WorldWideScience

Sample records for surface area ssa

  1. Molecularly-Limited Fractal Surface Area of Mineral Powders

    Directory of Open Access Journals (Sweden)

    Petr Jandacka

    2016-05-01

    Full Text Available The topic of the specific surface area (SSA of powders is not sufficiently described in the literature in spite of its nontrivial contribution to adsorption and dissolution processes. Fractal geometry provides a way to determine this parameter via relation SSA ~ x(D − 3s(2 − D, where x (m is the particle size and s (m is a scale. Such a relation respects nano-, micro-, or macro-topography on the surface. Within this theory, the fractal dimension 2 ≤ D < 3 and scale parameter s plays a significant role. The parameter D may be determined from BET or dissolution measurements on several samples, changing the powder particle sizes or sizes of adsorbate molecules. If the fractality of the surface is high, the SSA does not depend on the particle size distribution and vice versa. In this paper, the SSA parameter is analyzed from the point of view of adsorption and dissolution processes. In the case of adsorption, a new equation for the SSA, depending on the term (2 − D∙(s2 − sBET/sBET, is derived, where sBET and s2 are effective cross-sectional diameters for BET and new adsorbates. Determination of the SSA for the dissolution process appears to be very complicated, since the fractality of the surface may change in the process. Nevertheless, the presented equations have good application potential.

  2. Experiment Study on Determination of Surface Area of Finegrained Soils by Mercury Intrusion Porosimetry

    Science.gov (United States)

    Yan, X. Q.; Zhou, C. Y.; Fang, Y. G.; Lin, L. S.

    2017-12-01

    The specific surface area (SSA) has a great influence on the physical and chemical properties of fine-grained soils. Determination of specific surface area is an important content for fine-grained soils micro-meso analysis and characteristic research. In this paper, mercury intrusion porosimetry (MIP) was adopted to determine the SSA of fine-grained soils including quartz, kaolinite, bentonite and natural Shenzhen soft clay. The test results show that the average values of SSA obtained by MIP are 0.78m2/g, 11.31m2/g, 57.28m2/g and 27.15m2/g respectively for very fine-grained quartz, kaolin, bentonite and natural Shenzhen soft clay, and that it is feasible to apply MIP to obtain the SSA of fine-grained soils through statistical analysis of 97 samples. Through discussion, it is necessary to consider the state of fine-grained soils such as pore ratio when the SSA of fine-grained soils is determined by MIP.

  3. BOREAS AFM-08 ECMWF Hourly Surface and Upper Air Data for the SSA and NSA

    Science.gov (United States)

    Viterbo, Pedro; Betts, Alan; Hall, Forrest G. (Editor); Newcomer, Jeffrey A.; Smith, David E. (Technical Monitor)

    2000-01-01

    The Boreal Ecosystem-Atmosphere Study (BOREAS) Airborne Fluxes and Meteorology (AFM)-8 team focused on modeling efforts to improve the understanding of the diurnal evolution of the convective boundary layer over the boreal forest. This data set contains hourly data from the European Center for for Medium-Range Weather Forecasts (ECMWF) operational model from below the surface to the top of the atmosphere, including the model fluxes at the surface. Spatially, the data cover a pair of the points that enclose the rawinsonde sites at Candle Lake, Saskatchewan, in the Southern Study Area (SSA) and Thompson, Manitoba, in the Northern Study Area (NSA). Temporally, the data include the two time periods of 13 May 1994 to 30 Sept 1994 and 01 Mar 1996 to 31 Mar 1997. The data are stored in tabular ASCII files. The number of records in the upper air data files may exceed 20,000, causing a problem for some software packages. The ECMWF hourly surface and upper air data are available from the Earth Observing System Data and Information System (EOSDIS) Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC). The data files are available on a CD-ROM (see document number 20010000884).

  4. A template-free solvent-mediated synthesis of high surface area boron nitride nanosheets for aerobic oxidative desulfurization.

    Science.gov (United States)

    Wu, Peiwen; Zhu, Wenshuai; Chao, Yanhong; Zhang, Jinshui; Zhang, Pengfei; Zhu, Huiyuan; Li, Changfeng; Chen, Zhigang; Li, Huaming; Dai, Sheng

    2016-01-04

    Hexagonal boron nitride nanosheets (h-BNNs) with rather high specific surface area (SSA) are important two-dimensional layer-structured materials. Here, a solvent-mediated synthesis of h-BNNs revealed a template-free lattice plane control strategy that induced high SSA nanoporous structured h-BNNs with outstanding aerobic oxidative desulfurization performance.

  5. Robot Towed Shortwave Infrared Camera for Specific Surface Area Retrieval of Surface Snow

    Science.gov (United States)

    Elliott, J.; Lines, A.; Ray, L.; Albert, M. R.

    2017-12-01

    Optical grain size and specific surface area are key parameters for measuring the atmospheric interactions of snow, as well as tracking metamorphosis and allowing for the ground truthing of remote sensing data. We describe a device using a shortwave infrared camera with changeable optical bandpass filters (centered at 1300 nm and 1550 nm) that can be used to quickly measure the average SSA over an area of 0.25 m^2. The device and method are compared with calculations made from measurements taken with a field spectral radiometer. The instrument is designed to be towed by a small autonomous ground vehicle, and therefore rides above the snow surface on ultra high molecular weight polyethylene (UHMW) skis.

  6. Synthesis and crystal structures of a novel layered silicate SSA-1 and its microporous derivatives by topotactic transformation.

    Science.gov (United States)

    Takahashi, S; Kurita, Y; Ikeda, T; Miyamoto, M; Uemiya, S; Oumi, Y

    2016-10-18

    The synthesis of a novel layered silicate SSA-1 (SSA: silicate synthesized with a quaternary amine) was achieved in the SiO 2 -H 2 O-TEAOH (TEAOH: tetraethylammonium hydroxide - as an organic structural directing agent) system. The crystal structure of SSA-1 involved two silicate layers composed of bre [10T]-type CBU (Composite Building Unit) and TEAOH in interlayers. The topotactic transformation of SSA-1 by calcination was examined, resulting in a porous material (PML-1: porous material transformed from a layered silicate) with a 108 m 2 g -1 BET surface area and 0.035 cm 3 g -1 pore volume. PML-1 is a siliceous microporous material with silanols in the framework and possesses unique properties, such as hydrophilicity, in spite of all its silica composition. The most reasonable crystal structure of PML-1 was successfully determined on the basis of the crystal structure of SSA-1 by a combination of manual modelling, PXRD pattern simulation, DFT optimization and Rietveld analysis. Additionally, an interlayer expanded siliceous zeolite SSA-1 (IEZ-SSA-1) was also successfully prepared by silylation using trichloro(methyl)silane under acidic conditions. IEZ-SSA-1 showed hydrophilicity or hydrophobicity properties by changing the functional group of the pillar part in the interlayer. Additionally, IEZ-SSA-1 showed a large gas adsorption property (537 m 2 g -1 and 0.21 cm 3 g -1 ).

  7. Variation of solubility, biokinetics and dose coefficient of industrial uranium oxides according to the specific surface area

    International Nuclear Information System (INIS)

    Chazel, V.; Houpert, P.; Ansorbolo, E.; Henge-Napoli, M.H.; Paquet, F.

    2000-01-01

    The in vitro solubility, absorption to blood, lung retention and dose coefficient of industrial UO 2 samples were studied as a function of the specific surface area (SSA) of the particles. An in vitro study has been carried out on two samples of industrial UO 4 to compare the results with those obtained with UO 2 . Ten UO 2 samples supplied by different fuel factories or research laboratories, presented specific surface areas from 1.00 to 4.45 m 2 .g -1 . The wide range of values of SSA was due to the different conditions of fabrication. Dissolution tests in cell culture medium made on these ten samples have shown that the solubility increased 2.5-fold when the SSA increased 1.7-fold. The same tendency has been found for UO 4 , a soluble compound, and for U 3 O 8 , a moderately soluble compound. Four in vivo experiments carried out on rats by intratracheal instillation of dust suspensions of UO 2 , have highlighted the decrease in lung retention and the increase of absorption to blood with the SSA. The experimental absorption parameters calculated from the in vivo data allowed specific dose coefficients to be obtained which decreased from 6.6 to 4.3 μSv.Bq -1 when the SSA increased from 1.60 to 3.08 m 2 .g -1 . Thus, the medical monitoring of workers at the workplace has to take into account any change in the fabrication process of the uranium compound which can affect the physiochemical properties and consequently the dose coefficient. (author)

  8. Dynamic characterisation of the specific surface area for fracture networks

    Science.gov (United States)

    Cvetkovic, V.

    2017-12-01

    One important application of chemical transport is geological disposal of high-level nuclear waste for which crystalline rock is a prime candidate for instance in Scandinavia. Interconnected heterogeneous fractures of sparsely fractured rock such as granite, act as conduits for transport of dissolved tracers. Fluid flow is known to be highly channelized in such rocks. Channels imply narrow flow paths, adjacent to essentially stagnant water in the fracture and/or the rock matrix. Tracers are transported along channelised flow paths and retained by minerals and/or stagnant water, depending on their sorption properties; this mechanism is critical for rocks to act as a barrier and ultimately provide safety for a geological repository. The sorbing tracers are retained by diffusion and sorption on mineral surfaces, whereas non-sorbing tracers can be retained only by diffusion into stagnant water of fractures. The retention and transport properties of a sparsely fractured rock will primarily depend on the specific surface area (SSA) of the fracture network which is determined by the heterogeneous structure and flow. The main challenge when characterising SSA on the field-scale is its dependence on the flow dynamics. We first define SSA as a physical quantity and clarify its importance for chemical transport. A methodology for dynamic characterisation of SSA in fracture networks is proposed that relies on three sets of data: i) Flow rate data as obtained by a flow logging procedure; ii) transmissivity data as obtained by pumping tests; iii) fracture network data as obtained from outcrop and geophysical observations. The proposed methodology utilises these data directly as well as indirectly through flow and particle tracking simulations in three-dimensional discrete fracture networks. The methodology is exemplified using specific data from the Swedish site Laxemar. The potential impact of uncertainties is of particular significance and is illustrated for radionuclide

  9. The colour potentials of SSA-containing mortar

    DEFF Research Database (Denmark)

    Kappel, Annemette; Ottosen, Lisbeth M.; Kirkelund, Gunvor Marie

    2015-01-01

    This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA is with a......This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA...

  10. Arctic Region Space Weather Customers and SSA Services

    DEFF Research Database (Denmark)

    Høeg, Per; Kauristi, Kirsti; Wintoft, Peter

    Arctic inhabitants, authorities, and companies rely strongly on precise localization information and communication covering vast areas with low infrastructure and population density. Thus modern technology is crucial for establishing knowledge that can lead to growth in the region. At the same time...... and communication can be established without errors resulting from Space Weather effects. An ESA project have identified and clarified, how the products of the four ESA Space Weather Expert Service Centres (SWE) in the ESA Space Situational Awareness Programme (SSA), can contribute to the requirements of SSA...

  11. LITERATURE REVIEW OF PUO2 CALCINATION TIME AND TEMPERATURE DATA FOR SPECIFIC SURFACE AREA

    Energy Technology Data Exchange (ETDEWEB)

    Daniel, G.

    2012-03-06

    The literature has been reviewed in December 2011 for calcination data of plutonium oxide (PuO{sub 2}) from plutonium oxalate Pu(C{sub 2}O{sub 4}){sub 2} precipitation with respect to the PuO{sub 2} specific surface area (SSA). A summary of the literature is presented for what are believed to be the dominant factors influencing SSA, the calcination temperature and time. The PuO{sub 2} from Pu(C{sub 2}O{sub 4}){sub 2} calcination data from this review has been regressed to better understand the influence of calcination temperature and time on SSA. Based on this literature review data set, calcination temperature has a bigger impact on SSA versus time. However, there is still some variance in this data set that may be reflecting differences in the plutonium oxalate preparation or different calcination techniques. It is evident from this review that additional calcination temperature and time data for PuO{sub 2} from Pu(C{sub 2}O{sub 4}){sub 2} needs to be collected and evaluated to better define the relationship. The existing data set has a lot of calcination times that are about 2 hours and therefore may be underestimating the impact of heating time on SSA. SRNL recommends that more calcination temperature and time data for PuO{sub 2} from Pu(C{sub 2}O{sub 4}){sub 2} be collected and this literature review data set be augmented to better refine the relationship between PuO{sub 2} SSA and its calcination parameters.

  12. BOREAS TF-06 SSA-YA Surface Energy Flux and Meteorological Data

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: Contains meteorology data collected at the SSA-YA tower flux site by the TF6 group. These data were reported at 10 minute intervals. The flux and ancillary...

  13. Structure, specific surface area and thermal conductivity of the snowpack around Barrow, Alaska

    Science.gov (United States)

    Domine, Florent; Gallet, Jean-Charles; Bock, Josué; Morin, Samuel

    2012-07-01

    The structure of the snowpack near Barrow was studied in March-April 2009. Vertical profiles of density, specific surface area (SSA) and thermal conductivity were measured on tundra, lakes and landfast ice. The average thickness was 41 cm on tundra and 21 cm on fast ice. Layers observed were diamond dust or recent wind drifts on top, overlaying wind slabs, occasional faceted crystals and melt-freeze crusts, and basal depth hoar layers. The top layer had a SSA between 45 and 224 m2 kg-1. All layers at Barrow had SSAs higher than at many other places because of the geographical and climatic characteristics of Barrow. In particular, a given snow layer was remobilized several times by frequent winds, which resulted in SSA increases each time. The average snow area index (SAI, the dimensionless vertically integrated SSA) on tundra was 3260, higher than in the Canadian High Arctic or in the Alaskan taiga. This high SAI, combined with low snow temperatures, imply that the Barrow snowpack efficiently traps persistent organic pollutants, as illustrated with simple calculations for PCB 28 and PCB 180. The average thermal conductivity was 0.21 Wm-1 K-1, and the average thermal resistance on tundra was 3.25 m2 K W-1. This low value partly explains why the snow-ground interface was cold, around -19°C. The high SAI and low thermal resistance values illustrate the interplay between climate, snow physical properties, and their potential impact on atmospheric chemistry, and the need to describe these relationships in models of polar climate and atmospheric chemistry, especially in a climate change context.

  14. Preliminary approach of the MELiSSA loop energy balance

    Science.gov (United States)

    Poulet, Lucie; Lamaze, Brigitte; Lebrun, Jean

    Long duration missions, such as the establishment of permanent bases on the lunar surface or the travel to Mars, require a huge amount of life support consumables (e.g. food, water and oxygen). Current rockets are at the moment unable to launch such a mass from Earth. Consequently Regenerative Life Support Systems are necessary to sustain long-term manned space mission to increase recycling rates and so reduce the launched mass. Thus the European and Canadian research has been concentrating on the MELiSSA (Micro-Ecological Life Support System Alternative) project over the last 20 years. MELiSSA is an Environmental Controlled Life Support System (ECLSS), i.e. a closed regenerative loop inspired of a lake ecosystem. Using light as a source of energy, MELiSSA's goal is the recovery of food, water and oxygen from CO2 and organic wastes, using microorganisms and higher plants. The architecture of a ECLSS depends widely on the mission scenario. To compare several ECLSS architectures and in order to be able to evaluate them, ESA is developing a multi criteria evaluation tool: ALISSE (Advanced LIfe Support System Evaluator). One of these criteria is the energy needed to operate the ECLSS. Unlike other criteria like the physical mass, the energy criterion has not been investigated yet and needs hence a detailed analysis. It will consequently be the focus of this study. The main objective of the work presented here is to develop a dynamic tool able to estimate the energy balance for several configurations of the MELiSSA loop. The first step consists in establishing the energy balance using concrete figures from the MELiSSA Pilot Plant (MPP). This facility located at the Universitat Autonoma de Barcelona (UAB) is aimed at the ground demonstration of the MELiSSA loop. The MELiSSA loop is structured on several subsystems; each of them is characterized by supplies, exhausts and process reactions. For the purpose of this study (i.e. a generic tool) the solver EES (Engineering

  15. Ultraviolet radiation (UVR) induces cell-surface Ro/SSA antigen expression by human keratinocytes in vitro: a possible mechanism for the UVR induction of cutaneous lupus lesions

    International Nuclear Information System (INIS)

    Jones, S.K.

    1992-01-01

    Antinuclear antibodies are useful markers of connective tissue disease. In this study, UVB but not UVA induced the expression of Ro/SSA antigen on keratinocyte surfaces in vitro. This expression was also found with the extractable nuclear antigens RnP and Sm, but not with single or double-stranded DNA. The expression was prevented by blocking protein synthesis, suggesting that it was an active process. The results suggest that UVB exposure may result in the expression of Ro/SSA antigen on the surfaces of basal keratinocytes in vivo. This antigen could then bind circulating antibody leading to the cutaneous lesions in neonatal and subacute cutaneous lupus erythematosus. (Author)

  16. Dicty_cDB: SSA423 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA423 (Link to dictyBase) - - - - SSA423F (Link to Original s...ite) SSA423F 443 - - - - - - Show SSA423 Library SS (Link to library) Clone ID SSA423 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...FIIGFFLCLTVFLTFVNSSEIDHQYSLTSSINGSSSGVSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIA...VSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIAAGGAFLIIVFFFI CLCCCCCRRKKDKHYHNIQDDET

  17. Brandon mathematical model describing the effect of calcination and reduction parameters on specific surface area of UO{sub 2} powders

    Energy Technology Data Exchange (ETDEWEB)

    Hung, Nguyen Trong; Thuan, Le Ba [Institute for Technology of Radioactive and Rare Elements (ITRRE), 48 Lang Ha, Dong Da, Ha Noi (Viet Nam); Van Khoai, Do [Micro-Emission Ltd., 1-1 Asahidai, Nomi, Ishikawa, 923-1211 (Japan); Lee, Jin-Young, E-mail: jinlee@kigam.re.kr [Convergence Research Center for Development of Mineral Resources (DMR), Korea Institute of Geoscience and Mineral Resources (KIGAM), Daejeon, 305-350 (Korea, Republic of); Jyothi, Rajesh Kumar, E-mail: rkumarphd@kigam.re.kr [Convergence Research Center for Development of Mineral Resources (DMR), Korea Institute of Geoscience and Mineral Resources (KIGAM), Daejeon, 305-350 (Korea, Republic of)

    2016-06-15

    Uranium dioxide (UO{sub 2}) powder has been widely used to prepare fuel pellets for commercial light water nuclear reactors. Among typical characteristics of the powder, specific surface area (SSA) is one of the most important parameter that determines the sintering ability of UO{sub 2} powder. This paper built up a mathematical model describing the effect of the fabrication parameters on SSA of UO{sub 2} powders. To the best of our knowledge, the Brandon model is used for the first time to describe the relationship between the essential fabrication parameters [reduction temperature (T{sub R}), calcination temperature (T{sub C}), calcination time (t{sub C}) and reduction time (t{sub R})] and SSA of the obtained UO{sub 2} powder product. The proposed model was tested with Wilcoxon's rank sum test, showing a good agreement with the experimental parameters. The proposed model can be used to predict and control the SSA of UO{sub 2} powder.

  18. Dicty_cDB: SSA581 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA581 (Link to dictyBase) - - - Contig-U12576-1 SSA581Z (Link... to Original site) - - SSA581Z 504 - - - - Show SSA581 Library SS (Link to library) Clone ID SSA581 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dict...SARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT DEDI...QHASARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT D

  19. The Case for GEO Hosted SSA Payloads

    Science.gov (United States)

    Welsch, C.; Armand, B.; Repp, M.; Robinson, A.

    2014-09-01

    Space situational awareness (SSA) in the geosynchronous earth orbit (GEO) belt presents unique challenges, and given the national importance and high value of GEO satellites, is increasingly critical as space becomes more congested and contested. Space situational awareness capabilities can serve as an effective deterrent against potential adversaries if they provide accurate, timely, and persistent information and are resilient to the threat environment. This paper will demonstrate how simple optical SSA payloads hosted on GEO commercial and government satellites can complement the SSA mission and data provided by Space-Based Space Surveillance (SBSS) and the Geosynchronous Space Situational Awareness Program (GSSAP). GSSAP is built by Orbital Sciences Corporation and launched on July 28, 2014. Analysis performed for this paper will show how GEO hosted SSA payloads, working in combination with SBSS and GSSAP, can increase persistence and timely coverage of high value assets in the GEO belt. The potential to further increase GEO object identification and tracking accuracy by integrating SSA data from multiple sources across different viewing angles including GEO hosted SSA sources will be addressed. Hosting SSA payloads on GEO platforms also increases SSA mission architecture resiliency as the sensors are by distributed across multiple platforms including commercial platforms. This distributed architecture presents a challenging target for an adversary to attempt to degrade or disable. We will present a viable concept of operations to show how data from hosted SSA sensors could be integrated with SBSS and GSSAP data to present a comprehensive and more accurate data set to users. Lastly, we will present an acquisition approach using commercial practices and building on lessons learned from the Commercially Hosted Infra Red Payload CHIRP to demonstrate the affordability of GEO hosted SSA payloads.

  20. Dicty_cDB: SSA564 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA564 (Link to dictyBase) - - - - SSA564F (Link to Original s...ite) SSA564F 653 - - - - - - Show SSA564 Library SS (Link to library) Clone ID SSA564 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...NNTLKPKQTTKGFNIGGQPGNPTN*l--- Frame C: tlkfvmplvmkictslvlvlkrstk*rklfmmenshqtldgl...bits) Value N M77492 |M77492.1 Dictyostelium discoideum glycoprotein phosphorylase 2 (glpD) gene, complete c

  1. Delivering SSA Capabilities to the Warfighter

    Science.gov (United States)

    van Weezendonk, J.; Sherk, J.; Ryan, T.; McGuire, R.

    The Space Superiority Systems Wing at the Space and Missile Center (SMC/SY) equips US forces with Offensive Counterspace (OCS), Defensive Counterspace (DCS), and Space Situation Awareness (SSA) systems that further enhance space superiority. The Technology Division (SYT) mission is to identify, develop, and transition cutting-edge technologies to the warfighter. SYT invests in the most relevant technologies for SSA, DCS and OCS that enhance SMC/SY's portfolio. This presentation will provide an overview of the SMC/SY SSA Technology being worked and highlights several key programs. The presentation will also highlight how the SMC/SY SSA efforts fit into to a Space Superiority Architecture. SYT executes its own Space Control Technology program line and leverages technologies from various DoD and national laboratories, Federally Funded Research and Development Companies, national agencies, industry and academia to accomplish their mission. The portions of the SY FY06 SSA portfolio that will be discussed are: Precision Metrics, Star Sensor Studies, Multi-mission Deployable Optical System, Intelligent Agent Data Fusion efforts, ESSA ACTD and the GReAT tech demo.

  2. Surface speciation and interactions between adsorbed chloride and water on cerium dioxide

    Science.gov (United States)

    Sutherland-Harper, Sophie; Taylor, Robin; Hobbs, Jeff; Pimblott, Simon; Pattrick, Richard; Sarsfield, Mark; Denecke, Melissa; Livens, Francis; Kaltsoyannis, Nikolas; Arey, Bruce; Kovarik, Libor; Engelhard, Mark; Waters, John; Pearce, Carolyn

    2018-06-01

    Ceria particles with different specific surface areas (SSA) were contaminated with chloride and water, then heat treated at 500 and 900 °C to investigate sorption behaviour of these species on metal oxides. Results from x-ray photoelectron spectroscopy and infrared spectroscopy showed chloride and water adsorption onto particles increased with surface area and that these species were mostly removed on heat treatment (from 6.3 to 0.8 at% Cl- on high SSA and from 1.4 to 0.4 at% on low SSA particles). X-ray diffraction revealed that chloride was not incorporated into the bulk ceria structure, but crystal size increased upon contamination. Ce LIII-edge x-ray absorption spectroscopy confirmed that chloride was not present in the first co-ordination sphere around Ce(IV) ions, so was not bonded to Ce as chloride in the bulk structure. Sintering of contaminated high SSA particles occurred with heat treatment at 900 °C, and they resembled low SSA particles synthesised at this temperature. Physical chloride-particle interactions were investigated using electron microscopy and energy dispersive x-ray analysis, showing that chloride was homogeneously distributed on ceria and that reduction of porosity did not trap surface-sorbed chloride inside the particles as surface area was reduced during sintering. This has implications for stabilisation of chloride-contaminated PuO2 for long term storage.

  3. 77 FR 38880 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Railroad Retirement Board (SSA...

    Science.gov (United States)

    2012-06-29

    ... Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program that... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0002] Privacy Act of 1974, as Amended...

  4. Sessile serrated adenoma (SSA) vs. traditional serrated adenoma (TSA).

    Science.gov (United States)

    Torlakovic, Emina Emilia; Gomez, Jose D; Driman, David K; Parfitt, Jeremy R; Wang, Chang; Benerjee, Tama; Snover, Dale C

    2008-01-01

    The morphologic distinction between various serrated polyps of the colorectum may be challenging. The distinction between sessile serrated adenoma (SSA) and traditional serrated adenoma (TSA) may be difficult using currently available criteria mostly based on cytologic characteristics. We have evaluated 66 serrated polyps including 29 SSA, 18 TSA, and 19 hyperplastic polyps for overall shape of the polyps, architectural features of individual crypts, the presence of eosinophilic cytoplasm, size and distribution of the proliferation and maturation zones, as well as Ki-67 and CK20 expression. The extent of the expression of CK20 and Ki-67 could not distinguish between the 3 types of serrated polyps, but the distribution of their expression was very helpful and differences were statistically significant. The distribution of Ki-67+ cells was the single most helpful distinguishing feature of the serrated polyp type (PTSA had low Ki-67 expression, which was limited to "ectopic crypts" and admixed tubular adenomalike areas. In serrated polyps, ectopic crypt formation (ECF) defined by the presence of ectopic crypts with their bases not seated adjacent to the muscularis mucosae was nearly exclusive to TSA and was found in all cases, while the presence of cytologic atypia and eosinophilia of the cytoplasm were characteristic, but not limited to TSA. No evidence of ECF, but nevertheless abnormal distribution of proliferation zone was characteristic of SSA, whereas HP had neither. The presence of the ECF defines TSA in a more rigorous fashion than previous diagnostic criteria and also explains the biologic basis of exuberant protuberant growth associated with TSA and the lack of such growth in SSA. Recognition of this phenomenon may also help in exploring the genetic and molecular basis for differences between SSA and TSA, because these architectural abnormalities may well be a reflection of abnormalities in genetically programmed mucosal development.

  5. Hydraulic and mechanical behavior of landfill clay liner containing SSA in contact with leachate.

    Science.gov (United States)

    Zhang, Qian; Lu, Haijun; Liu, Junzhu; Wang, Weiwei; Zhang, Xiong

    2018-05-01

    Sewage sludge ash (SSA) produced by municipal sludge can be used as a modified additive for clay liner, and improves the working performance of landfill clay liner in contact with leachate. Under the action of landfill leachate, the permeability, shear strength, phase composition, and pore structure of the modified clay are investigated through the flexible wall permeability test, triaxial shear test, thermal gravimetric and differential thermal analysis, and low-temperature nitrogen adsorption test, respectively. The hydraulic conductivity of the modified clay containing 0-5% SSA is in the range of 3.94 × 10 -8 -1.16 × 10 -7  cm/s, and the pollutant concentration of the sample without SSA was higher than others. The shear strength of the modified clay is more than that of the traditional clay liner, the cohesion rate of modified clay increases from 32.5 to 199.91 kPa, and the internal friction angle decreases from 32.5° to 15.6°. Furthermore, the weight loss rates of the samples are 15.69%, 17.92%, 18.06%, and 20.68%, respectively, when the SSA content increases from 0% to 5%. The total pore volume and average pore diameter of the modified clay decrease with the increase in the SSA content, respectively. However, the specific area of the modified clay increases with the increase in the SSA content.

  6. SSA Disability Claim Data

    Data.gov (United States)

    Social Security Administration — The dataset includes fiscal year data for initial claims for SSA disability benefits that were referred to a state agency for a disability determination. Specific...

  7. The Aesthetical quality of SSA-containing mortar and concrete

    DEFF Research Database (Denmark)

    Kappel, Annemette; Kirkelund, Gunvor Marie; Ottosen, Lisbeth M.

    2014-01-01

    that gives a characteristic red colour. The process of grinding SSA has shown to improve the compressive strength of SSA- containing mortar (Donatello et al. 2010). Thus, in this study SSA was grinded in 6 different intervals ranging from 0 – 10 min, and then added to the mortar mix replacing 20% of cement....... The experiment revealed that the colour of the SSA-containing mortar intensified as the time interval of the grinding process increased. Each of the 6 steps within the time interval provided an additional colour tone and generated a colour scale consisting of mortar samples ranging from greyish to a more...

