollutants such as NOx, and this contributes to the elevated O3 levels through the reduced O3 destruction by NO in the NOx-rich environment. The advection of O3 precursors over the mountains near Seoul by the prevailing valley-breeze circulation in the mid- to late morning results in the build-up of O3 over the mountains in conjunction with biogenic volatile organic compound (BVOC emissions there. As the prevailing local circulation in the afternoon changes to urban-breeze circulation, the O3-rich air masses over the mountains are advected over the urban area. The urban-breeze circulation exerts significant influences on not only the advection of O3 but also the chemical production of O3 under the circumstances in which both anthropogenic and biogenic (natural emissions play important roles in O3 formation. As the air masses that are characterized by low NOx and high BVOC levels and long OH chain length are advected over the urban area from the surroundings, the ozone production efficiency increases in the urban area. The relatively strong vertical mixing in the urban boundary layer embedded in the

  3. Water surface area and depth determine oviposition choice in Aedes albopictus (Diptera: Culicidae). (United States)

    Reiskind, Michael H; Zarrabi, Ali A


    Oviposition choice is a well-studied aspect of the mosquito life cycle, and offers a potential avenue for species-specific surveillance and control. In container inhabiting mosquitoes, there has been a focus on how the components of the aquatic media determine choice, with little work on the physical characteristics of the containers themselves. We performed five experiments examining the effect of physical container parameters on oviposition choice by Aedes albopictus. We examined containers of three different surface areas (small, 496 cm2; medium, 863 cm2; and large, 1,938 cm2) at the same water depth and the same or different heights in a series of binary choice assays. We also examined different depths with the same surface area in clear containers (where the depth may be perceived by the darkness of the water) and in opaque containers, which appear uniformly dark at different depths. We found a significant preference for medium containers over large containers, whether the containers were different or the same heights, and a trend toward a preference for small containers over medium containers. There was a preference for deeper water regardless of whether containers were clear or opaque. These behaviors suggest mosquitoes take into account physical aspects of their habitats and their oviposition choices are consistent with minimizing the risk of habitat drying.

  4. Synthesis of silica aerogel monoliths with controlled specific surface areas and pore sizes (United States)

    Gao, Bingying; Lu, Shaoxiang; Kalulu, Mulenga; Oderinde, Olayinka; Ren, Lili


    To replace traditional preparation methods of silica aerogels, a small-molecule 1,2-epoxypropane (PO) has been introduced into the preparation process instead of using ammonia as the cross-linking agent, thus generating a lightweight, high porosity, and large surface area silica aerogel monolithic. We put forward a simple solution route for the chemical synthesis of silica aerogels, which was characterized by scanning electron microscopy (SEM), TEM, XRD, FTIR, thermogravimetric analysis (TGA) and the Brunauer-Emmett-Teller (BET) method In this paper, the effect of the amount of PO on the microstructure of silica aerogels is discussed. The BET surface areas and pore sizes of the resulting silica aerogels can be freely adjusted by changing the amount of PO, which will be helpful in promoting the development of silica aerogels to fabricate other porous materials with similar requirements. We also adopted a new organic solvent sublimation drying (OSSD) method to replace traditional expensive and dangerous drying methods such as critical point drying and freeze drying. This simple approach is easy to operate and has good repeatability, which will further facilitate actual applications of silica aerogels.

  5. Porous boron nitride with a high surface area: hydrogen storage and water treatment. (United States)

    Li, Jie; Lin, Jing; Xu, Xuewen; Zhang, Xinghua; Xue, Yanming; Mi, Jiao; Mo, Zhaojun; Fan, Ying; Hu, Long; Yang, Xiaojing; Zhang, Jun; Meng, Fanbin; Yuan, Songdong; Tang, Chengchun


    We report on the synthesis of high-quality microporous/mesoporous BN material via a facile two-step approach. An extremely high surface area of 1687 m(2) g(-1) and a large pore volume of 0.99 cm(3) g(-1) have been observed in the synthesized BN porous whiskers. The formation of the porous structure was attributed to the group elimination of organic species in a BN precursor, melamine diborate molecular crystal. This elimination method maintained the ordered pore structure and numerous structural defects. The features including high surface area, pore volume and structural defects make the BN whiskers highly suitable for hydrogen storage and wastewater treatment applications. We demonstrate excellent hydrogen uptake capacity of the BN whiskers with high weight adsorption up to 5.6% at room temperature and at the relatively low pressure of 3 MPa. Furthermore, the BN whiskers also exhibit excellent adsorption capacity of methyl orange and copper ions, with the maximum removal capacity of 298.3 and 373 mg g(-1) at 298 K, respectively.

  6. High-Surface-Area Nitrogen-Doped Reduced Graphene Oxide for Electric Double-Layer Capacitors. (United States)

    Youn, Hee-Chang; Bak, Seong-Min; Kim, Myeong-Seong; Jaye, Cherno; Fischer, Daniel A; Lee, Chang-Wook; Yang, Xiao-Qing; Roh, Kwang Chul; Kim, Kwang-Bum


    A two-step method consisting of solid-state microwave irradiation and heat treatment under NH3 gas was used to prepare nitrogen-doped reduced graphene oxide (N-RGO) with a high specific surface area (1007 m(2)  g(-1) ), high electrical conductivity (1532 S m(-1) ), and low oxygen content (1.5 wt %) for electrical double-layer capacitor applications. The specific capacitance of N-RGO was 291 F g(-1) at a current density of 1 A g(-1) , and a capacitance of 261 F g(-1) was retained at 50 A g(-1) , which indicated a very good rate capability. N-RGO also showed excellent cycling stability and preserved 96 % of the initial specific capacitance after 100 000 cycles. Near-edge X-ray absorption fine-structure spectroscopy results provided evidenced for the recovery of π conjugation in the carbon networks with the removal of oxygenated groups and revealed chemical bonding of the nitrogen atoms in N-RGO. The good electrochemical performance of N-RGO is attributed to its high surface area, high electrical conductivity, and low oxygen content. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. Particle size and surface area effects on the thin-pulse shock initiation of Diaminoazoxyfurazan (DAAF) (United States)

    Burritt, Rosemary; Francois, Elizabeth; Windler, Gary; Chavez, David


    Diaminoazoxyfurazan (DAAF) has many of the safety characteristics of an insensitive high explosive (IHE): it is extremely insensitive to impact and friction and is comparable to triaminotrinitrobezene (TATB) in this way. Conversely, it demonstrates many performance characteristics of a Conventional High Explosive (CHE). DAAF has a small failure diameter of about 1.25 mm and can be sensitive to shock under the right conditions. Large particle sized DAAF will not initiate in a typical exploding foil initiator (EFI) configuration but smaller particle sizes will. Large particle sized DAAF, of 40 μm, was crash precipitated and ball milled into six distinct samples and pressed into pellets with a density of 1.60 g/cc (91% TMD). To investigate the effect of particle size and surface area on the direct initiation on DAAF multiple threshold tests were preformed on each sample of DAAF in different EFI configurations, which varied in flyer thickness and/or bridge size. Comparative tests were performed examining threshold voltage and correlated to Photon Doppler Velocimetry (PDV) results. The samples with larger particle sizes and surface area required more energy to initiate while the smaller particle sizes required less energy and could be initiated with smaller diameter flyers.

  8. Adsorption of naphthalene onto a high-surface-area carbon from waste ion exchange resin. (United States)

    Shi, Qianqian; Li, Aimin; Zhu, Zhaolian; Liu, Bing


    A high-surface-area carbon (KC-1) was prepared from waste polystyrene-based ion exchange resin by KOH activation and used for naphthalene adsorption. The carbon exhibited a good hydrophobic nature with developed porous structure, favoring the adsorption of organic compounds. The Brunauer-Emmett-Teller surface area and total pore volume of KC-1 were 3442.2 and 1.68 cm3/g, respectively, which can be compared with those of KOH-activated carbons prepared from other precursors. Batch experiments were carried out to investigate the adsorption of naphthalene onto KC-1. The equilibrium data were analyzed by the Langmuir, Freundlich, and Polanyi-Manes isotherms and agreed with the Polanyi-Manes Model. The adsorption of naphthalene depended greatly on the porosity of the carbon, and the dispersive interactions between naphthalene and carbon could be relatively weak. The pH variation in aqueous solution had little effect on the adsorption process. The equilibrium time for 0.04 g/L of carbon dose was around 5 hr. Different models were used to evaluate the kinetic data and the pseudo second-order model was suitable to describe the kinetic process of naphthalene adsorption onto KC-1. Regeneration of spent carbon could be carried out effectively by alcohol treatment. The results indicated that KC-1 was a promising adsorbent for the removal of polycyclic aromatic hydrocarbons from aqueous solutions.

  9. Closure Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Nevada

    International Nuclear Information System (INIS)

    Campbell, K.B.


    This Closure Report provides the documentation for closure of the Central Nevada Test Area (CNTA) surface Corrective Action Unit (CAU) 417. The CNTA is located in Hot Creek Valley in Nye County, Nevada, approximately 22.5 kilometers (14 miles) west of U.S. State Highway 6 near the Moores Station historical site, and approximately 137 kilometers (85 miles) northeast of Tonopah, Nevada. The CNTA consists of three separate land withdrawal areas commonly referred to as UC-1, UC-3, and UC-4, all of which are accessible to the public. A nuclear device for Project Faultless was detonated approximately 975 meters (3,200 feet) below ground surface on January 19, 1968, in emplacement boring UC-1 (Department of Energy, Nevada Operation Office [DOE/NV], 1997). CAU 417 consists of 34 Corrective Action Sites (CASs). Site closure was completed using a Nevada Department of Environmental Protection (NDEP) approved Corrective Action Plan (CAP) (DOE/NV, 2000) which was based on the recommendations presented in the NDEP-approved Corrective Action Decision Document (DOE/NV, 1999). Closure of CAU 417 was completed in two phases. Phase I field activities were completed with NDEP concurrence during 1999 as outlined in the Phase I Work Plan, Appendix A of the CAP (DOE/NV, 2000), and as summarized in Section 2.1.2 of this document

  10. Quantifying the effect of waterways and green areas on the surface temperature

    Directory of Open Access Journals (Sweden)

    Elis Dener Lima Alves


    Full Text Available The cooling effects of urban parks and green areas, which form the “Park Cool Island” (PCI can help decrease the surface temperature and mitigate the effects of urban heat islands (UHI. Therefore, the objective of this research was to know the temporal variability of PCI intensity, as well as analyze the factors that determines it and propose an equation to predict the PCI intensity in Iporá, Goiás State, Brazil. To this purpose, the PCI intensity values were obtained using the Landsat-8 satellite (band 10, and then correlated with the NDVI and the LAI, in which proposes equations through multiple linear regression to estimate the PCI intensity. The results indicated that: 1 the greater the distance of the natural area, greater the surface temperature; 2 there is a great seasonality in PCI, in which the intensity of PCI is much higher in the spring (or close to it; 3 the relationship between NDVI and LAI variables, showed good coefficients of determination; 4 the equations for the buffer of 200 and 500 m, had low RMSE with high coefficients of determination (r2 = 0.924 and r2 = 0.957 respectively.

  11. Ultrahigh surface area carbon from carbonated beverages: Combining self-templating process and in situ activation

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Pengfei; Zhang, Zhiyong; Chen, Jihua; Dai, Sheng


    Ultrahigh surface area carbons (USACs, e.g., >2000 m2/g) are attracting tremendous attention due to their outstanding performance in energy-related applications. The state-of-art approaches to USACs involve templating or activation methods and all these techniques show certain drawbacks. In this work, a series of USACs with specific surface areas up to 3633 m2/g were prepared in two steps: hydrothermal carbonization (200 °C) of carbonated beverages (CBs) and further thermal treatment in nitrogen (600–1000 °C). The rich inner porosity is formed by a self-templated process during which acids and polyelectrolyte sodium salts in the beverage formulas make some contribution. This strategy covers various CBs such as Coca Cola®, Pepsi Cola®, Dr. Pepper®, and Fanta® and it enables an acceptable product yield (based on sugars), for example: 21 wt% for carbon (2940 m2/g) from Coca Cola®. Being potential electrode materials for supercapacitors, those carbon materials possessed a good specific capacitance (57.2–185.7 F g-1) even at a scan rate of 1000 mV s-1. Thus, a simple and efficient strategy to USACs has been presented.

  12. Surface area-burnoff correlation for the steam--graphite reaction

    International Nuclear Information System (INIS)

    Stark, W.A. Jr.; Malinauskas, A.P.


    The oxidation of core graphite by steam of air represents a problem area of significant concern in safety analyses for the high temperature gas cooled reactor (HTGR). Core and core-support graphite integrity and strength deteriorate with oxidation of the graphite, and oxidation furthermore could affect the rate of fission product release under upset conditions. Consequently, modeling of core response during steam or air ingress conditions requires an expression for the rate of graphite interaction with those impurities. The steam--graphite reaction in particular is a complex interaction of mass transport within the graphite with chemi-sorption and reaction on accessible surfaces; experimental results from graphite to graphite are highly variable, and the description of the reaction is not yet completely consistent. A simple etch pit model relating surface area to burnoff has been proposed and shown to provide reasonable correlation with experimental data obtained from steam oxidation studies of nuclear grade H-327 graphite. Unaccounted differences between theory and experiment arise at burnoffs exceeding 3 to 5 percent. The model, while not complete nor comprehensive, is consistent with experimental observations of graphite oxidation by O 2 (air), CO 2 , or H 2 O, and could have some utility in safety analysis

  13. Spherical Torus Plasma Interactions with Large-area Liquid Lithium Surfaces in CDX-U

    International Nuclear Information System (INIS)

    Kaita, R.; Majeski, R.; Boaz, M.; Efthimion, P.; Jones, B.; Hoffman, D.; Kugel, H.; Menard, J.; Munsat, T.; Post-Zwicker, A.; Soukhanovskii, V.; Spaleta, J.; Taylor, G.; Timberlake, J.; Woolley, R.; Zakharov, L.; Finkenthal, M.; Stutman, D.; Antar, G.; Doerner, R.; Luckhardt, S.; Maingi, R.; Maiorano, M.; Smith, S.


    The Current Drive Experiment-Upgrade (CDX-U) device at the Princeton Plasma Physics Laboratory (PPPL) is a spherical torus (ST) dedicated to the exploration of liquid lithium as a potential solution to reactor first-wall problems such as heat load and erosion, neutron damage and activation, and tritium inventory and breeding. Initial lithium limiter experiments were conducted with a toroidally-local liquid lithium rail limiter (L3) from the University of California at San Diego. Spectroscopic measurements showed a clear reduction of impurities in plasmas with the L3, compared to discharges with a boron carbide limiter. The evidence for a reduction in recycling was less apparent, however. This may be attributable to the relatively small area in contact with the plasma, and the presence of high-recycling surfaces elsewhere in the vacuum chamber. This conclusion was tested in subsequent experiments with a fully toroidal lithium limiter that was installed above the floor of the vacuum vessel. The new limiter covered over ten times the area of the L3 facing the plasma. Experiments with the toroidal lithium limiter have recently begun. This paper describes the conditioning required to prepare the lithium surface for plasma operations, and effect of the toroidal liquid lithium limiter on discharge performance

  14. Spherical Torus Plasma Interactions with Large-area Liquid Lithium Surfaces in CDX-U

    Energy Technology Data Exchange (ETDEWEB)

    R. Kaita; R. Majeski; M. Boaz; P. Efthimion; B. Jones; D. Hoffman; H. Kugel; J. Menard; T. Munsat; A. Post-Zwicker; V. Soukhanovskii; J. Spaleta; G. Taylor; J. Timberlake; R. Woolley; L. Zakharov; M. Finkenthal; D. Stutman; G. Antar; R. Doerner; S. Luckhardt; R. Maingi; M. Maiorano; S. Smith


    The Current Drive Experiment-Upgrade (CDX-U) device at the Princeton Plasma Physics Laboratory (PPPL) is a spherical torus (ST) dedicated to the exploration of liquid lithium as a potential solution to reactor first-wall problems such as heat load and erosion, neutron damage and activation, and tritium inventory and breeding. Initial lithium limiter experiments were conducted with a toroidally-local liquid lithium rail limiter (L3) from the University of California at San Diego. Spectroscopic measurements showed a clear reduction of impurities in plasmas with the L3, compared to discharges with a boron carbide limiter. The evidence for a reduction in recycling was less apparent, however. This may be attributable to the relatively small area in contact with the plasma, and the presence of high-recycling surfaces elsewhere in the vacuum chamber. This conclusion was tested in subsequent experiments with a fully toroidal lithium limiter that was installed above the floor of the vacuum vessel. The new limiter covered over ten times the area of the L3 facing the plasma. Experiments with the toroidal lithium limiter have recently begun. This paper describes the conditioning required to prepare the lithium surface for plasma operations, and effect of the toroidal liquid lithium limiter on discharge performance.

  15. Permeability surface area product analysis in malignant brain edema prediction - A pilot study. (United States)

    Volny, O; Cimflova, P; Lee, T-Y; Menon, B K; d'Esterre, C D


    Using an extended CT perfusion acquisition (150s), we sought to determine the association between perfusion parameters and malignant edema after ischemic stroke. Patients (from prospective study PROVE-IT, NCT02184936) with terminal internal carotid artery±proximal middle cerebral occlusion were involved. CTA was assessed for clot location and status of leptomeningeal collaterals. The following CTP parameters were calculated within the ischemic territory and contralaterally: permeability surface area product (PS), cerebral blood flow (CBF) and cerebral blood volume (CBV). PS was calculated using the adiabatic approximation to the Johnson and Wilson model. Outcome was evaluated by midline shift and infarction volume on follow-up imaging. Of 200 patients enrolled, 7 patients (3.5%) had midline shift≥5mm (2 excluded for poor-quality scans). Five patients with midline shift and 5 matched controls were analysed. There was no significant difference in mean PS, CBF and CBV within the ischemic territory between the two groups. A CBV threshold of 1.7ml/100g had the highest AUC=0.72, 95% CI=0.54-0.90 for early midline shift prediction, sensitivity and specificity were 0.83 and 0.67 respectively. Our preliminary results did not show significant differences in permeability surface area analysis if analysed for complete ischemic region. CBV parameter had the highest accuracy and there was a trend for the mean PS values for midline shift prediction. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. AFM-based tribological study of nanopatterned surfaces: the influence of contact area instabilities. (United States)

    Rota, A; Serpini, E; Gazzadi, G C; Valeri, S


    Although the importance of morphology on the tribological properties of surfaces has long been proved, an exhaustive understanding of nanopatterning effects is still lacking due to the difficulty in both fabricating 'really nano-' structures and detecting their tribological properties. In the present work we show how the probe-surface contact area can be a critical parameter due to its remarkable local variability, making a correct interpretation of the data very difficult in the case of extremely small nanofeatures. Regular arrays of parallel 1D straight nanoprotrusions were fabricated by means of a low-dose focused ion beam, taking advantage of the amorphization-related swelling effect. The tribological properties of the patterns were detected in the presence of air and in vacuum (dry ambient) by atomic force microscopy. We have introduced a novel procedure and data analysis to reduce the uncertainties related to contact instabilities. The real time estimation of the radius of curvature of the contacting asperity enables us to study the dependence of the tribological properties of the patterns from their geometrical characteristics. The effect of the patterns on both adhesion and the coefficient of friction strongly depends on the contact area, which is linked to the local radius of curvature of the probe. However, a detectable hydrophobic character induced on the hydrophilic native SiO2 has been observed as well. The results suggest a scenario for capillary formation on the patterns.