  8. Rapid assessment of populations trends of invasive species: Singular Spectrum Analysis (SSA

    Directory of Open Access Journals (Sweden)

    DANA, ED

    2010-01-01

    Full Text Available Singular Spectrum Analysis (SSA is a powerful analytical approach for biodi-versity management. Its main advan-tages are due to its intuitive processing and visualization, since mathematical workflow is conceptually similar to the widely accepted Principal Components Analysis. Detailed analyses of popula-tion trends with mathematical tools are often difficult to achieve for managers by a number of reasons (large numbers or areas monitored, large number of species, insufficient statistics skills, strong knowledge level in demographic analyses, etc.. SSA has been used since the 1970’s in signal processing to clarify signal vs. noisy information, but it has also been used in climate change analy-sis and other developmental areas. Be-sides, SSA is a rapid-learning method for technicians and managers with medium level of mathematical knowledge. Free software in Unix environment is avail-able. Unfortunately, no free and friendly software is available for Win-dows SO. Although R package may offer solutions for really advanced users, it does not fit real work situations for managers of biological invasions. Cater-pillar (Gistat Group, Ltd is by now, the best option found by the author in terms of price, facility for results inter-pretation and time consumed in learn-ing. The main disadvantage is the poor content of tutorial files

  9. Porous 3D graphene-based bulk materials with exceptional high surface area and excellent conductivity for supercapacitors

    Science.gov (United States)

    Zhang, Long; Zhang, Fan; Yang, Xi; Long, Guankui; Wu, Yingpeng; Zhang, Tengfei; Leng, Kai; Huang, Yi; Ma, Yanfeng; Yu, Ao; Chen, Yongsheng

    2013-01-01

    Until now, few sp2 carbon materials simultaneously exhibit superior performance for specific surface area (SSA) and electrical conductivity at bulk state. Thus, it is extremely important to make such materials at bulk scale with those two outstanding properties combined together. Here, we present a simple and green but very efficient approach using two standard and simple industry steps to make such three-dimensional graphene-based porous materials at the bulk scale, with ultrahigh SSA (3523 m2/g) and excellent bulk conductivity. We conclude that these materials consist of mainly defected/wrinkled single layer graphene sheets in the dimensional size of a few nanometers, with at least some covalent bond between each other. The outstanding properties of these materials are demonstrated by their superior supercapacitor performance in ionic liquid with specific capacitance and energy density of 231 F/g and 98 Wh/kg, respectively, so far the best reported capacitance performance for all bulk carbon materials. PMID:23474952

  10. The organic fraction of bubble-generated, accumulation mode Sea Spray Aerosol (SSA

    Directory of Open Access Journals (Sweden)

    R. L. Modini

    2010-03-01

    Full Text Available Recent studies have detected a dominant accumulation mode (~100 nm in the Sea Spray Aerosol (SSA number distribution. There is evidence to suggest that particles in this mode are composed primarily of organics. To investigate this hypothesis we conducted experiments on NaCl, artificial SSA and natural SSA particles with a Volatility-Hygroscopicity-Tandem-Differential-Mobility-Analyser (VH-TDMA. NaCl particles were atomiser generated and a bubble generator was constructed to produce artificial and natural SSA particles. Natural seawater samples for use in the bubble generator were collected from biologically active, terrestrially-affected coastal water in Moreton Bay, Australia. Differences in the VH-TDMA-measured volatility curves of artificial and natural SSA particles were used to investigate and quantify the organic fraction of natural SSA particles. Hygroscopic Growth Factor (HGF data, also obtained by the VH-TDMA, were used to confirm the conclusions drawn from the volatility data. Both datasets indicated that the organic fraction of our natural SSA particles evaporated in the VH-TDMA over the temperature range 170–200 °C. The organic volume fraction for 71–77 nm natural SSA particles was 8±6%. Organic volume fraction did not vary significantly with varying water residence time (40 s to 24 h in the bubble generator or SSA particle diameter in the range 38–173 nm. At room temperature we measured shape- and Kelvin-corrected HGF at 90% RH of 2.46±0.02 for NaCl, 2.35±0.02 for artifical SSA and 2.26±0.02 for natural SSA particles. Overall, these results suggest that the natural accumulation mode SSA particles produced in these experiments contained only a minor organic fraction, which had little effect on hygroscopic growth. Our measurement of 8±6% is an order of magnitude below two previous measurements of the organic fraction in SSA particles of comparable sizes. We stress that our results were obtained using coastal seawater and

  11. Evaluating Options for Civil Space Situational Awareness (SSA)

    Science.gov (United States)

    Lal, B.; Carioscia, S. A.

    In recent years, the number of active satellites and human-made orbital space debris has increased dramatically. An expansion of activities in space, as is currently being proposed by many commercial and international entities, is expected to further exacerbate this challenge. The 18th Space Control Squadron under the Department of Defense (DOD) United States Strategic Command provides space situational awareness (SSA) services to users outside the national security community at no cost. International and commercial users demand better SSA service than is currently feasible, and the demand comes at a time when DOD is under pressure to better prepare for and respond to growing space-based threats to national security. Concerned about the possibility of overextending across conflicting missions in a fiscally constrained environment, some DOD officials have publicly noted a desire to move SSA services not related to national security out of DOD purview. Responding to a request from the Federal Aviation Administration (FAA) Office of Commercial Space Transportation (AST), researchers at the Science and Technology Policy Institute (STPI) identified and evaluated potential approaches for providing SSA services for civil and commercial operations in space. In this paper, we summarize the report [1] and present the pros and cons of four approaches to the provision of civil SSA services in the United States: (1) maintaining status quo through continued provision by DOD; (2) provision by a civil government entity; (3) industry self-provision; and (4) provision by an international organization. Within the second approach, assuming the provision of SSA by a civil agency, STPI further identified and discussed four options: (1) civil agency service capability embedded within DOD; (2) independent civil service capability, using DOD software and systems; (3) independent civil service capability, using commercial software and systems; and (4) the government certifies non

  12. 76 FR 41685 - Electronic Substitutions for Form SSA-538

    Science.gov (United States)

    2011-07-15

    ... visit our Internet site, Social Security Online, at http://www.socialsecurity.gov . SUPPLEMENTARY... SOCIAL SECURITY ADMINISTRATION 20 CFR Part 416 [Docket No. SSA-2009-0027] RIN 0960-AH02 Electronic Substitutions for Form SSA-538 AGENCY: Social Security Administration. ACTION: Final rule with request for...

  13. SURFACE PROPERTIES AND CATALYTIC PERFORMANCE OF Pt ...

    African Journals Online (AJOL)

    various temperatures of precipitates obtained from aqueous solutions in the ... The oxidation reactivity of VOCs is in the following order: alcohols > aldheydes > aromatics ... Specific surface areas (SSA) were calculated by the BET method from ...

  14. SSA State Agency Workload Data

    Data.gov (United States)

    Social Security Administration — The dataset is revised and expanded from 4 to 71 data fields. It includes monthly data from October 2000 onwards for SSA disability cases that were referred to the...

  15. GillespieSSA: Implementing the Gillespie Stochastic Simulation Algorithm in R

    Directory of Open Access Journals (Sweden)

    Mario Pineda-Krch

    2008-02-01

    Full Text Available The deterministic dynamics of populations in continuous time are traditionally described using coupled, first-order ordinary differential equations. While this approach is accurate for large systems, it is often inadequate for small systems where key species may be present in small numbers or where key reactions occur at a low rate. The Gillespie stochastic simulation algorithm (SSA is a procedure for generating time-evolution trajectories of finite populations in continuous time and has become the standard algorithm for these types of stochastic models. This article presents a simple-to-use and flexible framework for implementing the SSA using the high-level statistical computing language R and the package GillespieSSA. Using three ecological models as examples (logistic growth, Rosenzweig-MacArthur predator-prey model, and Kermack-McKendrick SIRS metapopulation model, this paper shows how a deterministic model can be formulated as a finite-population stochastic model within the framework of SSA theory and how it can be implemented in R. Simulations of the stochastic models are performed using four different SSA Monte Carlo methods: one exact method (Gillespie's direct method; and three approximate methods (explicit, binomial, and optimized tau-leap methods. Comparison of simulation results confirms that while the time-evolution trajectories obtained from the different SSA methods are indistinguishable, the approximate methods are up to four orders of magnitude faster than the exact methods.

  16. Effects of synthesis conditions on structure and surface properties of SmMn{sub 2}O{sub 5} mullite-type oxide

    Energy Technology Data Exchange (ETDEWEB)

    Thampy, Sampreetha; Ibarra, Venessa; Lee, Yun-Ju [Department of Materials Science and Engineering, University of Texas at Dallas, Richardson, TX 75080 (United States); McCool, Geoffrey [Nanostellar Inc., 3696 Haven Avenue, Redwood City, CA 94063 (United States); Cho, Kyeongjae [Department of Materials Science and Engineering, University of Texas at Dallas, Richardson, TX 75080 (United States); Hsu, Julia W.P., E-mail: jwhsu@utdallas.edu [Department of Materials Science and Engineering, University of Texas at Dallas, Richardson, TX 75080 (United States)

    2016-11-01

    Highlights: • Investigate the effects of calcination temperature and precipitation pH on crystallinity, phase purity, particle size, surface composition, and NO adsorption capacity of SmMn{sub 2}O{sub 5}. • High calcination temperature increases mullite phase purity but decreases specific surface area (SSA). • Mullite phase purity is independent of pH while SSA monotonically increases. • SSA and surface Mn/Sm ratio determine NO uptake. - Abstract: A mixed-phase compound that contains SmMn{sub 2}O{sub 5} mullite-type oxides has been reported to display excellent catalytic activity for nitric oxide (NO) oxidation. Here we investigate the effects of calcination temperature and precipitation pH on structural, physical, chemical, and surface properties of SmMn{sub 2}O{sub 5}. As the calcination temperature increases from 750 °C to 1000 °C, mullite phase purity increases from 74% to 100%, while specific surface area (SSA) decreases from 23.6 m{sup 2}/g to 5.1 m{sup 2}/g with particle size increases correspondingly. Mullite phase purity (87%) is independent of pH between 8.5–10.4, whereas SSA monotonically increases from 12.5 m{sup 2}/g at pH 8.1 to 27.4 m{sup 2}/g at pH 13. X-ray photoelectron spectroscopy (XPS) studies reveal that the surface Mn/Sm ratio is similar to the bulk value and is unaffected by calcination temperature and pH values up to 10.4, whereas sample precipitated at pH 13 is surface-rich in Sm. NO chemisorption studies show that the SSA and surface Mn/Sm ratio determine NO uptake by SmMn{sub 2}O{sub 5} mullite oxides.

  17. A New Trend-Following Indicator: Using SSA to Design Trading Rules

    Science.gov (United States)

    Leles, Michel Carlo Rodrigues; Mozelli, Leonardo Amaral; Guimarães, Homero Nogueira

    Singular Spectrum Analysis (SSA) is a non-parametric approach that can be used to decompose a time-series as trends, oscillations and noise. Trend-following strategies rely on the principle that financial markets move in trends for an extended period of time. Moving Averages (MAs) are the standard indicator to design such strategies. In this study, SSA is used as an alternative method to enhance trend resolution in comparison with the traditional MA. New trading rules using SSA as indicator are proposed. This paper shows that for the Down Jones Industrial Average (DJIA) and Shangai Securities Composite Index (SSCI) time-series the SSA trading rules provided, in general, better results in comparison to MA trading rules.

  18. Adequacy of the default values for skin surface area used for risk assessment and French anthropometric data by a probabilistic approach.

    Science.gov (United States)

    Dornic, N; Ficheux, A S; Bernard, A; Roudot, A C

    2017-08-01

    The notes of guidance for the testing of cosmetic ingredients and their safety evaluation by the Scientific Committee on Consumer Safety (SCCS) is a document dedicated to ensuring the safety of European consumers. This contains useful data for risk assessment such as default values for Skin Surface Area (SSA). A more in-depth study of anthropometric data across Europe reveals considerable variations. The default SSA value was derived from a study on the Dutch population, which is known to be one of the tallest nations in the World. This value could be inadequate for shorter populations of Europe. Data were collected in a survey on cosmetic consumption in France. Probabilistic treatment of these data and analysis of the case of methylisothiazolinone, a sensitizer recently evaluated by a deterministic approach submitted to SCCS, suggest that the default value for SSA used in the quantitative risk assessment might not be relevant for a significant share of the French female population. Others female populations of Southern Europe may also be excluded. This is of importance given that some studies show an increasing risk of developping skin sensitization among women. The disparities in anthropometric data across Europe should be taken into consideration. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Vector Topographic Map Data over the BOREAS NSA and SSA in SIF Format

    Science.gov (United States)

    Knapp, David; Nickeson, Jaime; Hall, Forrest G. (Editor)

    2000-01-01

    This data set contains vector contours and other features of individual topographic map sheets from the National Topographic Series (NTS). The map sheet files were received in Standard Interchange Format (SIF) and cover the BOReal Ecosystem-Atmosphere Study (BOREAS) Northern Study Area (NSA) and Southern Study Area (SSA) at scales of 1:50,000 and 1:250,000. The individual files are stored in compressed Unix tar archives.

  20. Preliminary study of the space adaptation of the MELiSSA life support system

    Science.gov (United States)

    Mas-Albaigès, Joan L.; Duatis, Jordi; Podhajsky, Sandra; Guirado, Víctor; Poughon, Laurent

    MELiSSA (Micro-Ecological Life Support System Alternative) is an European Space Agency (ESA) project focused on the development of a closed regenerative life support system to aid the development of technologies for future life support systems for long term manned planetary missions, e.g. a lunar base or missions to Mars. In order to understand the potential evolution of the MELiSSA concept towards its future use in the referred manned planetary mission context the MELiSSA Space Adaptation (MSA) activity has been undertaken. MSA's main objective is to model the different MELiSSA compartments using EcosimPro R , a specialized simulation tool for life support applications, in order to define a preliminary MELiSSA implementation for service in a man-tended lunar base scenario, with a four-member crew rotating in six-month increments, and performing the basic LSS functions of air revitalization, food production, and waste and water recycling. The MELiSSA EcosimPro R Model features a dedicated library for the different MELiSSA elements (bioreactors, greenhouse, crew, interconnecting elements, etc.). It is used to dimension the MELiSSA system in terms of major parameters like mass, volume and energy needs, evaluate the accuracy of the results and define the strategy for a progressive loop closure from the initial required performance (approx.100 The MELiSSA configuration(s) obtained through the EcosimPro R simulation are further analysed using the Advanced Life Support System Evaluation (ALISSE) metric, relying on mass, energy, efficiency, human risk, system reliability and crew time, for trade-off and optimization of results. The outcome of the MSA activity is, thus, a potential Life Support System architecture description, based on combined MELiSSA and other physico-chemical technologies, defining its expected performance, associated operational conditions and logistic needs.

  1. Clinical and Pathological Roles of Ro/SSA Autoantibody System

    Directory of Open Access Journals (Sweden)

    Ryusuke Yoshimi

    2012-01-01

    Full Text Available Anti-Ro/SSA antibodies are among the most frequently detected autoantibodies against extractable nuclear antigens and have been associated with systemic lupus erythematosus (SLE and Sjögren's syndrome (SS. Although the presence of these autoantibodies is one of the criteria for the diagnosis and classification of SS, they are also sometimes seen in other systemic autoimmune diseases. In the last few decades, the knowledge of the prevalence of anti-Ro/SSA antibodies in various autoimmune diseases and symptoms has been expanded, and the clinical importance of these antibodies is increasing. Nonetheless, the pathological role of the antibodies is still poorly understood. In this paper, we summarize the milestones of the anti-Ro/SSA autoantibody system and provide new insights into the association between the autoantibodies and the pathogenesis of autoimmune diseases.

  2. BOREAS TF-8 NSA-OJP and SSA-OBS Ceilometer Data

    Science.gov (United States)

    Moore, Kathleen E.; Hall, Forrest G. (Editor); Huemmrich, Karl (Editor); Fitzjarrald, David R.

    2000-01-01

    The BOREAS TF-8 team used ceilometers to collect data on the fraction of the sky covered with clouds and the cloud height. Included with these data is the surface-based lifting condensation level, derived from temperature and humidity values acquired at the flux tower at the NSA-OJP site. Ceilo-meter data were collected at the NSA-OJP site in 1994 and at the NSA-OJP and SSA-OBS sites in 1996. The data are available in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884).

  3. BOREAS RSS-7 Landsat TM LAI IMages of the SSA and NSA

    Science.gov (United States)

    Hall, Forrest G. (Editor); Nickeson, Jaime (Editor); Chen, Jing; Cihlar, Josef

    2000-01-01

    The BOReal Ecosystem-Atmosphere Study Remote Sensing Science (BOREAS RSS-7) team used Landsat Thematic Mapper (TM) images processed at CCRS to produce images of Leaf Area Index (LAI) for the BOREAS study areas. Two images acquired on 06-Jun and 09-Aug-1991 were used for the SSA, and one image acquired on 09-Jun-1994 was used for the NSA. The LAI images are based on ground measurements and Landsat TM Reduced Simple Ratio (RSR) images. The data are stored in binary image-format files.

  4. BOREAS HYP-8 DEM Data Over The NSA-MSA and SSA-MSA in The AEAC Projection

    Science.gov (United States)

    Knapp, David E.; Hall, Forrest G. (Editor); Wang, Xue-Wen; Band, L. E.; Smith, David E. (Technical Monitor)

    2000-01-01

    These data were derived from the original Digital Elevation Models (DEMs) produced by the Boreal Ecosystem-Atmosphere Study (BOREAS) Hydrology (HYD)-8 team. The original DEMs were in the Universal Transverse Mercator (UTM) projection, while this product is projected in the Albers Equal-Area Conic (AEAC) projection. The pixel size of the data is 100 meters, which is appropriate for the 1:50,000-scale contours from which the DEMs were made. The original data were compiled from information available in the 1970s and 1980s. This data set covers the two Modeling Sub-Areas (MSAs) that are contained within the Southern Study Area (SSA) and the Northern Study Area (NSA). The data are stored in binary, image format files. The DEM data over the NSA-MSA and SSA-MSA in the AEAC projection are available from the Earth Observing System Data and Information System (EOSDIS) Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC). The data files are available on a CD-ROM (see document number 20010000884).

  5. Evolution of ESA's SSA Conjunction Prediction Service

    Science.gov (United States)

    Escobar, D.; Sancho, A. Tirado, J.; Agueda, A.; Martin, L.; Luque, F.; Fletcher, E.; Navarro, V.

    2013-08-01

    This paper presents the recent evolution of ESA's SSA Conjunction Prediction Service (CPS) as a result of an on-going activity in the Space Surveillance and Tracking (SST) Segment of ESA's Space Situational Awareness (SSA) Programme. The CPS is one of a number of precursor services being developed as part of the SST segment. It has been implemented as a service to provide external users with web-based access to conjunction information and designed with a service-oriented architecture. The paper encompasses the following topics: service functionality enhancements, integration with a live objects catalogue, all vs. all analyses supporting an operational concept based on low and high fidelity screenings, and finally conjunction detection and probability algorithms.

  6. MELiSSA celebrates 25 years of research into life support

    International Nuclear Information System (INIS)

    2015-01-01

    MELiSSA (Micro-Ecological Life Support System Alternative) is a collaborative project with the European Space Agency ESA and various other scientific partners. The objective of MELiSSA is to develop a system that is able to provide manned space missions with food, drinking water and oxygen autonomously in space. Drinkable water and oxygen are currently being made in the international space station ISS by filtering waste water and by electrolysing water. However, such physiochemical technologies do not offer a solution for food. The MELiSSA project intends to reuse waste products, which include CO2, water, stools and urine from the astronauts, and even the perspiration moisture in the cabin and to transfer these into food through the use of micro-organisms.

  7. Theoretical White Dwarf Spectra on Demand: TheoSSA

    Science.gov (United States)

    Ringat, E.; Rauch, T.

    2010-11-01

    In the last decades, a lot of progress was made in spectral analysis. The quality (e.g. resolution, S/N ratio) of observed spectra has improved much and several model-atmosphere codes were developed. One of these is the ``Tübingen NLTE Model-Atmosphere Package'' (TMAP), that is a highly developed program for the calculation of model atmospheres of hot, compact objects. In the framework of the German Astrophysical Virtual Observatory (GAVO), theoretical spectral energy distributions (SEDs) can be downloaded via TheoSSA. In a pilot phase, TheoSSA is based on TMAP model atmospheres. We present the current state of this VO service.

  8. TiSSA eelkonverents doktorantidele Tallinnas / Koidu Saame

    Index Scriptorium Estoniae

    Saame, Koidu

    2010-01-01

    Tallinna Ülikoolis toimunud TiSSA doktorantide eelkonverentsist 22.-24. aug. 2010.a. Doktorantide ettekannetest. Esinesid: Hans-Uwe Otto, Andriy Yuryev, Tiina Naarits, Ivar Tröner, Koidu Saame, Maija Jäppinen, Janissa Miettinen

  9. BOREAS TE-01 SSA Soil Lab Data

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: This data set provides a set of soil properties for the SSA. The soil samples were collected at sets of soil pits. Major soil properties include soil...

  10. BOREAS TE-01 SSA Soil Lab Data

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set provides a set of soil properties for the SSA. The soil samples were collected at sets of soil pits. Major soil properties include soil horizon; dry...

  11. Preliminary Modelling of Mass Flux at the Surface of Plant Leaves within the MELiSSA Higher Plant Compartments

    Science.gov (United States)

    Holmberg, Madeleine; Paille, Christel; Lasseur, Christophe

    The ESA project Micro Ecological Life Support System Alternative (MELiSSA) is an ecosystem of micro-organisms and higher plants, constructed with the objective of being operated as a tool to understand artificial ecosystems to be used for a long-term or permanent manned planetary base (e.g. Moon or Mars). The purpose of such a system is to provide for generation of food, water recycling, atmospheric regeneration and waste management within defined standards of quality and reliability. As MELiSSA consists of individual compartments which are connected to each other, the robustness of the system is fully dependent on the control of each compartment, as well as the flow management between them. Quality of consumables and reliability of the ecosystem rely on the knowledge, understanding and control of each of the components. This includes the full understanding of all processes related to the higher plants. To progress in that direction, this paper focuses on the mechanical processes driving the gas and liquid exchanges between the plant leaf and its environment. The process responsible for the mass transfer on the surface of plant leaves is diffusion. The diffusion flux is dependent on the behaviour of the stoma of the leaf and also on the leaf boundary layer (BL). In this paper, the physiology of the leaf is briefly examined in order to relate parameters such as light quality, light quantity, CO2 concentration, temperature, leaf water potential, humidity, vapour pressure deficit (VPD) gradients and pollutants to the opening or closing of stomata. The diffusion process is described theoretically and the description is compared to empirical approaches. The variables of the BL are examined and the effect airflow in the compartment has on the BL is investigated. Also presented is the impact changes in different environmental parameters may have on the fluid exchanges. Finally, some tests, to evaluate the accuracy of the concluded model, are suggested.

  12. Overview of Human-Centric Space Situational Awareness (SSA) Science and Technology (S&T)

    Science.gov (United States)

    Ianni, J.; Aleva, D.; Ellis, S.

    2012-09-01

    A number of organizations, within the government, industry, and academia, are researching ways to help humans understand and react to events in space. The problem is both helped and complicated by the fact that there are numerous data sources that need to be planned (i.e., tasked), collected, processed, analyzed, and disseminated. A large part of the research is in support of the Joint Space Operational Center (JSpOC), National Air and Space Intelligence Center (NASIC), and similar organizations. Much recent research has been specifically targeting the JSpOC Mission System (JMS) which has provided a unifying software architecture. This paper will first outline areas of science and technology (S&T) related to human-centric space situational awareness (SSA) and space command and control (C2) including: 1. Object visualization - especially data fused from disparate sources. Also satellite catalog visualizations that convey the physical relationships between space objects. 2. Data visualization - improve data trend analysis as in visual analytics and interactive visualization; e.g., satellite anomaly trends over time, space weather visualization, dynamic visualizations 3. Workflow support - human-computer interfaces that encapsulate multiple computer services (i.e., algorithms, programs, applications) into a 4. Command and control - e.g., tools that support course of action (COA) development and selection, tasking for satellites and sensors, etc. 5. Collaboration - improve individuals or teams ability to work with others; e.g., video teleconferencing, shared virtual spaces, file sharing, virtual white-boards, chat, and knowledge search. 6. Hardware/facilities - e.g., optimal layouts for operations centers, ergonomic workstations, immersive displays, interaction technologies, and mobile computing. Secondly we will provide a survey of organizations working these areas and suggest where more attention may be needed. Although no detailed master plan exists for human

  13. Non-traditional Sensor Tasking for SSA: A Case Study

    Science.gov (United States)

    Herz, A.; Herz, E.; Center, K.; Martinez, I.; Favero, N.; Clark, C.; Therien, W.; Jeffries, M.

    Industry has recognized that maintaining SSA of the orbital environment going forward is too challenging for the government alone. Consequently there are a significant number of commercial activities in various stages of development standing-up novel sensors and sensor networks to assist in SSA gathering and dissemination. Use of these systems will allow government and military operators to focus on the most sensitive space control issues while allocating routine or lower priority data gathering responsibility to the commercial side. The fact that there will be multiple (perhaps many) commercial sensor capabilities available in this new operational model begets a common access solution. Absent a central access point to assert data needs, optimized use of all commercial sensor resources is not possible and the opportunity for coordinated collections satisfying overarching SSA-elevating objectives is lost. Orbit Logic is maturing its Heimdall Web system - an architecture facilitating “data requestor” perspectives (allowing government operations centers to assert SSA data gathering objectives) and “sensor operator” perspectives (through which multiple sensors of varying phenomenology and capability are integrated via machine -machine interfaces). When requestors submit their needs, Heimdall’s planning engine determines tasking schedules across all sensors, optimizing their use via an SSA-specific figure-of-merit. ExoAnalytic was a key partner in refining the sensor operator interfaces, working with Orbit Logic through specific details of sensor tasking schedule delivery and the return of observation data. Scant preparation on both sides preceded several integration exercises (walk-then-run style), which culminated in successful demonstration of the ability to supply optimized schedules for routine public catalog data collection – then adapt sensor tasking schedules in real-time upon receipt of urgent data collection requests. This paper will provide a

  14. Biomass-derived nitrogen-doped porous carbons with tailored hierarchical porosity and high specific surface area for high energy and power density supercapacitors

    Science.gov (United States)

    Sun, Junting; Niu, Jin; Liu, Mengyue; Ji, Jing; Dou, Meiling; Wang, Feng

    2018-01-01

    Porous carbon materials with hierarchical structures attract intense interest for the development of high-performance supercapacitors. Herein, we demonstrate a facile and efficient strategy to synthesize nitrogen-doped hierarchically porous carbons with tailored porous structure combined with high specific surface area (SSA), which involves a pre-carbonization and a subsequent carbonization combined with KOH activation of silkworm cocoon precursors. Through adjusting the mass ratio of the activator (KOH) to pre-carbonized precursor in the activation process, the hierarchically porous carbon prepared at the mass ratio of 2 (referred to as NHPC-2) possesses a high defect density and a high SSA of 3386 m2 g-1 as well as the relatively high volumetric proportion of mesopores and macropores (45.5%). As a result, the energy density and power density of the symmetric supercapacitor based on NHPC-2 electrode are as high as 34.41 Wh kg-1 and 31.25 kW kg-1 in organic-solvent electrolyte, and are further improved to 112.1 Wh kg-1 and 23.91 kW kg-1 in ionic-liquid electrolyte.

  15. BOREAS TF-01 SSA-OA Soil Characteristics Data

    Data.gov (United States)

    National Aeronautics and Space Administration — Data collected in support of the effort to characterize and interpret soil information at the SSA-OA tower site in 1994. Data collected include soil respiration,...

  16. BOREAS TF-01 SSA-OA Soil Characteristics Data

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: Data collected in support of the effort to characterize and interpret soil information at the SSA-OA tower site in 1994. Data collected include soil...

  17. Fire-induced albedo change and surface radiative forcing in sub-Saharan Africa savanna ecosystems: Implications for the energy balance

    Science.gov (United States)

    Dintwe, Kebonye; Okin, Gregory S.; Xue, Yongkang

    2017-06-01

    Surface albedo is a critical parameter that controls surface energy balance. In dryland ecosystems, fires play a significant role in decreasing surface albedo, resulting in positive radiative forcing. Here we investigate the long-term effect of fire on surface albedo. We devised a method to calculate short-, medium-, and long-term effect of fire-induced radiative forcing and their relative effects on energy balance. We used Moderate Resolution Imaging Spectroradiometer (MODIS) data in our analysis, covering different vegetation classes in sub-Saharan Africa (SSA). Our analysis indicated that mean short-term fire-induced albedo change in SSA was -0.022, -0.035, and -0.041 for savannas, shrubland, and grasslands, respectively. At regional scale, mean fire-induced albedo change in savannas was -0.018 and -0.024 for northern sub-Saharan of Africa and the southern hemisphere Africa, respectively. The short-term mean fire-induced radiative forcing in burned areas in sub-Saharan Africa (SSA) was 5.41 W m-2, which contributed continental and global radiative forcings of 0.25 and 0.058 W m-2, respectively. The impact of fire in surface albedo has long-lasting effects that varies with vegetation type. The long-term energetic effects of fire-induced albedo change and associated radiative forcing were, on average, more than 19 times greater across SSA than the short-term effects, suggesting that fires exerted far more radiative forcing than previously thought. Taking into account the actual duration of fire's effect on surface albedo, we conclude that the contribution of SSA fires, globally and throughout the year, is 0.12 W m-2. These findings provide crucial information on possible impact of fire on regional climate variability.

  18. The relationship of the lipoprotein SsaB, manganese and superoxide dismutase in Streptococcus sanguinis virulence for endocarditis.

    Science.gov (United States)

    Crump, Katie E; Bainbridge, Brian; Brusko, Sarah; Turner, Lauren S; Ge, Xiuchun; Stone, Victoria; Xu, Ping; Kitten, Todd

    2014-06-01

    Streptococcus sanguinis colonizes teeth and is an important cause of infective endocarditis. Our prior work showed that the lipoprotein SsaB is critical for S. sanguinis virulence for endocarditis and belongs to the LraI family of conserved metal transporters. In this study, we demonstrated that an ssaB mutant accumulates less manganese and iron than its parent. A mutant lacking the manganese-dependent superoxide dismutase, SodA, was significantly less virulent than wild-type in a rabbit model of endocarditis, but significantly more virulent than the ssaB mutant. Neither the ssaB nor the sodA mutation affected sensitivity to phagocytic killing or efficiency of heart valve colonization. Animal virulence results for all strains could be reproduced by growing bacteria in serum under physiological levels of O(2). SodA activity was reduced, but not eliminated in the ssaB mutant in serum and in rabbits. Growth of the ssaB mutant in serum was restored upon addition of Mn(2+) or removal of O(2). Antioxidant supplementation experiments suggested that superoxide and hydroxyl radicals were together responsible for the ssaB mutant's growth defect. We conclude that manganese accumulation mediated by the SsaB transport system imparts virulence by enabling cell growth in oxygen through SodA-dependent and independent mechanisms. © 2014 John Wiley & Sons Ltd.

  19. Systematic Sustainability Assessment (SSA) Tool for Hydroelectric Project in Malaysia

    Science.gov (United States)

    Turan, Faiz Mohd; Johan, Kartina

    2017-08-01

    Sustainably developed and managed hydropower has enormous potential to contribute to global sustainability goals. It is known that hydroelectricity contributing small amounts to greenhouse gas emissions and other atmospheric pollutants. However, developing the remaining hydroelectric potential offers many challenges, and public pressure and expectations on the environmental and social performance of hydroelectric tend to increase over time. This paper aims to develop Systematic Sustainability Assessment (SSA) Tool that promotes and guides more sustainable hydroelectric projects in the context of Malaysia. The proposed SSA tool which not only provide a quality and quantitative report of sustainability performance but also act as Self-Assessment Report (SAR) to provide roadmap to achieve greater level of sustainability in project management for continuous improvement. It is expected to provide a common language that allow government, civil society, financial institutions and the hydroelectric sector to talk about and evaluate sustainability issues. The advantage of SSA tool is it can be used at any stage of hydroelectric development, from the earliest planning stages right through to operation.

  20. BOREAS HYD-8 DEM Data Over the NSA-MSA and SSA-MSA in the UTM Projection

    Science.gov (United States)

    Wang, Xue-Wen; Hall, Forrest G. (Editor); Knapp, David E. (Editor); Band, L. E.; Smith, David E. (Technical Monitor)

    2000-01-01

    The BOREAS HYD-8 team focused on describing the scaling behavior of water and carbon flux processes at local and regional scales. These DEMs were produced from digitized contours at a cell resolution of 100 meters. Vector contours of the area were used as input to a software package that interpolates between contours to create a DEM representing the terrain surface. The vector contours had a contour interval of 25 feet. The data cover the BOREAS MSAs of the SSA and NSA and are given in a UTM map projection. Most of the elevation data from which the DEM was produced were collected in the 1970s or 1980s. The data are stored in binary, image format files. The data files are available on a CD-ROM (see document number 20010000884) or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  1. Do the Asian Drivers undermine the export-oriented industrialisation in SSA?

    OpenAIRE

    Kaplinsky, Raphael; Morris, Mike

    2008-01-01

    An increase in outward orientation in general, and in export-oriented manufacturing in particular is widely indicated as a suitable developmental path for SSA. The logic for this is drawn both from the demonstration effect of China and the earlier generation of Asian NICs, and from theory. However, the entry of China (and to a lesser extent India) into the global economy as a significant exporter of manufactures poses severe problems for export-oriented growth in SSA. This can be seen from SS...

  2. Spectral Analysis within the Virtual Observatory: The GAVO Service TheoSSA

    Science.gov (United States)

    Ringat, E.

    2012-03-01

    In the last decade, numerous Virtual Observatory organizations were established. One of these is the German Astrophysical Virtual Observatory (GAVO) that e.g. provides access to spectral energy distributions via the service TheoSSA. In a pilot phase, these are based on the Tübingen NLTE Model-Atmosphere Package (TMAP) and suitable for hot, compact stars. We demonstrate the power of TheoSSA in an application to the sdOB primary of AA Doradus by comparison with a “classical” spectral analysis.

  3. Sewage sludge ash (SSA in high performance concrete: characterization and application

    Directory of Open Access Journals (Sweden)

    C. M. A. Fontes

    Full Text Available ABSTRACT Sewage sludge originated from the process of treatment of wastewater has become an environmental issue for three main reasons: contains pathogens, heavy metals and organic compounds that are harmful to the environmental and human health; high volumes are daily generated; and shortage of landfill sites for proper disposal. This research deals with the viability study of sewage sludge utilization, after calcination process, as mineral admixture in the production of concrete. High-performance concretes were produced with replacement content of 5% and 10% by weight of Portland cement with sewage sludge ash (SSA. The influence of this ash was analyzed through physical and mechanical tests. Analysis showed that the mixtures containing SSA have lower values of compressive strength than the reference. The results of absorptivity, porosity and accelerated penetration of chloride ions, presents that mixtures containing ash showed reductions compared to the reference. This indicates that SSA provided refinement of the pore structure, which was confirmed by mercury intrusion porosimetry test.

  4. Long-term evaluation of the needle surface wax condition of Pinus sylvestris around different industries in Lithuania

    International Nuclear Information System (INIS)

    Kupcinskiene, Eugenija; Huttunen, Satu

    2005-01-01

    The aim of our study was to evaluate the annual dynamics of needle surface wax erosion and wettability in Scots pines exposed to a gradient of industrial pollutants emitted from the main factories of Lithuania: a nitrogen fertilizer factory, an oil refinery and a cement factory. Decreased emissions (in the case of the oil refinery and the cement factory) were reflected in the increased structural surface area (SSA, i.e. area covered by tubular waxes) on the needles. The nearly constant amount of emissions from the nitrogen fertilizer factory within the 1994-2000 period corresponded to negligible annual differences in SSA. Annual changes in the hydrophobicity of needles on the investigated transects were small. Despite the decreased pollution within the 7-year period, industrial emissions are still causing significantly accelerated wax erosion and increased wettability in needles sampled from the stands most heavily affected by pollutants. - Tubular wax on the pine needle surface reflects changes/differences in industrial emissions

  5. Lupus systémique et atteinte rénale: Apport des anticorps anti-SSA ...

    African Journals Online (AJOL)

    -SSA dans 12 cas (40%).Cinq patients (62.5%) ayant une atteinte rénale avaient des anticorps anti DNA négatifs. Parmi ces patients avec atteinte rénale, 37.5% avaient des anticorps anti SSA sans anticorps anti DNA. La moitié des patients ...

  6. Lp-dual affine surface area

    Science.gov (United States)

    Wei, Wang; Binwu, He

    2008-12-01

    According to the notion of Lp-affine surface area by Lutwak, in this paper, we introduce the concept of Lp-dual affine surface area. Further, we establish the affine isoperimetric inequality and the Blaschke-Santaló inequality for Lp-dual affine surface area. Besides, the dual Brunn-Minkowski inequality for Lp-dual affine surface area is presented.

  7. The SSB-positive/SSA-negative antibody profile is not associated with key phenotypic features of Sjögren's syndrome

    DEFF Research Database (Denmark)

    Baer, Alan N; McAdams DeMarco, Mara; Shiboski, Stephen C

    2015-01-01

    phenotypic features. Among SICCA participants classified with SS on the basis of the American-European Consensus Group or American College of Rheumatology criteria, only 2% required the anti-SSB-alone test result to meet these criteria. CONCLUSIONS: The presence of anti-SSB, without anti-SSA antibodies, had...... participants, 2061 (63%) had negative anti-SSA/anti-SSB, 1162 (35%) had anti-SSA with or without anti-SSB, and 74 (2%) anti-SSB alone. Key SS phenotypic features were more prevalent and had measures indicative of greater disease activity in those participants with anti-SSA, either alone or with anti-SSB, than...... in those with anti-SSB alone or negative SSA/SSB serology. These between-group differences were highly significant and not explained by confounding by age, race/ethnicity or gender. Participants with anti-SSB alone were comparable to those with negative SSA/SSB serology in their association with these key...

  8. Dual Orlicz geominimal surface area

    Directory of Open Access Journals (Sweden)

    Tongyi Ma

    2016-02-01

    Full Text Available Abstract The L p $L_{p}$ -geominimal surface area was introduced by Lutwak in 1996, which extended the important concept of the geominimal surface area. Recently, Wang and Qi defined the p-dual geominimal surface area, which belongs to the dual Brunn-Minkowski theory. In this paper, based on the concept of the dual Orlicz mixed volume, we extend the dual geominimal surface area to the Orlicz version and give its properties. In addition, the isoperimetric inequality, a Blaschke-Santaló type inequality, and the monotonicity inequality for the dual Orlicz geominimal surface areas are established.

  9. Model-Atmosphere Spectra of Central Stars of Planetary Nebulae - Access via the Virtual Observatory Service TheoSSA

    Science.gov (United States)

    Rauch, T.; Reindl, N.

    2014-04-01

    In the framework of the Virtual Observatory (VO), the German Astrophysical Virtual Observatory GAVO project provides easy access to theoretical spectral energy distributions (SEDs) within the registered GAVO service TheoSSA (http://dc.g-vo.org/theossa). TheoSSA is based on the well established Tübingen NLTE Model-Atmosphere Package (TMAP) for hot, compact stars. This includes central stars of planetary nebulae. We show examples of TheoSSA in operation.

  10. Possible role of anti-SSA/Ro antibodies in the pathogenesis of pulmonary hypertension

    Directory of Open Access Journals (Sweden)

    Kelsey Guerreso

    2016-01-01

    Conclusion: It is known that pulmonary hypertension has association with autoimmune diseases, however no clear markers yet exist. Anti-SSA/Ro antibodies have been rarely described in cases of pulmonary disease, and less so in pulmonary hypertension. This case describes a unique association between isolated pulmonary hypertension and anti-SSA/Ro antibody, thereby illustrating the need to investigate this autoantibody and others in the pathogenesis of autoimmune pulmonary hypertension.

  11. Sorption of uranium (VI) on homoionic sodium smectite experimental study and surface complexation modeling.

    Science.gov (United States)

    Korichi, Smain; Bensmaili, Aicha

    2009-09-30

    )-BET specific surface area, SSA(BET) (thus, total edge site concentrations). The specific surface area should be at least 80-100m(2)/g for smectite clays in order to reach convergence during the modeling. The range of 10-20% SSA(BET) was used to estimate the values of edge site surfaces that led to the convergence during modeling. An agreement between the experimental data and model predictions is found reasonable when 15% SSA(BET) was used as edge site surface. However, the predicted U (VI) adsorption underestimated and overestimated the experimental observations at the 10 and 20% of the measured SSA(BET), respectively. The dependence of uranium sorption modeling results on specific surface area and edge site surface is useful to describe and predict U (VI) retardation as a function of chemical conditions in the field-scale reactive transport simulations. Therefore this approach can be used in the environmental quality assessment.

  12. Lp-mixed affine surface area

    Science.gov (United States)

    Wang, Weidong; Leng, Gangsong

    2007-11-01

    According to the three notions of mixed affine surface area, Lp-affine surface area and Lp-mixed affine surface area proposed by Lutwak, in this article, we give the concept of ith Lp-mixed affine surface area such that the first and second notions of Lutwak are its special cases. Further, some Lutwak's results are extended associated with this concept. Besides, applying this concept, we establish an inequality for the volumes and dual quermassintegrals of a class of star bodies.

  13. Understanding Large-scale Structure in the SSA22 Protocluster Region Using Cosmological Simulations

    Science.gov (United States)

    Topping, Michael W.; Shapley, Alice E.; Steidel, Charles C.; Naoz, Smadar; Primack, Joel R.

    2018-01-01

    We investigate the nature and evolution of large-scale structure within the SSA22 protocluster region at z = 3.09 using cosmological simulations. A redshift histogram constructed from current spectroscopic observations of the SSA22 protocluster reveals two separate peaks at z = 3.065 (blue) and z = 3.095 (red). Based on these data, we report updated overdensity and mass calculations for the SSA22 protocluster. We find {δ }b,{gal}=4.8+/- 1.8 and {δ }r,{gal}=9.5+/- 2.0 for the blue and red peaks, respectively, and {δ }t,{gal}=7.6+/- 1.4 for the entire region. These overdensities correspond to masses of {M}b=(0.76+/- 0.17)× {10}15{h}-1 {M}ȯ , {M}r=(2.15+/- 0.32)× {10}15{h}-1 {M}ȯ , and {M}t=(3.19+/- 0.40)× {10}15{h}-1 {M}ȯ for the red, blue, and total peaks, respectively. We use the Small MultiDark Planck (SMDPL) simulation to identify comparably massive z∼ 3 protoclusters, and uncover the underlying structure and ultimate fate of the SSA22 protocluster. For this analysis, we construct mock redshift histograms for each simulated z∼ 3 protocluster, quantitatively comparing them with the observed SSA22 data. We find that the observed double-peaked structure in the SSA22 redshift histogram corresponds not to a single coalescing cluster, but rather the proximity of a ∼ {10}15{h}-1 {M}ȯ protocluster and at least one > {10}14{h}-1 {M}ȯ cluster progenitor. Such associations in the SMDPL simulation are easily understood within the framework of hierarchical clustering of dark matter halos. We finally find that the opportunity to observe such a phenomenon is incredibly rare, with an occurrence rate of 7.4{h}3 {{{Gpc}}}-3. Based on data obtained at the W.M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration, and was made possible by the generous financial support of the W.M. Keck Foundation.

  14. 77 FR 43639 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA...

    Science.gov (United States)

    2012-07-25

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0090] Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA)/Department of Veterans Affairs (VA.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503...

  15. 77 FR 54943 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA...

    Science.gov (United States)

    2012-09-06

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0016] Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA)/Department of Veterans Affairs (VA.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503...

  16. BOREAS TF-02 SSA-OA Tethersonde Meteorological and Ozone Data

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: The BOREAS TF-02 team collected various trace gas and energy flux data along with meteorological parameters at the SSA-OA site. This data set contains...

  17. BOREAS TF-02 SSA-OA Tethersonde Meteorological and Ozone Data

    Data.gov (United States)

    National Aeronautics and Space Administration — The BOREAS TF-02 team collected various trace gas and energy flux data along with meteorological parameters at the SSA-OA site. This data set contains meteorological...

  18. Hierarchical nitrogen-doped porous carbon with high surface area derived from endothelium corneum gigeriae galli for high-performance supercapacitor

    International Nuclear Information System (INIS)

    Hong, Xiaoting; Hui, K.S.; Zeng, Zhi; Hui, K.N.; Zhang, Luojiang; Mo, Mingyue; Li, Min

    2014-01-01

    Highlights: • Porous carbons were prepared using endothelium corneum gigeriae galli as precursor. • Surface and structural properties strongly depend on carbonization temperatures. • Resultant carbons possess nitrogen heteroatom and high surface areas. • ECGG-900 sample exhibits excellent electrochemical capacitive performances. - Abstract: Endothelium corneum gigeriae galli derived 3D hierarchical nitrogen-doped porous carbon was for the first time prepared by preliminary carbonization at 450 °C and final KOH activation at high temperatures. The surface and structural properties of the as-synthesized samples are analyzed with Brunauer–Emmett–Teller surface analyzer apparatus, X-Ray Diffractometer, scanning electron microscopy, transmission electron microscopy, X-ray photoelectron spectrometer. The electrochemical performances are analyzed by cyclic voltammetry, galvanostatic charge/discharge cycling and electrochemical impedance spectroscopy. The obtained results show that the sample carbonized at 900 °C possesses the SSA of 2149.9 m 2 g −1 , average micropore diameter of 1.78 nm, and exhibits the highest initial specific capacitance of 198.0 F g −1 at current density of 1 A g −1 in 6 M KOH solution. It retains good specific capacitance retention of 91.6% after 3000 charge/discharge cycles at current density of 2 A g −1

  19. 76 FR 55690 - Submission for OMB Review; Comment Request; The SSA-NIH Collaboration To Improve the Disability...

    Science.gov (United States)

    2011-09-08

    ...; Comment Request; The SSA-NIH Collaboration To Improve the Disability Determination Process: Validation of... Collection: Title: The SSA-NIH Collaboration to Improve the Disability Determination Process: Validation of IRT-CAT tools. Type of Information Collection Request: NEW. Need and Use of Information Collection...

  20. 78 FR 12127 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of the Treasury...

    Science.gov (United States)

    2013-02-21

    ... 1310 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0007] Privacy Act of 1974, as Amended...

  1. 75 FR 51154 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of the Treasury...

    Science.gov (United States)

    2010-08-18

    ... 1310 AGENCY: Social Security Administration (SSA) ACTION: Notice of a renewal of an existing computer..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0035] Privacy Act of 1974, as Amended...

  2. 78 FR 51264 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of the Treasury...

    Science.gov (United States)

    2013-08-20

    ... 1016 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0022] Privacy Act of 1974, as Amended...

  3. 78 FR 16564 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Personnel Management...

    Science.gov (United States)

    2013-03-15

    ... 1021 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of existing computer... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0073] Privacy Act of 1974, as Amended...

  4. 75 FR 62623 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Internal Revenue Service (IRS...

    Science.gov (United States)

    2010-10-12

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0015] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Internal Revenue Service (IRS))--Match Number 1016 AGENCY: Social Security... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching...

  5. 77 FR 27108 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Child Support...

    Science.gov (United States)

    2012-05-08

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching... protections for such persons. The Privacy Act, as amended, regulates the use of computer matching by Federal... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0010] Privacy Act of 1974, as Amended...

  6. 76 FR 77238 - Submission for OMB Review; Comment Request; The SSA-NIH Collaboration to Improve the Disability...

    Science.gov (United States)

    2011-12-12

    ... Collaboration to Improve the Disability Determination Process: Validation of IRT-CAT tools. Type of Information...; Comment Request; The SSA-NIH Collaboration to Improve the Disability Determination Process: Validation of... being developed to assist in the SSA disability determination process. The utilization of CAT technology...

  7. 75 FR 18251 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Internal Revenue Service (IRS...

    Science.gov (United States)

    2010-04-09

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0066] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Internal Revenue Service (IRS))--Match 1305 AGENCY: Social Security... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...

  8. 75 FR 7648 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Veterans Affairs...

    Science.gov (United States)

    2010-02-22

    ... Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503), amended the Privacy... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0006] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Veterans Affairs/Veterans Benefits Administration (VA/ VBA...

  9. 75 FR 59780 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Railroad Retirement Board (RRB...

    Science.gov (United States)

    2010-09-28

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0040] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Railroad Retirement Board (RRB))--Match Number 1006 AGENCY: Social Security...: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L.) 100-503), amended the...

  10. 77 FR 32709 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Homeland Security...

    Science.gov (United States)

    2012-06-01

    ...; Computer Matching Program (SSA/ Department of Homeland Security (DHS))--Match Number 1010 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program that... amended by the Computer Matching and Privacy Protection Act of 1988, as amended, and the regulations and...

  11. 78 FR 12128 - Privacy Act of 1974; Computer Matching Program (SSA/Department of the Treasury, Internal Revenue...

    Science.gov (United States)

    2013-02-21

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0067] Privacy Act of 1974; Computer Matching... Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...

  12. 77 FR 49849 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Child Support...

    Science.gov (United States)

    2012-08-17

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer-matching... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0021] Privacy Act of 1974, as Amended...

  13. 78 FR 69926 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Centers for Medicare & Medicaid...

    Science.gov (United States)

    2013-11-21

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L 100-503), amended the... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0059] Privacy Act of 1974, as Amended...

  14. 75 FR 32833 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Personnel Management...

    Science.gov (United States)

    2010-06-09

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0077] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Office of Personnel Management (OPM))--Match 1307 AGENCY: Social Security... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...

  15. Production characteristics of lettuce Lactuca sativa L. in the frame of the first crop tests in the Higher Plant Chamber integrated into the MELiSSA Pilot Plant

    Science.gov (United States)

    Tikhomirova, Natalia; Lawson, Jamie; Stasiak, Michael; Dixon, Mike; Paille, Christel; Peiro, Enrique; Fossen, Arnaud; Godia, Francesc

    Micro-Ecological Life Support System Alternative (MELiSSA) is an artificial closed ecosystem that is considered a tool for the development of a bioregenerative life support system for manned space missions. One of the five compartments of MELiSSA loop -Higher Plant Chamber was recently integrated into the MELiSSA Pilot Plant facility at Universitat Aut`noma deo Barcelona. The main contributions expected by integration of this photosynthetic compartment are oxygen, water, vegetable food production and CO2 consumption. Production characteristics of Lactuca sativa L., as a MELiSSA candidate crop, were investigated in this work in the first crop experiments in the MELiSSA Pilot Plant facility. The plants were grown in batch culture and totaled 100 plants with a growing area 5 m long and 1 m wide in a sealed controlled environment. Several replicates of the experiments were carried out with varying duration. It was shown that after 46 days of lettuce cultivation dry edible biomass averaged 27, 2 g per plant. However accumulation of oxygen in the chamber, which required purging of the chamber, and decrease in the food value of the plants was observed. Reducing the duration of the tests allowed uninterrupted test without opening the system and also allowed estimation of the crop's carbon balance. Results of productivity, tissue composition, nutrient uptake and canopy photosynthesis of lettuce regardless of test duration are discussed in the paper.

  16. 75 FR 68396 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Labor (DOL))-Match...

    Science.gov (United States)

    2010-11-05

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0052] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1003 AGENCY: Social Security... as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...

  17. Effect of sewage sludge ash (SSA on the mechanical performance and corrosion levels of reinforced Portland cement mortars

    Directory of Open Access Journals (Sweden)

    Andión, L. G.ª

    2006-06-01

    Full Text Available The article describes a study conducted to determinecorrosion in reinforcement embedded in Portland cement(PC mortars with different percentages of sewage sludgeash (SSA admixtures. The polarization resistancetechnique was used to determine the steel corrosion rate(Icorr in the test specimens. The samples were subjectedto different environmental conditions and aggressiveagents: 100% relative humidity (RH, accelerated carbonationat 70% RH and seawater immersion. Portlandcement was partially substituted for SSA in the mixes atrates of 0, 10, 20, 30 and 60% (by mass to make thedifferent mortars. The results show that where cementwas replaced by SSA at rates of up to 10% by mass,mortar corrosion performance was comparable to thebehaviour observed in SSA-free mortars (control mortar:0% SSA. Data for higher rates are also shown. From themechanical standpoint, SSA exhibited moderate pozzolanicactivity and the best performance when SSA wasadded at a rate of 10% to mixes with a water/(binder:PC + SSA (w/b ratio of 0.5.Se ha estudiado el nivel de corrosion que presentan lasarmaduras embebidas en morteros fabricados con cementoPortland (CP con diferentes porcentajes de sustitucion deceniza de lodo de depuradora (CLD. Se ha utilizado la tecnicade la Resistencia a la Polarizacion para determinar lavelocidad de corrosion del acero embebido en las muestrasestudiadas. Las muestras se han sometido a diferentes condicionesambientales y agentes agresivos: 100% de humedadrelativa (HR, carbonatacion acelerada al 70% HR einmersion en agua de mar. Para la fabricacion de los distintosmorteros, el cemento Portland ha sido parcialmente sustituidopor CLD en los siguientes porcentajes en masa: 0,10, 20, 30 y 60%. Los resultados muestran que sustitucionesde cemento por CLD de hasta el 10% en masa no alteranel comportamiento frente a la corrosion de los morterosal compararlos con los morteros libres de CLD (morteroscontrol: 0% de sustitucion de cemento por CLD. Se

  18. 77 FR 24756 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Labor (DOL))-Match...

    Science.gov (United States)

    2012-04-25

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0084] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1003 AGENCY: Social Security... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988...

  19. 77 FR 24757 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Labor (DOL))-Match...

    Science.gov (United States)

    2012-04-25

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0083] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1015 AGENCY: Social Security... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching...

  20. Surviving space flight: case study on MELiSSA's CIII nitrifying compartment

    Science.gov (United States)

    Ilgrande, Chiara; Lasseur, Christophe; Mastroleo, Felice; Paille, Christel; Leys, Natalie; Morozova, Julia; Ilyin, Vyacheslav; Clauwaert, Peter; Christiaens, Marlies E. R.; Lindeboom, Ralph E. F.; Vlaeminck, Siegfried; Prat, Delphine; Arroyo, Jose M. C.; Conincx, Ilse; Van Hoey, Olivier; Roume, Hugo; Udert, Kai; Sas, Benedikt

    2016-07-01

    Space synthetic biology offers key opportunities for long-term space missions. Planets mining, terraformation, space medicine and Life Support technologies would all benefit from an integrative biological approach. However, space is a harsh environment for life: microgravity, temperature, UV and cosmic radiation can affect the health and functionality of microorganisms and plants, possibly preventing the optimal performance of the systems. The European Space Agency's Life Support System (MELiSSA) has been developed as a model for future long term Space missions and Space habitation. MELiSSA is a 5 compartment artificial ecosystem with microorganisms and higher, that aims at completely recycling gas, liquid and solid waste. In this study, the survival and functional activity after Lower Earth Orbit conditions of microbial nitrogen conversions, relevant for MELiSSA's CIII compartment, was tested. Synthetic communities containing Nitrosomonas europeae, Nitrosomonas ureae, Nitrobacter winogradskyi, Nitrospira moscoviensis and Cupriavidus pinatubonensis were exposed to the Lower Earth Orbit conditions of the International Space Station (ISS) for 7 days. Nitrosomonas europeae, Nitrobacter winogradskyi, Cupriavidus pinatubonensis, and three mixed communities (a urine nitrification sludge, a sludge containing aerobic ammonia oxidizing bacteria and anammox bacteria (OLAND), and an aquaculture sludge containing ammonia oxidizing archaea) were exposed to Lower Earth Orbit conditions for 44 days. Survival after both space flights was demonstrated because nitritation, nitratation, denitrification and anammox activity could be restored at a rate comparable to ground storage conditions. Our results validate the potential survival feasibility and suggest future space applications for N-related microorganisms.

  1. 77 FR 33547 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Centers for Medicare and Medicaid...

    Science.gov (United States)

    2012-06-06

    ...: Social Security Administration (SSA). ACTION: Notice of a new computer matching program that will expire... protections for such persons. The Privacy Act, as amended, regulates the use of computer matching by Federal... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0015] Privacy Act of 1974, as Amended...

  2. 20 CFR 411.597 - Will SSA periodically review the outcome payment system and the outcome-milestone payment system...

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Will SSA periodically review the outcome payment system and the outcome-milestone payment system for possible modifications? 411.597 Section 411... Employment Network Payment Systems § 411.597 Will SSA periodically review the outcome payment system and the...

  3. 20 CFR 403.100 - When can an SSA employee testify or produce information or records in legal proceedings?

    Science.gov (United States)

    2010-04-01

    ... information or records in legal proceedings? 403.100 Section 403.100 Employees' Benefits SOCIAL SECURITY ADMINISTRATION TESTIMONY BY EMPLOYEES AND THE PRODUCTION OF RECORDS AND INFORMATION IN LEGAL PROCEEDINGS § 403.100 When can an SSA employee testify or produce information or records in legal proceedings? An SSA...

  4. Human Decision Processes: Implications for SSA Support Tools

    Science.gov (United States)

    Picciano, P.

    2013-09-01

    Despite significant advances in computing power and artificial intelligence (AI), few critical decisions are made without a human decision maker in the loop. Space Situational Awareness (SSA) missions are both critical and complex, typically adhering to the human-in-the-loop (HITL) model. The collection of human operators injects a needed diversity of expert knowledge, experience, and authority required to successfully fulfill SSA tasking. A wealth of literature on human decision making exists citing myriad empirical studies and offering a varied set of prescriptive and descriptive models of judgment and decision making (Hastie & Dawes, 2001; Baron, 2000). Many findings have been proven sufficiently robust to allow information architects or system/interface designers to take action to improve decision processes. For the purpose of discussion, these concepts are bifurcated in two groups: 1) vulnerabilities to mitigate, and 2) capabilities to augment. These vulnerabilities and capabilities refer specifically to the decision process and should not be confused with a shortcoming or skill of a specific human operator. Thus the framing of questions and orders, the automated tools with which to collaborate, priming and contextual data, and the delivery of information all play a critical role in human judgment and choice. Evaluating the merits of any decision can be elusive; in order to constrain this discussion, ‘rational choice' will tend toward the economic model characteristics such as maximizing utility and selection consistency (e.g., if A preferred to B, and B preferred to C, than A should be preferred to C). Simple decision models often encourage one to list the pros and cons of a decision, perhaps use a weighting schema, but one way or another weigh the future benefit (or harm) of making a selection. The result (sought by the rationalist models) should drive toward higher utility. Despite notable differences in researchers' theses (to be discussed in the full

  5. 77 FR 6620 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/the States); Match 6000 and 6003

    Science.gov (United States)

    2012-02-08

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0102] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ the States); Match 6000 and 6003 AGENCY: Social Security Administration..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...

  6. 76 FR 12398 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Bureau of the Public Debt (BPD...

    Science.gov (United States)

    2011-03-07

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0034] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Bureau of the Public Debt (BPD))--Match Number 1304 AGENCY: Social Security... as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...

  7. Influence of surface features of hydroxyapatite on the adsorption of proteins relevant to bone regeneration.

    Science.gov (United States)

    Fernández-Montes Moraleda, Belén; San Román, Julio; Rodríguez-Lorenzo, Luís M

    2013-08-01

    Protein-surface interaction may determine the success or failure of an implanted device. Not much attention have been paid to the specific surface parametes of hydroxyapatite (OHAp) that modulates and determines the formation and potential activity of the layer of proteins that is first formed when the material get in contact with the host tissue. the influence of specific surface area (SSA), crystallite size (CS) and particle size (PS) of OHAp on the adsorption of proteins relevant for bone regeneration is evaluated in this article. OHAp have been prepared by a wet chemical reaction of Ca(OH)2 with H3PO4. One set of reactions included poly acrylic acid in the reactant solution to modify the properties of the powder. Fibrinogen (Fg) Fraction I, type I: from Human plasma, (67% Protein), and Fibronectin (Fn) from Human plasma were selected to perform the adsorption experiments. The analysis of protein adsorption was carried out by UV/Vis spectrometry. A lower SSA and a different aspect ratio are obtained when the acrylic acid is included in the reaction badge. The deconvolution of the amide I band on the Raman spectra of free and adsorbed proteins reveals that the interaction apatite-protein happens through the carboxylate groups of the proteins. The combined analysis of CS, SSA and PS should be considered on the design of OHAp materials intended to interact with proteins. Copyright © 2013 Wiley Periodicals, Inc.

  8. 75 FR 9012 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/U.S. Department of Health and...

    Science.gov (United States)

    2010-02-26

    ... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503), amended... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0052] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ U.S. Department of Health and Human Services (HHS), Administration for...