  17. Non-activated high surface area expanded graphite oxide for supercapacitors

    Energy Technology Data Exchange (ETDEWEB)

    Vermisoglou, E.C.; Giannakopoulou, T.; Romanos, G.E.; Boukos, N.; Giannouri, M. [Institute of Nanoscience and Nanotechnology “Demokritos”, 153 43 Ag. Paraskevi, Attikis (Greece); Lei, C.; Lekakou, C. [Division of Mechanical, Medical, and Aerospace Engineering, Faculty of Engineering and Physical Sciences, University of Surrey, Guildford GU2 7XH (United Kingdom); Trapalis, C., E-mail: [Institute of Nanoscience and Nanotechnology “Demokritos”, 153 43 Ag. Paraskevi, Attikis (Greece)


    Graphical abstract: - Highlights: • One-step exfoliation and reduction of graphite oxide via microwave irradiation. • Effect of pristine graphite (type, flake size) on the microwave expanded material. • Effect of pretreatment and oxidation cycles on the produced expanded material. • Expanded graphene materials with high BET surface areas (940 m{sup 2}/g–2490 m{sup 2}/g). • Non-activated graphene based materials suitable for supercapacitors. - Abstract: Microwave irradiation of graphite oxide constitutes a facile route toward production of reduced graphene oxide, since during this treatment both exfoliation and reduction of graphite oxide occurs. In this work, the effect of pristine graphite (type, size of flakes), pretreatment and oxidation cycles on the finally produced expanded material was examined. All the types of graphite that were tested afforded materials with high BET surface areas ranging from 940 m{sup 2}/g to 2490 m{sup 2}/g, without intervening an activation stage at elevated temperature. SEM and TEM images displayed exfoliated structures, where the flakes were significantly detached and curved. The quality of the reduced graphene oxide sheets was evidenced both by X-ray photoelectron spectroscopy and Raman spectroscopy. The electrode material capacitance was determined via electrochemical impedance spectroscopy and cyclic voltammetry. The materials with PEDOT binder had better performance (∼97 F/g) at low operation rates while those with PVDF binder performed better (∼20 F/g) at higher rates, opening up perspectives for their application in supercapacitors.

  18. Reduction Expansion Synthesis as Strategy to Control Nitrogen Doping Level and Surface Area in Graphene. (United States)

    Canty, Russell; Gonzalez, Edwin; MacDonald, Caleb; Osswald, Sebastian; Zea, Hugo; Luhrs, Claudia C


    Graphene sheets doped with nitrogen were produced by the reduction-expansion (RES) method utilizing graphite oxide (GO) and urea as precursor materials. The simultaneous graphene generation and nitrogen insertion reactions are based on the fact that urea decomposes upon heating to release reducing gases. The volatile byproducts perform two primary functions: (i) promoting the reduction of the GO and (ii) providing the nitrogen to be inserted in situ as the graphene structure is created. Samples with diverse urea/GO mass ratios were treated at 800 °C in inert atmosphere to generate graphene with diverse microstructural characteristics and levels of nitrogen doping. Scanning electron microscopy (SEM) and transmission electron microscopy (TEM) were used to study the microstructural features of the products. The effects of doping on the samples structure and surface area were studied by X-ray diffraction (XRD), Raman Spectroscopy, and Brunauer Emmet Teller (BET). The GO and urea decomposition-reduction process as well as nitrogen-doped graphene stability were studied by thermogravimetric analysis (TGA) coupled with mass spectroscopy (MS) analysis of the evolved gases. Results show that the proposed method offers a high level of control over the amount of nitrogen inserted in the graphene and may be used alternatively to control its surface area. To demonstrate the practical relevance of these findings, as-produced samples were used as electrodes in supercapacitor and battery devices and compared with conventional, thermally exfoliated graphene.

  19. Reduction Expansion Synthesis as Strategy to Control Nitrogen Doping Level and Surface Area in Graphene

    Directory of Open Access Journals (Sweden)

    Russell Canty


    Full Text Available Graphene sheets doped with nitrogen were produced by the reduction-expansion (RES method utilizing graphite oxide (GO and urea as precursor materials. The simultaneous graphene generation and nitrogen insertion reactions are based on the fact that urea decomposes upon heating to release reducing gases. The volatile byproducts perform two primary functions: (i promoting the reduction of the GO and (ii providing the nitrogen to be inserted in situ as the graphene structure is created. Samples with diverse urea/GO mass ratios were treated at 800 °C in inert atmosphere to generate graphene with diverse microstructural characteristics and levels of nitrogen doping. Scanning electron microscopy (SEM and transmission electron microscopy (TEM were used to study the microstructural features of the products. The effects of doping on the samples structure and surface area were studied by X-ray diffraction (XRD, Raman Spectroscopy, and Brunauer Emmet Teller (BET. The GO and urea decomposition-reduction process as well as nitrogen-doped graphene stability were studied by thermogravimetric analysis (TGA coupled with mass spectroscopy (MS analysis of the evolved gases. Results show that the proposed method offers a high level of control over the amount of nitrogen inserted in the graphene and may be used alternatively to control its surface area. To demonstrate the practical relevance of these findings, as-produced samples were used as electrodes in supercapacitor and battery devices and compared with conventional, thermally exfoliated graphene.

  20. Development of a GNSS Buoy for Monitoring Water Surface Elevations in Estuaries and Coastal Areas. (United States)

    Lin, Yen-Pin; Huang, Ching-Jer; Chen, Sheng-Hsueh; Doong, Dong-Jiing; Kao, Chia Chuen


    In this work, a Global Navigation Satellite System (GNSS) buoy that utilizes a Virtual Base Station (VBS) combined with the Real-Time Kinematic (RTK) positioning technology was developed to monitor water surface elevations in estuaries and coastal areas. The GNSS buoy includes a buoy hull, a RTK GNSS receiver, data-transmission devices, a data logger, and General Purpose Radio Service (GPRS) modems for transmitting data to the desired land locations. Laboratory and field tests were conducted to test the capability of the buoy and verify the accuracy of the monitored water surface elevations. For the field tests, the GNSS buoy was deployed in the waters of Suao (northeastern part of Taiwan). Tide data obtained from the GNSS buoy were consistent with those obtained from the neighboring tide station. Significant wave heights, zero-crossing periods, and peak wave directions obtained from the GNSS buoy were generally consistent with those obtained from an accelerometer-tilt-compass (ATC) sensor. The field tests demonstrate that the developed GNSS buoy can be used to obtain accurate real-time tide and wave data in estuaries and coastal areas.

  1. 75 FR 7648 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Veterans Affairs... (United States)


    .../Veterans Benefits Administration (VA/ VBA))--Match Number 1309 AGENCY: Social Security Administration (SSA... announces a renewal of an existing computer matching program that we are currently conducting with VA/VBA... Matching Program, SSA With the Department of Veterans Affairs/Veterans Benefits Administration (VA/VBA) A...

  2. 20 CFR 408.1235 - How does the State transfer funds to SSA to administer its recognition payment program? (United States)


    ... administer its recognition payment program? 408.1235 Section 408.1235 Employees' Benefits SOCIAL SECURITY... fifth business day following such date. (b) Accounting of State funds. (1) As soon as feasible after the... balance of the State's cash on deposit with SSA. (2) SSA will provide the State with an accounting of...

  3. 20 CFR 411.597 - Will SSA periodically review the outcome payment system and the outcome-milestone payment system... (United States)


    ... Employment Network Payment Systems § 411.597 Will SSA periodically review the outcome payment system and the outcome-milestone payment system for possible modifications? (a) Yes. We will periodically review the... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Will SSA periodically review the outcome...

  4. 76 FR 55690 - Submission for OMB Review; Comment Request; The SSA-NIH Collaboration To Improve the Disability... (United States)


    ...; Comment Request; The SSA-NIH Collaboration To Improve the Disability Determination Process: Validation of... Collection: Title: The SSA-NIH Collaboration to Improve the Disability Determination Process: Validation of IRT-CAT tools. Type of Information Collection Request: NEW. Need and Use of Information Collection...

  5. Lupus systémique et atteinte rénale: Apport des anticorps anti-SSA ...

    African Journals Online (AJOL)

    -SSA dans 12 cas (40%).Cinq patients (62.5%) ayant une atteinte rénale avaient des anticorps anti DNA négatifs. Parmi ces patients avec atteinte rénale, 37.5% avaient des anticorps anti SSA sans anticorps anti DNA. La moitié des patients ...

  6. Experimental Study on the Microstructure Evolution of Mixed Disposal Paste in Surface Subsidence Areas

    Directory of Open Access Journals (Sweden)

    Wei Sun


    Full Text Available The integrated disposal of surface subsidence pits and surface solid waste can be realized by backfilling a surface subsidence area with a paste made from the solid wastes of mines, such as tailings and waste rock. The microstructures of these wastes determine the macroscopic properties of a paste backfill. This paper presents an experimental study on the internal structure evolution of pasty fluid mixed with different waste rock concentrations (10%, 30%, and 50% and cement dosages (1% and 2% under damage. To this end, a real-time computed tomography (CT scan is conducted using medical CT and a small loading device. Results show that UCS (uniaxial compressive strength increases when the amount of cement increases. Given a constant amount of cement, UCS increases first and then decreases as waste rock content increases. UCS is maximized at 551 kPa when the waste rock content is 30%. The paste body is a typical medium used to investigate initial damage, which mainly consists of microholes, pores, and microcracks. The initial damages also exhibit a high degree of random inhomogeneity. After loading, cracks are initiated and expand gradually from the original damage location until the overall damages are generated. The mesostructure evolution model of the paste body is divided into six categories, and this mesostructure is reasonable when the waste rock content is 30%.

  7. Topographic Effects on the Surface Emissivity of a Mountainous Area Observed by a Spaceborne Microwave Radiometer

    Directory of Open Access Journals (Sweden)

    Frank S. Marzano


    Full Text Available A simulation study to understand the influence of topography on the surfaceemissivity observed by a satellite microwave radiometer is carried out. We analyze theeffects due to changes in observation angle, including the rotation of the polarization plane.A mountainous area in the Alps (Northern Italy is considered and the information on therelief extracted from a digital elevation model is exploited. The numerical simulation refersto a radiometric image, acquired by a conically-scanning radiometer similar to AMSR-E,i.e., flying at 705 km of altitude with an observation angle of 55°. To single out the impacton surface emissivity, scattering of the radiation due to the atmosphere or neighboringelevated surfaces is not considered. C and X bands, for which atmospheric effects arenegligible, and Ka band are analyzed. The results indicate that the changes in the localobservation angle tend to lower the apparent emissivity of a radiometric pixel with respectto the corresponding flat surface characteristics. The effect of the rotation of thepolarization plane enlarges (vertical polarization, or attenuates (horizontal polarizationthis decrease. By doing some simplifying assumptions for the radiometer antenna, theconclusion is that the microwave emissivity at vertical polarization is underestimated,whilst the opposite occurs for horizontal polarization, except for Ka band, for which bothunder- and overprediction may occur. A quantification of the differences with respect to aflat soil and an approximate evaluation of their impact on soil moisture retrieval areyielded.

  8. Synthetic microfluidic paper: high surface area and high porosity polymer micropillar arrays. (United States)

    Hansson, Jonas; Yasuga, Hiroki; Haraldsson, Tommy; van der Wijngaart, Wouter


    We introduce Synthetic Microfluidic Paper, a novel porous material for microfluidic applications that consists of an OSTE polymer that is photostructured in a well-controlled geometry of slanted and interlocked micropillars. We demonstrate the distinct benefits of Synthetic Microfluidic Paper over other porous microfluidic materials, such as nitrocellulose, traditional paper and straight micropillar arrays: in contrast to straight micropillar arrays, the geometry of Synthetic Microfluidic Paper was miniaturized without suffering capillary collapse during manufacturing and fluidic operation, resulting in a six-fold increased internal surface area and a three-fold increased porous fraction. Compared to commercial nitrocellulose materials for capillary assays, Synthetic Microfluidic Paper shows a wider range of capillary pumping speed and four times lower device-to-device variation. Compared to the surfaces of the other porous microfluidic materials that are modified by adsorption, Synthetic Microfluidic Paper contains free thiol groups and has been shown to be suitable for covalent surface chemistry, demonstrated here for increasing the material hydrophilicity. These results illustrate the potential of Synthetic Microfluidic Paper as a porous microfluidic material with improved performance characteristics, especially for bioassay applications such as diagnostic tests.

  9. Diversity of Bacterial Communities of Fitness Center Surfaces in a U.S. Metropolitan Area

    Directory of Open Access Journals (Sweden)

    Nabanita Mukherjee


    Full Text Available Public fitness centers and exercise facilities have been implicated as possible sources for transmitting community-acquired bacterial infections. However, the overall diversity of the bacterial community residing on the surfaces in these indoor environments is still unknown. In this study, we investigated the overall bacterial ecology of selected fitness centers in a metropolitan area (Memphis, TN, USA utilizing culture-independent pyrosequencing of the 16S rRNA genes. Samples were collected from the skin-contact surfaces (e.g., exercise instruments, floor mats, handrails, etc. within fitness centers. Taxonomical composition revealed the abundance of Firmicutes phyla, followed by Proteobacter and Actinobacteria, with a total of 17 bacterial families and 25 bacterial genera. Most of these bacterial genera are of human and environmental origin (including, air, dust, soil, and water. Additionally, we found the presence of some pathogenic or potential pathogenic bacterial genera including Salmonella, Staphylococcus, Klebsiella, and Micrococcus. Staphylococcus was found to be the most prevalent genus. Presence of viable forms of these pathogens elevates risk of exposure of any susceptible individuals. Several factors (including personal hygiene, surface cleaning and disinfection schedules of the facilities may be the reasons for the rich bacterial diversity found in this study. The current finding underscores the need to increase public awareness on the importance of personal hygiene and sanitation for public gym users.

  10. Diversity of bacterial communities of fitness center surfaces in a U.S. metropolitan area. (United States)

    Mukherjee, Nabanita; Dowd, Scot E; Wise, Andy; Kedia, Sapna; Vohra, Varun; Banerjee, Pratik


    Public fitness centers and exercise facilities have been implicated as possible sources for transmitting community-acquired bacterial infections. However, the overall diversity of the bacterial community residing on the surfaces in these indoor environments is still unknown. In this study, we investigated the overall bacterial ecology of selected fitness centers in a metropolitan area (Memphis, TN, USA) utilizing culture-independent pyrosequencing of the 16S rRNA genes. Samples were collected from the skin-contact surfaces (e.g., exercise instruments, floor mats, handrails, etc.) within fitness centers. Taxonomical composition revealed the abundance of Firmicutes phyla, followed by Proteobacter and Actinobacteria, with a total of 17 bacterial families and 25 bacterial genera. Most of these bacterial genera are of human and environmental origin (including, air, dust, soil, and water). Additionally, we found the presence of some pathogenic or potential pathogenic bacterial genera including Salmonella, Staphylococcus, Klebsiella, and Micrococcus. Staphylococcus was found to be the most prevalent genus. Presence of viable forms of these pathogens elevates risk of exposure of any susceptible individuals. Several factors (including personal hygiene, surface cleaning and disinfection schedules of the facilities) may be the reasons for the rich bacterial diversity found in this study. The current finding underscores the need to increase public awareness on the importance of personal hygiene and sanitation for public gym users.

  11. Benchmarking sensitivity of biophysical processes to leaf area changes in land surface models (United States)

    Forzieri, Giovanni; Duveiller, Gregory; Georgievski, Goran; Li, Wei; Robestson, Eddy; Kautz, Markus; Lawrence, Peter; Ciais, Philippe; Pongratz, Julia; Sitch, Stephen; Wiltshire, Andy; Arneth, Almut; Cescatti, Alessandro


    Land surface models (LSM) are widely applied as supporting tools for policy-relevant assessment of climate change and its impact on terrestrial ecosystems, yet knowledge of their performance skills in representing the sensitivity of biophysical processes to changes in vegetation density is still limited. This is particularly relevant in light of the substantial impacts on regional climate associated with the changes in leaf area index (LAI) following the observed global greening. Benchmarking LSMs on the sensitivity of the simulated processes to vegetation density is essential to reduce their uncertainty and improve the representation of these effects. Here we present a novel benchmark system to assess model capacity in reproducing land surface-atmosphere energy exchanges modulated by vegetation density. Through a collaborative effort of different modeling groups, a consistent set of land surface energy fluxes and LAI dynamics has been generated from multiple LSMs, including JSBACH, JULES, ORCHIDEE, CLM4.5 and LPJ-GUESS. Relationships of interannual variations of modeled surface fluxes to LAI changes have been analyzed at global scale across different climatological gradients and compared with satellite-based products. A set of scoring metrics has been used to assess the overall model performances and a detailed analysis in the climate space has been provided to diagnose possible model errors associated to background conditions. Results have enabled us to identify model-specific strengths and deficiencies. An overall best performing model does not emerge from the analyses. However, the comparison with other models that work better under certain metrics and conditions indicates that improvements are expected to be potentially achievable. A general amplification of the biophysical processes mediated by vegetation is found across the different land surface schemes. Grasslands are characterized by an underestimated year-to-year variability of LAI in cold climates

  12. Satellite Observed Variability in Antarctic and Arctic Surface Temperatures and Their Correlation to Open Water Areas (United States)

    Comiso, Josefino C.; Zukor, Dorothy (Technical Monitor)


    Recent studies using meterological station data have indicated that global surface air temperature has been increasing at a rate of 0.05 K/decade. Using the same set of data but for stations in the Antarctic and Arctic regions (>50 N) only, the increases in temperature were 0.08, and 0.22 K/decade, when record lengths of 100 and 50 years, respectively, were used. To gain insights into the increasing rate of warming, satellite infrared and passive microwave observations over the Arctic region during the last 20 years were processed and analyzed. The results show that during this period, the ice extent in the Antarctic has been increasing at the rate of 1.2% per decade while the surface temperature has been decreasing at about 0.08 K per decade. Conversely, in the Northern Hemisphere, the ice extent has been decreasing at a rate of 2.8% per decade, while the surface temperatures have been increasing at the rate of 0.38 K per decade. In the Antarctic, it is surprising that there is a short term trend of cooling during a global period of warming. Very large anomalies in open water areas in the Arctic were observed especially in the western region, that includes the Beaufort Sea, where the observed open water area was about 1x10(exp 6) sq km, about twice the average for the region, during the summer of 1998. In the eastern region, that includes the Laptev Sea, the area of open water was also abnormally large in the summer of 1995. Note that globally, the warmest and second warmest years in this century, were 1998 and 1995, respectively. The data, however, show large spatial variability with the open water area distribution showing a cyclic periodicity of about ten years, which is akin to the North Atlantic and Arctic Oscillations. This was observed in both western and eastern regions but with the phase of one lagging the other by about two years. This makes it difficult to interpret what the trends really mean. But although the record length of satellite data is still

  13. An application of the Krylov-FSP-SSA method to parameter fitting with maximum likelihood (United States)

    Dinh, Khanh N.; Sidje, Roger B.


    Monte Carlo methods such as the stochastic simulation algorithm (SSA) have traditionally been employed in gene regulation problems. However, there has been increasing interest to directly obtain the probability distribution of the molecules involved by solving the chemical master equation (CME). This requires addressing the curse of dimensionality that is inherent in most gene regulation problems. The finite state projection (FSP) seeks to address the challenge and there have been variants that further reduce the size of the projection or that accelerate the resulting matrix exponential. The Krylov-FSP-SSA variant has proved numerically efficient by combining, on one hand, the SSA to adaptively drive the FSP, and on the other hand, adaptive Krylov techniques to evaluate the matrix exponential. Here we apply this Krylov-FSP-SSA to a mutual inhibitory gene network synthetically engineered in Saccharomyces cerevisiae, in which bimodality arises. We show numerically that the approach can efficiently approximate the transient probability distribution, and this has important implications for parameter fitting, where the CME has to be solved for many different parameter sets. The fitting scheme amounts to an optimization problem of finding the parameter set so that the transient probability distributions fit the observations with maximum likelihood. We compare five optimization schemes for this difficult problem, thereby providing further insights into this approach of parameter estimation that is often applied to models in systems biology where there is a need to calibrate free parameters. Work supported by NSF grant DMS-1320849.

  14. Ro/SSA autoantibody-positive pregnancy: reactions to serial fetal Doppler echocardiographic surveillance. (United States)

    Tingström, J; Hjelmstedt, A; Welin Henriksson, E; Sonesson, S-E; Wahren-Herlenius, M


    The risk for congenital heart block (CHB) associated with maternal Ro/SSA autoantibodies is low, but the possibility of treating early stages of disease has seen the introduction of Doppler echocardiographic surveillance programs with serial examinations during the CHB susceptibility weeks of pregnancy. The aim of the present study was to understand how Ro/SSA autoantibody-positive women having undergone Doppler echocardiographic surveillance programs and giving birth to children without CHB experienced their pregnancy and frequent ultrasound examinations. A validated questionnaire based on data from an interview-study was distributed to Ro/SSA-positive women supervised with Doppler examinations during their pregnancy (n = 100). The response rate was 79%. The majority of the women (61%) reported that the increased number of ultrasound examinations influenced their pregnancy, but in a positive way, with qualified information and additional support from health care personnel in conjunction with the examinations. Further, the visits to the clinic provided opportunities to see the ultrasound picture of the expected infant. However, one-third of the women also reported stress in relation to the examinations. Fetal echocardiographic surveillance holds many and predominantly positive effects for Ro/SSA-positive women during pregnancy in addition to the medical advantages. © The Author(s) 2015.

  15. Possible role of anti-SSA/Ro antibodies in the pathogenesis of pulmonary hypertension. (United States)

    Guerreso, Kelsey; Conner, Edward Alexander


    There are many different causes of pulmonary hypertension and the pathogenesis of the disease is still being elucidated. Although they are not the most common, autoimmunity and inflammation have been identified as possible causes. No one autoantibody has been identified as the definite cause of pulmonary hypertension. We present a rare association of anti-SSA/Ro antibodies and isolated pulmonary hypertension. A 53 year old African American female presented with abdominal pain, nausea, weight loss, dyspnea and fatigue. Upon further exam she was found to have high titers of antinuclear antibodies and anti-SSA/Ro antibodies. This antibody profile would typically be suggestive of Sjögren's Syndrome, which is characterized by dry eyes and poor salivary gland function. However, since this patient did not have any symptoms consistent with the disease a diagnosis of Sjögren's Syndrome could not be made. A combination of laboratory, imaging and diagnostic studies were done that revealed a final diagnosis of pulmonary hypertension. It is known that pulmonary hypertension has association with autoimmune diseases, however no clear markers yet exist. Anti-SSA/Ro antibodies have been rarely described in cases of pulmonary disease, and less so in pulmonary hypertension. This case describes a unique association between isolated pulmonary hypertension and anti-SSA/Ro antibody, thereby illustrating the need to investigate this autoantibody and others in the pathogenesis of autoimmune pulmonary hypertension.

  16. ESA SSA Space Radiation Expert Service Centre: the Importance of Community Feedback (United States)

    Crosby, Norma; Dierckxsens, Mark; Kruglanski, Michel; De Donder, Erwin; Calders, Stijn; Messios, Neophytos; Glover, Alexi


    End-users in a wide range of sectors both in space and on the ground are affected by space weather. In the frame of its Space Situational Awareness (SSA) programme ( the European Space Agency (ESA) is establishing a Space Weather (SWE) Service Network to support end-users in three ways: mitigate the effects of space weather on their systems, reduce costs, and improve reliability. Almost 40 expert groups from institutes and organisations across Europe contribute to this Network organised in five Expert Service Centres (ESCs) - Solar Weather, Heliospheric Weather, Space Radiation, Ionospheric Weather, Geomagnetic Conditions. To understand the end-user needs, the ESCs are supported by the SSCC (SSA Space Weather Coordination Centre) that offers first line support to the end-users. Here we present the mission of the Space Radiation ESC (R-ESC) ( and the space domain services it supports. Furthermore, we describe how the R-ESC project complements past and ongoing projects both on national level as well as international (e.g. EU projects), emphasizing the importance of inter-disciplinary communication between different communities ranging from scientists, engineers to end-users. Such collaboration is needed if basic science is to be used most efficiently for the development of products and tools that provide end-users with what they actually need. Additionally, feedback from the various communities (projects) is also essential when defining future projects.

  17. BOREAS TF-1 SSA-OA Understory Flux, Meteorological, and Soil Temperature Data (United States)

    Hall, Forrest G. (Editor); Huemmrich, Karl (Editor); Black, T. Andrew; Chen, Z.; Nesic, Zoran


    The BOREAS TF-1 team collected energy, carbon dioxide, and momentum flux data under the canopy along with meteorological and soils data at the BOREAS SSA-OA site from mid-October to mid-November of 1993 and throughout all of 1994. The data are available in tabular ASCII files.

  18. BOREAS TF-9 SSA-OBS Tower Flux, Meteorological, and Soil Temperature Data (United States)

    Hall, Forrest G. (Editor); Huemmrich, Karl (Editor); Massheder, Jonathan M.; Moncrieff, John B.; Rayment, Mark B.; Jarvis, Paul G.


    The BOREAS TF-9 team collected energy, carbon dioxide, and water vapor flux data at the BOREAS SSA-OBS site during the growing season of 1994 and most of the year for 1996. From the winter of 1995 to 1996, soil temperature data were also collected and provided. The data are available in tabular ASCII files.

  19. BOREAS TF-1 SSA-OA Tower Flux, Meteorological, and Soil Temperature Data (United States)

    Hall, Forrest G. (Editor); Huemmrich, Karl (Editor); Black, T. Andrew; Chen, Z.; Nesic, Zoran


    The BOREAS TF-1 team collected energy, carbon dioxide, and momentum flux data above the canopy along with meteorological and soils data at the BOREAS SSA-OA site from mid-April to the end of the year for 1996. The data are available in tabular ASCII files.

  20. The relationship between epicuticular long-chained hydrocarbons and surface area - volume ratios in insects (Diptera, Hymenoptera, Lepidoptera). (United States)

    Brückner, Adrian; Heethoff, Michael; Blüthgen, Nico


    Long-chain cuticular hydrocarbons (CHCs) are common components of the epicuticle of terrestrial arthropods. CHC serve as a protective barrier against environmental influences but also act as semiochemicals in animal communication. Regarding the latter aspect, species- or intra-functional group specific CHCs composition and variation are relatively well studied. However, comparative knowledge about the relationship of CHC quantity and their relation to surface area-volume ratios in the context of water loss and protection is fragmentary. Hence, we aim to study the taxon-specific relationship of the CHC amount and surface-area to volume ratio related to their functional role (e.g. in water loss). We focused on flower visiting insects and analyzed the CHC amounts of three insect orders (Hymenoptera, Lepidoptera and Diptera) using gas chromatography-mass spectrometry (GC-MS). We included 113 species from two grassland plots, quantified their CHCs, and measured their body mass and surface area. We found differences in the surface area, CHCs per body mass and the CHC density (= amount of CHCs per surface area) across the three insect taxa. Especially the Hymenoptera had a higher CHC density compared to Diptera and Lepidoptera. CHC density could be explained by surface area-volume ratios in Hymenoptera but not in Diptera and Lepidoptera. Unexpectedly, CHC density decreased with increasing surface area-volume ratios.

  1. In Situ Aerosol Profile Measurements and Comparisons with SAGE 3 Aerosol Extinction and Surface Area Profiles at 68 deg North (United States)


    Under funding from this proposal three in situ profile measurements of stratospheric sulfate aerosol and ozone were completed from balloon-borne platforms. The measured quantities are aerosol size resolved number concentration and ozone. The one derived product is aerosol size distribution, from which aerosol moments, such as surface area, volume, and extinction can be calculated for comparison with SAGE III measurements and SAGE III derived products, such as surface area. The analysis of these profiles and comparison with SAGE III extinction measurements and SAGE III derived surface areas are provided in Yongxiao (2005), which comprised the research thesis component of Mr. Jian Yongxiao's M.S. degree in Atmospheric Science at the University of Wyoming. In addition analysis continues on using principal component analysis (PCA) to derive aerosol surface area from the 9 wavelength extinction measurements available from SAGE III. Ths paper will present PCA components to calculate surface area from SAGE III measurements and compare these derived surface areas with those available directly from in situ size distribution measurements, as well as surface areas which would be derived from PCA and Thomason's algorithm applied to the four wavelength SAGE II extinction measurements.

  2. New model for estimating the relationship between surface area and volume in the human body using skeletal remains. (United States)

    Kasabova, Boryana E; Holliday, Trenton W


    A new model for estimating human body surface area and body volume/mass from standard skeletal metrics is presented. This model is then tested against both 1) "independently estimated" body surface areas and "independently estimated" body volume/mass (both derived from anthropometric data) and 2) the cylindrical model of Ruff. The model is found to be more accurate in estimating both body surface area and body volume/mass than the cylindrical model, but it is more accurate in estimating body surface area than it is for estimating body volume/mass (as reflected by the standard error of the estimate when "independently estimated" surface area or volume/mass is regressed on estimates derived from the present model). Two practical applications of the model are tested. In the first test, the relative contribution of the limbs versus the trunk to the body's volume and surface area is compared between "heat-adapted" and "cold-adapted" populations. As expected, the "cold-adapted" group has significantly more of its body surface area and volume in its trunk than does the "heat-adapted" group. In the second test, we evaluate the effect of variation in bi-iliac breadth, elongated or foreshortened limbs, and differences in crural index on the body's surface area to volume ratio (SA:V). Results indicate that the effects of bi-iliac breadth on SA:V are substantial, while those of limb lengths and (especially) the crural index are minor, which suggests that factors other than surface area relative to volume are driving morphological variation and ecogeographical patterning in limb prorportions. © 2014 Wiley Periodicals, Inc.

  3. Woody vegetation and succession on the Fonde surface mine demonstration area, Bell County, Kentucky

    International Nuclear Information System (INIS)

    Wade, G.L.; Thompson, R.L.


    The long term impact of surface mining on vegetation and plant succession has always been of concern to environmentalists and residents of Appalachia. The Fonde Surface Mine Demonstration Area is a 7.3-ha, NE-NW-aspect contour coal mine at an elevation of 562 m. It was reclaimed in 1965 to show state-of-the-art surface mine reclamation techniques consistent with then-current law and regulations after coal mining in 1959 and 1963. The mine spoils were lightly graded to control erosion and crates a bench with water control and two sediment ponds. Soil pH ranged from 2.8 to 5.9. About 80 percent of the mine was planted with 18 tree and shrub species including plantations of mixed pine, mixed hardwoods, black locust, and shrubs for wildlife. In a complete floristic inventory conducted 25 years later, the authors found the woody flora consisted of 34 families, 53 genera, and 70 species including 7 exotics. This inventory of the Fonde mine shows that a diverse forest vegetation can be reestablished after extreme disturbances in Appalachia. Black locust, yellow poplar, and Virginia pine reproduction varied significantly among plantation types. Canopy tree species significantly affected ground layer cover, total species richness, number of tree seedling species, and total number of tree seedlings present. Mine soil type affected ground layer percent cover and total species richness. Pre-SMCRA (Surface Mining Control and Reclamation Act of 1977) reclaimed and inventoried mines can be used to evaluate biodiversity on post-SMCRA mines

  4. Multivariate Analyses of Heavy Metals in Surface Soil Around an Organized Industrial Area in Eskisehir, Turkey. (United States)

    Malkoc, S; Yazici, B


    A total of 50 surface industrial area soil in Eskisehir, Turkey were collected and the concentrations of As, Cr, Cd, Co, Cu, Ni, Pb, Zn, Fe and Mg, at 11.34, 95.8, 1.37, 15.28, 33.06, 143.65, 14.34, 78.79 mg/kg, 188.80% and 78.70%, respectively. The EF values for As, Cu, Pb and Zn at a number of sampling sites were found to be the highest among metals. Igeo-index results show that the study area is moderately polluted with respect to As, Cd, Ni. According to guideline values of Turkey Environmental Quality Standard for Soils, there is no problem for Pb, but the Cd values are fairly high. However, Cr, Cu, Ni and Zn values mostly exceed the limits. Cluster analyses suggested that soil the contaminator values are homogenous in those sub classes. The prevention and remediation of the heavy metal soil pollution should focus on these high-risk areas in the future.

  5. Relationship between the Physical Properties and Surface Area of Cellulose Derived from Adsorbates of Various Molecular Sizes. (United States)

    Ougiya, H; Hioki, N; Watanabe, K; Morinaga, Y; Yoshinaga, F; Samejima, M


    An aqueous suspension of bacterial cellulose (BC) has such physical properties as higher viscosity, emulsion-stabilizing effect and filler retention than cellulose of other origins. The specific surface areas of BC, microfibrillated cellulose and wood pulp were evaluated by determining the maximum amounts of adsorption of Congo red, cellobiose dehydrogenase (CDH) and xyloglucan. There was a positive linear correlation between the above-mentioned physical properties of each cellulose sample and the specific surface area derived from the maximum amount of CDH adsorbed. The highest physical property values for BC result from the largest external surface area of the fibrils of BC to which CDH was adsorbed.

  6. Anti-TNFa treatment in patients with rheumatoid arthritis and anti-Ro/SSA antibodies

    Directory of Open Access Journals (Sweden)

    P. Airò


    Full Text Available Objective: To analyse clinical efficacy, onset of new autoantibodies or symptoms of autoimmune disease in patients affected by rheumatoid arthritis with anti-Ro/SSA treated with anti-TNFa agents. Methods: Six anti-Ro/SSA positive subjects with RA were studied every six months until 24th month of treatment in order to detect ANA titer (IFI, anti-dsDNA (Farr, anti-cardiolipin and anti-beta2glycoprotein I (ELISA, anti-ENA (CIE. The titre of anti-Ro/SSA were analysed by ELISA. Four patients were diagnosed as overlap RA/SS. Results: Six female patients (mean age 58ys, SD 9.8ys, with long-standing RA (mean 7ys, range 5-22 ys were treated with anti-TNFa agents for a mean of 31 months (SD: 20.4 m: 4 with Infliximab and 2 with Etanercept. All the patients showed a significant reduction of DAS until 24th month (p<0.006 with stability of sicca symptoms. The titer of ANA and anti-Ro/SSA was stable, while 4 subjects developed anti-dsDNA at low titer within 6-12 months. One patient withdrawn the treatment, because of lupus-like features; another one, with HCV hepatitis, interrupted Etanercept because of elevation of liver enzymes. No anticardiolipin or antibeta2GPI antibodies were detected. One subject with RA-SS also presented a primary biliary cirrhosis: clinical and histological features of cholangitis remained stable during Etanercept treatment. Conclusions: Anti-TNFa treatment showed good efficacy and safety in anti-Ro/SSA positive patients with RA. Anti-ds- DNA antibodies at low titer appeared in most patients while the onset of lupus-like disease could be considered a rare event also in RA patients with a rich autoimmune repertoire.

  7. 30 CFR 785.19 - Surface coal mining and reclamation operations on areas or adjacent to areas including alluvial... (United States)


    ...— (A) The existence of current flood irrigation in the area in question; (B) The capability of an area... flood irrigation, streamflow, water quality, soils, and topography; or (C) Subirrigation of the lands in... after the complete application is evaluated. (2) An applicant need not submit the information required...

  8. Elevated IL-1β levels in anti-Ro/SSA connective tissue diseases patients with prolonged corrected QTc interval. (United States)

    Pisoni, Cecilia N; Reina, Silvia; Arakaki, Diego; Eimon, Alicia; Carrizo, Carolina; Borda, Enri


    Patients with systemic lupus erythematosus (SLE) and primary Sjögren's syndrome (pSS) have increased IL-1β levels. IL-1β and other pro-inflammatory cytokines have a modulating activity on cardiac ion channels and have been associated with increased arrhythmic risk in rheumatoid arthritis patients. Likewise, adult patients with connective tissue diseases (CTDs) may have prolonged QTc intervals associated with the presence of anti-Ro/SSA antibodies. Our objective was to evaluate the presence of serum IL-1β in subjects with CTDs, in relation to the presence of anti-Ro/SSA antibodies and QTc interval duration. 12-lead electrocardiograms (ECG) were performed and blood was withdrawn, measuring electrolytes, IL-1β anti-Ro/SSA antibodies by ELISA in 73 patients with CTDs. 55 patients were anti-Ro/SSA positive and 18 were anti-Ro/SSA negative. Patients with anti-Ro/SSA positive antibodies had a significantly greater median IL-1β serum level: 7.29 (range: 0.17-17.3 pg/ml) compared to patients with anti-Ro/SSA negative antibodies whose median was: 1.67 (range 0.55-4.12 pg/ml) pRo/SSA positive versus 0 (0 %) in anti-Ro/SSA negative patients p=0.05. Median IL-1β levels were: 8.7 (range: 2.69-15.1 pg/ml) in patients with prolonged QTc interval versus median: 5.0 (range: 0.17-17.3 pg/ml) in those with normal QTc interval values (Ro/SSA antibodies and prolonged QTc intervals.