  9. A hybrid intermediate language between SSA and CPS

    DEFF Research Database (Denmark)

    Torrens, Paulo; Vasconcellos, Cristiano; Gonçalves, Ju

    2017-01-01

    passing style (CPS) lambda calculus has been used as intermediate language for functional language compilers, they are (almost) equivalent and it is possible to draw syntactic translations between them. This short paper aims to present an untyped intermediate language which may be interpreted as both SSA...... and CPS, in order to provide a common language for both imperative and functional compilers, as well to take advantage of optimizations designed for either one of the approaches. Finally, potential variants and research opportunities are discussed....

  10. Pore size dependent molecular adsorption of cationic dye in biomass derived hierarchically porous carbon.

    Science.gov (United States)

    Chen, Long; Ji, Tuo; Mu, Liwen; Shi, Yijun; Wang, Huaiyuan; Zhu, Jiahua

    2017-07-01

    Hierarchically porous carbon adsorbents were successfully fabricated from different biomass resources (softwood, hardwood, bamboo and cotton) by a facile two-step process, i.e. carbonization in nitrogen and thermal oxidation in air. Without involving any toxic/corrosive chemicals, large surface area of up to 890 m 2 /g was achieved, which is comparable to commercial activated carbon. The porous carbons with various surface area and pore size were used as adsorbents to investigate the pore size dependent adsorption phenomenon. Based on the density functional theory, effective (E-SSA) and ineffective surface area (InE-SSA) was calculated considering the geometry of used probing adsorbate. It was demonstrated that the adsorption capacity strongly depends on E-SSA instead of total surface area. Moreover, a regression model was developed to quantify the adsorption capacities contributed from E-SSA and InE-SSA, respectively. The applicability of this model has been verified by satisfactory prediction results on porous carbons prepared in this work as well as commercial activated carbon. Revealing the pore size dependent adsorption behavior in these biomass derived porous carbon adsorbents will help to design more effective materials (either from biomass or other carbon resources) targeting to specific adsorption applications. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. Determination of retinal surface area.

    Science.gov (United States)

    Nagra, Manbir; Gilmartin, Bernard; Thai, Ngoc Jade; Logan, Nicola S

    2017-09-01

    Previous attempts at determining retinal surface area and surface area of the whole eye have been based upon mathematical calculations derived from retinal photographs, schematic eyes and retinal biopsies of donor eyes. 3-dimensional (3-D) ocular magnetic resonance imaging (MRI) allows a more direct measurement, it can be used to image the eye in vivo, and there is no risk of tissue shrinkage. The primary purpose of this study is to compare, using T2-weighted 3D MRI, retinal surface areas for superior-temporal (ST), inferior-temporal (IT), superior-nasal (SN) and inferior-nasal (IN) retinal quadrants. An ancillary aim is to examine whether inter-quadrant variations in area are concordant with reported inter-quadrant patterns of susceptibility to retinal breaks associated with posterior vitreous detachment (PVD). Seventy-three adult participants presenting without retinal pathology (mean age 26.25 ± 6.06 years) were scanned using a Siemens 3-Tesla MRI scanner to provide T2-weighted MR images that demarcate fluid-filled internal structures for the whole eye and provide high-contrast delineation of the vitreous-retina interface. Integrated MRI software generated total internal ocular surface area (TSA). The second nodal point was used to demarcate the origin of the peripheral retina in order to calculate total retinal surface area (RSA) and quadrant retinal surface areas (QRSA) for ST, IT, SN, and IN quadrants. Mean spherical error (MSE) was -2.50 ± 4.03D and mean axial length (AL) 24.51 ± 1.57 mm. Mean TSA and RSA for the RE were 2058 ± 189 and 1363 ± 160 mm 2 , respectively. Repeated measures anova for QRSA data indicated a significant difference within-quadrants (P area/mm increase in AL. Although the differences between QRSAs are relatively small, there was evidence of concordance with reported inter-quadrant patterns of susceptibility to retinal breaks associated with PVD. The data allow AL to be converted to QRSAs, which will assist further

  12. Remote Ultra-low Light Imaging (RULLI) For Space Situational Awareness (SSA): Modeling And Simulation Results For Passive And Active SSA

    International Nuclear Information System (INIS)

    Thompson, David C.; Shirey, Robert L.; Roggemann, Michael C; Gudimetla, Rao

    2008-01-01

    Remote Ultra-Low Light Imaging detectors are photon limited detectors developed at Los Alamos National Laboratories. RULLI detectors provide a very high degree of temporal resolution for the arrival times of detected photoevents, but saturate at a photo-detection rate of about 10 6 photo-events per second. Rather than recording a conventional image, such as output by a charged coupled device (CCD) camera, the RULLI detector outputs a data stream consisting of the two-dimensional location, and time of arrival of each detected photo-electron. Hence, there is no need to select a specific exposure time to accumulate photo-events prior to the data collection with a RULLI detector this quantity can be optimized in post processing. RULLI detectors have lower peak quantum efficiency (from as low as 5% to perhaps as much as 40% with modern photocathode technology) than back-illuminated CCD's (80% or higher). As a result of these factors, and the associated analyses of signal and noise, we have found that RULLI detectors can play two key new roles in SSA: passive imaging of exceedingly dim objects, and three-dimensional imaging of objects illuminated with an appropriate pulsed laser. In this paper we describe the RULLI detection model, compare it to a conventional CCD detection model, and present analytic and simulation results to show the limits of performance of RULLI detectors used for SSA applications at AMOS field site

  13. The MELiSSA GreenMOSS Study: Preliminary Design Considerations for a Greenhouse Module on the Lunar Surface

    Science.gov (United States)

    Lobascio, Cesare; Paille, Christel; Lamantea, Matteo Maria; Boscheri, Giorgio; Rossetti, Vittorio

    Extended human presence on an extraterrestrial planetary surface will be made possible by the development of life support systems affordable in the long term. The key elements to support the goal will be the maximization of closure of air and water cycles, as well as the development of cost-effective and reliable hardware, including a careful strategic effort toward reduction of spare parts and consumables. Regenerative life support systems likely represent the final step toward long term sustainability of a space crew, allowing in situ food production and regeneration of organic waste. Referring to the MELiSSA loop, a key element for food production is the Higher Plant Compartment. The paper focuses on the preliminary design of a Greenhouse at the lunar South Pole, as performed within the “Greenhouse Module for Space System” (GreenMOSS) study, under a contract from the European Space Agency. The greenhouse is in support to a relatively small crew for provision of an energetic food complement. Resources necessary for the greenhouse such as water, carbon dioxide and nitrogen are assumed available, as required. The relevant mass and energy balances for incoming resources should be part of future studies, and should help integrate this element with the interfacing MELISSA compartments. Net oxygen production and harvested crop biomass from the greenhouse system will be quantified. This work presents the results of the two major trade-offs performed as part of this study: artificial vs natural illumination and monocrop vs multicrop solutions. Comparisons among possible design solutions were driven by the ALiSSE metric as far as practicable within this preliminary stage, considering mass and power parameters. Finally, the paper presents the mission duration threshold for determining the convenience of the designed solution with respect to other resources provision strategies

  14. Surface moisture estimation in urban areas

    Science.gov (United States)

    Jiang, Yitong

    Surface moisture is an important parameter because it modifies urban microclimate and surface layer meteorology. The primary objectives of this paper are: 1) to analyze the impact of surface roughness from buildings on surface moisture in urban areas; and 2) to quantify the impact of surface roughness resulting from urban trees on surface moisture. To achieve the objectives, two hypotheses were tested: 1) the distribution of surface moisture is associated with the structural complexity of buildings in urban areas; and 2) The distribution and change of surface moisture is associated with the distribution and vigor of urban trees. The study area is Indianapolis, Indiana, USA. In the part of the morphology of urban trees, Warren Township was selected due to the limitation of tree inventory data. To test the hypotheses, the research design was made to extract the aerodynamic parameters, such as frontal areas, roughness length and displacement height of buildings and trees from Terrestrial and Airborne LiDAR data, then to input the aerodynamic parameters into the urban surface energy balance model. The methodology was developed for comparing the impact of aerodynamic parameters from LiDAR data with the parameters that were derived empirically from land use and land cover data. The analytical procedures are discussed below: 1) to capture the spatial and temporal variation of surface moisture, daily and hourly Land Surface Temperature (LST) were downscaled from 4 km to 1 km, and 960 m to 30 m, respectively, by regression between LST and various components that impact LST; 2) to estimate surface moisture, namely soil moisture and evapotranspiration (ET), land surfaces were classified into soil, vegetation, and impervious surfaces, using Linear Spectral Mixture Analysis (LSMA); 3) aerodynamic parameters of buildings and trees were extracted from Airborne and Terrestrial LiDAR data; 4) the Temperature-Vegetation-Index (TVX) method, and the Two-Source-Energy-Balance (TSEB

  15. Effect of lime addition during sewage sludge treatment on characteristics of resulting SSA when it is used in cementitious materials.

    Science.gov (United States)

    Vouk, D; Nakic, D; Štirmer, N; Baricevic, A

    2017-02-01

    Final disposal of sewage sludge is important not only in terms of satisfying the regulations, but the aspect of choosing the optimal wastewater treatment technology, including the sludge treatment. In most EU countries, significant amounts of stabilized and dewatered sludge are incinerated, and sewage sludge ash (SSA) is generated as a by product. At the same time, lime is one of the commonly used additives in the sewage sludge treatment primarily to stabilize the sludge. In doing so, the question arose how desirable is such addition of lime if the sludge is subsequently incinerated, and the generated ash is further used in the production of cementitious materials. A series of mortars were prepared where 10-20% of the cement fraction was replaced by SSA. Since all three types of analyzed SSA (without lime, with lime added during sludge stabilization and with extra lime added during sludge incineration) yielded nearly same results, it can be concluded that if sludge incineration is accepted solution, lime addition during sludge treatment is unnecessary even from the standpoint of preserving the pozzolanic properties of the resulting SSA. Results of the research carried out on cement mortars point to the great possibilities of using SSA in concrete industry.

  16. Surface area-volume ratios in insects.

    Science.gov (United States)

    Kühsel, Sara; Brückner, Adrian; Schmelzle, Sebastian; Heethoff, Michael; Blüthgen, Nico

    2017-10-01

    Body mass, volume and surface area are important for many aspects of the physiology and performance of species. Whereas body mass scaling received a lot of attention in the literature, surface areas of animals have not been measured explicitly in this context. We quantified surface area-volume (SA/V) ratios for the first time using 3D surface models based on a structured light scanning method for 126 species of pollinating insects from 4 orders (Diptera, Hymenoptera, Lepidoptera, and Coleoptera). Water loss of 67 species was measured gravimetrically at very dry conditions for 2 h at 15 and 30 °C to demonstrate the applicability of the new 3D surface measurements and relevance for predicting the performance of insects. Quantified SA/V ratios significantly explained the variation in water loss across species, both directly or after accounting for isometric scaling (residuals of the SA/V ∼ mass 2/3 relationship). Small insects with a proportionally larger surface area had the highest water loss rates. Surface scans of insects to quantify allometric SA/V ratios thus provide a promising method to predict physiological responses, improving the potential of body mass isometry alone that assume geometric similarity. © 2016 Institute of Zoology, Chinese Academy of Sciences.

  17. The East Asian Development Experience: Policy Lessons, Implications, and Recommendations for Sub-Saharan Africa (SSA) Global Competitiveness

    OpenAIRE

    Ashford C. Chea

    2012-01-01

    The paper looks at the development experience of East Asia and draws lessons for Sub-Saharan Africa in building global competitiveness. It starts with a historical perspective of both regions’ developmental trajectories. This is followed by an analysis of the causes of East Asia’s superior economic performance and development and SSA underdevelopment. The article also draws policy lessons from East Asia development strategies for SSA global competitiveness. The paper ends with a presentation ...

  18. Isolating the effect of pore size distribution on electrochemical double-layer capacitance using activated fluid coke

    Science.gov (United States)

    Zuliani, Jocelyn E.; Tong, Shitang; Kirk, Donald W.; Jia, Charles Q.

    2015-12-01

    Electrochemical double-layer capacitors (EDLCs) use physical ion adsorption in the capacitive electrical double layer of high specific surface area (SSA) materials to store electrical energy. Previous work shows that the SSA-normalized capacitance increases when pore diameters are less than 1 nm. However, there still remains uncertainty about the charge storage mechanism since the enhanced SSA-normalized capacitance is not observed in all microporous materials. In previous studies, the total specific surface area and the chemical composition of the electrode materials were not controlled. The current work is the first reported study that systematically compares the performance of activated carbon prepared from the same raw material, with similar chemical composition and specific surface area, but different pore size distributions. Preparing samples with similar SSAs, but different pores sizes is not straightforward since increasing pore diameters results in decreasing the SSA. This study observes that the microporous activated carbon has a higher SSA-normalized capacitance, 14.1 μF cm-2, compared to the mesoporous material, 12.4 μF cm-2. However, this enhanced SSA-normalized capacitance is only observed above a threshold operating voltage. Therefore, it can be concluded that a minimum applied voltage is required to induce ion adsorption in these sub-nanometer micropores, which increases the capacitance.

  19. MELiSSA Food Characterization general approach and current status

    Science.gov (United States)

    Weihreter, Martin; Chaerle, Laury; Secco, Benjamin; Molders, Katrien; van der Straeten, Dominique; Duliere, Eric; Pieters, Serge; Maclean, Heather; Dochain, Denis; Quinet, Muriel; Lutts, Stanley; Graham, Thomas; Stasiak, Michael; Rondeau Vuk, Theresa; Zheng, Youbin; Dixon, Mike; Laniau, Martine; Larreture, Alain; Timsit, Michel; Aronne, Giovanna; Barbieri, Giancarlo; Buonomo, Roberta; Veronica; Paradiso, Roberta; de Pascale, Stafania; Galbiati, Massimo; Troia, A. R.; Nobili, Matteo; Bucchieri, Lorenzo; Page, Valérie; Feller, Urs; Lasseur, Christophe

    Higher plants play an important role in closed ecological life support systems as oxygen pro-ducers, carbon dioxide and water recyclers, and as a food source. For an integration of higher plant chambers into the MELiSSA (Micro Ecological Life Support System Alternative) loop, a detailed characterization and optimization of the full food production and preparation chain is needed. This implies the prediction and control of the nutritional quality of the final products consumed by the crew, the prediction of the wastes quality and quantity produced along the chain for further waste treatment (MELiSSA waste treatment) and the optimization of overall efficiencies. To reach this goal several issues have to be studied in an integrated manner: the physiological responses of crops to a range of environmental parameters, crop yield efficiencies and respective ratio and composition of edible and inedible biomass, the processability and storability of the produced food and last but not least composition of wastes in view of further degradation (fiber content). Within the Food Characterization (FC) project several compar-ative plant growth bench tests were carried out to obtain preliminary data regarding these aspects. Four pre-selected cultivars of each of the four energy-rich crops with worldwide usage -wheat, durum wheat, potato and soybean -were grown under well-characterized environmental conditions. The different cultivars of each species are screened for their performance in view of a closed loop application by parameter ranking. This comprises the characterization of edi-ble/inedible biomass ratio, nutritional quality, processability and overall performance under the specific conditions of hydroponic cultivation and artificial illumination. A second closely linked goal of the FC project is to develop a mechanistic physiological plant model, which will ease the integration of higher plants compartments in the MELiSSA concept by virtue of its predictive abilities

  20. Wetted surface area of recreational boats

    NARCIS (Netherlands)

    Bakker J; van Vlaardingen PLA; ICH; VSP

    2018-01-01

    The wetted surface area of recreational craft is often treated with special paint that prevents growth of algae and other organisms. The active substances in this paint (antifouling) are also emitted into the water. The extent of this emission is among others determined by the treated surface area.

  1. Preparation and characterization of PVA/SSA membranes with Al{sub 2}O{sub 3} nanoparticles for fuel cell applications; Preparacao de caracterizacao de membranas de PVAL/SSA na presenca de nanoparticulas de Al{sub 2}O{sub 3} para aplicacao em celulas de combustivel

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Paula N.; Pires, Alfredo T.N. [Grupo de Estudo em Materiais Polimericos - POLIMAT - UFSC, Florianopolis, SC (Brazil); Catarino, Margarida; Brandao, Lucia; Tanaka, Alfredo; Mendes, Adelio [Faculdade de Engenharia da Universidade do Porto, Porto (Portugal)

    2011-07-01

    In the present study, PVA/SSA membranes were prepared with and without the addition of Al{sub 2}O{sub 3} nanoparticles. Sulfosuccinic acid (SSA) was used as the crosslinking agent. Membranes were prepared with different amounts of SSA (26, 43 and 55 wt.%) and with 5 and 10 wt.% of nanoparticles. Crosslinking was performed at 90 degree C during 1.5 h. Membranes were analyzed by infrared spectroscopy, thermal analysis, water absorption, ion exchange capacity (IEC) and proton conductivity. The results showed that control of the crosslinking conditions, IEC value, water absorption and polymer structure are of significant importance to obtain a set of properties suitable for application in proton exchange membrane fuel cells. (author)

  2. L p -Dual geominimal surface area

    Directory of Open Access Journals (Sweden)

    Weidong Wang

    2011-01-01

    Full Text Available Abstract Lutwak proposed the notion of Lp -geominimal surface area according to the Lp -mixed volume. In this article, associated with the Lp -dual mixed volume, we introduce the Lp -dual geominimal surface area and prove some inequalities for this notion. 2000 Mathematics Subject Classification: 52A20 52A40.

  3. Contact area measurements on structured surfaces

    DEFF Research Database (Denmark)

    Kücükyildiz, Ömer Can; Jensen, Sebastian Hoppe Nesgaard; De Chiffre, Leonardo

    In connection with the use of brass specimens featuring structured surfaces in a tribology test, an algorithm was developed for automatic measurement of the contact area by optical means.......In connection with the use of brass specimens featuring structured surfaces in a tribology test, an algorithm was developed for automatic measurement of the contact area by optical means....

  4. Shock Hazard Prevention through Self-Healing Insulative Coating on SSA Metallic Bearings, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — The space suit assembly (SSA) contains metallic bearings at the wrist, neck, and waist, which are exposed to space environment, and pose a potential shock hazard....

  5. Sewage sludge ash (SSA) from large and small incineration plants as a potential source of phosphorus - Polish case study.

    Science.gov (United States)

    Smol, Marzena; Kulczycka, Joanna; Kowalski, Zygmunt

    2016-12-15

    The aim of this research is to present the possibility of using the sewage sludge ash (SSA) generated in incineration plants as a secondary source of phosphorus (P). The importance of issues related to P recovery from waste materials results from European Union (UE) legislation, which indicated phosphorus as a critical raw material (CRM). Due to the risks of a shortage of supply and its impact on the economy, which is greater than other raw materials, the proper management of phosphorus resources is required in order to achieve global P security. Based on available databases and literature, an analysis of the potential use of SSA for P-recovery in Poland was conducted. Currently, approx. 43,000 Mg/year of SSA is produced in large and small incineration plants and according to in the Polish National Waste Management Plan 2014 (NWMP) further steady growth is predicted. This indicates a great potential to recycle phosphorus from SSA and to reintroduce it again into the value chain as a component of fertilisers which can be applied directly on fields. The amount of SSA generated in installations, both large and small, varies and this contributes to the fact that new and different P recovery technology solutions must be developed and put into use in the years to come (e.g. mobile/stationary P recovery installations). The creation of a database focused on the collection and sharing of data about the amount of P recovered in EU and Polish installations is identified as a helpful tool in the development of an efficient P management model for Poland. Copyright © 2016 Elsevier Ltd. All rights reserved.

  6. Hand burns surface area: A rule of thumb.

    Science.gov (United States)

    Dargan, Dallan; Mandal, Anirban; Shokrollahi, Kayvan

    2018-03-11

    Rapid estimation of acute hand burns is important for communication, standardisation of assessment, rehabilitation and research. Use of an individual's own thumbprint area as a fraction of their total hand surface area was evaluated to assess potential utility in hand burn evaluation. Ten health professionals used an ink-covered dominant thumb pulp to cover the surfaces of their own non-dominant hand using the contralateral thumb. Thumbprints were assessed on the web spaces, sides of digits and dorsum and palm beyond the distal wrist crease. Hand surface area was estimated using the Banerjee and Sen method, and thumbprint ellipse area calculated to assess correlation. Mean estimated total hand surface area was 390.0cm 2 ±SD 51.5 (328.3-469.0), mean thumbprint ellipse area was 5.5cm 2 ±SD 1.3 (3.7-8.4), and mean estimated print number was 73.5±SD 11.0 (range 53.1-87.8, 95% CI 6.8). The mean observed number of thumbprints on one hand was 80.1±SD 5.9 (range 70.0-88.0, 95% CI 3.7), χ 2 =0.009. The combined mean of digital prints was 42, comprising a mean of two prints each on volar, dorsal, radial and ulnar digit surfaces, except volar middle and ring (3 prints each). Palmar prints were 15 (11-19), dorsal 15 (11-19), ulnar palm border 3, first web space 2, and second, third and fourth web spaces one each. Using the surface of the palm alone, excluding digits, as 0.5% of total body surface area, the area of one thumbprint was approximated as 1/30th of 1%. We have demonstrated how thumbprint area serves as a simple method for evaluating hand burn surface area. Copyright © 2018 Elsevier Ltd and ISBI. All rights reserved.

  7. Estimating surface area in early hominins.

    Directory of Open Access Journals (Sweden)

    Alan Cross

    Full Text Available Height and weight-based methods of estimating surface area have played an important role in the development of the current consensus regarding the role of thermoregulation in human evolution. However, such methods may not be reliable when applied to early hominins because their limb proportions differ markedly from those of humans. Here, we report a study in which this possibility was evaluated by comparing surface area estimates generated with the best-known height and weight-based method to estimates generated with a method that is sensitive to proportional differences. We found that the two methods yield indistinguishable estimates when applied to taxa whose limb proportions are similar to those of humans, but significantly different results when applied to taxa whose proportions differ from those of humans. We also found that the discrepancy between the estimates generated by the two methods is almost entirely attributable to inter-taxa differences in limb proportions. One corollary of these findings is that we need to reassess hypotheses about the role of thermoregulation in human evolution that have been developed with the aid of height and weight-based methods of estimating body surface area. Another is that we need to use other methods in future work on fossil hominin body surface areas.

  8. A Simple Proof of Cauchy's Surface Area Formula

    OpenAIRE

    Tsukerman, Emmanuel; Veomett, Ellen

    2016-01-01

    We give a short and simple proof of Cauchy's surface area formula, which states that the average area of a projection of a convex body is equal to its surface area up to a multiplicative constant in the dimension.

  9. Quantifying object and material surface areas in residences

    Energy Technology Data Exchange (ETDEWEB)

    Hodgson, Alfred T.; Ming, Katherine Y.; Singer, Brett C.

    2005-01-05

    The dynamic behavior of volatile organic compounds (VOCs) in indoor environments depends, in part, on sorptive interactions between VOCs in the gas phase and material surfaces. Since information on the types and quantities of interior material surfaces is not generally available, this pilot-scale study was conducted in occupied residences to develop and demonstrate a method for quantifying surface areas of objects and materials in rooms. Access to 33 rooms in nine residences consisting of bathrooms, bedroom/offices and common areas was solicited from among research group members living in the East San Francisco Bay Area. A systematic approach was implemented for measuring rooms and objects from 300 cm{sup 2} and larger. The ventilated air volumes of the rooms were estimated and surface area-to-volume ratios were calculated for objects and materials, each segregated into 20 or more categories. Total surface area-to-volume ratios also were determined for each room. The bathrooms had the highest total surface area-to-volume ratios. Bedrooms generally had higher ratios than common areas consisting of kitchens, living/dining rooms and transitional rooms. Total surface area-to-volume ratios for the 12 bedrooms ranged between 2.3 and 4.7 m{sup 2} m{sup -3}. The importance of individual objects and materials with respect to sorption will depend upon the sorption coefficients for the various VOC/materials combinations. When combined, the highly permeable material categories, which may contribute to significant interactions, had a median ratio of about 0.5 m{sup 2} m{sup -3} for all three types of rooms.

  10. MELiSSA third compartment: Nitrosomonas europaea and Nitrobacter winogradskyi axenic cultures in bioreactors

    Science.gov (United States)

    Cruvellier, Nelly; Lasseur, Christophe; Poughon, Laurent; Creuly, Catherine; Dussap, Gilles

    Nitrogen is a key element for the life and its balance on Earth is regulated by the nitrogen cycle. This loop includes several steps among which nitrification that permits the transformation of the ammonium into nitrate. The MELiSSA loop is an artificial ecosystem designed for life support systems (LSS). It is based on the carbon and nitrogen cycles and the recycling of the non-edible part of the higher plants and the waste produced by the crew. In this order, all the wastes are collected in the first compartment to degrade them into organic acids and CO2. These compounds are joining the second compartment which is a photoheterotrophic compartment where at the outlet an organic-free medium containing ammonium is produced. This solution will be the substrate of the third compartment where nitrification is done. This compartment has to oxidize the ammonium into nitrate, and this biological reaction needs two steps. In the MELiSSA loop, the nitrification is carried out by two bacteria: Nitrosomonas europaea ATCC® 19718™ which is oxidizing ammonia into nitrite and Nitrobacter winogradskyi ATCC® 25391™ which is producing nitrate from nitrite in the third compartment. These two bacteria are growing in axenic conditions on a fixed bed bioreactor filled with Biostyr® beads. The nitrogen compounds are controlled by Ionic Chromatography and colorimetric titration for each sample. The work presented here deals with the culture of both bacteria in pure cultures and mixed cultures in stirred and aerated bioreactors of different volumes. The first aim of our work is the characterization of the bacteria growth in bioreactors and in the nitrifying fixed-bed column. The experimental results confirm that the growth is slow; the maximal growth rate in suspended cultures is 0.054h-1 for Nitrosomonas europaea and 0.022h-1 for Nitrobacter winogradskyi. Mixed cultures are difficult to control and operate but one could be done for more than 500 hours. The characterization of the

  11. Advantageous use of SSA technique to observe effects of thickness, antioxidant and oxygen in gamma irradiated low density polyethylene

    Energy Technology Data Exchange (ETDEWEB)

    Perez, C.J., E-mail: cjperez@fi.mdp.edu.ar [Research Institute of Material Science and Technology (INTEMA), National Research Council (CONICET), Engineering Faculty, Mar del Plata University, Av. J.B. Justo 4302, 7600 Mar del Plata (Argentina); Failla, M.D. [Planta Piloto de Ingenieria Quimica-PLAPIQUI (UNS-CONICET), Camino ' La Carrindanga' Km 7, 8000 Bahia Blanca (Argentina); Carella, J.M. [Research Institute of Material Science and Technology (INTEMA), National Research Council (CONICET), Engineering Faculty, Mar del Plata University, Av. J.B. Justo 4302, 7600 Mar del Plata (Argentina)

    2012-06-20

    Highlights: Black-Right-Pointing-Pointer Information from successive self-nucleation and annealing technique is analyzed. Black-Right-Pointing-Pointer Oxygen and antioxidants reduce crosslinking efficiency by reaction with free radicals. Black-Right-Pointing-Pointer Recognizable differences are obtained in samples irradiated at different atmospheres. - Abstract: Information obtained from successive self-nucleation and annealing (SSA) technique is analyzed, paying special attention to the observable effects of samples thickness and antioxidant and oxygen concentrations. Molecular structure changes for low density polyethylene (LDPE) samples, irradiated under three different atmospheres for doses between 33 and 222 kGy were analyzed, with emphasis on the changes of longer polymethylene crystallizable lengths. Antioxidant and oxygen concentrations were varied for samples of different thickness to study the effects on degradation. The changes in the molecular structure were followed simultaneously by SSA and Infrared spectroscopy (FTIR) via carbonyl group concentration. Preliminary quantifications of the SSA technique sensitivity are also advanced.

  12. Quantification of lung surface area using computed tomography

    Directory of Open Access Journals (Sweden)

    Xing Li

    2010-10-01

    Full Text Available Abstract Objective To refine the CT prediction of emphysema by comparing histology and CT for specific regions of lung. To incorporate both regional lung density measured by CT and cluster analysis of low attenuation areas for comparison with histological measurement of surface area per unit lung volume. Methods The histological surface area per unit lung volume was estimated for 140 samples taken from resected lung specimens of fourteen subjects. The region of the lung sampled for histology was located on the pre-operative CT scan; the regional CT median lung density and emphysematous lesion size were calculated using the X-ray attenuation values and a low attenuation cluster analysis. Linear mixed models were used to examine the relationships between histological surface area per unit lung volume and CT measures. Results The median CT lung density, low attenuation cluster analysis, and the combination of both were important predictors of surface area per unit lung volume measured by histology (p Conclusion Combining CT measures of lung density and emphysematous lesion size provides a more accurate estimate of lung surface area per unit lung volume than either measure alone.

  13. Isoprene emission inventory for the BOREAS southern study area

    International Nuclear Information System (INIS)

    Westberg, H.; Lamb, B.; Kempf, K.; Allwine, G.

    2000-01-01

    The Boreal Ecosystem-Atmosphere Study (BOREAS) was designed to measure trace gas fluxes, nutrient cycling, hydrologic budgets and other ecosystem features in order to establish relationships between ecosystem processes and various global climate change scenarios. During the 1994 BOREAS field study isoprene and terpene emissions have been measured at several sites in the Southern Study Area (SSA). Ambient measurements were also made to help establish the chemical importance of these biogenic species in boreal atmosphere. The data was used to test and improve algorithms for predicting emission rates as a function of species, environmental conditions and biomass dynamics and to provide an expanded database describing the relationship of volatile organic compounds emissions to ecosystem dynamics. The study also sought to provide the foundation for improved understanding of physical exchange processes, and define hydrocarbon reactivity in the boundary layer at high latitudes. Details of the biogenic emission rate measurements made in the SSA are also discussed, including the creation of an isoprene emission inventory for the area. The study has been helpful in eliminating major sources of uncertainty associated with estimates of carbon loss due to isoprene emission on the BOREAS SSA. 28 refs., 4 tabs., 5 figs

  14. Surface area considerations for corroding N reactor fuel

    International Nuclear Information System (INIS)

    Johnson, A.B. Jr.; Pitner, A.L.