  9. Anti-Ro/SSA antibodies are associated with severe mitral valve regurgitation in patients with systemic lupus erythematosus. (United States)

    Higuera-Ortiz, Violeta; Mora-Arias, Tania; Castillo-Martinez, Diana; Amezcua-Guerra, Luis M


    To assess whether anti-Ro/SSA antibodies are associated with cardiac valve disease in lupus. A single-center, medical chart review was performed. Lupus patients were divided according to its anti-Ro/SSA status and subgroups were compared for valvular abnormalities and other characteristics. Dependence of anti-Ro/SSA reactivity to anti-Ro52/TRIM21 antibodies was also evaluated. Eighty-nine lupus patients were analyzed. The most common valvular abnormalities were tricuspid (60%), mitral (41%) and pulmonary (14%) regurgitation. Thirty-six patients were positive and 53 negative for anti-Ro/SSA antibodies. In patients positive to anti-Ro/SSA, a difference was noted for anti-dsDNA (67 versus 45%; p = 0.04) and anti-La/SSB (19 versus 2%; p = 0.004) antibodies. An association between anti-Ro/SSA antibodies and severe mitral regurgitation was observed; indeed, 4/15 patients with anti-Ro/SSA and mitral regurgitation had severe forms of valvulopathy as compared to only 1/22 patients with mitral regurgitation but negative to such antibody (27 versus 5%; p = 0.02). Anti-Ro/SSA antibodies significantly elevated the risk of severe mitral regurgitation (OR = 5). Anti-Ro52/TRIM21 levels (103 ± 29 versus 42 ± 43 U/mL; p = 0.03) and anti-Ro52/TRIM21: anti-Ro/SSA ratios (0.88 ± 0.02 versus 0.35 ± 0.37; p = 0.03) were higher in patients with mitral valve regurgitation than in those with no valvulopathy. Anti-Ro/SSA antibodies, mainly against Ro52/TRIM21 antigens, may be pathologically involved in lupus-associated mitral valve regurgitation.

  10. Water and Carbon Dioxide Ices-Rich Areas on Comet 67P/CG Nucleus Surface (United States)

    Filacchione, G.; Capaccioni, F.; Raponi, A.; De Sanctis, M. C.; Ciarniello, M.; Barucci, M. A.; Tosi, F.; Migliorini, A.; Capria, M. T.; Erard, S.; Bockelée-Morvan, D.; Leyrat, C.; Arnold, G.; Kappel, D.; McCord, T. B.


    So far, only two ice species have been identified by Rosetta/VIRTIS-M [1] on the surface of 67P/Churyumov-Gerasimenko during the pre-perihelion time: crystalline water and carbon dioxide ice. Water ice has been spectroscopically identified in three distinct modalities: 1) On the active areas of Hapi region where water ice changes its abundance with local time and illumination conditions, condensing during the night hours and sublimating during daytime [2]; 2) On recent debris fields collapsed from two elevated structures in the Imhotep region where more fresh and pristine material is exposed [3]; 3) On eight bright areas located in Khonsu, Imhotep, Anhur, Atum and Khepry regions [4] where single or multiple grouped icy patches with sizes ranging between few meters to about 60 m are observed. Carbon dioxide ice has been detected only in a 60-80 m area in Anhur region while it was exiting from a four year-long winter-night season [5]. This ice deposit underwent a rapid sublimation, disappearing in about one month after its initial detection. While water and carbon dioxide ice appear always mixed with the ubiquitous dark material [6,7], there are no evidences of the presence of water and carbon dioxide ices mixed together in the same area. If observed, ices always account for very small fraction (few percent) with respect to the dark material. Moreover, the surface ice deposits are preferentially located on the large lobe and the neck while they are absent on the small lobe. Apart from these differences in the spatial distribution of ices on the surface, a large variability is observed the mixing modalities and in the grain size distributions, as retrieved from spectral modeling [8]: 1) very small μm-sized water ice grains in intimate mixing with the dark terrain are detected on Hapi active regions [2]; 2) two monodispersed distributions with maxima at 56 μm and at 2 mm, corresponding to the intimate and areal mixing classes, are observedon the Imhotep debris

  11. Long-term evolution of the surface environment of the Campine area, Northern Belgium

    International Nuclear Information System (INIS)

    Beerten, K.; De Craen, M.; Brassinnes, S.; Wouters, L.


    Document available in extended abstract form only. The Boom Clay in the Campine Basin is studied as the reference host formation for the geological disposal of radioactive waste. Near Mol, it is covered by approximately 200 m of sediment which protects the clay layer. Here, we will give a preliminary assessment of the long-term evolution of the surface environment in the Campine area for the next 1 Ma, with respect to geomorphological, pedological and hydrological processes. The current surface environment started to develop after the last major marine regression around 2 Ma ago. Then, the climatic and tectonic evolution caused significant changes in surficial geology, relief intensity, soils and hydrography. The palaeo-geographical evolution during the Quaternary is characterized by important stream divergences, relative uplift and erosion. Tectonic uplift of the Campine Plateau forced the river Meuse to incise into the substrate. To the west, erosional processes shaped the Nete and the Lower Scheldt basins as a result of combined uplift and gradual sea-level drop. The Campine Plateau being covered by coarse fluvial deposits from the Early and Middle Pleistocene, is largely protected from erosion. The same is true for the Campine Cuesta, that stands out as a result of the cohesive and erosion resistant Kempen Clay substrate. Burial graphs covering the last few million years from different locations in the Boom Clay sub-crop zone reflect processes of subsidence, uplift, sea level variations and climate change in relation to the erodibility of the substrate. Continuous burial during the Quaternary as a result of subsidence is observed near the Dutch border, and for the Roer Valley Graben. Burial graphs for the Campine Plateau do not show important erosional phases during the last several million years. This is due to the protecting cover of coarse fluvial deposits. The area that is now occupied by the Lower Scheldt and the Nete basin has experienced erosion during

  12. BET surface area distributions in polar stream sediments: Implications for silicate weathering in a cold-arid environment (United States)

    Marra, Kristen R.; Elwood Madden, Megan E; Soreghan, Gerilyn S.; Hall, Brenda L


    BET surface area values are critical for quantifying the amount of potentially reactive sediments available for chemical weathering and ultimately, prediction of silicate weathering fluxes. BET surface area values of fine-grained (<62.5 μm) sediment from the hyporheic zone of polar glacial streams in the McMurdo Dry Valleys, Antarctica (Wright and Taylor Valleys) exhibit a wide range (2.5–70.6 m2/g) of surface area values. Samples from one (Delta Stream, Taylor Valley) of the four sampled stream transects exhibit high values (up to 70.6 m2/g), which greatly exceed surface area values from three temperate proglacial streams (0.3–12.1 m2/g). Only Clark stream in Wright Valley exhibits a robust trend with distance, wherein surface area systematically decreases (and particle size increases) in the mud fraction downstream, interpreted to reflect rapid dissolution processes in the weathering environment. The remaining transects exhibit a range in variability in surface area distributions along the length of the channel, likely related to variations in eolian input to exposed channel beds, adjacent snow drifts, and to glacier surfaces, where dust is trapped and subsequently liberated during summer melting. Additionally, variations in stream discharge rate, which mobilizes sediment in pulses and influences water:rock ratios, the origin and nature of the underlying drift material, and the contribution of organic acids may play significant roles in the production and mobilization of high-surface area sediment. This study highlights the presence of sediments with high surface area in cold-based glacier systems, which influences models of chemical denudation rates and the impact of glacial systems on the global carbon cycle.

  13. Preparation and Characterization of Highly Spherical Silica-titania Aerogel Beads with High Surface Area

    Directory of Open Access Journals (Sweden)

    YU Yu-xi


    Full Text Available The silica-titania aerogel beads were synthesized through sol-gel reaction followed by supercritical drying, in which TEOS and TBT as co-precursors, EtOH as solvents, HAC and NH3·H2O as catalysts. The as-prepared aerogel beads were characterized by SEM,TEM,XRD,FT-IR,TG-DTA and nitrogen adsorption-desorption. The results indicate that the diameter distribution of beads are between 1-8mm, the average diameter of beads is 3.5mm. The aerogel beads have nanoporous network structure with high specific surface area of 914.5m2/g, and the TiO2 particles are distributed in the aerogel uniformly, which keep the anatase crystal under high temperature.

  14. A Standardized Method for Measuring Internal Lung Surface Area via Mouse Pneumonectomy and Prosthesis Implantation. (United States)

    Liu, Zhe; Fu, Siling; Tang, Nan


    Pulmonary morphology, physiology, and respiratory functions change in both physiological and pathological conditions. Internal lung surface area (ISA), representing the gas-exchange capacity of the lung, is a critical criterion to assess respiratory function. However, observer bias can significantly influence measured values for lung morphological parameters. The protocol that we describe here minimizes variations during measurements of two morphological parameters used for ISA calculation: internal lung volume (ILV) and mean linear intercept (MLI). Using ISA as a morphometric and functional parameter to determine the outcome of alveolar regeneration in both pneumonectomy (PNX) and prosthesis implantation mouse models, we found that the increased ISA following PNX treatment was significantly blocked by implantation of a prosthesis into the thoracic cavity 1 . The ability to accurately quantify ISA is not only expected to improve the reliability and reproducibility of lung function studies in injured-induced alveolar regeneration models, but also to promote mechanistic discoveries of multiple pulmonary diseases.

  15. Method for the preparation of high surface area high permeability carbons (United States)

    Lagasse, R.R.; Schroeder, J.L.


    A method for preparing carbon materials having high surface area and high macropore volume to provide high permeability. These carbon materials are prepared by dissolving a carbonizable polymer precursor, in a solvent. The solution is cooled to form a gel. The solvent is extracted from the gel by employing a non-solvent for the polymer. The non-solvent is removed by critical point drying in CO{sub 2} at an elevated pressure and temperature or evaporation in a vacuum oven. The dried product is heated in an inert atmosphere in a first heating step to a first temperature and maintained there for a time sufficient to substantially cross-link the polymer material. The cross-linked polymer material is then carbonized in an inert atmosphere. 3 figs.

  16. Periodontal inflamed surface area as a novel numerical variable describing periodontal conditions. (United States)

    Park, Shin-Young; Ahn, Soyeon; Lee, Jung-Tae; Yun, Pil-Young; Lee, Yun Jong; Lee, Joo Youn; Song, Yeong Wook; Chang, Yoon-Seok; Lee, Hyo-Jung


    A novel index, the periodontal inflamed surface area (PISA), represents the sum of the periodontal pocket depth of bleeding on probing (BOP)-positive sites. In the present study, we evaluated correlations between PISA and periodontal classifications, and examined PISA as an index integrating the discrete conventional periodontal indexes. This study was a cross-sectional subgroup analysis of data from a prospective cohort study investigating the association between chronic periodontitis and the clinical features of ankylosing spondylitis. Data from 84 patients without systemic diseases (the control group in the previous study) were analyzed in the present study. PISA values were positively correlated with conventional periodontal classifications (Spearman correlation coefficient=0.52; P variable. PISA is advantageous for quantifying periodontal inflammation and plaque accumulation.

  17. Macrostructure-dependent photocatalytic property of high-surface-area porous titania films

    Directory of Open Access Journals (Sweden)

    T. Kimura


    Full Text Available Porous titania films with different macrostructures were prepared with precise control of condensation degree and density of the oxide frameworks in the presence of spherical aggregates of polystyrene-block-poly(oxyethylene (PS-b-PEO diblock copolymer. Following detailed explanation of the formation mechanisms of three (reticular, spherical, and large spherical macrostructures by the colloidal PS-b-PEO templating, structural variation of the titania frameworks during calcination were investigated by X-ray diffraction and X-ray photoelectron spectroscopy. Then, photocatalytic performance of the macroporous titania films was evaluated through simple degradation experiments of methylene blue under an UV irradiation. Consequently, absolute surface area of the film and crystallinity of the titania frameworks were important for understanding the photocatalytic performance, but the catalytic performance can be improved further by the macrostructural design that controls diffusivity of the targeted molecules inside the film and their accessibility to active sites.

  18. Carbon monoxide oxidation on Pt-Ru electrocatalysts supported on high surface area carbon

    Directory of Open Access Journals (Sweden)

    Colmati Jr. Flavio


    Full Text Available This work describes the preparation and characterization of Pt-Ru alloys dispersed on high surface area carbon, which were evaluated for CO oxidation on thin porous coating rotating disk electrodes and for hydrogen oxidation on polymer electrolyte fuel cells fed with hydrogen containing 100 ppm CO. A thermal treatment (H2, 300 ºC applied to the catalysts improves the tolerance to small quantities of CO and, in some cases, reduces the potential necessary to promote the CO oxidation during a linear potential scan. Under operational conditions in a fuel cell in the presence of CO it was observed that the best results were obtained when the Pt-Ru/C alloy was prepared by simultaneous reduction of the ions Pt (IV and Ru (III, as opposed to a sequential reduction.

  19. Trajectories of cortical surface area and cortical volume maturation in normal brain development

    Directory of Open Access Journals (Sweden)

    Simon Ducharme


    Full Text Available This is a report of developmental trajectories of cortical surface area and cortical volume in the NIH MRI Study of Normal Brain Development. The quality-controlled sample included 384 individual typically-developing subjects with repeated scanning (1–3 per subject, total scans n=753 from 4.9 to 22.3 years of age. The best-fit model (cubic, quadratic, or first-order linear was identified at each vertex using mixed-effects models, with statistical correction for multiple comparisons using random field theory. Analyses were performed with and without controlling for total brain volume. These data are provided for reference and comparison with other databases. Further discussion and interpretation on cortical developmental trajectories can be found in the associated Ducharme et al.׳s article “Trajectories of cortical thickness maturation in normal brain development – the importance of quality control procedures” (Ducharme et al., 2015 [1].

  20. Environmental protection management by monitoring the surface water quality in Semenic area

    Directory of Open Access Journals (Sweden)



    Full Text Available Environment seems to have been the war against all. In fact recently most people polluted the environment and those few are cared for his cleaning. Today, the relationship evolvedas societies have changed in favour of ensuring environmental protection. With modern technology, performance, monitoring the environment becomes part of human activity ever more necessary, more possible and more efficient. The quality of the environment, its components: air, water, soil, plants, vegetable and animal products, is a condition "sine qua non" for the life of the modern man. The consequences of environmental pollution areso dangerous that modern man cannot afford considering them. Through this paper I will study the environmental quality by monitoring the surfaces waters from the Semenic- Gărâna area.

  1. FreeSASA: An open source C library for solvent accessible surface area calculations. (United States)

    Mitternacht, Simon


    Calculating solvent accessible surface areas (SASA) is a run-of-the-mill calculation in structural biology. Although there are many programs available for this calculation, there are no free-standing, open-source tools designed for easy tool-chain integration. FreeSASA is an open source C library for SASA calculations that provides both command-line and Python interfaces in addition to its C API. The library implements both Lee and Richards' and Shrake and Rupley's approximations, and is highly configurable to allow the user to control molecular parameters, accuracy and output granularity. It only depends on standard C libraries and should therefore be easy to compile and install on any platform. The library is well-documented, stable and efficient. The command-line interface can easily replace closed source legacy programs, with comparable or better accuracy and speed, and with some added functionality.

  2. Lithium inclusion in indium metal-organic frameworks showing increased surface area and hydrogen adsorption

    Directory of Open Access Journals (Sweden)

    Mathieu Bosch


    Full Text Available Investigation of counterion exchange in two anionic In-Metal-Organic Frameworks (In-MOFs showed that partial replacement of disordered ammonium cations was achieved through the pre-synthetic addition of LiOH to the reaction mixture. This resulted in a surface area increase of over 1600% in {Li [In(1,3 − BDC2]}n and enhancement of the H2 uptake of approximately 275% at 80 000 Pa at 77 K. This method resulted in frameworks with permanent lithium content after repeated solvent exchange as confirmed by inductively coupled plasma mass spectrometry. Lithium counterion replacement appears to increase porosity after activation through replacement of bulkier, softer counterions and demonstrates tuning of pore size and properties in MOFs.

  3. Cross-cutting High Surface Area Graphene-based Frameworks with Controlled Pore Structure/Dopants

    Energy Technology Data Exchange (ETDEWEB)

    Gaillard, J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)


    The goal of this project is to enhance the performance of graphene-based materials by manufacturing specific 3D architectures. The materials have global applications regarding fuel cell catalysts, gas adsorbents, supercapacitor/battery electrodes, ion (e.g., actinide) capture, gas separation, oil adsorption, and catalysis. This research focuses on hydrogen storage for hydrogen fuel cell vehicles with a potential transformational impact on hydrogen adsorbents that exhibit high gravimetric and volumetric density, a clean energy application sought by the Department of Energy. The development of an adsorbent material would enable broad commercial opportunities in hydrogen-fueled vehicles, promote new advanced nanomanufacturing scale-up, and open other opportunities at Savannah River National Laboratory to utilize a high surface area material that is robust, chemically stable, and radiation resistant.

  4. Data on the role of accessible surface area on osmolytes-induced protein stabilization

    Directory of Open Access Journals (Sweden)

    Safikur Rahman


    Full Text Available This paper describes data related to the research article “Testing the dependence of stabilizing effect of osmolytes on the fractional increase in the accessible surface area on thermal and chemical denaturations of proteins” [1]. Heat- and guanidinium chloride (GdmCl-induced denaturation of three disulfide free proteins (bovine cytochrome c (b-cyt-c, myoglobin (Mb and barstar in the presence of different concentrations of methylamines (sarcosine, glycine-betaine (GB and trimethylamine-N-oxide (TMAO was monitored by [ϴ]222, the mean residue ellipticity at 222 nm at pH 7.0. Methylamines belong to a class of osmolytes known to protect proteins from deleterious effect of urea. This paper includes comprehensive thermodynamic data obtained from the heat- and GdmCl-induced denaturations of barstar, b-cyt-c and Mb.

  5. A finite area scheme for shallow granular flows on three-dimensional surfaces (United States)

    Rauter, Matthias


    Shallow granular flow models have become a popular tool for the estimation of natural hazards, such as landslides, debris flows and avalanches. The shallowness of the flow allows to reduce the three-dimensional governing equations to a quasi two-dimensional system. Three-dimensional flow fields are replaced by their depth-integrated two-dimensional counterparts, which yields a robust and fast method [1]. A solution for a simple shallow granular flow model, based on the so-called finite area method [3] is presented. The finite area method is an adaption of the finite volume method [4] to two-dimensional curved surfaces in three-dimensional space. This method handles the three dimensional basal topography in a simple way, making the model suitable for arbitrary (but mildly curved) topography, such as natural terrain. Furthermore, the implementation into the open source software OpenFOAM [4] is shown. OpenFOAM is a popular computational fluid dynamics application, designed so that the top-level code mimics the mathematical governing equations. This makes the code easy to read and extendable to more sophisticated models. Finally, some hints on how to get started with the code and how to extend the basic model will be given. I gratefully acknowledge the financial support by the OEAW project "beyond dense flow avalanches". Savage, S. B. & Hutter, K. 1989 The motion of a finite mass of granular material down a rough incline. Journal of Fluid Mechanics 199, 177-215. Ferziger, J. & Peric, M. 2002 Computational methods for fluid dynamics, 3rd edn. Springer. Tukovic, Z. & Jasak, H. 2012 A moving mesh finite volume interface tracking method for surface tension dominated interfacial fluid flow. Computers & fluids 55, 70-84. Weller, H. G., Tabor, G., Jasak, H. & Fureby, C. 1998 A tensorial approach to computational continuum mechanics using object-oriented techniques. Computers in physics 12(6), 620-631.

  6. Renal function maturation in children: is normalization to surface area valid?

    International Nuclear Information System (INIS)

    Rutland, M.D.; Hassan, I.M.; Que, L.


    Full text: Gamma camera DTPA renograms were analysed to measure renal function by the rate at which the kidneys took up tracer from the blood. This was expressed either directly as the fractional uptake rate (FUR), which is not related to body size, or it was converted to a camera-based GFR by the formula GFR blood volume x FUR, and this GFR was normalized to a body surface area of 1.73 m2. Most of the patients studied had one completely normal kidney, and one kidney with reflux but normal function and no large scars. The completely normal kidneys contributed, on average, 50% of the total renal function. The results were considered in age bands, to display the effect of age on renal function. The camera-GFR measurements showed the conventional results of poor renal function in early childhood, with a slow rise to near-adult values by the age of 2 years, and somewhat low values throughout childhood. The uptake values showed a different pattern, with renal function rising to adult equivalent values by the age of 4 months, and with children having better renal function than adults throughout most of their childhood. The standard deviations expressed as coefficients of variation (CV) were smaller for the FUR technique than the GFR (Wilcoxon rank test, P < 0.01). These results resemble recent published measurements of absolute DMSA uptake, which are also unrelated to body size and show early renal maturation. The results also suggest that the reason children have lower serum creatinine levels than adults is that they have better renal function. If this were confirmed, it would raise doubts about the usefulness of normalizing renal function to body surface area in children

  7. Relationship between surface, free tropospheric and total column ozone in 2 contrasting areas in South-Africa

    CSIR Research Space (South Africa)

    Combrink, J


    Full Text Available Measurements of surface ozone in two contrasting areas of South Africa are compared with free tropospheric and Total Ozone Mapping Spectrometer (TOMS) total column ozone data. Cape Point is representative of a background monitoring station which...

  8. CLPX-Satellite: EO-1 Hyperion Surface Reflectance, Snow-Covered Area, and Grain Size, Version 1 (United States)

    National Aeronautics and Space Administration — This data set consists of apparent surface reflectance, subpixel snow-covered area, and grain size collected from the Hyperion hyperspectral imager. The Hyperion...

  9. Effects of raw material texture and activation manner on surface area of porous carbons derived from biomass resources. (United States)

    Zhang, Feng; Li, Guo-Dong; Chen, Jie-Sheng


    Porous carbons have been prepared from biomass resources, such as cornstalks, rice straws, pine needles and pinecone hulls, through a simple carbonization and KOH solution activation process. The pore sizes of the obtained porous carbons are mainly distributed in the range of 1-2 nm, whereas the surface areas of the materials vary from 1000 to more than 3000 m(2) g(-1) depending on the raw materials and preparation conditions. It is found that the biomass texture and the activation manner play key roles in determination of surface areas of the porous carbons. In addition, the amount of activation agent, the activation temperature and the activation time also affect the surface area of the porous carbons but to a less extent. The obtained porous carbons with high surface areas show good performance when used as Pt-catalyst supports for cinanamaldehyde hydrogenation.

  10. Development and Testing of High Surface Area Iridium Anodes for Molten Oxide Electrolysis (United States)

    Shchetkovskiy, Anatoliy; McKechnie, Timothy; Sadoway, Donald R.; Paramore, James; Melendez, Orlando; Curreri, Peter A.


    Processing of lunar regolith into oxygen for habitat and propulsion is needed to support future space missions. Direct electrochemical reduction of molten regolith is an attractive method of processing, because no additional chemical reagents are needed. The electrochemical processing of molten oxides requires high surface area, inert anodes. Such electrodes need to be structurally robust at elevated temperatures (1400-1600?C), be resistant to thermal shock, have good electrical conductivity, be resistant to attack by molten oxide (silicate), be electrochemically stable and support high current density. Iridium with its high melting point, good oxidation resistance, superior high temperature strength and ductility is the most promising candidate for anodes in high temperature electrochemical processes. Several innovative concepts for manufacturing such anodes by electrodeposition of iridium from molten salt electrolyte (EL-Form? process) were evaluated. Iridium electrodeposition to form of complex shape components and coating was investigated. Iridium coated graphite, porous iridium structure and solid iridium anodes were fabricated. Testing of electroformed iridium anodes shows no visible degradation. The result of development, manufacturing and testing of high surface, inert iridium anodes will be presented.

  11. Study of transverse crack formation on surface area of UO{sub 2} pellet circumference

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Dionisia S.; Paneto, Lelia F.P.C.; Souza, Patricia O. de, E-mail:, E-mail:, E-mail: [Industrias Nucleares do Brasil (INB), Resende, RJ (Brazil). Gerencia de Analise Tecnica do Combustivel Nuclear


    Microstructure of a polycrystalline material has a considerable influence on particular properties, such as mechanical strength, electrical conductivity, optical transmission and magnetic susceptibility. The uranium dioxide (UO{sub 2}) is used in water-cooled nuclear reactors, due to its desirable ceramics characteristics as a nuclear fuel. The UO{sub 2} is used in the form of pellets manufactured by wet route by INB, where they are loaded into fuel rods to build the fuel assemblies used in pressurized water reactors of Angra 1, Angra 2 and future Angra 3 nuclear power plants, for electric energy generated from nuclear power in Brazil. The geometric and structural integrity of these pellets cause direct influence on their performance during the reactor core operating cycle, so pellets presenting surface cracks leading to the phenomenon of pellet cladding interaction-PCI, resulting in failures in the fuel rod and subsequently release of fission products in the reactor coolant. Transverse cracks on surface area of pellet circumference are detected by visual inspection during the manufacturing process. This paper presents the study of these cracks formation by content analysis conducted with the support of electron microscopy. These results here are analyzed from the point of view of materials science through observation of the microstructure, and the pressing process where the defect was probably generated. (author)

  12. Preparation of high surface area nickel electrodeposit using a liquid crystal template technique

    International Nuclear Information System (INIS)

    Ganesh, V.; Lakshminarayanan, V.


    We show in this work that template electrodeposition of nickel at room temperature from a nickel sulphamate bath prepared in a new hexagonal liquid crystalline phase of water-Triton X-100-poly (acrylic acid) results in a highly porous surface. The roughness factor value of about 3620 obtained for this coating is the highest value reported in the literature for any electrodeposited nickel. The scanning electron microscopy (SEM) and scanning tunneling microscopy (STM) pictures show the formation of porous deposit with granular features in between the pores. The single electrode double layer capacitance value measured for the deposit is 338 mF cm -2 , which translates into a specific capacitance of 50 F g -1 without any post-thermal treatment of the electrode, suggesting its utility in super capacitors. Electrochemical studies using cyclic voltammetry (CV), Tafel plots and electrochemical impedance spectroscopy (EIS) and comparison of these results with some existing high surface area Ni catalysts show that the material has potential application as an excellent hydrogen evolving cathode

  13. Characteristics of hazardous airborne dust around an Indian surface coal mining area. (United States)

    Ghose, Mrinal K; Majee, S R


    Surface coal mining creates more air pollution problems with respect to dust than underground mining . An investigation was conducted to evaluate the characteristics of the airborne dust created by surface coal mining in the Jharia Coalfield. Work zone air quality monitoring was conducted at six locations, and ambient air quality monitoring was conducted at five locations, for a period of 1 year. Total suspended particulate matter (TSP) concentration was found to be as high as 3,723 microg/m(3), respirable particulate matter (PM10) 780 microg/m(3), and benzene soluble matter was up to 32% in TSP in work zone air. In ambient air, the average maximum level of TSP was 837 microg/m(3), PM10 170 microg/m(3) and benzene soluble matter was up to 30%. Particle size analysis of TSP revealed that they were more respirable in nature and the median diameter was around 20 microm. Work zone air was found to have higher levels of TSP, PM10 and benzene soluble materials than ambient air. Variations in weight percentages for different size particles are discussed on the basis of mining activities. Anionic concentration in TSP was also determined. This paper concludes that more stringent air quality standards should be adopted for coal mining areas and due consideration should be given on particle size distribution of the air-borne dust while designing control equipment.

  14. Area G Perimeter Surface-Soil Sampling Environmental Surveillance for Fiscal Year 1998 Hazardous and Solid Waste Group (ESH-19)

    Energy Technology Data Exchange (ETDEWEB)

    Marquis Childs


    Material Disposal Area G (Area G) is at Technical Area 54 at Los Alamos National Laboratory (LANL). Area G has been the principal facility for the disposal of low-level, solid-mixed, and transuranic waste since 1957. It is currently LANL's primary facility for radioactive solid waste burial and storage. As part of the annual environmental surveillance effort at Area G, surface soil samples are collected around the facility's perimeter to characterize possible radionuclide movement off the site through surface water runoff During 1998, 39 soil samples were collected and analyzed for percent moisture, tritium, plutonium-238 and 239, cesium-137 and americium-241. To assess radionuclide concentrations, the results from these samples are compared with baseline or background soil samples collected in an undisturbed area west of the active portion Area G. The 1998 results are also compared to the results from analogous samples collected during 1996 and 1997 to assess changes over this time in radionuclide activity concentrations in surface soils around the perimeter of Area G. The results indicate elevated levels of all the radionuclides assessed (except cesium-137) exist in Area G perimeter surface soils vs the baseline soils. The comparison of 1998 soil data to previous years (1996 and 1997) indicates no significant increase or decrease in radionuclide concentrations; an upward or downward trend in concentrations is not detectable at this time. These results are consistent with data comparisons done in previous years. Continued annual soil sampling will be necessary to realize a trend if one exists. The radionuclide levels found in the perimeter surface soils are above background but still considered relatively low. This perimeter surface soil data will be used for planning purposes at Area G, techniques to prevent sediment tm.nsport off-site are implemented in the areas where the highest radionuclide concentrations are indicated.

  15. Genesis and Development of Soils along Different Geomorphic Surfaces in Kouh Birk Area, Mehrestan City

    Directory of Open Access Journals (Sweden)

    Mohammad Akbar Bahoorzahi


    Full Text Available Introduction: The optimum and sustainable use of soil is only possible with correct and complete understanding of its properties. The objectives of the present research were to study 1 genesis and development of soils related to different geomorphic surfaces in Kouh Birk Area (Mehrestan City, 2 Soil classification according to Soil Taxonomy (2014 and WRB (2014 systems, and 3 physicochemical properties, clay mineralogy and micromorphology of soils. Materials and Methods: Mean annual rainfall and soil temperature in the selected location are 153.46 mm and 19.6 oC, respectively. From geological point of view, the studied area is a part of west and south west zones and Flysch zone of east Iran. Soil temperature and moisture regimes of this part are thermic and aridic, respectively. Eight representative pedons on different surfaces including rock pediment, mantled pediment, Alluvial fan and Upper terraces were selected, sampled, and described. Routine physicochemical analyses, clay mineralogy, and micromorphological observations performed on soil samples. Soil reaction, texture, electrical conductivity, calcium carbonate, and gypsum were identified. Four samples including Bt horizon of pedon 1, Bk1 horizon of pedon 4, By2 horizon of pedon 5 and Bk1 horizon of pedon 7 were selected for clay mineralogy investigations. Four slides including Mg saturated, Mg saturated treated with ethylene glycol, K saturated, and K saturated heated up to 550 oC were analyzed. A Brucker X-Ray diffractometer at 40 kV and 30 mA was used for XRD analyses. Undisturbed soil samples from Bt horizon of pedon 1, Bk2 horizon of pedon 2, Btn horizon of pedon 3, By2 horizon of pedon 5, Bk1 horizon of pedon 7, and By1 horizon of pedon 8 were selected for micromorphological observations. A vestapol resin with stearic acid and cobalt as hardener was used for soil impregnation. Bk-Pol petrographic microscope was used for micromorphology investigations. Results and Discussion: Due to

  16. Surface area analysis of dental implants using micro-computed tomography. (United States)

    Schicho, Kurt; Kastner, Johann; Klingesberger, Roman; Seemann, Rudolf; Enislidis, Georg; Undt, Gerhard; Wanschitz, Felix; Figl, Michael; Wagner, Arne; Ewers, Rolf


    In this study, we present and evaluate a micro-computed tomography (micro-CT)-based method for the calculation of the potential bone/implant contact area (p-BICA) on the surface of dental implants. For seven commercially available implants (Ankylos implant, Brånemark System, Frialit CELLplus, Replace((R)) Select Tapered, Straumann Solid screw, XiVE S CELLplus, 3i Osseotite XP Threaded Miniplant, the p-BICA surface is determined by means of three-dimensional X-ray computed-tomography and computer-based data processing. Measurements were repeated two times, and the stability and repeatability of the measurement method were evaluated. Our analysis revealed a p-BICA of 118 mm(2) for the XiVE S CELLplus implant, 134 mm(2) for the Ankylos, 136 mm(2) for the Frialit CELLplus, 138 mm(2) for the Brånemark System, 139 mm(2) for the Replace((R)), 159 mm(2) for the 3i Osseotite XP and 199 mm(2) for the Straumann Solid screw implant. The measurement method proved to be stable and led to reproducible results. The micro- and macrostructure of dental implants define the surface and the p-BICA. Precise determination of this parameter can be achieved by means of the micro-CT-based method as presented in this study. The value of p-BICA lies in the predictability of industrial design before preclinical and clinical testing. Based on this method, dental implant properties become comparable even if geometrical details are not disclosed by the manufacturer.

  17. Thermal infrared imagery as a tool for analysing the variability of surface saturated areas at various temporal and spatial scales (United States)

    Glaser, Barbara; Antonelli, Marta; Pfister, Laurent; Klaus, Julian


    Surface saturated areas are important for the on- and offset of hydrological connectivity within the hillslope-riparian-stream continuum. This is reflected in concepts such as variable contributing areas or critical source areas. However, we still lack a standardized method for areal mapping of surface saturation and for observing its spatiotemporal variability. Proof-of-concept studies in recent years have shown the potential of thermal infrared (TIR) imagery to record surface saturation dynamics at various temporal and spatial scales. Thermal infrared imagery is thus a promising alternative to conventional approaches, such as the squishy boot method or the mapping of vegetation. In this study we use TIR images to investigate the variability of surface saturated areas at different temporal and spatial scales in the forested Weierbach catchment (0.45 km2) in western Luxembourg. We took TIR images of the riparian zone with a hand-held FLIR infrared camera at fortnightly intervals over 18 months at nine different locations distributed over the catchment. Not all of the acquired images were suitable for a derivation of the surface saturated areas, as various factors influence the usability of the TIR images (e.g. temperature contrasts, shadows, fog). Nonetheless, we obtained a large number of usable images that provided a good insight into the dynamic behaviour of surface saturated areas at different scales. The images revealed how diverse the evolution of surface saturated areas can be throughout the hydrologic year. For some locations with similar morphology or topography we identified diverging saturation dynamics, while other locations with different morphology / topography showed more similar behaviour. Moreover, we were able to assess the variability of the dynamics of expansion / contraction of saturated areas within the single locations, which can help to better understand the mechanisms behind surface saturation development.

  18. Albedo and land surface temperature shift in hydrocarbon seepage potential area, case study in Miri Sarawak Malaysia

    International Nuclear Information System (INIS)

    Suherman, A; Rahman, M Z A; Busu, I


    The presence of hydrocarbon seepage is generally associated with rock or mineral alteration product exposures, and changes of soil properties which manifest with bare development and stress vegetation. This alters the surface thermodynamic properties, changes the energy balance related to the surface reflection, absorption and emission, and leads to shift in albedo and LST. Those phenomena may provide a guide for seepage detection which can be recognized inexpensively by remote sensing method. District of Miri is used for study area. Available topographic maps of Miri and LANDSAT ETM+ were used for boundary construction and determination albedo and LST. Three land use classification methods, namely fixed, supervised and NDVI base classifications were employed for this study. By the intensive land use classification and corresponding statistical comparison was found a clearly shift on albedo and land surface temperature between internal and external seepage potential area. The shift shows a regular pattern related to vegetation density or NDVI value. In the low vegetation density or low NDVI value, albedo of internal area turned to lower value than external area. Conversely in the high vegetation density or high NDVI value, albedo of internal area turned to higher value than external area. Land surface temperature of internal seepage potential was generally shifted to higher value than external area in all of land use classes. In dense vegetation area tend to shift the temperature more than poor vegetation area

  19. Description of surface systems. Preliminary site description. Forsmark area Version 1.2

    International Nuclear Information System (INIS)

    Lindborg, Tobias


    Swedish Nuclear Fuel and Waste Management Co (SKB) started site investigations for a deep repository for spent nuclear fuel in 2002 at two different sites in Sweden, Forsmark and Oskarshamn. The investigations should provide necessary information for a license application aimed at starting underground exploration. For this reason, ecosystem data need to be interpreted and assessed into site descriptive models, which in turn are used for safety assessment studies and for environmental impact assessment. Descriptions of the surface system are also needed for further planning of the site investigations. This report describes the surface ecosystems of the Forsmark site (e.g. hydrology, Quaternary deposits, chemistry, vegetation, animals and the human land use). The ecosystem description is an integration of the site and its regional setting, covering the current state of the biosphere as well as the ongoing natural processes affecting the longterm development. Improving the descriptions is important during both the initial and the complete site investigation phase. Before starting of the initial phase in Forsmark, version 0 of the site descriptive model was developed. The results of the initial site investigation phase is compiled into a preliminary site description of Forsmark (version 1.2) in June 2005. This report provides the major input and background to the biosphere description, in the 1.2 version of the Forsmark site description. The basis for this interim version is quality-assured field data from the Forsmark sub area and regional area, available in the SKB SICADA, and GIS data bases as of July 31th 2004 as well as version 1.1 of the Site Descriptive Model. To achieve an ecosystem site description there is a need to develop discipline-specific models by interpreting and analysing primary data. The different discipline-specific models are then integrated into a system describing interactions and flows and stocks of matter between and within functional units in

  20. Description of surface systems. Preliminary site description. Forsmark area Version 1.2

    Energy Technology Data Exchange (ETDEWEB)

    Lindborg, Tobias (ed.)


    Swedish Nuclear Fuel and Waste Management Co (SKB) started site investigations for a deep repository for spent nuclear fuel in 2002 at two different sites in Sweden, Forsmark and Oskarshamn. The investigations should provide necessary information for a license application aimed at starting underground exploration. For this reason, ecosystem data need to be interpreted and assessed into site descriptive models, which in turn are used for safety assessment studies and for environmental impact assessment. Descriptions of the surface system are also needed for further planning of the site investigations. This report describes the surface ecosystems of the Forsmark site (e.g. hydrology, Quaternary deposits, chemistry, vegetation, animals and the human land use). The ecosystem description is an integration of the site and its regional setting, covering the current state of the biosphere as well as the ongoing natural processes affecting the longterm development. Improving the descriptions is important during both the initial and the complete site investigation phase. Before starting of the initial phase in Forsmark, version 0 of the site descriptive model was developed. The results of the initial site investigation phase is compiled into a preliminary site description of Forsmark (version 1.2) in June 2005. This report provides the major input and background to the biosphere description, in the 1.2 version of the Forsmark site description. The basis for this interim version is quality-assured field data from the Forsmark sub area and regional area, available in the SKB SICADA, and GIS data bases as of July 31th 2004 as well as version 1.1 of the Site Descriptive Model. To achieve an ecosystem site description there is a need to develop discipline-specific models by interpreting and analysing primary data. The different discipline-specific models are then integrated into a system describing interactions and flows and stocks of matter between and within functional units in

  1. Large area window on vacuum chamber surface for neutron scattering instruments

    International Nuclear Information System (INIS)

    Itoh, Shinichi; Yokoo, Tetsuya; Ueno, Kenji; Suzuki, Junichi; Teraoku, Takuji; Tsuchiya, Masao


    The feasibility of a large area window using a thin aluminum plate on the surface of the vacuum chamber for neutron scattering instruments at a pulsed neutron source was investigated. In the prototype investigation for a window with an area of 1m×1.4m and a thickness of 1 mm, the measured pressure dependence of the displacement agreed well with a calculation using a nonlinear strain–stress curve up to the plastic deformation region. In addition, we confirmed the repetition test up to 2000 pressurization-and-release cycles, which is sufficient for the lifetime of the vacuum chamber for neutron scattering instruments. Based on these investigations, an actual model of the window to be mounted on the vacuum chamber of the High Resolution Chopper Spectrometer (HRC) at J-PARC was designed. By using a calculated stress distribution on the window, the clamping structure capable of balancing the tension in the window was determined. In a model with a structure identical to the actual window, we confirmed the repetition test over more than 7000 pressurization-and-release cycles, which shows a lifetime long enough for the actual usage of the vacuum chamber on the HRC.