    1996-06-01

    The N Reactor fuel is corroding at sites where the Zircaloy cladding was damaged when the fuel was discharged from the reactor. Corroding areas are clearly visible on the fuel stored in open cans in the K East Basin. There is a need to estimate the area of the corroding uranium to analyze aspects of fuel behavior as it is transitioned. from current wet storage to dry storage. In this report, the factors that contribute to open-quotes trueclose quotes surface area are analyzed in terms of what is currently known about the N Reactor fuel. Using observations from a visual examinations of the fuel in the K East wet storage facility, a value for the corroding geometric area is estimated. Based on observations of corroding uranium and surface roughness values for other metals, a surface roughness factor is also estimated and applied to the corroding K East fuel to provide an estimated open-quotes trueclose quotes surface area. While the estimated area may be modified as additional data become available from fuel characterization studies, the estimate provides a basis to assess effects of exposed uranium metal surfaces on fuel behavior in operations involved in transitioning from wet to dry storage, during shipment and staging, conditioning, and dry interim storage

  15. Application of the nonlinear time series prediction method of genetic algorithm for forecasting surface wind of point station in the South China Sea with scatterometer observations

    International Nuclear Information System (INIS)

    Zhong Jian; Dong Gang; Sun Yimei; Zhang Zhaoyang; Wu Yuqin

    2016-01-01

    The present work reports the development of nonlinear time series prediction method of genetic algorithm (GA) with singular spectrum analysis (SSA) for forecasting the surface wind of a point station in the South China Sea (SCS) with scatterometer observations. Before the nonlinear technique GA is used for forecasting the time series of surface wind, the SSA is applied to reduce the noise. The surface wind speed and surface wind components from scatterometer observations at three locations in the SCS have been used to develop and test the technique. The predictions have been compared with persistence forecasts in terms of root mean square error. The predicted surface wind with GA and SSA made up to four days (longer for some point station) in advance have been found to be significantly superior to those made by persistence model. This method can serve as a cost-effective alternate prediction technique for forecasting surface wind of a point station in the SCS basin. (paper)

  16. Forecasting Energy-Related CO2 Emissions Employing a Novel SSA-LSSVM Model: Considering Structural Factors in China

    Directory of Open Access Journals (Sweden)

    Huiru Zhao

    2018-03-01

    Full Text Available Carbon dioxide (CO2 emissions forecasting is becoming more important due to increasing climatic problems, which contributes to developing scientific climate policies and making reasonable energy plans. Considering that the influential factors of CO2 emissions are multiplex and the relationships between factors and CO2 emissions are complex and non-linear, a novel CO2 forecasting model called SSA-LSSVM, which utilizes the Salp Swarm Algorithm (SSA to optimize the two parameters of the least squares support sector machine (LSSVM model, is proposed in this paper. The influential factors of CO2 emissions, including the gross domestic product (GDP, population, energy consumption, economic structure, energy structure, urbanization rate, and energy intensity, are regarded as the input variables of the SSA-LSSVM model. The proposed model is verified to show a better forecasting performance compared with the selected models, including the single LSSVM model, the LSSVM model optimized by the particle swarm optimization algorithm (PSO-LSSVM, and the back propagation (BP neural network model, on CO2 emissions in China from 2014 to 2016. The comparative analysis indicates the SSA-LSSVM model is greatly superior and has the potential to improve the accuracy and reliability of CO2 emissions forecasting. CO2 emissions in China from 2017 to 2020 are forecast combined with the 13th Five-Year Plan for social, economic and energy development. The comparison of CO2 emissions of China in 2020 shows that structural factors significantly affect CO2 emission forecasting results. The average annual growth of CO2 emissions slows down significantly due to a series of policies and actions taken by the Chinese government, which means China can keep the promise that greenhouse gas emissions will start to drop after 2030.

  17. VBA SSA Acc To Fed Rec Online (SAFRO) - Also known as Veterans Benefit Administration Query (VBAQ).

    Data.gov (United States)

    Social Security Administration — The purpose of this query is to provide SSA field office personnel with real-time access to military discharge data from the VA BIRLS database. This information is...

  18. AN EXAMPLE IN SURFACE AREA*

    Science.gov (United States)

    Goffman, Casper

    1969-01-01

    For length and area, a central fact is that the value of the length of a curve or the area of a surface, as given by the Lebesgue theory, is at least as great as that given by the classical formula, whenever the latter has meaning. This is now found not to be valid in higher dimensions. We give an example of a continuous mapping of the unit cube into itself for which the value given by the formula exceeds the three-dimensional Lebesgue area of the corresponding suface. PMID:16591750

  19. On the specific surface area of nanoporous materials

    NARCIS (Netherlands)

    Detsi, E.; De Jong, E.; Zinchenko, A.; Vukovic, Z.; Vukovic, I.; Punzhin, S.; Loos, K.; ten Brinke, G.; De Raedt, H. A.; Onck, P. R.; De Hosson, J. T. M.

    2011-01-01

    A proper quantification of the specific surface area of nanoporous materials is necessary for a better understanding of the properties that are affected by the high surface-area-to-volume ratio of nanoporous metals, nanoporous polymers and nanoporous ceramics. In this paper we derive an analytical

  20. BOREAS RSS-20 POLDER C-130 Measurements of Surface BRDF

    Science.gov (United States)

    Leroy, Marc; Hall, Forrest G. (Editor); Nickerson, Jaime (Editor); Smith, David E. (Technical Monitor)

    2000-01-01

    This Boreal Ecosystem-Atmosphere Study (BOREAS) Remote Sensing Science (RSS)-20 data set contains measurements of surface bidirectional reflectance distribution function (BRDF) made by the polarization and Directionality of Earth reflectances (POLDER) instrument over several surface types (pine, spruce, fen) of the BOREAS southern study area (SSA) during the 1994 intensive field campaigns (IFCs). Single-point BRDF values were acquired either from the NASA Ames Research Center (ARC) C-130 aircraft or from a NASA Wallops Flight Facility (WFF) helicopter. A related data set collected from the helicopter platform is available as is POLDER imagery acquired from the C-130. The data are stored in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884) or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  1. Sea spray aerosol chemical composition: elemental and molecular mimics for laboratory studies of heterogeneous and multiphase reactions.

    Science.gov (United States)

    Bertram, Timothy H; Cochran, Richard E; Grassian, Vicki H; Stone, Elizabeth A

    2018-04-03

    Sea spray aerosol particles (SSA), formed through wave breaking at the ocean surface, contribute to natural aerosol particle concentrations in remote regions of Earth's atmosphere, and alter the direct and indirect effects of aerosol particles on Earth's radiation budget. In addition, sea spray aerosol serves as suspended surface area that can catalyze trace gas reactions. It has been shown repeatedly that sea spray aerosol is heavily enriched in organic material compared to the surface ocean. The selective enrichment of organic material complicates the selection of representative molecular mimics of SSA for laboratory or computational studies. In this review, we first provide a short introduction to SSA formation processes and discuss chemical transformations of SSA that occur in polluted coastal regions and remote pristine air. We then focus on existing literature of the chemical composition of nascent SSA generated in controlled laboratory experiments and field investigations. We combine the evidence on the chemical properties of nascent SSA with literature measurements of SSA water uptake to assess SSA molecular composition and liquid water content. Efforts to speciate SSA organic material into molecular classes and specific molecules have led to the identification of saccharides, alkanes, free fatty acids, anionic surfactants, dicarboxylic acids, amino acids, proteinaceous matter, and other large macromolecules. However to date, less than 25% of the organic mass of nascent SSA has been quantified at a molecular level. As discussed here, quantitative measurements of size resolved elemental ratios, combined with determinations of water uptake properties, provides unique insight on the concentration of ions within SSA as a function of particle size, pointing to a controlling role for relative humidity and the hygroscopicity of SSA organic material at small particle diameters.

  2. Comparison of two different sea-salt aerosol schemes as implemented in air quality models applied to the Mediterranean Basin

    Directory of Open Access Journals (Sweden)

    P. Jiménez-Guerrero

    2011-05-01

    Full Text Available A number of attempts have been made to incorporate sea-salt aerosol (SSA source functions in chemistry transport models with varying results according to the complexity of the scheme considered. This contribution compares the inclusion of two different SSA algorithms in two chemistry transport models: CMAQ and CHIMERE. The main goal is to examine the differences in average SSA mass and composition and to study the seasonality of the prediction of SSA when applied to the Mediterranean area with high resolution for a reference year. Dry and wet deposition schemes are also analyzed to better understand the differences observed between both models in the target area. The applied emission algorithm in CHIMERE uses a semi-empirical formulation which obtains the surface emission rate of SSA as a function of the particle size and the surface wind speed raised to the power 3.41. The emission parameterization included within CMAQ is somehow more sophisticated, since fluxes of SSA are corrected with relative humidity. In order to evaluate their strengths and weaknesses, the participating algorithms as implemented in the chemistry transport models were evaluated against AOD measurements from Aeronet and available surface measurements in Southern Europe and the Mediterranean area, showing biases around −0.002 and −1.2 μg m−3, respectively. The results indicate that both models represent accurately the patterns and dynamics of SSA and its non-uniform behavior in the Mediterranean basin, showing a strong seasonality. The levels of SSA strongly vary across the Western and the Eastern Mediterranean, reproducing CHIMERE higher annual levels in the Aegean Sea (12 μg m−3 and CMAQ in the Gulf of Lion (9 μg m−3. The large difference found for the ratio PM2.5/total SSA in CMAQ and CHIMERE is also investigated. The dry and wet removal rates are very similar for both models despite the different schemes

  3. Persistent fetal sinus bradycardia associated with maternal anti-SSA/Ro and anti-SSB/La antibodies

    NARCIS (Netherlands)

    Chockalingam, Priya; Jaeggi, Edgar T.; Rammeloo, Lukas A.; Haak, Monique C.; Adama van Scheltema, Phebe N.; Breur, Johannes M. P. J.; Bartelings, Margot M.; Clur, Sally-Ann B.; Blom, Nico A.

    2011-01-01

    To study the clinical course and outcome of fetal sinus bradycardia (SB) due to maternal antibody-induced sinus node dysfunction. We reviewed the maternal, prenatal, and postnatal findings of fetuses with SB associated with elevated maternal anti-SSA/Ro and anti-SSB/La antibodies. Of the 6 cases

  4. SSA DISABILITY. SGA Levels Appear to Affect the Work Behavior of Relatively Few Beneficiaries, but More Data Needed

    National Research Council Canada - National Science Library

    Baucus, Max

    2002-01-01

    ... physical or mental impairment has earnings that exceed the Substantial Gainful Activity (SGA) level, which represents SSA's principal standard for determining whether a disabled individual is able to work...

  5. 77 FR 74913 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA...

    Science.gov (United States)

    2012-12-18

    ...; Computer Matching Program (Social Security Administration (SSA)/Office of Personnel Management (OPM.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub... computer matching involving the Federal government could be performed and adding certain protections for...

  6. Indexing aortic valve area by body surface area increases the prevalence of severe aortic stenosis

    DEFF Research Database (Denmark)

    Jander, Nikolaus; Gohlke-Bärwolf, Christa; Bahlmann, Edda

    2014-01-01

    To account for differences in body size in patients with aortic stenosis, aortic valve area (AVA) is divided by body surface area (BSA) to calculate indexed AVA (AVAindex). Cut-off values for severe stenosis are......To account for differences in body size in patients with aortic stenosis, aortic valve area (AVA) is divided by body surface area (BSA) to calculate indexed AVA (AVAindex). Cut-off values for severe stenosis are...

  7. OBSERVED ASTEROID SURFACE AREA IN THE THERMAL INFRARED

    Energy Technology Data Exchange (ETDEWEB)

    Nugent, C. R. [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Mainzer, A.; Masiero, J.; Bauer, J.; Kramer, E.; Sonnett, S. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Wright, E. L. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Grav, T. [Planetary Science Institute, Tucson, AZ (United States)

    2017-02-01

    The rapid accumulation of thermal infrared observations and shape models of asteroids has led to increased interest in thermophysical modeling. Most of these infrared observations are unresolved. We consider what fraction of an asteroid’s surface area contributes the bulk of the emitted thermal flux for two model asteroids of different shapes over a range of thermal parameters. The resulting observed surface in the infrared is generally more fragmented than the area observed in visible wavelengths, indicating high sensitivity to shape. For objects with low values of the thermal parameter, small fractions of the surface contribute the majority of thermally emitted flux. Calculating observed areas could enable the production of spatially resolved thermal inertia maps from non-resolved observations of asteroids.

  8. Assessment of dialyzer surface in online hemodiafiltration; objective choice of dialyzer surface area

    Directory of Open Access Journals (Sweden)

    Francisco Maduell

    2015-05-01

    Conclusion: The increase in 40% and 80% of dialyzer surface area entails an increase in convective volume of 6 and 16% respectively, showing minimal differences both in convective volume and clearance capacity when UFC was greater than 45 mL/h/mmHg. It is advisable to optimise dialyser efficiency to the smallest surface area possible, adjusting treatment prescription.

  9. Surface States and Effective Surface Area on Photoluminescent P-Type Porous Silicon

    Science.gov (United States)

    Weisz, S. Z.; Porras, A. Ramirez; Resto, O.; Goldstein, Y.; Many, A.; Savir, E.

    1997-01-01

    The present study is motivated by the possibility of utilizing porous silicon for spectral sensors. Pulse measurements on the porous-Si/electrolyte system are employed to determine the surface effective area and the surface-state density at various stages of the anodization process used to produce the porous material. Such measurements were combined with studies of the photoluminescence spectra. These spectra were found to shift progressively to the blue as a function of anodization time. The luminescence intensity increases initially with anodization time, reaches a maximum and then decreases with further anodization. The surface state density, on the other hand, increases with anodization time from an initial value of about 2 x 10(exp 12)/sq cm surface to about 1013 sq cm for the anodized surface. This value is attained already after -2 min anodization and upon further anodization remains fairly constant. In parallel, the effective surface area increases by a factor of 10-30. This behavior is markedly different from the one observed previously for n-type porous Si.

  10. 20 CFR 408.1205 - How can a State have SSA administer its State recognition payment program?

    Science.gov (United States)

    2010-04-01

    ... recognition payment program? 408.1205 Section 408.1205 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SPECIAL BENEFITS FOR CERTAIN WORLD WAR II VETERANS Federal Administration of State Recognition Payments § 408.1205 How can a State have SSA administer its State recognition payment program? A State (or...

  11. STEREOLOGICAL ESTIMATION OF SURFACE AREA FROM DIGITAL IMAGES

    Directory of Open Access Journals (Sweden)

    Johanna Ziegel

    2011-05-01

    Full Text Available A sampling design of local stereology is combined with a method from digital stereology to yield a novel estimator of surface area based on counts of configurations observed in a digitization of an isotropic 2- dimensional slice with thickness s. As a tool, a result of the second author and J. Rataj on infinitesimal increase of volumes of morphological transforms is refined and used. The proposed surface area estimator is asymptotically unbiased in the case of sets contained in the ball centred at the origin with radius s and in the case of balls centred at the origin with unknown radius. For general shapes bounds for the asymptotic expected relative worst case error are given. A simulation example is discussed for surface area estimation based on 2×2×2-configurations.

  12. Solar Flare Prediction Science-to-Operations: the ESA/SSA SWE A-EFFort Service

    Science.gov (United States)

    Georgoulis, Manolis K.; Tziotziou, Konstantinos; Themelis, Konstantinos; Magiati, Margarita; Angelopoulou, Georgia

    2016-07-01

    We attempt a synoptical overview of the scientific origins of the Athens Effective Solar Flare Forecasting (A-EFFort) utility and the actions taken toward transitioning it into a pre-operational service of ESA's Space Situational Awareness (SSA) Programme. The preferred method for solar flare prediction, as well as key efforts to make it function in a fully automated environment by coupling calculations with near-realtime data-downloading protocols (from the Solar Dynamics Observatory [SDO] mission), pattern recognition (solar active-region identification) and optimization (magnetic connectivity by simulated annealing) will be highlighted. In addition, the entire validation process of the service will be described, with its results presented. We will conclude by stressing the need for across-the-board efforts and synergistic work in order to bring science of potentially limited/restricted interest into realizing a much broader impact and serving the best public interests. The above presentation was partially supported by the ESA/SSA SWE A-EFFort project, ESA Contract No. 4000111994/14/D/MRP. Special thanks go to the ESA Project Officers R. Keil, A. Glover, and J.-P. Luntama (ESOC), M. Bobra and C. Balmer of the SDO/HMI team at Stanford University, and M. Zoulias at the RCAAM of the Academy of Athens for valuable technical help.

  13. Specific surface area evaluation method by using scanning electron microscopy

    International Nuclear Information System (INIS)

    Petrescu, Camelia; Petrescu, Cristian; Axinte, Adrian

    2000-01-01

    Ceramics are among the most interesting materials for a large category of applications, including both industry and health. Among the characteristic of the ceramic materials, the specific surface area is often difficult to evaluate.The paper presents a method of evaluation for the specific surface area of two ceramic powders by means of scanning electron microscopy measurements and an original method of computing the specific surface area.Cumulative curves are used to calculate the specific surface area under assumption that the values of particles diameters follow a normal logarithmic distribution. For two powder types, X7R and NPO the results are the following: - for the density ρ (g/cm 2 ), 5.5 and 6.0, respectively; - for the average diameter D bar (μm), 0.51 and 0.53, respectively; - for σ, 1.465 and 1.385, respectively; - for specific surface area (m 2 /g), 1.248 and 1.330, respectively. The obtained results are in good agreement with the values measured by conventional methods. (authors)

  14. 3-D image-based numerical computations of snow permeability: links to specific surface area, density, and microstructural anisotropy

    Directory of Open Access Journals (Sweden)

    N. Calonne

    2012-09-01

    Full Text Available We used three-dimensional (3-D images of snow microstructure to carry out numerical estimations of the full tensor of the intrinsic permeability of snow (K. This study was performed on 35 snow samples, spanning a wide range of seasonal snow types. For several snow samples, a significant anisotropy of permeability was detected and is consistent with that observed for the effective thermal conductivity obtained from the same samples. The anisotropy coefficient, defined as the ratio of the vertical over the horizontal components of K, ranges from 0.74 for a sample of decomposing precipitation particles collected in the field to 1.66 for a depth hoar specimen. Because the permeability is related to a characteristic length, we introduced a dimensionless tensor K*=K/res2, where the equivalent sphere radius of ice grains (res is computed from the specific surface area of snow (SSA and the ice density (ρi as follows: res=3/(SSA×ρi. We define K and K* as the average of the diagonal components of K and K*, respectively. The 35 values of K* were fitted to snow density (ρs and provide the following regression: K = (3.0 ± 0.3 res2 exp((−0.0130 ± 0.0003ρs. We noted that the anisotropy of permeability does not affect significantly the proposed equation. This regression curve was applied to several independent datasets from the literature and compared to other existing regression curves or analytical models. The results show that it is probably the best currently available simple relationship linking the average value of permeability, K, to snow density and specific surface area.

  15. Potential use of sewage sludge ash (SSA as a cement replacement in precast concrete blocks

    Directory of Open Access Journals (Sweden)

    Pérez-Carrión, M.

    2014-03-01

    Full Text Available The present study explored the technological feasibility of re-using sewage sludge ash (SSA as a Portland cement replacement in commercially manufactured pre cast concrete blocks. The blocks analysed were made to the guidelines laid down in Spain’s National Plan for Waste Water Treatment Plant Sludge, 2001–2006, and European Union specifications (CE marking for such products. Performance was compared in three families of blocks, with 0, 10 and 20% SSA. The findings proved that SSA is apt for pre cast concrete block manufacture and that, in addition to the economic and environmental benefits afforded, its use would improve certain of the properties of conventional block.El objetivo de esta investigación es estudiar el uso potencial de las cenizas de lodos de depuradora (CLD, como sustitución del cemento Portland en bloques de hormigón prefabricados, de forma que se pueda lograr una revalorización de este material de desecho mediante este procedimiento. La metodología utilizada en este trabajo se rige por las directrices del Plan Nacional Español de Lodos de Aguas Residuales de 2001–2006, y por las exigencias del Consejo Europeo (marcado CE, que es obligatorio para este tipo de productos. Se han utilizado dos niveles de sustitución de cemento (10% y 20%, y todos los resultados han sido referidos a las muestras control. Los resultados obtenidos muestran que es posible utilizar una sustitución parcial del cemento por CLD, en la fabricación de bloques de hormigón prefabricados, y por lo tanto, se pueden conseguir beneficios económicos y ambientales, así como la mejora de una serie de propiedades.

  16. Neurodevelopment in children with and without congenital heart block born to anti-Ro/SSA-positive mothers.

    Science.gov (United States)

    Skog, Amanda; Tingström, Joanna; Salomonsson, Stina; Sonesson, Sven-Erik; Wahren-Herlenius, Marie

    2013-01-01

    To define factors influencing neurodevelopment in children with and without complete congenital heart block (CHB) born to mothers with Ro/SSA autoantibodies. Medical records of a population-based cohort of siblings with (n = 60) and without (n = 54) CHB born 1974-2009 to anti-Ro/SSA-positive mothers were retrieved from children primary healthcare centres and school health services and used to extract data on neurodevelopment. Impaired neurodevelopment was reported in 16% of the children (18/114) during the follow-up time of 13.0 (8.2-17.5) years, median (quartiles). Reported problems included speech (9%), motor (8%) and learning (8%) impairment, attention deficit (5%) and behavioural impairment (4%). Impairment in motor skill development was more common in boys (p influenced by maternal SLE (p influenced by both maternal SLE (p influence neurodevelopment. Follow-up of neurodevelopment should therefore be considered for children with CHB, especially if the mother is diagnosed with SLE. ©2012 The Author(s)/Acta Paediatrica ©2012 Foundation Acta Paediatrica.

  17. A review of plutonium oxalate decomposition reactions and effects of decomposition temperature on the surface area of the plutonium dioxide product

    International Nuclear Information System (INIS)

    Orr, R.M.; Sims, H.E.; Taylor, R.J.

    2015-01-01

    Plutonium (IV) and (III) ions in nitric acid solution readily form insoluble precipitates with oxalic acid. The plutonium oxalates are then easily thermally decomposed to form plutonium dioxide powder. This simple process forms the basis of current industrial conversion or ‘finishing’ processes that are used in commercial scale reprocessing plants. It is also widely used in analytical or laboratory scale operations and for waste residues treatment. However, the mechanisms of the thermal decompositions in both air and inert atmospheres have been the subject of various studies over several decades. The nature of intermediate phases is of fundamental interest whilst understanding the evolution of gases at different temperatures is relevant to process control. The thermal decomposition is also used to control a number of powder properties of the PuO_2 product that are important to either long term storage or mixed oxide fuel manufacturing. These properties are the surface area, residual carbon impurities and adsorbed volatile species whereas the morphology and particle size distribution are functions of the precipitation process. Available data and experience regarding the thermal and radiation-induced decompositions of plutonium oxalate to oxide are reviewed. The mechanisms of the thermal decompositions are considered with a particular focus on the likely redox chemistry involved. Also, whilst it is well known that the surface area is dependent on calcination temperature, there is a wide variation in the published data and so new correlations have been derived. Better understanding of plutonium (III) and (IV) oxalate decompositions will assist the development of more proliferation resistant actinide co-conversion processes that are needed for advanced reprocessing in future closed nuclear fuel cycles. - Highlights: • Critical review of plutonium oxalate decomposition reactions. • New analysis of relationship between SSA and calcination temperature. • New SEM

  18. Characterizing the sorption of polybrominated diphenyl ethers (PBDEs) to cotton and polyester fabrics under controlled conditions

    Energy Technology Data Exchange (ETDEWEB)

    Saini, Amandeep [Department of Physical and Environmental Sciences, University of Toronto Scarborough, 1265 Military trail, Toronto, ON M1C 1A4 (Canada); Rauert, Cassandra [School of Geography, Earth and Environmental Sciences, University of Birmingham, Birmingham B15 2TT (United Kingdom); Simpson, Myrna J. [Department of Physical and Environmental Sciences, University of Toronto Scarborough, 1265 Military trail, Toronto, ON M1C 1A4 (Canada); Harrad, Stuart [School of Geography, Earth and Environmental Sciences, University of Birmingham, Birmingham B15 2TT (United Kingdom); Diamond, Miriam L., E-mail: miriam.diamond@utoronto.ca [Department of Earth Sciences, 22 Russell Street, University of Toronto, Toronto, ON M5S 3B1 (Canada); Department of Physical and Environmental Sciences, University of Toronto Scarborough, 1265 Military trail, Toronto, ON M1C 1A4 (Canada)

    2016-09-01

    Cotton and polyester, physically and chemically different fabrics, were characterized for sorption of gas-phase polybrominated diphenyl ethers (PBDEs). Scanning electron microscopic (SEM) images and BET specific surface area (BET-SSA) analysis showed cotton's high microsurface area; NMR analysis showed richness of hexose- and aromatic-carbon in cotton and polyester, respectively. Cotton and polyester sorbed similar concentrations of gas-phase PBDEs in chamber studies, when normalized to planar surface area. However, polyester concentrations were 20–50 times greater than cotton when normalized to BET-SSA, greater than the 10 times difference in BET-SSA. The difference in sorption between cotton and polyester is hypothesized to be due to ‘dilution’ due to cotton's large BET-SSA and/or greater affinity of PBDEs for aromatic-rich polyester. Similar fabric-air area normalized distribution coefficients (K'{sub D}, 10{sup 3} to 10{sup 4} m) for cotton and polyester support air-side controlled uptake under non-equilibrium conditions. K'{sub D} values imply that 1 m{sup 2} of cotton or polyester fabrics would sorb gas-phase PBDEs present in 10{sup 3} to 10{sup 4} m{sup 3} of equivalent air volume at room temperature over one week, assuming similar air flow conditions. Sorption of PBDEs to fabrics has implications for their fate indoors and human exposure. - Highlights: • Sorption of gas-phase PBDEs by cotton and polyester fabrics • Similar sorption to cotton and polyester per unit planar surface area • Greater sorption by polyester/BET-SSA; cotton's dilution or polyester’s affinity • 1 m{sup 2} fabric sorbs PBDEs in 10{sup 3} to 10{sup 4} m{sup 3} of equivalent air volume • Clothing likely a large indoor sink of PBDEs and influence human exposure.

  19. Clay mineralogy in different geomorphic surfaces in sugarcane areas

    Science.gov (United States)

    Camargo, L.; Marques, J., Jr.

    2012-04-01

    The crystallization of the oxides and hydroxides of iron and aluminum and kaolinite of clay fraction is the result of pedogenetic processes controlled by the relief. These minerals have influence on the physical and chemical attributes of soil and exhibit spatial dependence. The pattern of spatial distribution is influenced by forms of relief as the geomorphic surfaces. In this sense, the studies aimed at understanding the relationship between relief and the distribution pattern of the clay fraction attributes contribute to the delineation of specific areas of management in the field. The objective of this study was to evaluate the spatial distribution of oxides and hydroxides of iron and aluminum and kaolinite of clay fraction and its relationship with the physical and chemical attributes in different geomorphic surfaces. Soil samples were collected in a transect each 25 m (100 samples) and in the sides of the same (200 samples) as well as an area of 500 ha (1 sample each six hectare). Geomorphic surfaces (GS) in the transect were mapped in detail to support mapping the entire area. The soil samples were taken to the laboratory for chemical, physical, and mineralogical analysis, and the pattern of spatial distribution of soil attributes was obtained by statistics and geostatistics. The GS I is considered the oldest surface of the study area, with depositional character, and a slope ranging from 0 to 4%. GS II and III are considered to be eroded, and the surface II plan a gentle slope that extends from the edge of the surface until the beginning of I and III. The crystallographic characteristics of the oxides and hydroxides of iron and aluminum and kaolinite showed spatial dependence and the distribution pattern corresponding to the limits present of the GS in the field. Surfaces I and II showed the best environments to the degree of crystallinity of hematite and the surface III to the greatest degree of crystallinity of goethite agreeing to the pedoenvironment

  20. MCO gas composition for low reactive surface areas

    International Nuclear Information System (INIS)

    Packer, M.J.

    1998-01-01

    This calculation adjusts modeled output (HNF-SD-SNF-TI-040, Rev. 2) by considering lower reactive fuel surface areas and by increasing the input helium backfill overpressure from 0.5 to 1.5 atm (2.5 atm abs) to verify that MCO gas-phase oxygen concentrations can remain below 4 mole % over a 40 year interim period under a worst case condition of zero reactive surface area. Added backfill gas will dilute any gases generated during interim storage and is a strategy within the current design capability. The zero reactive surface area represents a hypothetical worst case example where there is no fuel scrap and/or damaged spent fuel rods in an MCO. Also included is a hypothetical case where only K East fuel exists in an MCO with an added backfill overpressure of 0.5 atm (1.5 atm abs)

  1. Effects of surface roughening of Nafion 117 on the mechanical and physicochemical properties of ionic polymer-metal composite (IPMC) actuators

    Science.gov (United States)

    Wang, Yanjie; Zhu, Zicai; Liu, Jiayu; Chang, Longfei; Chen, Hualing

    2016-08-01

    In this paper, the surface of a Nafion membrane was roughened by the sandblasting method, mainly considering the change of sandblasting time and powder size. The roughened surfaces were characterized in terms of their topography from the confocal laser scanning microscope (CLSM) and SEM. The key surface parameters, such as Sa (the arithmetical mean deviation of the specified surface profile), SSA (the surface area ratio before and after roughening) and the area measurement on the histogram from the CLSM images, were extracted and evaluated from the roughened membranes. Also, the detailed change in surface and interfacial electrodes were measured and discussed together with the surface resistance, equivalent modulus, capacitance and performances of IPMC actuators based on the roughened membranes. The results show that a suitable sandblasting condition, resulting in the decrease in the bending stiffness and the increase in the interface area closely related to the capacitance, can effectively increase the electromechanical responses of IPMCs. Although the surface roughening by sandblasting caused a considerable lowering of mechanical strength, it was very effective for enlarging the interfacial area between Nafion membrane and the electrode layers, and for forming a penetrated electrode structure, which facilitated improvement of the surface resistance and capacitance characteristics of IPMCs. In this work, a quantitative relationship was built between the topography of Nafion membrane surface and electromechanical performance of IPMCs by means of sandblasting.

  2. Assessment of dialyzer surface in online hemodiafiltration; objective choice of dialyzer surface area

    OpenAIRE

    Francisco Maduell; Raquel Ojeda; Marta Arias-Guillén; Giannina Bazan; Manel Vera; Néstor Fontseré; Elisabeth Massó; Miquel Gómez; Lida Rodas; Mario Jiménez-Hernández; Gastón Piñeiro; Nayra Rico

    2015-01-01

    Introduction: Online haemodiafiltration (OL-HDF) is most effective technique; several randomised studies and meta-analyses have shown a reduction in mortality, with a directly related association with convective volume. At present, it is not properly established whether the increasing in dialyser surface area may suppose better outcomes in terms of convective and clearance efficacy. The purpose of the study was to assess the effect of increase in dialyser surface area on the convective volume...

  3. Use of Sugarcane Bagasse with Different Particle Sizes to Determine the Relationship between Physical Properties and Enzymatic Hydrolysis

    Directory of Open Access Journals (Sweden)

    Jingbo Li

    2016-04-01

    Full Text Available The supramolecular structures of a substrate, such as crystallinity, specific surface area, average pore size, and cellulase adsorption capacity, etc., affect the enzymatic hydrolysis of a lignocellulosic biomass. It is unclear which of these factors is most important for efficient hydrolysis. To eliminate the influence of the hemicellulose content and the lignin, sugarcane bagasse samples with the same cellulose, hemicellulose, and lignin content but with different particle sizes were used as substrates to investigate the relationship between physical properties and enzymatic conversion efficiency. When the content of hemicellulose and lignin was not significantly different, the decrease in the crystallinity index (CrI and the increase in the specific surface area (SSA, cellulase adsorption, average pore size, and the cellulase adsorption per SSA could give rise to higher enzymatic convertibility. The effects of the CrI and the average pore size were more pronounced than the effects of the SSA, the cellulase adsorption capacity, and the cellulase adsorption per SSA. According to the developed formula, the CrI was more influential than the average pore size under the specific conditions.

  4. Lage-area planar RF plasma productions by surface waves

    International Nuclear Information System (INIS)

    Nonaka, S.

    1994-01-01

    Large-area rf plasmas are confirmed to be produced by means of RF discharges inside a large-area dielectric tube. The plasma space is 73 cm x 176 cm and 2.5 cm. The plasma is thought to be produced by an odd plasma-surface wave (PSW ο ) in case of using large-area electrodes and by an even plasma-surface wave (PSW ο ) in case of without the electrodes. (author). 7 refs, 4 figs

  5. Comparison of different methods to retrieve optical-equivalent snow grain size in central Antarctica

    Directory of Open Access Journals (Sweden)

    T. Carlsen

    2017-11-01

    Full Text Available The optical-equivalent snow grain size affects the reflectivity of snow surfaces and, thus, the local surface energy budget in particular in polar regions. Therefore, the specific surface area (SSA, from which the optical snow grain size is derived, was observed for a 2-month period in central Antarctica (Kohnen research station during austral summer 2013/14. The data were retrieved on the basis of ground-based spectral surface albedo measurements collected by the COmpact RAdiation measurement System (CORAS and airborne observations with the Spectral Modular Airborne Radiation measurement sysTem (SMART. The snow grain size and pollution amount (SGSP algorithm, originally developed to analyze spaceborne reflectance measurements by the MODerate Resolution Imaging Spectroradiometer (MODIS, was modified in order to reduce the impact of the solar zenith angle on the retrieval results and to cover measurements in overcast conditions. Spectral ratios of surface albedo at 1280 and 1100 nm wavelength were used to reduce the retrieval uncertainty. The retrieval was applied to the ground-based and airborne observations and validated against optical in situ observations of SSA utilizing an IceCube device. The SSA retrieved from CORAS observations varied between 27 and 89 m2 kg−1. Snowfall events caused distinct relative maxima of the SSA which were followed by a gradual decrease in SSA due to snow metamorphism and wind-induced transport of freshly fallen ice crystals. The ability of the modified algorithm to include measurements in overcast conditions improved the data coverage, in particular at times when precipitation events occurred and the SSA changed quickly. SSA retrieved from measurements with CORAS and MODIS agree with the in situ observations within the ranges given by the measurement uncertainties. However, SSA retrieved from the airborne SMART data slightly underestimated the ground-based results.

  6. Comparison of different methods to retrieve optical-equivalent snow grain size in central Antarctica

    Science.gov (United States)

    Carlsen, Tim; Birnbaum, Gerit; Ehrlich, André; Freitag, Johannes; Heygster, Georg; Istomina, Larysa; Kipfstuhl, Sepp; Orsi, Anaïs; Schäfer, Michael; Wendisch, Manfred

    2017-11-01

    The optical-equivalent snow grain size affects the reflectivity of snow surfaces and, thus, the local surface energy budget in particular in polar regions. Therefore, the specific surface area (SSA), from which the optical snow grain size is derived, was observed for a 2-month period in central Antarctica (Kohnen research station) during austral summer 2013/14. The data were retrieved on the basis of ground-based spectral surface albedo measurements collected by the COmpact RAdiation measurement System (CORAS) and airborne observations with the Spectral Modular Airborne Radiation measurement sysTem (SMART). The snow grain size and pollution amount (SGSP) algorithm, originally developed to analyze spaceborne reflectance measurements by the MODerate Resolution Imaging Spectroradiometer (MODIS), was modified in order to reduce the impact of the solar zenith angle on the retrieval results and to cover measurements in overcast conditions. Spectral ratios of surface albedo at 1280 and 1100 nm wavelength were used to reduce the retrieval uncertainty. The retrieval was applied to the ground-based and airborne observations and validated against optical in situ observations of SSA utilizing an IceCube device. The SSA retrieved from CORAS observations varied between 27 and 89 m2 kg-1. Snowfall events caused distinct relative maxima of the SSA which were followed by a gradual decrease in SSA due to snow metamorphism and wind-induced transport of freshly fallen ice crystals. The ability of the modified algorithm to include measurements in overcast conditions improved the data coverage, in particular at times when precipitation events occurred and the SSA changed quickly. SSA retrieved from measurements with CORAS and MODIS agree with the in situ observations within the ranges given by the measurement uncertainties. However, SSA retrieved from the airborne SMART data slightly underestimated the ground-based results.

  7. Development of cortical thickness and surface area in autism spectrum disorder

    Directory of Open Access Journals (Sweden)

    Vincent T. Mensen

    2017-01-01

    Full Text Available Autism spectrum disorder (ASD is a neurodevelopmental disorder often associated with changes in cortical volume. The constituents of cortical volume – cortical thickness and surface area – have separable developmental trajectories and are related to different neurobiological processes. However, little is known about the developmental trajectories of cortical thickness and surface area in ASD. In this magnetic resonance imaging (MRI study, we used an accelerated longitudinal design to investigate the cortical development in 90 individuals with ASD and 90 typically developing controls, aged 9 to 20 years. We quantified cortical measures using the FreeSurfer software package, and then used linear mixed model analyses to estimate the developmental trajectories for each cortical measure. Our primary finding was that the development of surface area follows a linear trajectory in ASD that differs from typically developing controls. In typical development, we found a decline in cortical surface area between the ages of 9 and 20 that was absent in ASD. We found this pattern in all regions where developmental trajectories for surface area differed between groups. When we applied a more stringent correction that takes the interdependency of measures into account, this effect on cortical surface area retained significance for left banks of superior temporal sulcus, postcentral area, and right supramarginal area. These areas have previously been implicated in ASD and are involved in the interpretation and processing of audiovisual social stimuli and distinction between self and others. Although some differences in cortical volume and thickness were found, none survived the more stringent correction for multiple testing. This study underscores the importance of distinguishing between cortical surface area and thickness in investigating cortical development, and suggests the development of cortical surface area is of importance to ASD.

  8. Rapid fabrication of large-area, corrosion-resistant superhydrophobic Mg alloy surfaces.

    Science.gov (United States)

    Xu, Wenji; Song, Jinlong; Sun, Jing; Lu, Yao; Yu, Ziyuan

    2011-11-01

    A superhydrophobic magnesium (Mg) alloy surface was successfully fabricated via a facile electrochemical machining process, and subsequently covered with a fluoroalkylsilane (FAS) film. The surface morphologies and chemical compositions were investigated using a scanning electron microscope (SEM) equipped with an energy-dispersive spectroscopy (EDS) and a Fourier-transform infrared spectrophotometer (FTIR). The results show hierarchal rough structures and an FAS film with a low surface energy on the Mg alloy surfaces, which confers good superhydrophobicity with a water contact angle of 165.2° and a water tilting angle of approximately 2°. The processing conditions, such as the processing time and removal rate per unit area at a constant removal mass per unit area, were investigated to determine their effects on the superhydrophobicity. Interestingly, when the removal mass per unit area is constant at approximately 11.10 mg/cm(2), the superhydrophobicity does not change with the removal rate per unit area. Therefore, a superhydrophobic Mg alloy surface can be rapidly fabricated based on this property. A large-area superhydrophobic Mg alloy surface was also fabricated for the first time using a small-area moving cathode. The corrosion resistance and durability of the superhydrophobic surfaces were also examined.

  9. Particle surface area and bacterial activity in recirculating aquaculture systems

    DEFF Research Database (Denmark)

    Pedersen, Per Bovbjerg; von Ahnen, Mathis; Fernandes, Paulo

    2017-01-01

    Suspended particles in recirculating aquaculture systems (RAS) provide surface area that can be colonized by bacteria. More particles accumulate as the intensity of recirculation increases thus potentially increasing the bacterial carrying capacity of the systems. Applying a recent, rapid, culture...... but may provide significant surface area. Hence, the study substantiates that particles in RAS provide surface area supporting bacterial activity, and that particles play a key role in controlling the bacterial carrying capacity at least in less intensive RAS. Applying fast, culture-independent techniques......-independent fluorometric detection method (Bactiquant®) for measuring bacterial activity, the current study explored the relationship between total particle surface area (TSA, derived from the size distribution of particles >5 μm) and bacterial activity in freshwater RAS operated at increasing intensity of recirculation...

  10. Monitoring System for ALICE Surface Areas

    CERN Document Server

    Demirbasci, Oguz

    2016-01-01

    I have been at CERN for 12 weeks within the scope of Summer Student Programme working on a monitoring system project for surface areas of the ALICE experiment during this period of time. The development and implementation of a monitoring system for environmental parameters in the accessible areas where a cheap hardware setup can be deployed were aim of this project. This report explains how it was developed by using Arduino, Raspberry PI, WinCC OA and DIM protocol.

  11. 75 FR 54213 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Personnel Management...

    Science.gov (United States)

    2010-09-03

    ... 1021 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub... computer matching involving the Federal government could be performed and adding certain protections for...

  12. Function of SSA subfamily of Hsp70 within and across species varies widely in complementing Saccharomyces cerevisiae cell growth and prion propagation.

    Directory of Open Access Journals (Sweden)

    Deepak Sharma

    2009-08-01

    Full Text Available The cytosol of most eukaryotic cells contains multiple highly conserved Hsp70 orthologs that differ mainly by their spatio-temporal expression patterns. Hsp70s play essential roles in protein folding, transport or degradation, and are major players of cellular quality control processes. However, while several reports suggest that specialized functions of Hsp70 orthologs were selected through evolution, few studies addressed systematically this issue.We compared the ability of Ssa1p-Ssa4p from Saccharomyces cerevisiae and Ssa5p-Ssa8p from the evolutionary distant yeast Yarrowia lipolytica to perform Hsp70-dependent tasks when expressed as the sole Hsp70 for S. cerevisiae in vivo. We show that Hsp70 isoforms (i supported yeast viability yet with markedly different growth rates, (ii influenced the propagation and stability of the [PSI(+] and [URE3] prions, but iii did not significantly affect the proteasomal degradation rate of CFTR. Additionally, we show that individual Hsp70 orthologs did not induce the formation of different prion strains, but rather influenced the aggregation properties of Sup35 in vivo. Finally, we show that [URE3] curing by the overexpression of Ydj1p is Hsp70-isoform dependent.Despite very high homology and overlapping functions, the different Hsp70 orthologs have evolved to possess distinct activities that are required to cope with different types of substrates or stress situations. Yeast prions provide a very sensitive model to uncover this functional specialization and to explore the intricate network of chaperone/co-chaperone/substrates interactions.

  13. Size and surface AREA analysis of some metallic and intermetallic powders

    International Nuclear Information System (INIS)

    Elmasry, M.A.A.; Elsayed, A.A.; Abadir, M.F.

    1988-01-01

    The powder characterization of three intermetallic compounds ( Cr B, B 4 c and S ib 4 ) and three metallic powders (Fe, Co, and Ni) has been performed. This included the determination of powder density, chemical analysis, impurity analysis, shape factor, particle size analysis and specific surface area. The particle size analysis for the six powders was carried out using three techniques, namely; the 0-23, the microtrac and the fisher sub sieve and size. It was found that the analysis of the two powders and deviates from the log-normal probability distribution and the deviation was corrected. The specific surface area of the powders was measured using the high speed surface area analysis (BET method), and it was also calculated from surface area analysis findings, the BET technique was found to give the highest specific surface area values, and was attributed to the inclusion of internal porosity in the measurement. 8 fig., 10 tab

  14. 76 FR 21091 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Centers for Medicare & Medicaid...

    Science.gov (United States)

    2011-04-14

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching...: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...), as amended, (Pub. L. 100-503, the Computer Matching and Privacy Protection Act (CMPPA) of 1988), the...

  15. 76 FR 71417 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Law Enforcement Agencies (LEA...

    Science.gov (United States)

    2011-11-17

    ...; Computer Matching Program (SSA/ Law Enforcement Agencies (LEA)) Match Number 5001 AGENCY: Social Security... protections for such persons. The Privacy Act, as amended, regulates the use of computer matching by Federal... accordance with the Privacy Act of 1974, as amended by the Computer Matching and Privacy Protection Act of...

  16. Surface Area, and Oxidation Effects on Nitridation Kinetics of Silicon Powder Compacts

    Science.gov (United States)

    Bhatt, R. T.; Palczer, A. R.

    1998-01-01

    Commercially available silicon powders were wet-attrition-milled from 2 to 48 hr to achieve surface areas (SA's) ranging from 1.3 to 70 sq m/g. The surface area effects on the nitridation kinetics of silicon powder compacts were determined at 1250 or 1350 C for 4 hr. In addition, the influence of nitridation environment, and preoxidation on nitridation kinetics of a silicon powder of high surface area (approximately equals 63 sq m/g) was investigated. As the surface area increased, so did the percentage nitridation after 4 hr in N2 at 1250 or 1350 C. Silicon powders of high surface area (greater than 40 sq m/g) can be nitrided to greater than 70% at 1250 C in 4 hr. The nitridation kinetics of the high-surface-area powder compacts were significantly delayed by preoxidation treatment. Conversely, the nitridation environment had no significant influence on the nitridation kinetics of the same powder. Impurities present in the starting powder, and those accumulated during attrition milling, appeared to react with the silica layer on the surface of silicon particles to form a molten silicate layer, which provided a path for rapid diffusion of nitrogen and enhanced the nitridation kinetics of high surface area silicon powder.

  17. 78 FR 37875 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Bureau of the Fiscal Service...

    Science.gov (United States)

    2013-06-24

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988... computer matching involving the Federal government could be performed and adding certain protections for...

  18. Comment s'inventer un père écrivain: Albert camus chez Maïssa Bey

    NARCIS (Netherlands)

    Rosello, M.

    2015-01-01

    This article focuses on the role played by Camus in Maïssa Bey’s work. Focusing on the ambivalent and paradoxical place he occupies in Au commencement était la mer and l’Ombre d’un homme qui marche au soleil, I analyse the construction of the father or rather Bey’s definition of fathers. The

  19. Validation of IPS Single-Station Analysis (SSA) Using MEXART Routines in Multi-Station Spectra. Comparison with Cross Correlation Function (CCF) Analysis.

    Science.gov (United States)

    Bisi, M. M.; Chang, O.; Gonzalez-Esparza, A.; Fallows, R. A.; Aguilar-Rodriguez, E.

    2017-12-01

    The phenomenon of Interplanetary Scintillation (IPS) occurs from the scattering of radio waves coming from compact radio sources that cross electron density fluctuations in the interplanetary medium. By analyzing these fluctuations in the measurements of flux intensity of galactic (compact) radio sources in a radio telescope, it is possible to infer some properties of structures in the solar wind. Studies based on observations of IPS have provided valuable information on the physics of the internal heliosphere for over 50 years. There are two techniques that provide IPS results: 1) Single-Station Analysis (SSA), where a theoretical model is fitted to the observed spectrum; and 2) Cross-Correlation Function (CCF), where two antennas separated by a few hundred kilometers simultaneously and independently observe the same radio source. In order to combine and complement solar wind speed determinations, it is important to validate the results of these two IPS techniques. In this work we analyze events from previously studied observations from MERLIN (Multi-Element Radio-Linked Interferometer Network) using the CCF methodology. The SSA model fit is applied to these observations and compared with the previous results to validate the two techniques. The objective is to know the behavior of the parameters in cases studied by CCFs that can be implemented in the SSA model. This work studies the capability of SSA model fit to describe complex events in the interplanetary environment and seeks to improve the adjustment of parameters from individual spectra to the theoretical model. The validation of these two methodologies is important to be able to combine data in real time from different radio telescopes which is necessary for the success of the Worldwide Interplanetary Scintillation Stations (WIPSS) Network to monitor solar wind structures using IPS data.

  20. Assessment of nanoparticle surface area by measuring unattached fraction of radon progeny

    Energy Technology Data Exchange (ETDEWEB)

    Ruzer, Lev S. [Ernest Orlando Lawrence Berkeley National Laboratory, Indoor Environment Department (United States)], E-mail: LSRuzer@lbl.gov

    2008-05-15

    A number of studies on the exposure of nanometer aerosols have indicated that health effects associated with low-solubility inhaled particles in the range of 1-100 nm may be more appropriately associated with particulate surface area than mass concentration. Such data on correlation between number, surface area and mass concentration are needed for exposure investigations, but the means for measuring aerosol surface area are not readily available. In this paper we propose a method for particle surface area assessment based on a new approach, deposition of the 'unattached fraction of radon progeny' onto nanometer aerosols.The proposed approach represents a synthesis of:(1) Derived direct analytical correlation between the 'unattached fraction' of radon progeny and surface area particle concentration in the range of 1-100 nm particle diameter;(2) Experimental data on correlation between the unattached fraction of radon progeny and particle surface area for particles with diameter in the range of 44 nm-2.1 {mu}m.

  1. Porous silicon structures with high surface area/specific pore size

    Science.gov (United States)

    Northrup, M.A.; Yu, C.M.; Raley, N.F.

    1999-03-16

    Fabrication and use of porous silicon structures to increase surface area of heated reaction chambers, electrophoresis devices, and thermopneumatic sensor-actuators, chemical preconcentrates, and filtering or control flow devices. In particular, such high surface area or specific pore size porous silicon structures will be useful in significantly augmenting the adsorption, vaporization, desorption, condensation and flow of liquids and gases in applications that use such processes on a miniature scale. Examples that will benefit from a high surface area, porous silicon structure include sample preconcentrators that are designed to adsorb and subsequently desorb specific chemical species from a sample background; chemical reaction chambers with enhanced surface reaction rates; and sensor-actuator chamber devices with increased pressure for thermopneumatic actuation of integrated membranes. Examples that benefit from specific pore sized porous silicon are chemical/biological filters and thermally-activated flow devices with active or adjacent surfaces such as electrodes or heaters. 9 figs.

  2. Localized solid-state amorphization at grain boundaries in a nanocrystalline Al solid solution subjected to surface mechanical attrition

    Energy Technology Data Exchange (ETDEWEB)

    Wu, X [State Key Laboratory of Nonlinear Mechanics, Institute of Mechanics, Chinese Academy of Sciences, Beijing 100080 (China); Tao, N [Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Sciences, Shenyang 110016 (China); Hong, Y [State Key Laboratory of Nonlinear Mechanics, Institute of Mechanics, Chinese Academy of Sciences, Beijing 100080 (China); Lu, J [LASMIS, University of Technology of Troyes, 10000, Troyes (France); Lu, K [Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Sciences, Shenyang 110016 (China)

    2005-11-21

    Using high-resolution electron microscopy, localized solid-state amorphization (SSA) was observed in a nanocrystalline (NC) Al solid solution (weight per cent 4.2 Cu, 0.3 Mn, the rest being Al) subjected to a surface mechanical attrition treatment. It was found that the deformation-induced SSA may occur at the grain boundary (GB) where either the high density dislocations or dislocation complexes are present. It is suggested that lattice instability due to elastic distortion within the dislocation core region plays a significant role in the initiation of the localized SSA at defective sites. Meanwhile, the GB of severely deformed NC grains exhibits a continuously varying atomic structure in such a way that while most of the GB is ordered but reveals corrugated configurations, localized amorphization may occur along the same GB.

  3. Can foot anthropometric measurements predict dynamic plantar surface contact area?

    Directory of Open Access Journals (Sweden)

    Collins Natalie

    2009-10-01

    Full Text Available Abstract Background Previous studies have suggested that increased plantar surface area, associated with pes planus, is a risk factor for the development of lower extremity overuse injuries. The intent of this study was to determine if a single or combination of foot anthropometric measures could be used to predict plantar surface area. Methods Six foot measurements were collected on 155 subjects (97 females, 58 males, mean age 24.5 ± 3.5 years. The measurements as well as one ratio were entered into a stepwise regression analysis to determine the optimal set of measurements associated with total plantar contact area either including or excluding the toe region. The predicted values were used to calculate plantar surface area and were compared to the actual values obtained dynamically using a pressure sensor platform. Results A three variable model was found to describe the relationship between the foot measures/ratio and total plantar contact area (R2 = 0.77, p R2 = 0.76, p Conclusion The results of this study indicate that the clinician can use a combination of simple, reliable, and time efficient foot anthropometric measurements to explain over 75% of the plantar surface contact area, either including or excluding the toe region.

  4. Stereological estimation of surface area from digital images

    DEFF Research Database (Denmark)

    Ziegel, Johanna; Kiderlen, Markus

    2010-01-01

    A sampling design of local stereology is combined with a method from digital stereology to yield a novel estimator of surface area based on counts of configurations observed in a digitization of an isotropic 2- dimensional slice with thickness s. As a tool, a result of the second author and J....... Rataj on infinitesimal increase of volumes of morphological transforms is refined and used. The proposed surface area estimator is asymptotically unbiased in the case of sets contained in the ball centred at the origin with radius s and in the case of balls centred at the origin with unknown radius...

  5. On $L_p$ Affine Surface Area and Curvature Measures

    OpenAIRE

    Zhao, Yiming

    2015-01-01

    The relationship between $L_p$ affine surface area and curvature measures is investigated. As a result, a new representation of the existing notion of $L_p$ affine surface area depending only on curvature measures is derived. Direct proofs of the equivalence between this new representation and those previously known are provided. The proofs show that the new representation is, in a sense, "polar" to that of Lutwak's and "dual" to that of Sch\\"utt & Werner's.

  6. Distinctive toxicity of TiO2 rutile/anatase mixed phase nanoparticles on Caco-2 cells.

    Science.gov (United States)

    Gerloff, Kirsten; Fenoglio, Ivana; Carella, Emanuele; Kolling, Julia; Albrecht, Catrin; Boots, Agnes W; Förster, Irmgard; Schins, Roel P F

    2012-03-19

    Titanium dioxide has a long-standing use as a food additive. Micrometric powders are, e.g., applied as whiteners in confectionary or dairy products. Possible hazards of ingested nanometric TiO(2) particles for humans and the potential influence of varying specific surface area (SSA) are currently under discussion. Five TiO(2)-samples were analyzed for purity, crystallinity, primary particle size, SSA, ζ potential, and aggregation/agglomeration. Their potential to induce cytotoxicity, oxidative stress, and DNA damage was evaluated in human intestinal Caco-2 cells. Only anatase-rutile containing samples, in contrast to the pure anatase samples, induced significant LDH leakage or mild DNA damage (Fpg-comet assay). Evaluation of the metabolic competence of the cells (WST-1 assay) revealed a highly significant correlation between the SSA of the anatase samples and cytotoxicity. The anatase/rutile samples showed higher toxicity per unit surface area than the pure anatase powders. However, none of the samples affected cellular markers of oxidative stress. Our findings suggest that both SSA and crystallinity are critical determinants of TiO(2)-toxicity toward intestinal cells. © 2012 American Chemical Society

  7. High Surface Area Tunnels in Hexagonal WO₃.

    Science.gov (United States)

    Sun, Wanmei; Yeung, Michael T; Lech, Andrew T; Lin, Cheng-Wei; Lee, Chain; Li, Tianqi; Duan, Xiangfeng; Zhou, Jun; Kaner, Richard B

    2015-07-08

    High surface area in h-WO3 has been verified from the intracrystalline tunnels. This bottom-up approach differs from conventional templating-type methods. The 3.67 Å diameter tunnels are characterized by low-pressure CO2 adsorption isotherms with nonlocal density functional theory fitting, transmission electron microscopy, and thermal gravimetric analysis. These open and rigid tunnels absorb H(+) and Li(+), but not Na(+) in aqueous electrolytes without inducing a phase transformation, accessing both internal and external active sites. Moreover, these tunnel structures demonstrate high specific pseudocapacitance and good stability in an H2SO4 aqueous electrolyte. Thus, the high surface area created from 3.67 Å diameter tunnels in h-WO3 shows potential applications in electrochemical energy storage, selective ion transfer, and selective gas adsorption.

  8. Integrated iron(II) oxidation and limestone neutralisation of acid mine water

    CSIR Research Space (South Africa)

    Maree, JP

    1999-01-01

    Full Text Available dependent on the surface area exposed to the liquid (RSA) and the OH-, oxygen, CaCO3, suspended solids and iron (II) concentrations, and less dependent on specific surface area (SSA) and pressure in the pH range 5 to 6, The chemical oxidation rate (p...

  9. 20 CFR 408.1235 - How does the State transfer funds to SSA to administer its recognition payment program?

    Science.gov (United States)

    2010-04-01

    ... administer its recognition payment program? 408.1235 Section 408.1235 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SPECIAL BENEFITS FOR CERTAIN WORLD WAR II VETERANS Federal Administration of State Recognition Payments § 408.1235 How does the State transfer funds to SSA to administer its recognition payment program...

  10. 76 FR 5235 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA Internal Match)-Match Number 1014

    Science.gov (United States)

    2011-01-28

    ...; Computer Matching Program (SSA Internal Match)--Match Number 1014 AGENCY: Social Security Administration... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching....C. 552a, as amended, and the provisions of the Computer Matching and Privacy Protection Act of 1988...

  11. High-surface-area silica nanospheres (KCC-1) with a fibrous morphology

    KAUST Repository

    Polshettiwar, Vivek; Cha, Dong Kyu; Zhang, Xixiang; Basset, Jean-Marie

    2010-01-01

    Fibrous nanosilica: A new family of high-surface-area silica nanospheres (KCC-1) have been prepared (see picture). KCC-1 features excellent physical properties, including high surface area, unprecedented fibrous surface morphology, high thermal (up to 950 °C) and hydrothermal stabilities, and high mechanical stability. Copyright © 2010 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. High-surface-area silica nanospheres (KCC-1) with a fibrous morphology

    KAUST Repository

    Polshettiwar, Vivek

    2010-08-02

    Fibrous nanosilica: A new family of high-surface-area silica nanospheres (KCC-1) have been prepared (see picture). KCC-1 features excellent physical properties, including high surface area, unprecedented fibrous surface morphology, high thermal (up to 950 °C) and hydrothermal stabilities, and high mechanical stability. Copyright © 2010 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. Why Do We Need the Derivative for the Surface Area?

    Science.gov (United States)

    Hristova, Yulia; Zeytuncu, Yunus E.

    2016-01-01

    Surface area and volume computations are the most common applications of integration in calculus books. When computing the surface area of a solid of revolution, students are usually told to use the frustum method instead of the disc method; however, a rigorous explanation is rarely provided. In this note, we provide one by using geometric…

  14. A novel film-pore-surface diffusion model to explain the enhanced enzyme adsorption of corn stover pretreated by ultrafine grinding.

    Science.gov (United States)

    Zhang, Haiyan; Chen, Longjian; Lu, Minsheng; Li, Junbao; Han, Lujia

    2016-01-01

    Ultrafine grinding is an environmentally friendly pretreatment that can alter the degree of polymerization, the porosity and the specific surface area of lignocellulosic biomass and can, thus, enhance cellulose hydrolysis. Enzyme adsorption onto the substrate is a prerequisite for the enzymatic hydrolysis process. Therefore, it is necessary to investigate the enzyme adsorption properties of corn stover pretreated by ultrafine grinding. The ultrafine grinding pretreatment was executed on corn stover. The results showed that ultrafine grinding pretreatment can significantly decrease particle size [from 218.50 μm of sieve-based grinding corn stover (SGCS) to 17.45 μm of ultrafine grinding corn stover (UGCS)] and increase the specific surface area (SSA), pore volume (PV) and surface composition (SSA: from 1.71 m(2)/g of SGCS to 2.63 m(2)/g of UGCS, PV: from 0.009 cm(3)/g of SGCS to 0.024 m(3)/g of UGCS, cellulose surface area: from 168.69 m(2)/g of SGCS to 290.76 m(2)/g of UGCS, lignin surface area: from 91.46 m(2)/g of SGCS to 106.70 m(2)/g of UGCS). The structure and surface composition changes induced by ultrafine grinding increase the enzyme adsorption capacity from 2.83 mg/g substrate of SGCS to 5.61 mg/g substrate of UGCS. A film-pore-surface diffusion model was developed to simultaneously predict the enzyme adsorption kinetics of both the SGCS and UGCS. Satisfactory predictions could be made with the model based on high R (2) and low RMSE values (R (2) = 0.95 and RMSE = 0.16 mg/g for the UGCS, R (2) = 0.93 and RMSE = 0.09 mg/g for the SGCS). The model was further employed to analyze the rate-limiting steps in the enzyme adsorption process. Although both the external-film and internal-pore mass transfer are important for enzyme adsorption on the SGCS and UGCS, the UGCS has a lower internal-pore resistance compared to the SGCS. Ultrafine grinding pretreatment can enhance the enzyme adsorption onto corn stover by altering structure and

  15. 76 FR 12397 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Bureau of the Public Debt (BPD...