  2. Representation of Glossy Material Surface in Ventral Superior Temporal Sulcal Area of Common Marmosets. (United States)

    Miyakawa, Naohisa; Banno, Taku; Abe, Hiroshi; Tani, Toshiki; Suzuki, Wataru; Ichinohe, Noritaka


    The common marmoset ( Callithrix jacchus ) is one of the smallest species of primates, with high visual recognition abilities that allow them to judge the identity and quality of food and objects in their environment. To address the cortical processing of visual information related to material surface features in marmosets, we presented a set of stimuli that have identical three-dimensional shapes (bone, torus or amorphous) but different material appearances (ceramic, glass, fur, leather, metal, stone, wood, or matte) to anesthetized marmoset, and recorded multiunit activities from an area ventral to the superior temporal sulcus (STS) using multi-shanked, and depth resolved multi-electrode array. Out of 143 visually responsive multiunits recorded from four animals, 29% had significant main effect only of the material, 3% only of the shape and 43% of both the material and the shape. Furthermore, we found neuronal cluster(s), in which most cells: (1) showed a significant main effect in material appearance; (2) the best stimulus was a glossy material (glass or metal); and (3) had reduced response to the pixel-shuffled version of the glossy material images. The location of the gloss-selective area was in agreement with previous macaque studies, showing activation in the ventral bank of STS. Our results suggest that perception of gloss is an important ability preserved across wide range of primate species.

  3. Correlation of Superior Canal Dehiscence Surface Area With Vestibular Evoked Myogenic Potentials, Audiometric Thresholds, and Dizziness Handicap. (United States)

    Hunter, Jacob B; O'Connell, Brendan P; Wang, Jianing; Chakravorti, Srijata; Makowiec, Katie; Carlson, Matthew L; Dawant, Benoit; McCaslin, Devin L; Noble, Jack H; Wanna, George B


    To correlate objective measures of vestibular and audiometric function as well as subjective measures of dizziness handicap with the surface area of the superior canal dehiscence (SCD). Retrospective chart review and radiological analysis. Single tertiary academic referral center. Preoperative computed tomography imaging, patient survey, audiometric thresholds, and vestibular evoked myogenic potential (VEMP) testing in patients with confirmed SCD. Image analysis techniques were developed to measure the surface area of each SCD in computed tomography imaging. Preoperative ocular and cervical VEMPs, air and bone conduction thresholds, air-bone gap, dizziness handicap inventory scores, and surface area of the SCD. Fifty-three patients (mean age 52.7 yr) with 84 SCD were analyzed. The median surface area of dehiscence was 1.44 mm (0.068-8.23 mm). Ocular VEMP amplitudes (r = 0.61, p handicap and surface area was identified. Among patients with confirmed SCD, ocular and cervical VEMP amplitudes, cervical VEMP thresholds, and air conduction thresholds at 250 Hz are significantly correlated with the surface area of the dehiscence.

  4. Isoperimetric surfaces and area-angular momentum inequality in a rotating black hole in new massive gravity (United States)

    Aceña, Andrés; López, Ericson; Llerena, Mario


    We study the existence and stability of isoperimetric surfaces in a family of rotating black holes in new massive gravity. We show that the stability of such surfaces is determined by the sign of the hair parameter. We use the isoperimetric surfaces to find a geometric inequality between the area and the angular momentum of the black hole, conjecturing geometric inequalities for more general black holes.

  5. Three-dimensional measurement of periodontal surface area for quantifying inflammatory burden. (United States)

    Park, Sa-Beom; An, So-Youn; Han, Won-Jeong; Park, Jong-Tae


    Measurement of the root surface area (RSA) is important in periodontal treatment and for the evaluation of periodontal disease as a risk factor for systemic disease. The aim of this study was to measure the RSA at 6 mm below the cementoenamel junction (CEJ) using the Mimics software (Materialise, Leuven, Belgium). We obtained cone-beam computed tomography (CBCT) data from 33 patients who had visited the Department of Oral and Maxillofacial Radiology of Dankook University Dental Hospital. The patients comprised 17 men and 16 women aged from 20 to 35 years, with a mean age of 24.4 years. Only morphologically intact teeth were included in our data. Because the third molars of the maxilla and mandible have a high deformation rate and were absent in some participants, they were not included in our research material. The CBCT data were reconstructed into 3-dimensional (3D) teeth models using the Mimics software, and the RSA at 6 mm below the CEJ was separated and measured using 3-Matic (Materialise). In total, 924 3D teeth models were created, and the area at 6 mm below the CEJ could be isolated in all the models. The area at 6 mm below the CEJ was measured in all teeth from the 33 patients and compared based on sex and position (maxilla vs. mandible). In this study, we demonstrated that it was feasible to generate 3D data and to evaluate RSA values using CBCT and the Mimics software. These results provide deeper insights into the relationship between periodontal inflammatory burden and systemic diseases.

  6. Understanding Large-scale Structure in the SSA22 Protocluster Region Using Cosmological Simulations (United States)

    Topping, Michael W.; Shapley, Alice E.; Steidel, Charles C.; Naoz, Smadar; Primack, Joel R.


    We investigate the nature and evolution of large-scale structure within the SSA22 protocluster region at z = 3.09 using cosmological simulations. A redshift histogram constructed from current spectroscopic observations of the SSA22 protocluster reveals two separate peaks at z = 3.065 (blue) and z = 3.095 (red). Based on these data, we report updated overdensity and mass calculations for the SSA22 protocluster. We find {δ }b,{gal}=4.8+/- 1.8 and {δ }r,{gal}=9.5+/- 2.0 for the blue and red peaks, respectively, and {δ }t,{gal}=7.6+/- 1.4 for the entire region. These overdensities correspond to masses of {M}b=(0.76+/- 0.17)× {10}15{h}-1 {M}ȯ , {M}r=(2.15+/- 0.32)× {10}15{h}-1 {M}ȯ , and {M}t=(3.19+/- 0.40)× {10}15{h}-1 {M}ȯ for the red, blue, and total peaks, respectively. We use the Small MultiDark Planck (SMDPL) simulation to identify comparably massive z∼ 3 protoclusters, and uncover the underlying structure and ultimate fate of the SSA22 protocluster. For this analysis, we construct mock redshift histograms for each simulated z∼ 3 protocluster, quantitatively comparing them with the observed SSA22 data. We find that the observed double-peaked structure in the SSA22 redshift histogram corresponds not to a single coalescing cluster, but rather the proximity of a ∼ {10}15{h}-1 {M}ȯ protocluster and at least one > {10}14{h}-1 {M}ȯ cluster progenitor. Such associations in the SMDPL simulation are easily understood within the framework of hierarchical clustering of dark matter halos. We finally find that the opportunity to observe such a phenomenon is incredibly rare, with an occurrence rate of 7.4{h}3 {{{Gpc}}}-3. Based on data obtained at the W.M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration, and was made possible by the generous financial support of the W.M. Keck Foundation.

  7. Effect of impervious surface area and vegetation changes on mean surface temperature over Tshwane metropolis, Gauteng Province, South Africa

    CSIR Research Space (South Africa)

    Adeyemi, A


    Full Text Available temperature (LST) derived from the thermal bands was also examined. The results of this research reveal that the ISA increase has occurred due to urban sprawl and this have contributed to increase in surface temperature....

  8. In various protein complexes, disordered protomers have large per-residue surface areas and area of protein-, DNA- and RNA-binding interfaces. (United States)

    Wu, Zhonghua; Hu, Gang; Yang, Jianyi; Peng, Zhenling; Uversky, Vladimir N; Kurgan, Lukasz


    We provide first large scale analysis of the peculiarities of surface areas of 5658 dissimilar (below 50% sequence similarity) proteins with known 3D-structures that bind to proteins, DNA or RNAs. We show here that area of the protein surface is highly correlated with the protein length. The size of the interface surface is only modestly correlated with the protein size, except for RNA-binding proteins where larger proteins are characterized by larger interfaces. Disordered proteins with disordered interfaces are characterized by significantly larger per-residue areas of their surfaces and interfaces when compared to the structured proteins. These result are applicable for proteins involved in interaction with DNA, RNA, and proteins and suggest that disordered proteins and binding regions are less compact and more likely to assume extended shape. We demonstrate that disordered protein binding residues in the interfaces of disordered proteins drive the increase in the per residue area of these interfaces. Our results can be used to predict in silico whether a given protomer from the DNA, RNA or protein complex is likely to be disordered in its unbound form. Copyright © 2015 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.

  9. Polybrominated diphenyl ethers in surface soils from e-waste recycling areas and industrial areas in South China: concentration levels, congener profile, and inventory. (United States)

    Gao, Shutao; Hong, Jianwen; Yu, Zhiqiang; Wang, Jingzhi; Yang, Guoyi; Sheng, Guoying; Fu, Jiamo


    Polybrominated diphenyl ethers (PBDEs) were determined in 60 surface soils from two e-waste recycling sites (Qingyuan and Guiyu, China) and their surrounding areas to assess the extent and influence of PBDEs from e-waste recycling sites on the surrounding areas. A total of 32 surface soils from industrial areas in South China were also investigated for comparison. The mean concentrations of total PBDEs in the e-waste recycling sites of Guiyu and Qingyuan were 2,909 and 3,230 ng/g dry weight, respectively, whereas the PBDE concentrations decreased dramatically (1-2 orders of magnitude) with increasing distance from the recycling site, suggesting that the e-waste recycling activities were the major source of PBDEs in the surrounding areas. Decabromodiphenyl ethers accounted for 77.0 to 85.8% of total PBDEs in e-waste recycling areas, whereas it accounted for 90.2% in industrial areas. Principal component analysis showed that the major source of PBDEs in e-waste recycling areas were a combination of penta-, octa-, and deca-BDE commercial formulations, whereas deca-BDE commercial formulations were the major source of PBDE congeners in industrial areas. The inventories of PBDEs gave preliminary estimates of 6.22 tons and 13.4 tons for the e-waste recycling areas and industrial areas. The results suggested that significantly higher PBDEs in the e-waste recycling sites have already affected surrounding areas negatively within a relatively large distance. Because of the environmental persistence, bioaccumulation, and toxicity of PBDEs, improving the recycling techniques employed at such facilities and developing e-waste management policies are necessary. Copyright © 2011 SETAC.

  10. The Effect of Specific Surface Area of Chitin-Metal Silicate Coprocessed Excipient on the Chemical Decomposition of Cefotaxime Sodium. (United States)

    Al-Nimry, Suhair S; Alkhamis, Khouloud A; Alzarieni, Kawthar Z


    Chitin-metal silicates are multifunctional excipients used in tablets. Previously, a correlation between the surface acidity of chitin-calcium and chitin-magnesium silicate and the chemical decomposition of cefotaxime sodium was found but not with chitin-aluminum silicate. This lack of correlation could be due to the catalytic effect of silica alumina or the difference in surface area of the excipients. The objective of this study was to investigate the effect of the specific surface area of the excipient on the chemical decomposition of cefotaxime sodium in the solid state. Chitin was purified and coprocessed with different metal silicates to prepare the excipients. The specific surface area was determined using gas adsorption. The chemical decomposition was studied at constant temperature and relative humidity. Also, the degradation in solution was studied. A correlation was found between the degradation rate constant and the surface area of chitin-aluminum and chitin-calcium silicate but not with chitin-magnesium silicate. This was due to the small average pore diameter of this excipient. Also, the degradation in solution was slower than in solid state. In conclusion, the stability of cefotaxime sodium was dependent on the surface area of the excipient in contact with the drug. Copyright © 2017 American Pharmacists Association®. Published by Elsevier Inc. All rights reserved.

  11. Body surface area in normal-weight, overweight, and obese adults. A comparison study. (United States)

    Verbraecken, Johan; Van de Heyning, Paul; De Backer, Wilfried; Van Gaal, Luc


    Values for body surface area (BSA) are commonly used in medicine, particularly to calculate doses of chemotherapeutic agents and index cardiac output. Various BSA formulas have been developed over the years. The DuBois and DuBois (Arch Intern Med 1916;17:863-71) BSA equation is the most widely used, although derived from only 9 subjects. More recently, Mosteller (N Engl J Med 1987;317:1098) produced a simple formula, [weight (kg) x height (cm)/3600](1/2), which could be easily remembered and evaluated on a pocket calculator, but validation data in adults are rare. The purpose of the present study was to examine the BSA based on Mosteller's formula in normal-weight (body mass index [BMI], 20-24.9 kg/m(2)), overweight (BMI, 25-29.9 kg/m(2)), and obese (BMI, >/=30 kg/m(2)) adults (>18 years old) in comparison with other empirically derived formulas (DuBois and DuBois, Boyd [The growth of the surface area of the human body. Minneapolis: University of Minnesota Press; 1935], Gehan and George [Cancer Chemother Rep 1970;54:225-35], US Environmental Protection Agency [Development of statistical distributions or ranges of standard factors used in exposure assessments Washington, EPA/600/8-85-010. Office of Health and Environmental Assessment; 1985), Haycock et al [J Pediatr 1978;93:62-6], Mattar [Crit Care Med 1989;17:846-7], Livingston and Scott [Am J Physiol Endocrinol Metab 2001;281:E586-91]) and with the new 3-dimensional-derived formula of Yu et al (Appl Ergon. 2003;34:273-8). One thousand eight hundred sixty-eight patients were evaluated (397 normal weight [BMI, 23 +/- 1 kg/m(2); age, 50 +/- 14 years; M/F, 289/108], 714 overweight [BMI, 27 +/- 1 kg/m(2); age, 52 +/- 11 years; M/F, 594/120], and 757 obese [BMI, 36 +/- 6 kg/m(2); age, 53 +/- 11 years; M/F, 543/215]). The overall BSA was 2.04 +/- 0.24 m(2): 1.81 +/- 0.19 m(2) in normal-weight, 1.99 +/- 0.16 m(2) in overweight, and 2.21 +/- 0.22 m(2) in obese subjects. These values were significantly higher in overweight

  12. Joint AGU/SSA Statement on the Comprehensive Test Ban Treaty (United States)

    Lanzerotti, Louis J.

    Recognizing that the debate in the U.S. Senate on whether to ratify the Comprehensive Test Ban Treaty (CTBT) could benefit from a clear analysis of the technical limits to monitoring nuclear explosions, AGU joined with the Seismological Society of America (SSA) to carry out such an analysis. In the following policy statement, approved by both societies, seismologists speak with essentially one voice about this crucial aspect of the CTBT. This is the first time that AGU has prepared a policy statement jointly with another society, and this is the first policy statement SSA has adopted.The policy regarding AGU's procedures for developing position statements on public issues, the Union's role in advocacy of the statements, and all current AGU position statements are available online at http://www.agu. org/sci_soc/policy/sci_ pol.html.

  13. The increase of surface area of a Brazilian palygorskite clay activated with sulfuric acid solutions using a factorial design

    Directory of Open Access Journals (Sweden)

    R. N. Oliveira


    Full Text Available Palygorskite is fibrous clay in which the structural tetrahedral and octahedral layers are organized in a way that structural channels are formed, leading to high surface area. However, impurities inside the channels and aggregated ones considerably reduce the available area. In order to increase the surface area, an activation treatment can be considered useful. The goal of this work is the activation of palygorskite from Guadalupe, Piauí, via sulfuric acid treatment using a two-level factorial design. The influence of three parameters (solution molarity, temperature and time on BET surface area was determined. Moreover, samples were characterized via X-ray diffraction (XRD and fluorescence (XRF, Fourier-transform infrared spectroscopy (FTIR and transmission electron microscopy (TEM. The largest surface area (282 m²/g without considerable changes in clay structure and morphology was found in a sample treated with 5M H2SO4 at 70°C for 1h. The main parameters that favored the improvement of the surface area were the solution's molarity, temperature and their interaction.

  14. Closure Report for Corrective Action Unit 300: Surface Release Areas Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    NSTec Environmental Restoration


    Corrective Action Unit (CAU) 300 is located in Areas 23, 25, and 26 of the Nevada Test Site, which is located approximately 65 miles northwest of Las Vegas, Nevada. CAU 300 is listed in the Federal Facility Agreement and Consent Order of 1996 as Surface Release Areas and is comprised of the following seven Corrective Action Sites (CASs), which are associated with the identified Building (Bldg): {sm_bullet} CAS 23-21-03, Bldg 750 Surface Discharge {sm_bullet} CAS 23-25-02, Bldg 750 Outfall {sm_bullet} CAS 23-25-03, Bldg 751 Outfall {sm_bullet} CAS 25-60-01, Bldg 3113A Outfall {sm_bullet} CAS 25-60-02, Bldg 3901 Outfall {sm_bullet} CAS 25-62-01, Bldg 3124 Contaminated Soil {sm_bullet} CAS 26-60-01, Bldg 2105 Outfall and Decon Pad The Nevada Division of Environmental Protection (NDEP)-approved corrective action alternative for CASs 23-21-03, 23-25-02, and 23-25-03 is no further action. As a best management practice, approximately 48 feet of metal piping was removed from CAS 23-25-02 and disposed of as sanitary waste. The NDEP-approved corrective action alternative for CASs 25-60-01, 25-60-02, 25-62-01, and 26-60-01, is clean closure. Closure activities for these CASs included removing and disposing of soil impacted with total petroleum hydrocarbons-diesel range organics (TPH-DRO), polychlorinated biphenyls (PCBs), semivolatile organic compounds (SVOCs), and cesium (Cs)-137, concrete impacted with TPH-DRO, and associated piping impacted with TPH-DRO. CAU 300 was closed in accordance with the NDEP-approved CAU 300 Corrective Action Plan (CAP) (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office [NNSA/NSO], 2006). The closure activities specified in the CAP were based on the recommendations presented in the CAU 300 Corrective Action Decision Document (NNSA/NSO, 2005). This Closure Report documents CAU 300 closure activities. During closure activities, approximately 40 cubic yards (yd3) of low-level waste consisting of TPH-DRO-, PCB

  15. Formula and scale for body surface area estimation in high-risk infants. (United States)

    Ahn, Youngmee


    Advances in medical technology and the health sciences have lead to a rapid increase in the prevalence and morbidity of high-risk infants with chronic or permanent sequels such as the birth of early preterm infants. A suitable formula is therefore needed for body surface area (BSA) estimation for high-risk infants to more accurately devise therapeutic regimes in clinical practice. A cohort study involving 5014 high-risk infants was conducted to develop a suitable formula for estimating BSA using four of the existing formulas in the literature. BSA of high-risk infants was calculated using the four BSA equations (Boyd-BSA, Dubois-BSA, Meban-BSA, Mosteller-BSA), from which a new calculation, Mean-BSA, was arithmetically derived as a reference BSA measure. Multiple-regression was performed using nonlinear least squares curve fitting corresponding to the trend line and the new equation, Neo-BSA, developed using Excel and SPSS 17.0. The Neo-BSA equation was constructed as follows: Neo-BSA = 5.520 x W(0.5526) x L(0.300). With the assumption of the least square root relation between weight and length, a BSA scale using only weight was fabricated specifically for clinical applications where weight is more available in high-risk infant populations than is length. The validity of Neo-BSA was evaluated against Meban-BSA, the best of the four equations for high-risk infants, as there is a similarity of subjects in the two studies. The other formulas revealed substantial variances in BSA compared to Neo-BSA. This study developed a new surface area equation, Neo-BSA, as the most suitable formula for BSA measurement of high-risk infants in modern-day societies, where an emerging population of newborns with shorten gestational ages are becoming more prevalent as a result of new advances in the health sciences and new development of reproductive technologies. In particular, a scale for 400-7000 g body weight babies derived from the Neo-BSA equation has the clinical advantage of

  16. An approach for mapping large-area impervious surfaces: Synergistic use of Landsat-7 ETM+ and high spatial resolution imagery (United States)

    Yang, Limin; Huang, Chengquan; Homer, Collin G.; Wylie, Bruce K.; Coan, Michael


    A wide range of urban ecosystem studies, including urban hydrology, urban climate, land use planning, and resource management, require current and accurate geospatial data of urban impervious surfaces. We developed an approach to quantify urban impervious surfaces as a continuous variable by using multisensor and multisource datasets. Subpixel percent impervious surfaces at 30-m resolution were mapped using a regression tree model. The utility, practicality, and affordability of the proposed method for large-area imperviousness mapping were tested over three spatial scales (Sioux Falls, South Dakota, Richmond, Virginia, and the Chesapeake Bay areas of the United States). Average error of predicted versus actual percent impervious surface ranged from 8.8 to 11.4%, with correlation coefficients from 0.82 to 0.91. The approach is being implemented to map impervious surfaces for the entire United States as one of the major components of the circa 2000 national land cover database.

  17. Evolution of surface area-to-volume ratio for a water meniscus evaporating between contacting silica spheres. (United States)

    Cutts, R E; Burns, S E


    An experimental investigation was performed under isothermal conditions to quantify the rate of evaporation of water from a receding pendular meniscus connecting two silica spheres. Optically based measurements were used to determine the relevant meniscus dimensions, and the meniscus was modeled using a toroidal approximation. The rate of change of meniscus surface area and volume was then predicted using mathematical modeling software. The results demonstrated that once the meniscus transitioned from a relatively flat surface to one with an increasing radius of curvature, the rate of change of the ratio of surface area-to-volume was relatively constant over the range of water contents that were observable using the optical investigation techniques implemented in this study. Comparison of the flux of water from the meniscus surface demonstrated that the evaporation of bound water was four orders of magnitude slower than evaporation from a free water surface. 2009 Elsevier Inc. All rights reserved.

  18. Effect of surface area and air-drying distance on shear bond strength of etch-and-rinse adhesive

    Directory of Open Access Journals (Sweden)

    Farid Mohammed Sabry El-Askary


    Full Text Available We evaluated the effects of air-drying distance and bond surface area on the shear bond strength of a 2-step etch-and-rinse adhesive. A total of 120 bovine anterior teeth were equally divided into 6 main groups based on bonding surface area. The main groups were divided into sub-groups (n = 5 according to air-drying distance. The shear strength was determined using a universal testing machine at a crosshead speed of 0.5 mm/min. The averaged results were subjected to two-way ANOVA and Tukey's test (α = 0.05. Two-way ANOVA testing identified no significant cross-product interactions (p > 0.05, but the main factors of area (p < 0.0001 and air-drying distance (p < 0.00001 significantly affected the mean bond strength. Shorter air-drying distances improved bond strength, and increased surface area decreased the bond strength.

  19. An assessment of the diagnostic criteria for sessile serrated adenoma/polyps: SSA/Ps using image processing software analysis for Ki67 immunohistochemistry

    Directory of Open Access Journals (Sweden)

    Fujimori Yukari


    Full Text Available Abstract Background Serrated polyps belong to a heterogeneous group of lesions that are generally characterized morphologically. This type of lesion is thought to be the precursor of sporadic carcinomas with microsatellite instability, and probably also the precursor for CpG island-methylated microsatellite-stable carcinomas. For practical purposes, according to the 2010 WHO classification, the diagnostic criteria for sessile serrated adenomas/polyps (SSA/Ps was established by the research project “Potential of Cancerization of Colorectal Serrated Lesions” led by the Japanese Society for Cancer of the Colon and Rectum. The aim of this study was to evaluate the validity of the morphologic characteristics established in Japan by using immunohistochemical staining for Ki-67. Methods To calculate the target cells, 2 contiguous crypts which could be detected from the bottom of the crypt to the surface of the colorectal epithelium were selected. To validate the proliferative activity, we evaluated the percentage and the asymmetrical staining pattern of Ki67 positive cells in each individual crypt. To examine the immunoreactivity of Ki67, computer-assisted cytometrical analysis was performed. Results SSA/Ps had a higher proliferative activity as compared to hyperplastic polyps (HPs based on the difference in incidence of Ki67 positive cells, and the former also exhibited a significantly higher asymmetric distribution of these cells as compared to HPs, even in lesions with a diameter Conclusion We conclude that assessment of the pathological findings of SSA/Ps, including crypt dilation, irregularly branching crypts, and horizontally arranged basal crypts (inverted T- and/or L-shaped crypts is appropriate to show a significantly higher proliferative activity as compared to HPs. Further, the use of two-dimensional image analysis software is an objective and reproducible method for this type of histological examination. Virtual slides The virtual

  20. Factors influencing fetal cardiac conduction in anti-Ro/SSA-positive pregnancies. (United States)

    Sonesson, Sven-Erik; Hedlund, Malin; Ambrosi, Aurélie; Wahren-Herlenius, Marie


    Congenital heart block (CHB) develops in 1-2% of anti-Ro/SSA-positive pregnancies and has a recurrence rate of 12-20%, which indicates that factors other than maternal autoantibodies are crucial for CHB to occur. Here, we aimed to evaluate the influence of factors previously associated with CHB on the occurrence of milder forms of fetal cardiac conduction disturbances, shown to occur in up to 30% of anti-Ro/SSA-positive pregnancies, and on neonatal outcome in a large cohort of prospectively followed pregnancies. The association of maternal age, season of the year and history of atrioventricular block (AVB) with the development of fetal Doppler and neonatal ECG conduction disturbances was evaluated in 212 anti-Ro52/SSA-positive singleton pregnancies. Maternal age was significantly higher in AVB II-III pregnancies but was not correlated with fetal AV time intervals in fetuses without signs of AVB II-III. AV time intervals of fetuses surveilled during the winter were significantly longer than those of fetuses surveilled during the summer. Fetal AV time intervals in consecutive pregnancies from the same women were significantly correlated. A history of AVB II-III was associated with significantly longer AV time intervals, and AVB I-III was observed at birth in 38% of babies born after a sibling with abnormal fetal AV conduction. Our study shows that AV time intervals in anti-Ro/SSA antibody-exposed fetuses during the CHB risk period are influenced by the season of the year, and reveals that the recurrence of conduction disturbances in antibody-exposed fetuses is higher than previously reported when milder forms are taken into account. © The Author 2017. Published by Oxford University Press on behalf of the British Society for Rheumatology. All rights reserved. For Permissions, please email:

  1. Scaling of Haversian canal surface area to secondary osteon bone volume in ribs and limb bones. (United States)

    Skedros, John G; Knight, Alex N; Clark, Gunnar C; Crowder, Christian M; Dominguez, Victoria M; Qiu, Shijing; Mulhern, Dawn M; Donahue, Seth W; Busse, Björn; Hulsey, Brannon I; Zedda, Marco; Sorenson, Scott M


    Studies of secondary osteons in ribs have provided a great deal of what is known about remodeling dynamics. Compared with limb bones, ribs are metabolically more active and sensitive to hormonal changes, and receive frequent low-strain loading. Optimization for calcium exchange in rib osteons might be achieved without incurring a significant reduction in safety factor by disproportionally increasing central canal size with increased osteon size (positive allometry). By contrast, greater mechanical loads on limb bones might favor reducing deleterious consequences of intracortical porosity by decreasing osteon canal size with increased osteon size (negative allometry). Evidence of this metabolic/mechanical dichotomy between ribs and limb bones was sought by examining relationships between Haversian canal surface area (BS, osteon Haversian canal perimeter, HC.Pm) and bone volume (BV, osteonal wall area, B.Ar) in a broad size range of mature (quiescent) osteons from adult human limb bones and ribs (modern and medieval) and various adult and subadult non-human limb bones and ribs. Reduced major axis (RMA) and least-squares (LS) regressions of HC.Pm/B.Ar data show that rib and limb osteons cannot be distinguished by dimensional allometry of these parameters. Although four of the five rib groups showed positive allometry in terms of the RMA slopes, nearly 50% of the adult limb bone groups also showed positive allometry when negative allometry was expected. Consequently, our results fail to provide clear evidence that BS/BV scaling reflects a rib versus limb bone dichotomy whereby calcium exchange might be preferentially enhanced in rib osteons. Copyright © 2013 Wiley Periodicals, Inc.

  2. Quality of surface-water supplies in the Triangle area of North Carolina, water year 2009 (United States)

    Pfeifle, C. A.; Giorgino, M. J.; Rasmussen, R. B.


    Surface-water supplies are important sources of drinking water for residents in the Triangle area of North Carolina, which is located within the upper Cape Fear and Neuse River Basins. Since 1988, the U.S. Geological Survey and a consortium of governments have tracked water-quality conditions and trends in several of the area’s water-supply lakes and streams. This report summarizes data collected through this cooperative effort, known as the Triangle Area Water Supply Monitoring Project, during October 2008 through September 2009. Major findings for this period include: - Annual precipitation was approximately 20 percent below the long-term mean (average) annual precipitation. - Streamflow was below the long-term mean at the 10 project streamgages during most of the year. - More than 7,000 individual measurements of water quality were made at a total of 26 sites—15 in the Neuse River Basin and 11 in the Cape Fear River Basin. Forty-seven water-quality properties and constituents were measured. - All observations met North Carolina water-quality standards for water temperature, pH, hardness, chloride, fluoride, sulfate, nitrate, arsenic, cadmium, chromium, lead, nickel, and selenium. - North Carolina water-quality standards were exceeded one or more times for dissolved oxygen, dissolved oxygen percent saturation, chlorophyll a, mercury, copper, iron, manganese, silver, and zinc. Exceedances occurred at 23 sites—13 in the Neuse River Basin and 10 in the Cape Fear River Basin. - Stream samples collected during storm events contained elevated concentrations of 18 water-quality constituents compared to samples collected during non-storm events. - Concentrations of nitrogen and phosphorus were within ranges observed during previous years. - Five reservoirs had chlorophyll a concentrations in excess of 40 micrograms per liter at least once during 2009: Little River Reservoir, Falls Lake, Cane Creek Reservoir, University Lake, and Jordan Lake.

  3. Sewage sludge ash (SSA in high performance concrete: characterization and application

    Directory of Open Access Journals (Sweden)

    C. M. A. Fontes

    Full Text Available ABSTRACT Sewage sludge originated from the process of treatment of wastewater has become an environmental issue for three main reasons: contains pathogens, heavy metals and organic compounds that are harmful to the environmental and human health; high volumes are daily generated; and shortage of landfill sites for proper disposal. This research deals with the viability study of sewage sludge utilization, after calcination process, as mineral admixture in the production of concrete. High-performance concretes were produced with replacement content of 5% and 10% by weight of Portland cement with sewage sludge ash (SSA. The influence of this ash was analyzed through physical and mechanical tests. Analysis showed that the mixtures containing SSA have lower values of compressive strength than the reference. The results of absorptivity, porosity and accelerated penetration of chloride ions, presents that mixtures containing ash showed reductions compared to the reference. This indicates that SSA provided refinement of the pore structure, which was confirmed by mercury intrusion porosimetry test.

  4. Tear-Film Evaporation Rate from Simultaneous Ocular-Surface Temperature and Tear-Breakup Area. (United States)

    Dursch, Thomas J; Li, Wing; Taraz, Baseem; Lin, Meng C; Radke, Clayton J


    A corneal heat-transfer model is presented to quantify simultaneous measurements of fluorescein tear-breakup area (TBA) and ocular-surface temperature (OST). By accounting for disruption of the tear-film lipid layer (TFLL), we report evaporation rates through lipid-covered tear. The modified heat-transfer model provides new insights into evaporative dry eye. A quantitative analysis is presented to assess human aqueous tear evaporation rate (TER) through intact TFLLs from simultaneous in vivo measurement of time-dependent infrared OST and fluorescein TBA. We interpret simultaneous OST and TBA measurements using an extended heat-transfer model. We hypothesize that TBAs are ineffectively insulated by the TFLL and therefore exhibit higher TER than does that for a well-insulting TFLL-covered tear. As time proceeds, TBAs increase in number and size, thereby increasing the cornea area-averaged TER and decreasing OST. Tear-breakup areas were assessed from image analysis of fluorescein tear-film-breakup video recordings and are included in the heat-transfer description of OST. Model-predicted OSTs agree well with clinical experiments. Percent reductions in TER of lipid-covered tear range from 50 to 95% of that for pure water, in good agreement with literature. The physical picture of noninsulating or ruptured TFLL spots followed by enhanced evaporation from underlying cooler tear-film ruptures is consistent with the evaporative-driven mechanism for local tear rupture. A quantitative analysis is presented of in vivo TER from simultaneous clinical measurement of transient OST and TBA. The new heat-transfer model accounts for increased TER through expanding TBAs. Tear evaporation rate varies strongly across the cornea because lipid is effectively missing over tear-rupture troughs. The result is local faster evaporation compared with nonruptured, thick lipid-covered tear. Evaporative-driven tear-film ruptures deepen to a thickness where fluorescein quenching commences and local

  5. Genetic network properties of the human cortex based on regional thickness and surface area measures

    Directory of Open Access Journals (Sweden)

    Anna R. Docherty


    Full Text Available We examined network properties of genetic covariance between average cortical thickness (CT and surface area (SA within genetically-identified cortical parcellations that we previously derived from human cortical genetic maps using vertex-wise fuzzy clustering analysis with high spatial resolution. There were 24 hierarchical parcellations based on vertex-wise CT and 24 based on vertex-wise SA expansion/contraction; in both cases the 12 parcellations per hemisphere were largely symmetrical. We utilized three techniques—biometrical genetic modeling, cluster analysis, and graph theory—to examine genetic relationships and network properties within and between the 48 parcellation measures. Biometrical modeling indicated significant shared genetic covariance between size of several of the genetic parcellations. Cluster analysis suggested small distinct groupings of genetic covariance; networks highlighted several significant negative and positive genetic correlations between bilateral parcellations. Graph theoretical analysis suggested that small world, but not rich club, network properties may characterize the genetic relationships between these regional size measures. These findings suggest that cortical genetic parcellations exhibit short characteristic path lengths across a broad network of connections. This property may be protective against network failure. In contrast, previous research with structural data has observed strong rich club properties with tightly interconnected hub networks. Future studies of these genetic networks might provide powerful phenotypes for genetic studies of normal and pathological brain development, aging, and function.

  6. Features of protein-protein interactions that translate into potent inhibitors: topology, surface area and affinity. (United States)

    Smith, Matthew C; Gestwicki, Jason E


    Protein-protein interactions (PPIs) control the assembly of multi-protein complexes and, thus, these contacts have enormous potential as drug targets. However, the field has produced a mix of both exciting success stories and frustrating challenges. Here, we review known examples and explore how the physical features of a PPI, such as its affinity, hotspots, off-rates, buried surface area and topology, might influence the chances of success in finding inhibitors. This analysis suggests that concise, tight binding PPIs are most amenable to inhibition. However, it is also clear that emerging technical methods are expanding the repertoire of 'druggable' protein contacts and increasing the odds against difficult targets. In particular, natural product-like compound libraries, high throughput screens specifically designed for PPIs and approaches that favour discovery of allosteric inhibitors appear to be attractive routes. The first group of PPI inhibitors has entered clinical trials, further motivating the need to understand the challenges and opportunities in pursuing these types of targets.

  7. Voice Morphing Using 3D Waveform Interpolation Surfaces and Lossless Tube Area Functions

    Directory of Open Access Journals (Sweden)

    Lavner Yizhar


    Full Text Available Voice morphing is the process of producing intermediate or hybrid voices between the utterances of two speakers. It can also be defined as the process of gradually transforming the voice of one speaker to that of another. The ability to change the speaker's individual characteristics and to produce high-quality voices can be used in many applications. Examples include multimedia and video entertainment, as well as enrichment of speech databases in text-to-speech systems. In this study we present a new technique which enables production of a given number of intermediate voices or of utterances which gradually change from one voice to another. This technique is based on two components: (1 creation of a 3D prototype waveform interpolation (PWI surface from the LPC residual signal, to produce an intermediate excitation signal; (2 a representation of the vocal tract by a lossless tube area function, and an interpolation of the parameters of the two speakers. The resulting synthesized signal sounds like a natural voice lying between the two original voices.

  8. Reduced cortical thickness and increased surface area in antisocial personality disorder. (United States)

    Jiang, Weixiong; Li, Gang; Liu, Huasheng; Shi, Feng; Wang, Tao; Shen, Celina; Shen, Hui; Lee, Seong-Whan; Hu, Dewen; Wang, Wei; Shen, Dinggang


    Antisocial personality disorder (ASPD), one of whose characteristics is high impulsivity, is of great interest in the field of brain structure and function. However, little is known about possible impairments in the cortical anatomy in ASPD, in terms of cortical thickness (CTh) and surface area (SA), as well as their possible relationship with impulsivity. In this neuroimaging study, we first investigated the changes of CTh and SA in ASPD patients, in comparison to those of healthy controls, and then performed correlation analyses between these measures and the ability of impulse control. We found that ASPD patients showed thinner cortex while larger SA in several specific brain regions, i.e., bilateral superior frontal gyrus (SFG), orbitofrontal and triangularis, insula cortex, precuneus, middle frontal gyrus (MFG), middle temporal gyrus (MTG), and left bank of superior temporal sulcus (STS). In addition, we also found that the ability of impulse control was positively correlated with CTh in the SFG, MFG, orbitofrontal cortex (OFC), pars triangularis, superior temporal gyrus (STG), and insula cortex. To our knowledge, this study is the first to reveal simultaneous changes in CTh and SA in ASPD, as well as their relationship with impulsivity. These cortical structural changes may introduce uncontrolled and callous behavioral characteristic in ASPD patients, and these potential biomarkers may be very helpful in understanding the pathomechanism of ASPD. Copyright © 2016 IBRO. Published by Elsevier Ltd. All rights reserved.