    Science.gov (United States)

    2011-03-07

    ...; Computer Matching Program (SSA/ Bureau of the Public Debt (BPD))--Match Number 1038 AGENCY: Social Security... as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection... containing SSNs extracted from the Supplemental Security Record database. Exchanges for this computer...

  16. Surface modification of calcium fluoro and hydroxyapatite by 1-octylphosphonic dichloride

    Science.gov (United States)

    Aissa, Abdallah; Agougui, Hassen; Debbabi, Mongi

    2011-08-01

    The reactivity of the surface of calcium hydroxyapatite (CaHAp) and fluorapatite (CaFAp) was tested and compared by grafting the 1-octylphosphonic dichloride (C 8H 17OPCl 2) using a molar ratio x = 2 or 4, x = n(organic)/ n(apatite). Successful synthesis was confirmed by different characterisation techniques such as X-ray powder diffraction patterns, IR spectroscopy, MAS-NMR ( 1H and 31P) and chemical analysis. The difference between their specific surface area (SSA: 57.46 for HAp and 12.09 m 2/g for FAp), the percentage of carbon measured after treatment with (C 8H 17OPCl 2) and the intensities of IR bands attributed to the grafted moiety suggests that the surface of hydroxyapatite is more reactive than that of fluorapatite. The 31P CP-MAS-NMR spectra of treated fluorapatite show a significant change in isotropic signal due to the protonation and deprotonation of superficial phosphate group. This can be explained by the difference in the nature of inorganic material.

  17. Surface modification of calcium fluoro and hydroxyapatite by 1-octylphosphonic dichloride

    Energy Technology Data Exchange (ETDEWEB)

    Aissa, Abdallah; Agougui, Hassen [Laboratoire de Physico-Chimie des Materiaux, Faculte des Sciences de Monastir, 5019 Monastir (Tunisia); Debbabi, Mongi, E-mail: m.debbabi@yahoo.fr [Laboratoire de Physico-Chimie des Materiaux, Faculte des Sciences de Monastir, 5019 Monastir (Tunisia)

    2011-08-15

    The reactivity of the surface of calcium hydroxyapatite (CaHAp) and fluorapatite (CaFAp) was tested and compared by grafting the 1-octylphosphonic dichloride (C{sub 8}H{sub 17}OPCl{sub 2}) using a molar ratio x = 2 or 4, x = n(organic)/n(apatite). Successful synthesis was confirmed by different characterisation techniques such as X-ray powder diffraction patterns, IR spectroscopy, MAS-NMR ({sup 1}H and {sup 31}P) and chemical analysis. The difference between their specific surface area (SSA: 57.46 for HAp and 12.09 m{sup 2}/g for FAp), the percentage of carbon measured after treatment with (C{sub 8}H{sub 17}OPCl{sub 2}) and the intensities of IR bands attributed to the grafted moiety suggests that the surface of hydroxyapatite is more reactive than that of fluorapatite. The {sup 31}P CP-MAS-NMR spectra of treated fluorapatite show a significant change in isotropic signal due to the protonation and deprotonation of superficial phosphate group. This can be explained by the difference in the nature of inorganic material.

  18. Surface modification of calcium fluoro and hydroxyapatite by 1-octylphosphonic dichloride

    International Nuclear Information System (INIS)

    Aissa, Abdallah; Agougui, Hassen; Debbabi, Mongi

    2011-01-01

    The reactivity of the surface of calcium hydroxyapatite (CaHAp) and fluorapatite (CaFAp) was tested and compared by grafting the 1-octylphosphonic dichloride (C 8 H 17 OPCl 2 ) using a molar ratio x = 2 or 4, x = n(organic)/n(apatite). Successful synthesis was confirmed by different characterisation techniques such as X-ray powder diffraction patterns, IR spectroscopy, MAS-NMR ( 1 H and 31 P) and chemical analysis. The difference between their specific surface area (SSA: 57.46 for HAp and 12.09 m 2 /g for FAp), the percentage of carbon measured after treatment with (C 8 H 17 OPCl 2 ) and the intensities of IR bands attributed to the grafted moiety suggests that the surface of hydroxyapatite is more reactive than that of fluorapatite. The 31 P CP-MAS-NMR spectra of treated fluorapatite show a significant change in isotropic signal due to the protonation and deprotonation of superficial phosphate group. This can be explained by the difference in the nature of inorganic material.

  19. A review of plutonium oxalate decomposition reactions and effects of decomposition temperature on the surface area of the plutonium dioxide product

    Energy Technology Data Exchange (ETDEWEB)

    Orr, R.M.; Sims, H.E.; Taylor, R.J., E-mail: robin.j.taylor@nnl.co.uk

    2015-10-15

    Plutonium (IV) and (III) ions in nitric acid solution readily form insoluble precipitates with oxalic acid. The plutonium oxalates are then easily thermally decomposed to form plutonium dioxide powder. This simple process forms the basis of current industrial conversion or ‘finishing’ processes that are used in commercial scale reprocessing plants. It is also widely used in analytical or laboratory scale operations and for waste residues treatment. However, the mechanisms of the thermal decompositions in both air and inert atmospheres have been the subject of various studies over several decades. The nature of intermediate phases is of fundamental interest whilst understanding the evolution of gases at different temperatures is relevant to process control. The thermal decomposition is also used to control a number of powder properties of the PuO{sub 2} product that are important to either long term storage or mixed oxide fuel manufacturing. These properties are the surface area, residual carbon impurities and adsorbed volatile species whereas the morphology and particle size distribution are functions of the precipitation process. Available data and experience regarding the thermal and radiation-induced decompositions of plutonium oxalate to oxide are reviewed. The mechanisms of the thermal decompositions are considered with a particular focus on the likely redox chemistry involved. Also, whilst it is well known that the surface area is dependent on calcination temperature, there is a wide variation in the published data and so new correlations have been derived. Better understanding of plutonium (III) and (IV) oxalate decompositions will assist the development of more proliferation resistant actinide co-conversion processes that are needed for advanced reprocessing in future closed nuclear fuel cycles. - Highlights: • Critical review of plutonium oxalate decomposition reactions. • New analysis of relationship between SSA and calcination temperature.

  20. High surface area carbon and process for its production

    Energy Technology Data Exchange (ETDEWEB)

    Romanos, Jimmy; Burress, Jacob; Pfeifer, Peter; Rash, Tyler; Shah, Parag; Suppes, Galen

    2016-12-13

    Activated carbon materials and methods of producing and using activated carbon materials are provided. In particular, biomass-derived activated carbon materials and processes of producing the activated carbon materials with prespecified surface areas and pore size distributions are provided. Activated carbon materials with preselected high specific surface areas, porosities, sub-nm (<1 nm) pore volumes, and supra-nm (1-5 nm) pore volumes may be achieved by controlling the degree of carbon consumption and metallic potassium intercalation into the carbon lattice during the activation process.

  1. Surface water and groundwater interaction in Marala - Khanki area, Punjab

    International Nuclear Information System (INIS)

    Akram, W.; Ahmad, M.; Latif, Z.; Tariq, J.A.; Malik, M.R.

    2011-07-01

    Isotope hydrological investigations were carried out in two selected areas of Indus Basin viz. Haripur Area and Chashma- Taunsa Area for elucidating various aspects of surface water and groundwater interaction. Groundwater samples were collected on seasonal basis (low and high river discharge periods) while surface water samples were collected more frequently (weekly or monthly basis). Isotopic data suggested that there is no contribution of surface water to groundwater recharge in Haripur Area and rain is the prevailing source of groundwater recharge. The data further revealed that isotopic values of the Haripur pocket of Tarbela Lake are higher than those of Main Lake / Indus River meaning that there is a significant contribution of base flow in this pocket. Indus River appeared to be the dominant source of groundwater recharge at most of the locations in Chashma- Taunsa Area. Isotopic data of Indus River showed an increase at Taunsa as compared to Chashma in low flow period indicating the high contribution of base flow at this point in time. Stable isotopes were successfully used to quantify the base flow contribution. (author)

  2. Effect of solution and leaf surface polarity on droplet spread area and contact angle.

    Science.gov (United States)

    Nairn, Justin J; Forster, W Alison; van Leeuwen, Rebecca M

    2016-03-01

    How much an agrochemical spray droplet spreads on a leaf surface can significantly influence efficacy. This study investigates the effect solution polarity has on droplet spreading on leaf surfaces and whether the relative leaf surface polarity, as quantified using the wetting tension dielectric (WTD) technique, influences the final spread area. Contact angles and spread areas were measured using four probe solutions on 17 species. Probe solution polarity was found to affect the measured spread area and the contact angle of the droplets on non-hairy leaves. Leaf hairs skewed the spread area measurement, preventing investigation of the influence of surface polarity on hairy leaves. WTD-measured leaf surface polarity of non-hairy leaves was found to correlate strongly with the effect of solution polarity on spread area. For non-polar leaf surfaces the spread area decreases with increasing solution polarity, for neutral surfaces polarity has no effect on spread area and for polar leaf surfaces the spread area increases with increasing solution polarity. These results attest to the use of the WTD technique as a means to quantify leaf surface polarity. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.

  3. Kinetics of the high temperature oxygen exchange reaction on {sup 238}PuO{sub 2} powder

    Energy Technology Data Exchange (ETDEWEB)

    Whiting, Christofer E., E-mail: chris.whiting@udri.udayton.edu [University of Dayton – Research Institute, 300 College Park, Dayton, OH 45469-0172 (United States); Du, Miting; Felker, L. Kevin; Wham, Robert M. [Oak Ridge National Laboratory, P.O. Box 2008, Oak Ridge, TN 37831 (United States); Barklay, Chadwick D.; Kramer, Daniel P. [University of Dayton – Research Institute, 300 College Park, Dayton, OH 45469-0172 (United States)

    2015-12-15

    Oxygen exchange reactions performed on PuO{sub 2} suggest the reaction is influenced by at least three mechanisms: an internal chemical reaction, surface mobility of active species/defects, and surface exchange of gaseous oxygen with lattice oxygen. Activation energies for the surface mobility and internal chemical reaction are presented. Determining which mechanism is dominant appears to be a complex function including at least specific surface area and temperature. Thermal exposure may also impact the oxygen exchange reaction by causing reductions in the specific surface area of PuO{sub 2}. Previous CeO{sub 2} surrogate studies exhibit similar behavior, confirming that CeO{sub 2} is a good qualitative surrogate for PuO{sub 2}, in regards to the oxygen exchange reaction. Comparison of results presented here with previous work on the PuO{sub 2} oxygen exchange reaction allows complexities in the previous work to be explained. These explanations allowed new conclusions to be drawn, many of which confirm the conclusions presented here. - Highlights: • PuO{sub 2} Oxygen exchange kinetics can be influenced by at least 3 different mechanisms. • An internal chemical reaction controls the rate at high temperature and large SSA. • Surface mobility and surface exchange influence rate at lower temperatures and SSA. • Exchange temperatures may alter SSA and make data difficult to interpret.

  4. Kinetics of the high temperature oxygen exchange reaction on 238PuO2 powder

    International Nuclear Information System (INIS)

    Whiting, Christofer E.; Du, Miting; Felker, L. Kevin; Wham, Robert M.; Barklay, Chadwick D.; Kramer, Daniel P.

    2015-01-01

    Oxygen exchange reactions performed on PuO 2 suggest the reaction is influenced by at least three mechanisms: an internal chemical reaction, surface mobility of active species/defects, and surface exchange of gaseous oxygen with lattice oxygen. Activation energies for the surface mobility and internal chemical reaction are presented. Determining which mechanism is dominant appears to be a complex function including at least specific surface area and temperature. Thermal exposure may also impact the oxygen exchange reaction by causing reductions in the specific surface area of PuO 2 . Previous CeO 2 surrogate studies exhibit similar behavior, confirming that CeO 2 is a good qualitative surrogate for PuO 2 , in regards to the oxygen exchange reaction. Comparison of results presented here with previous work on the PuO 2 oxygen exchange reaction allows complexities in the previous work to be explained. These explanations allowed new conclusions to be drawn, many of which confirm the conclusions presented here. - Highlights: • PuO 2 Oxygen exchange kinetics can be influenced by at least 3 different mechanisms. • An internal chemical reaction controls the rate at high temperature and large SSA. • Surface mobility and surface exchange influence rate at lower temperatures and SSA. • Exchange temperatures may alter SSA and make data difficult to interpret.

  5. Nondestructive, stereological estimation of canopy surface area

    DEFF Research Database (Denmark)

    Wulfsohn, Dvora-Laio; Sciortino, Marco; Aaslyng, Jesper M.

    2010-01-01

    We describe a stereological procedure to estimate the total leaf surface area of a plant canopy in vivo, and address the problem of how to predict the variance of the corresponding estimator. The procedure involves three nested systematic uniform random sampling stages: (i) selection of plants from...... a canopy using the smooth fractionator, (ii) sampling of leaves from the selected plants using the fractionator, and (iii) area estimation of the sampled leaves using point counting. We apply this procedure to estimate the total area of a chrysanthemum (Chrysanthemum morifolium L.) canopy and evaluate both...... the time required and the precision of the estimator. Furthermore, we compare the precision of point counting for three different grid intensities with that of several standard leaf area measurement techniques. Results showed that the precision of the plant leaf area estimator based on point counting...

  6. Lake Chad Total Surface Water Area as Derived from Land Surface Temperature and Radar Remote Sensing Data

    Directory of Open Access Journals (Sweden)

    Frederick Policelli

    2018-02-01

    Full Text Available Lake Chad, located in the middle of the African Sahel belt, underwent dramatic decreases in the 1970s and 1980s leaving less than ten percent of its 1960s surface water extent as open water. In this paper, we present an extended record (dry seasons 1988–2016 of the total surface water area of the lake (including both open water and flooded vegetation derived using Land Surface Temperature (LST data (dry seasons 2000–2016 from the NASA Terra MODIS sensor and EUMETSAT Meteosat-based LST measurements (dry seasons 1988–2001 from an earlier study. We also examine the total surface water area for Lake Chad using radar data (dry seasons 2015–2016 from the ESA Sentinel-1a mission. For the limited number of radar data sets available to us (18 data sets, we find on average a close match between the estimates from these data and the corresponding estimates from LST, though we find spatial differences in the estimates using the two types of data. We use these spatial differences to adjust the record (dry seasons 2000–2016 from MODIS LST. Then we use the adjusted record to remove the bias of the existing LST record (dry seasons 1988–2001 derived from Meteosat measurements and combine the two records. From this composite, extended record, we plot the total surface water area of the lake for the dry seasons of 1988–1989 through 2016–2017. We find for the dry seasons of 1988–1989 to 2016–2017 that the maximum total surface water area of the lake was approximately 16,800 sq. km (February and May, 2000, the minimum total surface water area of the lake was approximately 6400 sq. km (November, 1990, and the average was approximately 12,700 sq. km. Further, we find the total surface water area of the lake to be highly variable during this period, with an average rate of increase of approximately 143 km2 per year.

  7. BOREAS Elevation Contours over the NSA and SSA in ARC/INFO Generate Format

    Science.gov (United States)

    Knapp, David; Nickeson, Jaime; Hall, Forrest G. (Editor)

    2000-01-01

    This data set was prepared by BORIS Staff by reformatting the original data into the ARC/INFO Generate format. The original data were received in SIF at a scale of 1:50,000. BORIS staff could not find a format document or commercial software for reading SIF; the BOREAS HYD-08 team pro-vided some C source code that could read some of the SIF files. The data cover the BOREAS NSA and SSA. The original data were compiled from information available in the 1970s and 1980s. The data are available in ARC/INFO Generate format files.

  8. Estimating the surface area of birds: using the homing pigeon (Columba livia as a model

    Directory of Open Access Journals (Sweden)

    Cristina R. Perez

    2014-05-01

    Full Text Available Estimation of the surface area of the avian body is valuable for thermoregulation and metabolism studies as well as for assessing exposure to oil and other surface-active organic pollutants from a spill. The use of frozen carcasses for surface area estimations prevents the ability to modify the posture of the bird. The surface area of six live homing pigeons in the fully extended flight position was estimated using a noninvasive method. An equation was derived to estimate the total surface area of a pigeon based on its body weight. A pigeon's surface area in the fully extended flight position is approximately 4 times larger than the surface area of a pigeon in the perching position. The surface area of a bird is dependent on its physical position, and, therefore, the fully extended flight position exhibits the maximum area of a bird and should be considered the true surface area of a bird.

  9. Estimating the surface area of birds: using the homing pigeon (Columba livia) as a model.

    Science.gov (United States)

    Perez, Cristina R; Moye, John K; Pritsos, Chris A

    2014-05-08

    Estimation of the surface area of the avian body is valuable for thermoregulation and metabolism studies as well as for assessing exposure to oil and other surface-active organic pollutants from a spill. The use of frozen carcasses for surface area estimations prevents the ability to modify the posture of the bird. The surface area of six live homing pigeons in the fully extended flight position was estimated using a noninvasive method. An equation was derived to estimate the total surface area of a pigeon based on its body weight. A pigeon's surface area in the fully extended flight position is approximately 4 times larger than the surface area of a pigeon in the perching position. The surface area of a bird is dependent on its physical position, and, therefore, the fully extended flight position exhibits the maximum area of a bird and should be considered the true surface area of a bird. © 2014. Published by The Company of Biologists Ltd | Biology Open.

  10. Determining surface areas of marine alga cells by acid-base titration method.

    Science.gov (United States)

    Wang, X; Ma, Y; Su, Y

    1997-09-01

    A new method for determining the surface area of living marine alga cells was described. The method uses acid-base titration to measure the surface acid/base amount on the surface of alga cells and uses the BET (Brunauer, Emmett, and Teller) equation to estimate the maximum surface acid/base amount, assuming that hydrous cell walls have carbohydrates or other structural compounds which can behave like surface Brönsted acid-base sites due to coordination of environmental H2O molecules. The method was applied to 18 diverse alga species (including 7 diatoms, 2 flagellates, 8 green algae and 1 red alga) maintained in seawater cultures. For the species examined, the surface areas of individual cells ranged from 2.8 x 10(-8) m2 for Nannochloropsis oculata to 690 x 10(-8) m2 for Dunaliella viridis, specific surface areas from 1,030 m2.g-1 for Dunaliella salina to 28,900 m2.g-1 for Pyramidomonas sp. Measurement accuracy was 15.2%. Preliminary studies show that the method may be more promising and accurate than light/electron microscopic measurements for coarse estimation of the surface area of living algae.

  11. Osmosis and Surface Area to Volume Ratio.

    Science.gov (United States)

    Barrett, D. R. B.

    1984-01-01

    Describes an experiment designed to help students understand the concepts of osmosis and surface area to volume ratio (SA:VOL). The task for students is to compare water uptake in different sizes of potato cubes and relate differences to their SA:VOL ratios. (JN)

  12. NEW CONCEPTS AND TEST METHODS OF CURVE PROFILE AREA DENSITY IN SURFACE: ESTIMATION OF AREAL DENSITY ON CURVED SPATIAL SURFACE

    OpenAIRE

    Hong Shen

    2011-01-01

    The concepts of curve profile, curve intercept, curve intercept density, curve profile area density, intersection density in containing intersection (or intersection density relied on intersection reference), curve profile intersection density in surface (or curve intercept intersection density relied on intersection of containing curve), and curve profile area density in surface (AS) were defined. AS expressed the amount of curve profile area of Y phase in the unit containing surface area, S...

  13. Amylolytic hydrolysis of native starch granules affected by granule surface area.

    Science.gov (United States)

    Kim, J C; Kong, B W; Kim, M J; Lee, S H

    2008-11-01

    Initial stage of hydrolysis of native starch granules with various amylolytic enzymes, alpha-amylase from Bacillus subtilis, glucoamylase I (GA-I) and II (GA-II) from Aspergillus niger, and beta-amylase from sweet potato showed that the reaction was apparently affected by a specific surface area of the starch granules. The ratios of the reciprocal of initial velocity of each amylolytic hydrolysis for native potato and maize starch to that for rice with the amylolytic enzymes were nearly equivalent to the ratio of surface area per mass of the 2 starch granules to that of rice, that is, 6.94 and 2.25, respectively. Thus, the reciprocal of initial velocity of each enzymatic hydrolysis as expressed in a Lineweaver-Burk plot was a linear function of the reciprocal of surface area for each starch granule. As a result, it is concluded that amylolytic hydrolysis of native starch granules is governed by the specific surface area, not by the mass concentration, of each granule.

  14. High surface area fibrous silica nanoparticles

    KAUST Repository

    Polshettiwar, Vivek; Basset, Jean-Marie

    2014-01-01

    Disclosed are high surface area nanoparticles that have a fibrous morphology. The nanoparticles have a plurality of fibers, wherein each fiber is in contact with one other fiber and each fiber has a length of between about 1 nm and about 5000 nm. Also disclosed are applications of the nanoparticles of the present invention, and methods of fabrication of the nanoparticles of the present invention.

  15. High surface area fibrous silica nanoparticles

    KAUST Repository

    Polshettiwar, Vivek

    2014-11-11

    Disclosed are high surface area nanoparticles that have a fibrous morphology. The nanoparticles have a plurality of fibers, wherein each fiber is in contact with one other fiber and each fiber has a length of between about 1 nm and about 5000 nm. Also disclosed are applications of the nanoparticles of the present invention, and methods of fabrication of the nanoparticles of the present invention.

  16. Root surface area measurement of permanent dentition in Indian population – CBCT analysis

    Directory of Open Access Journals (Sweden)

    Kanika Lakhani

    2017-01-01

    Full Text Available The area of the root surface of human teeth has been investigated extensively in the dental literature. All previous attempts mainly rely on the use of physical methods to calculate surface area on extracted teeth or use virtual 3D Models for the same. The aim is to develop an algorithm using MATLAB software that estimates the dimensions of 3-D image produced with the help of CBCT so that the same can be utilized to calculate the root surface area of teeth among Indian population. Present research utilizes CBCT images of samples of extracted teeth mounted on a customized jpg. A descriptive chart for statistical analysis has been prepared to obtain average root surface area of each tooth type. The currently developed algorithm has been successfully applied to the CBCT images of complete sample of teeth to obtain their root surface area. The algorithm developed to calculate root surface area of the teeth holds wide spread application in the field of dentistry pursuing its high expediency in even various specializations of dentistry including orthodontics, prosthodontics, periodontology and implantalogy. It is concluded that it has now become a reality to accurately determine the surface area of the root of human teeth without extracting them using the CBCT radiographs of the patients.

  17. Surface area of antimony oxide by isotope exchange and other methods

    Energy Technology Data Exchange (ETDEWEB)

    Rao, Y.K.; Acharya, B.V.; Rangamannar, B.

    1985-06-17

    Specific surface areas of antimony oxide samples, one commercial, the other prepared from antimony trichloride were measured by heterogeneous isotope exchange, gas adsorption, air permeability and microscopic methods. Specific surface areas obtained by these four methods for the two samples were compared and the observed differences are explained.

  18. Surface-Casting Synthesis of Mesoporous Zirconia with a CMK-5-Like Structure and High Surface Area.

    Science.gov (United States)

    Gu, Dong; Schmidt, Wolfgang; Pichler, Christian M; Bongard, Hans-Josef; Spliethoff, Bernd; Asahina, Shunsuke; Cao, Zhengwen; Terasaki, Osamu; Schüth, Ferdi

    2017-09-04

    About 15 years ago, the Ryoo group described the synthesis of CMK-5, a material consisting of a hexagonal arrangement of carbon nanotubes. Extension of the surface casting synthesis to oxide compositions, however, was not possible so far, in spite of many attempts. Here it is demonstrated, that crystalline mesoporous hollow zirconia materials with very high surface areas up to 400 m 2  g -1 , and in selected cases in the form of CMK-5-like, are indeed accessible via such a surface casting process. The key for the successful synthesis is an increased interaction between the silica hard template surface and the zirconia precursor species by using silanol group-rich mesoporous silica as a hard template. The surface areas of the obtained zirconias exceed those of conventionally hard-templated ones by a factor of two to three. The surface casting process seems to be applicable also to other oxide materials. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Large area, surface discharge pumped, vacuum ultraviolet light source

    Science.gov (United States)

    Sze, R.C.; Quigley, G.P.

    1996-12-17

    Large area, surface discharge pumped, vacuum ultraviolet (VUV) light source is disclosed. A contamination-free VUV light source having a 225 cm{sup 2} emission area in the 240-340 nm region of the electromagnetic spectrum with an average output power in this band of about 2 J/cm{sup 2} at a wall-plug efficiency of approximately 5% is described. Only ceramics and metal parts are employed in this surface discharge source. Because of the contamination-free, high photon energy and flux, and short pulse characteristics of the source, it is suitable for semiconductor and flat panel display material processing. 3 figs.

  20. Determining eyeball surface area directly exposed to the effects of external factors.

    Science.gov (United States)

    Juliszewski, Tadeusz; Kadłuczka, Filip; Kiełbasa, Paweł

    2016-01-01

    This article discusses determining the surface area of eyeballs of men and women exposed to the direct effects of external factors in the working environment. For one eye, the mean surface is 172-182 mm(2). The determined surface area can be used in formulas for calculating the exposure of eyeballs to harmful chemical substances in workplace air.

  1. Cortical surface area and cortical thickness in the precuneus of adult humans.

    Science.gov (United States)

    Bruner, E; Román, F J; de la Cuétara, J M; Martin-Loeches, M; Colom, R

    2015-02-12

    The precuneus has received considerable attention in the last decade, because of its cognitive functions, its role as a central node of the brain networks, and its involvement in neurodegenerative processes. Paleoneurological studies suggested that form changes in the deep parietal areas represent a major character associated with the origin of the modern human brain morphology. A recent neuroanatomical survey based on shape analysis suggests that the proportions of the precuneus are also a determinant source of overall brain geometrical differences among adult individuals, influencing the brain spatial organization. Here, we evaluate the variation of cortical thickness and cortical surface area of the precuneus in a sample of adult humans, and their relation with geometry and cognition. Precuneal thickness and surface area are not correlated. There is a marked individual variation. The right precuneus is thinner and larger than the left one, but there are relevant fluctuating asymmetries, with only a modest correlation between the hemispheres. Males have a thicker cortex but differences in cortical area are not significant between sexes. The surface area of the precuneus shows a positive allometry with the brain surface area, although the correlation is modest. The dilation/contraction of the precuneus, described as a major factor of variability within adult humans, is associated with absolute increase/decrease of its surface, but not with variation in thickness. Precuneal thickness, precuneal surface area and precuneal morphology are not correlated with psychological factors such as intelligence, working memory, attention control, and processing speed, stressing further possible roles of this area in supporting default mode functions. Beyond gross morphology, the processes underlying the large phenotypic variation of the precuneus must be further investigated through specific cellular analyses, aimed at considering differences in cellular size, density

  2. Sorption of water vapour by the Na+-exchanged clay-sized fractions of some tropical soil samples

    International Nuclear Information System (INIS)

    Yormah, T.B.R.; Hayes, M.H.B.

    1993-09-01

    Water vapour sorption isotherms at 299K for the Na + -exchanged clay-sized (≤ 2μm e.s.d.) fraction of two sets of samples taken at three different depths from a tropical soil profile have been studied. One set of samples was treated (with H 2 O 2 ) for the removal of much of the organic matter (OM); the other set (of the same samples) was not so treated. The isotherms obtained were all of type II and analyses by the BET method yielded values for the Specific Surface Areas (SSA) and for the average energy of adsorption of the first layer of adsorbate (E a ). OM content and SSA for the untreated samples were found to decrease with depth. Whereas removal of organic matter made negligible difference to the SSA of the top/surface soil, the same treatment produced a significant increase in the SSA of the samples taken from the middle and from the lower depths in the profile; the resulting increase was more pronounced for the subsoil. It has been deduced from these results that OM in the surface soil was less involved with the inorganic soil colloids than that in the subsoil. The increase in surface area which resulted from the removal of OM from the subsoil was most probably due to disaggregation. Values of E a obtained show that for all the samples the adsorption of water vapour became more energetic after the oxidative removal of organic matter; the resulting ΔE a also increased with depth. This suggests that in the dry state, the ''cleaned'' surface of the inorganic soil colloids was more energetic than the ''organic-matter-coater surface''. These data provide strong support for the deduction that OM in the subsoil was in a more ''combined'' state than that in the surface soil. (author). 21 refs, 4 figs, 2 tabs

  3. Effect of impervious surface area and vegetation changes on mean ...

    African Journals Online (AJOL)

    adeniyi adeyemi

    Land surface temperature (LST) is measured by the surface energy balance, .... climatic and environmental conditions (Cheng et al., 2006). ..... urban areas have generally resulted in a high reflection and emission of solar radiation and greater.