  9. Hydrothermal synthesis of high surface area ZIF-8 with minimal use of TEA (United States)

    Butova, V. V.; Budnyk, A. P.; Bulanova, E. A.; Lamberti, C.; Soldatov, A. V.


    In this paper we present, for the first time, a simple hydrothermal recipe for the synthesis of ZIF-8 Metal-Organic Framework (MOF) with a large specific surface area (1340 m2/g by BET). An important feature of the method is that the product forms in aqueous medium under standard hydrothermal conditions without DMF and great excess of linker with the use of TEA as structure directing agent. The ZIF-8 crystal phase of the product was confirmed by XRD; this technique has been also exploited to check the crystallinity and to follow the changes in the MOF structure induced by heating. TGA and temperature dependent XRD testify the high thermal stability of the material (470 °C in N2 and at 400 °C in air). The IR spectral profile of the material provides a complete picture of vibrations assigned to the linker and the metal center. The systematic investigation of the products obtained by increasing the TEA amount in the reacting medium from 0 to 25.5 mol equivalent Zn2+, allowed us to understand its role and to find 2.6 mol equivalent Zn2+ as the minimum amount needed to obtain a single phase ZIF-8 material with the high standard reported above. The stability of the material under severe basic conditions makes it a promising candidate in heterogeneous catalysis. The material has shown high capacity in I2 uptake, making it interesting also for selective molecular adsorption.

  10. Accessible surface area of proteins from purely sequence information and the importance of global features (United States)

    Faraggi, Eshel; Zhou, Yaoqi; Kloczkowski, Andrzej


    We present a new approach for predicting the accessible surface area of proteins. The novelty of this approach lies in not using residue mutation profiles generated by multiple sequence alignments as descriptive inputs. Rather, sequential window information and the global monomer and dimer compositions of the chain are used. We find that much of the lost accuracy due to the elimination of evolutionary information is recouped by the use of global features. Furthermore, this new predictor produces similar results for proteins with or without sequence homologs deposited in the Protein Data Bank, and hence shows generalizability. Finally, these predictions are obtained in a small fraction (1/1000) of the time required to run mutation profile based prediction. All these factors indicate the possible usability of this work in de-novo protein structure prediction and in de-novo protein design using iterative searches. Funded in part by the financial support of the National Institutes of Health through Grants R01GM072014 and R01GM073095, and the National Science Foundation through Grant NSF MCB 1071785.

  11. Lanthanum based high surface area perovskite-type oxide and application in CO and propane combustion

    International Nuclear Information System (INIS)

    Silva, P.R.N.; Soares, A.B.


    The perovskite-type oxides using transition metals present a promising potential as catalysts in total oxidation reaction. The present work investigates the effect of synthesis by oxidant co-precipitation on the catalytic activity of perovskite-type oxides LaBO 3 (B= Co, Ni, Mn) in total oxidation of propane and CO. The perovskite-type oxides were characterized by means of X-ray diffraction, nitrogen adsorption (BET method), thermo gravimetric and differential thermal analysis (ATG-DTA) and X-ray photoelectron spectroscopy (XPS). Through a method involving the oxidant co-precipitation it's possible to obtain catalysts with different BET surface areas, of 33-44 m 2 /g, according the salts of metal used. The characterization results proved that catalysts have a perovskite phase as well as lanthanum oxide, except LaMnO 3 , that presents a cationic vacancies and generation for known oxygen excess. The results of catalytic test showed that all oxides have a specific catalytic activity for total oxidation of CO and propane even though the temperatures for total conversion change for each transition metal and substance to be oxidized. (author)

  12. [Study on plasma temperature of a large area surface discharge by optical emission spectrum]. (United States)

    Dong, Li-Fang; Tong, Guo-Liang; Zhang, Yu; Zhou, Bin


    A large area surface discharge was realized in air/argon gas mixture by designing a discharge device with water electrodes. By using optical emission spectrum, the variations of the molecular vibrational temperature, the mean energy of electron, and the electronic excitation temperature as a function of the gas pressure were studied. The nitrogen molecular vibrational temperature was calculated according to the emission line of the second positive band system of the nitrogen molecule (C3 pi(u) --> B 3 pi(g)). The electronic excitation temperature was obtained by using the intensity ratio of Ar I 763.51 nm (2P(6) --> 1S(5)) to Ar I 772.42 nm (2P(2) --> 1S(3)). The changes in the mean energy of electron were studied by the relative intensity ratio of the nitrogen molecular ion 391.4 nm to nitrogen 337.1 nm. It was found that the intensity of emission spectral line increases with the increase in the gas pressure, meanwhile, the outline and the ratios of different spectral lines intensity also change. The molecular vibrational temperature, the mean energy of electron, and the electronic excitation temperature decrease as the gas pressure increases from 0.75 x 10(5) Pa to 1 x 10(5) Pa.

  13. Reliable nanomaterial classification of powders using the volume-specific surface area method

    Energy Technology Data Exchange (ETDEWEB)

    Wohlleben, Wendel, E-mail: [Department of Material Physics, BASF SE (Germany); Mielke, Johannes [BAM–Federal Institute for Materials Research and Testing (Germany); Bianchin, Alvise [MBN Nanomaterialia s.p.a (Italy); Ghanem, Antoine [R& I Centre Brussels, Solvay (Belgium); Freiberger, Harald [Department of Material Physics, BASF SE (Germany); Rauscher, Hubert [European Commission, Nanobiosciences Unit, Joint Research Centre (Italy); Gemeinert, Marion; Hodoroaba, Vasile-Dan, E-mail: [BAM–Federal Institute for Materials Research and Testing (Germany)


    The volume-specific surface area (VSSA) of a particulate material is one of two apparently very different metrics recommended by the European Commission for a definition of “nanomaterial” for regulatory purposes: specifically, the VSSA metric may classify nanomaterials and non-nanomaterials differently than the median size in number metrics, depending on the chemical composition, size, polydispersity, shape, porosity, and aggregation of the particles in the powder. Here we evaluate the extent of agreement between classification by electron microscopy (EM) and classification by VSSA on a large set of diverse particulate substances that represent all the anticipated challenges except mixtures of different substances. EM and VSSA are determined in multiple labs to assess also the level of reproducibility. Based on the results obtained on highly characterized benchmark materials from the NanoDefine EU FP7 project, we derive a tiered screening strategy for the purpose of implementing the definition of nanomaterials. We finally apply the screening strategy to further industrial materials, which were classified correctly and left only borderline cases for EM. On platelet-shaped nanomaterials, VSSA is essential to prevent false-negative classification by EM. On porous materials, approaches involving extended adsorption isotherms prevent false positive classification by VSSA. We find no false negatives by VSSA, neither in Tier 1 nor in Tier 2, despite real-world industrial polydispersity and diverse composition, shape, and coatings. The VSSA screening strategy is recommended for inclusion in a technical guidance for the implementation of the definition.

  14. Periodontal inflamed surface area as a novel numerical variable describing periodontal conditions (United States)


    Purpose A novel index, the periodontal inflamed surface area (PISA), represents the sum of the periodontal pocket depth of bleeding on probing (BOP)-positive sites. In the present study, we evaluated correlations between PISA and periodontal classifications, and examined PISA as an index integrating the discrete conventional periodontal indexes. Methods This study was a cross-sectional subgroup analysis of data from a prospective cohort study investigating the association between chronic periodontitis and the clinical features of ankylosing spondylitis. Data from 84 patients without systemic diseases (the control group in the previous study) were analyzed in the present study. Results PISA values were positively correlated with conventional periodontal classifications (Spearman correlation coefficient=0.52; Pperiodontal indexes, such as BOP and the plaque index (PI) (r=0.94; Pperiodontal classification, PI, bleeding index, and smoking, but not in the multivariate analysis. In the multivariate linear regression analysis, PISA values were positively correlated with the quantity of current smoking, PI, and severity of periodontal disease. Conclusions PISA integrates multiple periodontal indexes, such as probing pocket depth, BOP, and PI into a numerical variable. PISA is advantageous for quantifying periodontal inflammation and plaque accumulation. PMID:29093989

  15. Large-area homogeneous periodic surface structures generated on the surface of sputtered boron carbide thin films by femtosecond laser processing

    International Nuclear Information System (INIS)

    Serra, R.; Oliveira, V.; Oliveira, J.C.; Kubart, T.; Vilar, R.; Cavaleiro, A.


    Highlights: • Large-area LIPSS were formed by femtosecond laser processing B-C films surface. • The LIPSS spatial period increases with laser fluence (140–200 nm). • Stress-related sinusoidal-like undulations were formed on the B-C films surface. • The undulations amplitude (down to a few nanometres) increases with laser fluence. • Laser radiation absorption increases with surface roughness. - Abstract: Amorphous and crystalline sputtered boron carbide thin films have a very high hardness even surpassing that of bulk crystalline boron carbide (≈41 GPa). However, magnetron sputtered B-C films have high friction coefficients (C.o.F) which limit their industrial application. Nanopatterning of materials surfaces has been proposed as a solution to decrease the C.o.F. The contact area of the nanopatterned surfaces is decreased due to the nanometre size of the asperities which results in a significant reduction of adhesion and friction. In the present work, the surface of amorphous and polycrystalline B-C thin films deposited by magnetron sputtering was nanopatterned using infrared femtosecond laser radiation. Successive parallel laser tracks 10 μm apart were overlapped in order to obtain a processed area of about 3 mm 2 . Sinusoidal-like undulations with the same spatial period as the laser tracks were formed on the surface of the amorphous boron carbide films after laser processing. The undulations amplitude increases with increasing laser fluence. The formation of undulations with a 10 μm period was also observed on the surface of the crystalline boron carbide film processed with a pulse energy of 72 μJ. The amplitude of the undulations is about 10 times higher than in the amorphous films processed at the same pulse energy due to the higher roughness of the films and consequent increase in laser radiation absorption. LIPSS formation on the surface of the films was achieved for the three B-C films under study. However, LIPSS are formed under different

  16. Large-area homogeneous periodic surface structures generated on the surface of sputtered boron carbide thin films by femtosecond laser processing

    Energy Technology Data Exchange (ETDEWEB)

    Serra, R., E-mail: [SEG-CEMUC, Mechanical Engineering Department, University of Coimbra, Rua Luís Reis Santos, 3030-788 Coimbra (Portugal); Oliveira, V. [ICEMS-Instituto de Ciência e Engenharia de Materiais e Superfícies, Avenida Rovisco Pais no 1, 1049-001 Lisbon (Portugal); Instituto Superior de Engenharia de Lisboa, Avenida Conselheiro Emídio Navarro no 1, 1959-007 Lisbon (Portugal); Oliveira, J.C. [SEG-CEMUC, Mechanical Engineering Department, University of Coimbra, Rua Luís Reis Santos, 3030-788 Coimbra (Portugal); Kubart, T. [The Ångström Laboratory, Solid State Electronics, P.O. Box 534, SE-751 21 Uppsala (Sweden); Vilar, R. [Instituto Superior de Engenharia de Lisboa, Avenida Conselheiro Emídio Navarro no 1, 1959-007 Lisbon (Portugal); Instituto Superior Técnico, Avenida Rovisco Pais no 1, 1049-001 Lisbon (Portugal); Cavaleiro, A. [SEG-CEMUC, Mechanical Engineering Department, University of Coimbra, Rua Luís Reis Santos, 3030-788 Coimbra (Portugal)


    Highlights: • Large-area LIPSS were formed by femtosecond laser processing B-C films surface. • The LIPSS spatial period increases with laser fluence (140–200 nm). • Stress-related sinusoidal-like undulations were formed on the B-C films surface. • The undulations amplitude (down to a few nanometres) increases with laser fluence. • Laser radiation absorption increases with surface roughness. - Abstract: Amorphous and crystalline sputtered boron carbide thin films have a very high hardness even surpassing that of bulk crystalline boron carbide (≈41 GPa). However, magnetron sputtered B-C films have high friction coefficients (C.o.F) which limit their industrial application. Nanopatterning of materials surfaces has been proposed as a solution to decrease the C.o.F. The contact area of the nanopatterned surfaces is decreased due to the nanometre size of the asperities which results in a significant reduction of adhesion and friction. In the present work, the surface of amorphous and polycrystalline B-C thin films deposited by magnetron sputtering was nanopatterned using infrared femtosecond laser radiation. Successive parallel laser tracks 10 μm apart were overlapped in order to obtain a processed area of about 3 mm{sup 2}. Sinusoidal-like undulations with the same spatial period as the laser tracks were formed on the surface of the amorphous boron carbide films after laser processing. The undulations amplitude increases with increasing laser fluence. The formation of undulations with a 10 μm period was also observed on the surface of the crystalline boron carbide film processed with a pulse energy of 72 μJ. The amplitude of the undulations is about 10 times higher than in the amorphous films processed at the same pulse energy due to the higher roughness of the films and consequent increase in laser radiation absorption. LIPSS formation on the surface of the films was achieved for the three B-C films under study. However, LIPSS are formed under

  17. Marine organic geochemistry in industrially affected coastal areas in Greece: Hydrocarbons in surface sediments (United States)

    Hatzianestis, Ioannis


    Hydrocarbons are abundant components of the organic material in coastal zones. Their sources are mainly anthropogenic, but several natural ones have also been recognized. Among hydrocarbons, the polycyclic aromatic ones (PAHs) have received special attention since they considered as hazardous environmental chemicals and are included in priority pollutant lists. The purpose of this study was to investigate the distribution, sources and transport pathways of hydrocarbons in marine areas in Greece directly influenced from the operation of major industrial units in the coastal zone by using a molecular marker approach, characteristic compositional patterns and related indices and also to evaluate their potential toxicity. Thirty two surface sediment samples were collected from three marine areas: a) Antikyra bay in Korinthiakos gulf, affected from the operation of an alumina and production plant b) Larymna bay in Noth Evoikos, affected from the operation of a nickel production plant and c) Aliveri bay in South Evoikos Gulf, affected from a cement production plant. In all the studied areas aquaculture and fishing activities have been also developed in the coastal zone. High aliphatic hydrocarbon (AHC) concentrations (~500 μg/g), indicating significant petroleum related inputs, were measured only in Antikyra bay. In all the other samples, AHC values were below 100 μg/g. N-alkanes were the most prominent resolved components (R) with an elevated odd to even carbon number preference, revealing the high importance of terrestrial inputs in the study areas. The unresolved complex mixture (UCM) was the major component of the aliphatic fraction (UCM/R > 4), indicating a chronic oil pollution. A series of hopanes were also identified, with patterns characteristic of oil-derived hydrocarbons, further confirming the presence of pollutant inputs from fossil fuel products. Extremely high PAH concentrations (> 100,000 ng/g) were found in the close vicinity of the alumina production

  18. Characterization of the intragranular water regime within subsurface sediments: pore volume, surface area, and mass transfer limitations (United States)

    Hay, Michael B.; Stoliker, Deborah L.; Davis, James A.; Zachara, John M.


    Although "intragranular" pore space within grain aggregates, grain fractures, and mineral surface coatings may contain a relatively small fraction of the total porosity within a porous medium, it often contains a significant fraction of the reactive surface area, and can thus strongly affect the transport of sorbing solutes. In this work, we demonstrate a batch experiment procedure using tritiated water as a high-resolution diffusive tracer to characterize the intragranular pore space. The method was tested using uranium-contaminated sediments from the vadose and capillary fringe zones beneath the former 300A process ponds at the Hanford site (Washington). Sediments were contacted with tracers in artificial groundwater, followed by a replacement of bulk solution with tracer-free groundwater and the monitoring of tracer release. From these data, intragranular pore volumes were calculated and mass transfer rates were quantified using a multirate first-order mass transfer model. Tritium-hydrogen exchange on surface hydroxyls was accounted for by conducting additional tracer experiments on sediment that was vacuum dried after reaction. The complementary ("wet" and "dry") techniques allowed for the simultaneous determination of intragranular porosity and surface area using tritium. The Hanford 300A samples exhibited intragranular pore volumes of ~1% of the solid volume and intragranular surface areas of ~20%–35% of the total surface area. Analogous experiments using bromide ion as a tracer yielded very different results, suggesting very little penetration of bromide into the intragranular porosity.


    Directory of Open Access Journals (Sweden)

    A. V. Gorevoy


    Full Text Available The problem of non-contact surface defect area measurement at complex-shape objects under videoendoscopic control is considered. Major factors contributing to the measurement uncertainty are analyzed for the first time. The proposed method of accuracy analysis is based on the evaluation of 3D coordinates of surface points from 2D projections under assumption of projective camera model and Mahalanobis distance minimization in the image plane. Expressions for area measurement error caused by sum-of-triangles approximation are obtained analytically for practically important cases of cylindrical and spherical surfaces. It is shown that the magnitude of this error component for a single triangle does not exceed 1% for the real values of parameters of the endoscopic imaging system. Expressions are derived for area measurement uncertainty evaluation on arbitrary shape surfaces, caused by measurement errors of 3D coordinates of individual points with and without a priori information about surface shape. Verification of the obtained expressions with real experiment data showed that area measurement error for a complex figure, given by a set of points, is mainly caused by ignoring the fact that these points belong to the surface. It is proved that the use of a priori information about investigated surface shape, which is often available from the design documentation, in many cases would radically improve the accuracy of surface defects area measurement. The presented results are valid for stereoscopic, shadow and phase methods of video endoscopic measurements and can be effectively used in development of new non-contact measuring endoscopic systems and modernization of existing ones.

  20. Automated mapping of impervious surfaces in urban and suburban areas: Linear spectral unmixing of high spatial resolution imagery (United States)

    Yang, Jian; He, Yuhong


    Quantifying impervious surfaces in urban and suburban areas is a key step toward a sustainable urban planning and management strategy. With the availability of fine-scale remote sensing imagery, automated mapping of impervious surfaces has attracted growing attention. However, the vast majority of existing studies have selected pixel-based and object-based methods for impervious surface mapping, with few adopting sub-pixel analysis of high spatial resolution imagery. This research makes use of a vegetation-bright impervious-dark impervious linear spectral mixture model to characterize urban and suburban surface components. A WorldView-3 image acquired on May 9th, 2015 is analyzed for its potential in automated unmixing of meaningful surface materials for two urban subsets and one suburban subset in Toronto, ON, Canada. Given the wide distribution of shadows in urban areas, the linear spectral unmixing is implemented in non-shadowed and shadowed areas separately for the two urban subsets. The results indicate that the accuracy of impervious surface mapping in suburban areas reaches up to 86.99%, much higher than the accuracies in urban areas (80.03% and 79.67%). Despite its merits in mapping accuracy and automation, the application of our proposed vegetation-bright impervious-dark impervious model to map impervious surfaces is limited due to the absence of soil component. To further extend the operational transferability of our proposed method, especially for the areas where plenty of bare soils exist during urbanization or reclamation, it is still of great necessity to mask out bare soils by automated classification prior to the implementation of linear spectral unmixing.