  4. Surface Area of Patellar Facets: Inferential Statistics in the Iraqi Population

    Directory of Open Access Journals (Sweden)

    Ahmed Al-Imam

    2017-01-01

    Full Text Available Background. The patella is the largest sesamoid bone in the body; its three-dimensional complexity necessitates biomechanical perfection. Numerous pathologies occur at the patellofemoral unit which may end in degenerative changes. This study aims to test the presence of statistical correlation between the surface areas of patellar facets and other patellar morphometric parameters. Materials and Methods. Forty dry human patellae were studied. The morphometry of each patella was measured using a digital Vernier Caliper, electronic balance, and image analyses software known as ImageJ. The patellar facetal surface area was correlated with patellar weight, height, width, and thickness. Results. Inferential statistics proved the existence of linear correlation of total facetal surface area and patellar weight, height, width, and thickness. The correlation was strongest for surface area versus patellar weight. The lateral facetal area was found persistently larger than the medial facetal area, the p value was found to be <0.001 (one-tailed t-test for right patellae, and another significant p value of < 0.001 (one-tailed t-test was found for left patellae. Conclusion. These data are vital for the restoration of the normal biomechanics of the patellofemoral unit; these are to be consulted during knee surgeries and implant designs and can be of an indispensable anthropometric, interethnic, and biometric value.

  5. Thermal Desorption Analysis of Effective Specific Soil Surface Area

    Science.gov (United States)

    Smagin, A. V.; Bashina, A. S.; Klyueva, V. V.; Kubareva, A. V.

    2017-12-01

    A new method of assessing the effective specific surface area based on the successive thermal desorption of water vapor at different temperature stages of sample drying is analyzed in comparison with the conventional static adsorption method using a representative set of soil samples of different genesis and degree of dispersion. The theory of the method uses the fundamental relationship between the thermodynamic water potential (Ψ) and the absolute temperature of drying ( T): Ψ = Q - aT, where Q is the specific heat of vaporization, and a is the physically based parameter related to the initial temperature and relative humidity of the air in the external thermodynamic reservoir (laboratory). From gravimetric data on the mass fraction of water ( W) and the Ψ value, Polyanyi potential curves ( W(Ψ)) for the studied samples are plotted. Water sorption isotherms are then calculated, from which the capacity of monolayer and the target effective specific surface area are determined using the BET theory. Comparative analysis shows that the new method well agrees with the conventional estimation of the degree of dispersion by the BET and Kutilek methods in a wide range of specific surface area values between 10 and 250 m2/g.

  6. Preparation, Surface and Pore Structure of High Surface Area Activated Carbon Fibers from Bamboo by Steam Activation

    Directory of Open Access Journals (Sweden)

    Xiaojun Ma

    2014-06-01

    Full Text Available High surface area activated carbon fibers (ACF have been prepared from bamboo by steam activation after liquefaction and curing. The influences of activation temperature on the microstructure, surface area and porosity were investigated. The results showed that ACF from bamboo at 850 °C have the maximum iodine and methylene blue adsorption values. Aside from the graphitic carbon, phenolic and carbonyl groups were the predominant functions on the surface of activated carbon fiber from bamboo. The prepared ACF from bamboo were found to be mainly type I of isotherm, but the mesoporosity presented an increasing trend after 700 °C. The surface area and micropore volume of samples, which were determined by application of the Brunauer-Emmett-Teller (BET and t-plot methods, were as high as 2024 m2/g and 0.569 cm3/g, respectively. It was also found that the higher activation temperature produced the more ordered microcrystalline structure of ACF from bamboo.

  7. Whole object surface area and volume of partial-view 3D models

    International Nuclear Information System (INIS)

    Mulukutla, Gopal K; Proussevitch, Alexander A; Genareau, Kimberly D; Durant, Adam J

    2017-01-01

    Micro-scale 3D models, important components of many studies in science and engineering, are often used to determine morphological characteristics such as shape, surface area and volume. The application of techniques such as stereoscopic scanning electron microscopy on whole objects often results in ‘partial-view’ models with a portion of object not within the field of view thus not captured in the 3D model. The nature and extent of the surface not captured is dependent on the complex interaction of imaging system attributes (e.g. working distance, viewing angle) with object size, shape and morphology. As a result, any simplistic assumptions in estimating whole object surface area or volume can lead to significant errors. In this study, we report on a novel technique to estimate the physical fraction of an object captured in a partial-view 3D model of an otherwise whole object. This allows a more accurate estimate of surface area and volume. Using 3D models, we demonstrate the robustness of this method and the accuracy of surface area and volume estimates relative to true values. (paper)

  8. Multiproxy summer and winter surface air temperature field reconstructions for southern South America covering the past centuries

    Energy Technology Data Exchange (ETDEWEB)

    Neukom, R.; Grosjean, M.; Wanner, H. [University of Bern, Oeschger Centre for Climate Change Research (OCCR), Bern (Switzerland); University of Bern, Institute of Geography, Climatology and Meteorology, Bern (Switzerland); Luterbacher, J. [Justus Liebig University of Giessen, Department of Geography, Climatology, Climate Dynamics and Climate Change, Giessen (Germany); Villalba, R.; Morales, M.; Srur, A. [CONICET, Instituto Argentino de Nivologia, Glaciologia y Ciencias Ambientales (IANIGLA), Mendoza (Argentina); Kuettel, M. [University of Bern, Oeschger Centre for Climate Change Research (OCCR), Bern (Switzerland); University of Bern, Institute of Geography, Climatology and Meteorology, Bern (Switzerland); University of Washington, Department of Earth and Space Sciences, Seattle (United States); Frank, D. [Swiss Federal Research Institute WSL, Birmensdorf (Switzerland); Jones, P.D. [University of East Anglia, Climatic Research Unit, School of Environmental Sciences, Norwich (United Kingdom); Aravena, J.-C. [Centro de Estudios Cuaternarios de Fuego Patagonia y Antartica (CEQUA), Punta Arenas (Chile); Black, D.E. [Stony Brook University, School of Marine and Atmospheric Sciences, Stony Brook (United States); Christie, D.A.; Urrutia, R. [Universidad Austral de Chile Valdivia, Laboratorio de Dendrocronologia, Facultad de Ciencias Forestales y Recursos Naturales, Valdivia (Chile); D' Arrigo, R. [Earth Institute at Columbia University, Tree-Ring Laboratory, Lamont-Doherty Earth Observatory, Palisades, NY (United States); Lara, A. [Universidad Austral de Chile Valdivia, Laboratorio de Dendrocronologia, Facultad de Ciencias Forestales y Recursos Naturales, Valdivia (Chile); Nucleo Cientifico Milenio FORECOS, Fundacion FORECOS, Valdivia (Chile); Soliz-Gamboa, C. [Utrecht Univ., Inst. of Environmental Biology, Utrecht (Netherlands); Gunten, L. von [Univ. of Bern (Switzerland); Univ. of Massachusetts, Climate System Research Center, Amherst (United States)

    2011-07-15

    We statistically reconstruct austral summer (winter) surface air temperature fields back to ad 900 (1706) using 22 (20) annually resolved predictors from natural and human archives from southern South America (SSA). This represents the first regional-scale climate field reconstruction for parts of the Southern Hemisphere at this high temporal resolution. We apply three different reconstruction techniques: multivariate principal component regression, composite plus scaling, and regularized expectation maximization. There is generally good agreement between the results of the three methods on interannual and decadal timescales. The field reconstructions allow us to describe differences and similarities in the temperature evolution of different sub-regions of SSA. The reconstructed SSA mean summer temperatures between 900 and 1350 are mostly above the 1901-1995 climatology. After 1350, we reconstruct a sharp transition to colder conditions, which last until approximately 1700. The summers in the eighteenth century are relatively warm with a subsequent cold relapse peaking around 1850. In the twentieth century, summer temperatures reach conditions similar to earlier warm periods. The winter temperatures in the eighteenth and nineteenth centuries were mostly below the twentieth century average. The uncertainties of our reconstructions are generally largest in the eastern lowlands of SSA, where the coverage with proxy data is poorest. Verifications with independent summer temperature proxies and instrumental measurements suggest that the interannual and multi-decadal variations of SSA temperatures are well captured by our reconstructions. This new dataset can be used for data/model comparison and data assimilation as well as for detection and attribution studies at sub-continental scales. (orig.)

  9. Measurement of the specific surface area of loose copper deposit by electrochemical methods

    Directory of Open Access Journals (Sweden)

    E. A. Dolmatova

    2016-07-01

    Full Text Available In the work the surface area of the electrode with dispersed copper deposit obtained within 30 seconds was evaluated by techniques of chronopotentiometry (CPM and impedance spectroscopy. In method CPM the electrode surface available for measurement depends on the value of the polarizing current. At high currents during the transition time there is a change of surface relief that can not determine the full surface of loose deposit. The electrochemical impedance method is devoid of this shortcoming since the measurements are carried out in indifferent electrolyte in the absence of current. The area measured by the impedance is tens of times higher than the value obtained by chronopotentiometry. It is found that from a solution containing sulfuric acid the deposits form with a high specific surface area. Based on these data it was concluded that the method of impedance spectroscopy can be used to measure in situ the surface area of the dispersed copper deposits.

  10. Estimating surface fluxes over the north Tibetan Plateau area with ASTER imagery

    Directory of Open Access Journals (Sweden)

    Weiqiang Ma

    2009-01-01

    Full Text Available Surface fluxes are important boundary conditions for climatological modeling and Asian monsoon system. The recent availability of high-resolution, multi-band imagery from the ASTER (Advanced Space-borne Thermal Emission and Reflection radiometer sensor has enabled us to estimate surface fluxes to bridge the gap between local scale flux measurements using micrometeorological instruments and regional scale land-atmosphere exchanges of water and heat fluxes that are fundamental for the understanding of the water cycle in the Asian monsoon system. A parameterization method based on ASTER data and field observations has been proposed and tested for deriving surface albedo, surface temperature, Normalized Difference Vegetation Index (NDVI, Modified Soil Adjusted Vegetation Index (MSAVI, vegetation coverage, Leaf Area Index (LAI, net radiation flux, soil heat flux, sensible heat flux and latent heat flux over heterogeneous land surface in this paper. As a case study, the methodology was applied to the experimental area of the Coordinated Enhanced Observing Period (CEOP Asia-Australia Monsoon Project (CAMP on the Tibetan Plateau (CAMP/Tibet, located at the north Tibetan Plateau. The ASTER data of 24 July 2001, 29 November 2001 and 12 March 2002 was used in this paper for the case of summer, winter and spring. To validate the proposed methodology, the ground-measured surface variables (surface albedo and surface temperature and land surface heat fluxes (net radiation flux, soil heat flux, sensible heat flux and latent heat flux were compared to the ASTER derived values. The results show that the derived surface variables and land surface heat fluxes in three different months over the study area are in good accordance with the land surface status. Also, the estimated land surface variables and land surface heat fluxes are in good accordance with ground measurements, and all their absolute percentage difference (APD is less than 10% in the validation sites

  11. Environmental and geochemical assessment of surface sediments on irshansk ilmenite deposit area

    Directory of Open Access Journals (Sweden)

    Наталия Олеговна Крюченко

    2015-03-01

    Full Text Available It is revealed the problem of pollution of surface sediments of Irshansk ilmenite deposit area of various chemical elements hazard class (Mn, V, Ba, Ni, Co, Cr, Mo, Cu, Pb, Zn. It is determined its average content in surface sediments of various functional areas (forest and agricultural land, flood deposits, reclaimed land, calculated geochemical criteria, so given ecological and geochemical assessment of area

  12. Gene transcript analysis blood values correlate with 68Ga-DOTA-somatostatin analog (SSA) PET/CT imaging in neuroendocrine tumors and can define disease status

    International Nuclear Information System (INIS)

    Bodei, L.; Kidd, M.; Modlin, I.M.; Drozdov, I.; Prasad, V.; Severi, S.; Paganelli, G.; Ambrosini, V.; Kwekkeboom, D.J.; Krenning, E.P.; Baum, R.P.

    2015-01-01

    Precise determination of neuroendocrine tumor (NET) disease status and response to therapy remains a rate-limiting concern for disease management. This reflects limitations in biomarker specificity and resolution capacity of imaging. In order to evaluate biomarker precision and identify if combinatorial blood molecular markers and imaging could provide added diagnostic value, we assessed the concordance between 68 Ga-somatostatin analog (SSA) positron emission tomography (PET), circulating NET gene transcripts (NETest), chromogranin A (CgA), and Ki-67 in NETs. We utilized two independent patient groups with positive 68 Ga-SSA PET: data set 1 ( 68 Ga-SSA PETs undertaken for peptide receptor radionuclide therapy (PRRT), as primary or salvage treatment, n = 27) and data set 2 ( 68 Ga-SSA PETs performed in patients referred for initial disease staging or restaging after various therapies, n = 22). We examined the maximum standardized uptake value (SUV max ), circulating gene transcripts, CgA levels, and baseline Ki-67. Regression analyses, generalized linear modeling, and receiver-operating characteristic (ROC) analyses were undertaken to determine the strength of the relationships. SUV max measured in two centers were mathematically evaluated (regression modeling) and determined to be comparable. Of 49 patients, 47 (96 %) exhibited a positive NETest. Twenty-six (54 %) had elevated CgA (χ 2 = 20.1, p < 2.5 x 10 -6 ). The majority (78 %) had Ki-67 < 20 %. Gene transcript scores were predictive of imaging with >95 % concordance and significantly correlated with SUV max (R 2 = 0.31, root-mean-square error = 9.4). The genes MORF4L2 and somatostatin receptors SSTR1, 3, and 5 exhibited the highest correlation with SUV max . Progressive disease was identified by elevated levels of a quotient of MORF4L2 expression and SUV max [ROC-derived AUC (R 2 = 0.7, p < 0.05)]. No statistical relationship was identified between CgA and Ki-67 and no relationship with imaging parameters

  13. 30 CFR 785.19 - Surface coal mining and reclamation operations on areas or adjacent to areas including alluvial...

    Science.gov (United States)

    2010-07-01

    ... alluvial valley floor exists if it finds that— (i) Unconsolidated streamlaid deposits holding streams are... on areas or adjacent to areas including alluvial valley floors in the arid and semiarid areas west of....19 Surface coal mining and reclamation operations on areas or adjacent to areas including alluvial...

  14. Long-term studies on the effects of nonvolatile organic compounds on porous media surface areas.

    Science.gov (United States)

    Khachikian, Crist S; Harmon, Thomas C

    2002-01-01

    This paper investigates the long-term behavior of porous media contaminated by nonvolatile organic compounds (NVOC) in terms of specific interfacial surface area. Specifically, a natural sand, Moffett sand (MS), was contaminated with naphthalene and the surface area was measured repeatedly over time using nitrogen adsorption-desorption techniques. A field-contaminated sand affected by lamp-black material (LB) from former manufactured gas plant operations was also studied. Lampblack is a carbonaceous skeleton containing polycyclic aromatic hydrocarbons (PAHs) and other hydrocarbons. It is hypothesized that soils contaminated by these types of chemicals will exhibit significantly less surface area than their clean counterparts. The surface areas for the contaminated MS samples increased toward their clean-MS values during the 700-h aging period, but achieved the clean values only after pentane extraction or heating at 60 degrees C. Heating at 50 degrees C failed to achieve a similar recovery of the clean-MS surface area value. Nonspecific mass loss tracked the increase in surface area as indirect evidence that naphthalene loss was the cause of the surface area increase. For the LB samples, aging at 100 degrees C produced a slight decrease in surface area and mass while aging at 250 degrees C caused the surface area to increase roughly threefold while the mass decreased by approximately 1%. These results suggest that, under moderate heating and over the time scale of this investigation, there is a redistribution of the complex contaminant mixture on the solid matrix. Greater temperatures remove mass more efficiently and therefore exhibited the surface area increase expected in this experiment.

  15. A method of analyzing rectal surface area irradiated and rectal complications in prostate conformal radiotherapy

    International Nuclear Information System (INIS)

    Lu Yong; Song, Paul Y.; Li Shidong; Spelbring, Danny R.; Vijayakumar, Srinivasan; Haraf, Daniel J.; Chen, George T.Y.

    1995-01-01

    Purpose: To develop a method of analyzing rectal surface area irradiated and rectal complications in prostate conformal radiotherapy. Methods and Materials: Dose-surface histograms of the rectum, which state the rectal surface area irradiated to any given dose, were calculated for a group of 27 patients treated with a four-field box technique to a total (tumor minimum) dose ranging from 68 to 70 Gy. Occurrences of rectal toxicities as defined by the Radiation Therapy Oncology Group (RTOG) were recorded and examined in terms of dose and rectal surface area irradiated. For a specified end point of rectal complication, the complication probability was analyzed as a function of dose irradiated to a fixed rectal area, and as a function of area receiving a fixed dose. Lyman's model of normal tissue complication probability (NTCP) was used to fit the data. Results: The observed occurrences of rectal complications appear to depend on the rectal surface area irradiated to a given dose level. The patient distribution of each toxicity grade exhibits a maximum as a function of percentage surface area irradiated, and the maximum moves to higher values of percentage surface area as the toxicity grade increases. The dependence of the NTCP for the specified end point on dose and percentage surface area irradiated was fitted to Lyman's NTCP model with a set of parameters. The curvature of the NTCP as a function of the surface area suggests that the rectum is a parallel structured organ. Conclusions: The described method of analyzing rectal surface area irradiated yields interesting insight into understanding rectal complications in prostate conformal radiotherapy. Application of the method to a larger patient data set has the potential to facilitate the construction of a full dose-surface-complication relationship, which would be most useful in guiding clinical practice

  16. High-surface-area active carbon

    International Nuclear Information System (INIS)

    O'Grady, T.M.; Wennerberg, A.N.

    1986-01-01

    This paper describes the preparation and properties of a unique active carbon having exceptionally high surface areas, over 2500 m 2 /gm, and extraordinary adsorptive capacities. The carbon is made by a direct chemical activation route in which petroleum coke or other carbonaceous sources are reacted with excess potassium hydroxide at 400 0 to 500 0 C to an intermediate product that is subsequently pyrolyzed at 800 0 to 900 0 C to active carbon containing potassium salts. These are removed by water washing and the carbon is dried to produce a powdered product. A granular carbon can also be made by further processing the powdered carbon by using specialized granulation techniques. Typical properties of the carbon include Iodine Numbers of 3000 to 3600, methylene blue adsorption of 650 to 750 mg/gm, pore volumes of 2.0 to 2.6 cc/gm and less than 3.0% ash. This carbon's high adsorption capacities make it uniquely suited for numerous demanding applications in the medical area, purifications, removal of toxic substances, as catalyst carriers, etc

  17. Spectral theory of infinite-area hyperbolic surfaces

    CERN Document Server

    Borthwick, David

    2016-01-01

    This text introduces geometric spectral theory in the context of infinite-area Riemann surfaces, providing a comprehensive account of the most recent developments in the field. For the second edition the context has been extended to general surfaces with hyperbolic ends, which provides a natural setting for development of the spectral theory while still keeping technical difficulties to a minimum. All of the material from the first edition is included and updated, and new sections have been added. Topics covered include an introduction to the geometry of hyperbolic surfaces, analysis of the resolvent of the Laplacian, scattering theory, resonances and scattering poles, the Selberg zeta function, the Poisson formula, distribution of resonances, the inverse scattering problem, Patterson-Sullivan theory, and the dynamical approach to the zeta function. The new sections cover the latest developments in the field, including the spectral gap, resonance asymptotics near the critical line, and sharp geometric constan...

  18. 75 FR 30839 - Privacy Act of 1974; CMS Computer Match No. 2010-03, HHS Computer Match No. 1003, SSA Computer...

    Science.gov (United States)

    2010-06-02

    ... 1974; CMS Computer Match No. 2010-03, HHS Computer Match No. 1003, SSA Computer Match No. 1048, IRS... Services (CMS). ACTION: Notice of renewal of an existing computer matching program (CMP) that has an...'' section below for comment period. DATES: Effective Dates: CMS filed a report of the Computer Matching...

  19. Electrochemical Properties of High Surface Area Vanadium Oxide Aerogels

    National Research Council Canada - National Science Library

    Dong, Winny

    2001-01-01

    .... Traditional composite electrode structures have prevented truly quantitative analysis of surface area effects in nanoscale battery materials, as well as a study of their innate electrochemical behavior...

  20. Assessment of Surface Area Characteristics of Dental Implants with Gradual Bioactive Surface Treatment

    Science.gov (United States)

    Czan, Andrej; Babík, Ondrej; Miklos, Matej; Záušková, Lucia; Mezencevová, Viktória

    2017-10-01

    Since most of the implant surface is in direct contact with bone tissue, shape and integrity of said surface has great influence on successful osseointegration. Among other characteristics that predetermine titanium of different grades of pureness as ideal biomaterial, titanium shows high mechanical strength making precise miniature machining increasingly difficult. Current titanium-based implants are often anodized due to colour coding. This anodized layer has important functional properties for right usage and also bio-compatibility of dental implants. Physical method of anodizing and usage of anodizing mediums has a significant influence on the surface quality and itself functionality. However, basic requirement of the dental implant with satisfactory properties is quality of machined surface before anodizing. Roughness, for example, is factor affecting of time length of anodizing operation and so whole productivity. The paper is focused on monitoring of surface and area characteristics, such as roughness or surface integrity after different cutting conditions of miniature machining of dental implants and their impact on suitability for creation of satisfactory anodized layer with the correct biocompatible functional properties.

  1. Relationship among land surface temperature and LUCC, NDVI in typical karst area.

    Science.gov (United States)

    Deng, Yuanhong; Wang, Shijie; Bai, Xiaoyong; Tian, Yichao; Wu, Luhua; Xiao, Jianyong; Chen, Fei; Qian, Qinghuan

    2018-01-12

    Land surface temperature (LST) can reflect the land surface water-heat exchange process comprehensively, which is considerably significant to the study of environmental change. However, research about LST in karst mountain areas with complex topography is scarce. Therefore, we retrieved the LST in a karst mountain area from Landsat 8 data and explored its relationships with LUCC and NDVI. The results showed that LST of the study area was noticeably affected by altitude and underlying surface type. In summer, abnormal high-temperature zones were observed in the study area, perhaps due to karst rocky desertification. LSTs among different land use types significantly differed with the highest in construction land and the lowest in woodland. The spatial distributions of NDVI and LST exhibited opposite patterns. Under the spatial combination of different land use types, the LST-NDVI feature space showed an obtuse-angled triangle shape and showed a negative linear correlation after removing water body data. In summary, the LST can be retrieved well by the atmospheric correction model from Landsat 8 data. Moreover, the LST of the karst mountain area is controlled by altitude, underlying surface type and aspect. This study provides a reference for land use planning, ecological environment restoration in karst areas.

  2. Comparison of diffusion charging and mobility-based methods for measurement of aerosol agglomerate surface area.

    Science.gov (United States)

    Ku, Bon Ki; Kulkarni, Pramod

    2012-05-01

    We compare different approaches to measure surface area of aerosol agglomerates. The objective was to compare field methods, such as mobility and diffusion charging based approaches, with laboratory approach, such as Brunauer, Emmett, Teller (BET) method used for bulk powder samples. To allow intercomparison of various surface area measurements, we defined 'geometric surface area' of agglomerates (assuming agglomerates are made up of ideal spheres), and compared various surface area measurements to the geometric surface area. Four different approaches for measuring surface area of agglomerate particles in the size range of 60-350 nm were compared using (i) diffusion charging-based sensors from three different manufacturers, (ii) mobility diameter of an agglomerate, (iii) mobility diameter of an agglomerate assuming a linear chain morphology with uniform primary particle size, and (iv) surface area estimation based on tandem mobility-mass measurement and microscopy. Our results indicate that the tandem mobility-mass measurement, which can be applied directly to airborne particles unlike the BET method, agrees well with the BET method. It was also shown that the three diffusion charging-based surface area measurements of silver agglomerates were similar within a factor of 2 and were lower than those obtained from the tandem mobility-mass and microscopy method by a factor of 3-10 in the size range studied. Surface area estimated using the mobility diameter depended on the structure or morphology of the agglomerate with significant underestimation at high fractal dimensions approaching 3.

  3. On semiautomatic estimation of surface area

    DEFF Research Database (Denmark)

    Dvorak, J.; Jensen, Eva B. Vedel

    2013-01-01

    and the surfactor. For ellipsoidal particles, it is shown that the flower estimator is equal to the pivotal estimator based on support function measurements along four perpendicular rays. This result makes the pivotal estimator a powerful approximation to the flower estimator. In a simulation study of prolate....... If the segmentation is correct the estimate is computed automatically, otherwise the expert performs the necessary measurements manually. In case of convex particles we suggest to base the semiautomatic estimation on the so-called flower estimator, a new local stereological estimator of particle surface area....... For convex particles, the estimator is equal to four times the area of the support set (flower set) of the particle transect. We study the statistical properties of the flower estimator and compare its performance to that of two discretizations of the flower estimator, namely the pivotal estimator...

  4. Digital photography and transparency-based methods for measuring wound surface area.

    Science.gov (United States)

    Bhedi, Amul; Saxena, Atul K; Gadani, Ravi; Patel, Ritesh

    2013-04-01

    To compare and determine a credible method of measurement of wound surface area by linear, transparency, and photographic methods for monitoring progress of wound healing accurately and ascertaining whether these methods are significantly different. From April 2005 to December 2006, 40 patients (30 men, 5 women, 5 children) admitted to the surgical ward of Shree Sayaji General Hospital, Baroda, had clean as well as infected wound following trauma, debridement, pressure sore, venous ulcer, and incision and drainage. Wound surface areas were measured by these three methods (linear, transparency, and photographic methods) simultaneously on alternate days. The linear method is statistically and significantly different from transparency and photographic methods (P value transparency and photographic methods (P value >0.05). Photographic and transparency methods provided measurements of wound surface area with equivalent result and there was no statistically significant difference between these two methods.

  5. Gene transcript analysis blood values correlate with {sup 68}Ga-DOTA-somatostatin analog (SSA) PET/CT imaging in neuroendocrine tumors and can define disease status

    Energy Technology Data Exchange (ETDEWEB)

    Bodei, L. [European Institute of Oncology, Division of Nuclear Medicine, Milan (Italy); Kidd, M.; Modlin, I.M.; Drozdov, I. [Wren Laboratories, Branford, CT (United States); Prasad, V. [Charite University Hospital, Department of Nuclear Medicine, Berlin (Germany); Severi, S.; Paganelli, G. [Istituto Scientifico Romagnolo per lo Studio e la Cura dei Tumori (IRST) IRCCS, Nuclear Medicine and Radiometabolic Units, Meldola (Italy); Ambrosini, V. [S. Orsola-Malpighi University Hospital, Nuclear Medicine, Bologna (Italy); Kwekkeboom, D.J.; Krenning, E.P. [Erasmus Medical Center Rotterdam, Nuclear Medicine Department, Rotterdam (Netherlands); Baum, R.P. [Zentralklinik Bad Berka, THERANOSTICS Center for Molecular Radiotherapy and Imaging, Bad Berka (Germany)

    2015-08-15

    Precise determination of neuroendocrine tumor (NET) disease status and response to therapy remains a rate-limiting concern for disease management. This reflects limitations in biomarker specificity and resolution capacity of imaging. In order to evaluate biomarker precision and identify if combinatorial blood molecular markers and imaging could provide added diagnostic value, we assessed the concordance between {sup 68}Ga-somatostatin analog (SSA) positron emission tomography (PET), circulating NET gene transcripts (NETest), chromogranin A (CgA), and Ki-67 in NETs. We utilized two independent patient groups with positive {sup 68}Ga-SSA PET: data set 1 ({sup 68}Ga-SSA PETs undertaken for peptide receptor radionuclide therapy (PRRT), as primary or salvage treatment, n = 27) and data set 2 ({sup 68}Ga-SSA PETs performed in patients referred for initial disease staging or restaging after various therapies, n = 22). We examined the maximum standardized uptake value (SUV{sub max}), circulating gene transcripts, CgA levels, and baseline Ki-67. Regression analyses, generalized linear modeling, and receiver-operating characteristic (ROC) analyses were undertaken to determine the strength of the relationships. SUV{sub max} measured in two centers were mathematically evaluated (regression modeling) and determined to be comparable. Of 49 patients, 47 (96 %) exhibited a positive NETest. Twenty-six (54 %) had elevated CgA (χ{sup 2} = 20.1, p < 2.5 x 10{sup -6}). The majority (78 %) had Ki-67 < 20 %. Gene transcript scores were predictive of imaging with >95 % concordance and significantly correlated with SUV{sub max} (R {sup 2} = 0.31, root-mean-square error = 9.4). The genes MORF4L2 and somatostatin receptors SSTR1, 3, and 5 exhibited the highest correlation with SUV{sub max}. Progressive disease was identified by elevated levels of a quotient of MORF4L2 expression and SUV{sub max} [ROC-derived AUC (R {sup 2} = 0.7, p < 0.05)]. No statistical relationship was identified

  6. An analysis of the potential for achieving the fourth millennium development goal in SSA with domestic resources.

    Science.gov (United States)

    O'Hare, Bernadette; Makuta, Innocent

    2015-02-25

    The importance of good health is reflected in the fact that more than half of the eight Millennium Development Goals (MDGs) are aimed at improving health status. Goal 4 (MDG4) aims to reduce child mortality. The progress indicator for goal 4 is the under-five mortality rate (U5M), with a targeted reduction of two thirds by 2015 from 1990 levels. This paper seeks to compare the time (in years) Sub Saharan African (SSA) countries will take to reach their MDG4 target at the current rate of decline, and the time it could have taken to reach their target if domestic resources had not been lost through illicit financial flows, corruption and servicing of debt since 2000. We estimate the amount by which the Gross Domestic Product (GDP) per capita would increase (in percentage terms) if losses of resource through illicit financial flows, corruption and debt servicing, were reduced. Using the income elasticity of U5M, a metric which reports the percentage change in U5M for a one percent change in GDP per capita, we estimate the potential gains in the annual reduction of the under-five mortality if these resource losses were reduced. At the current rate of reduction in U5M, nine countries out of this sample of 36 SSA countries (25%) will achieve their MDG4 target by 2015. In the absence of the leakages (IFF, corruption and debt service) 30 out of 36 (83%) would reach their MDG4 target by 2015 and all except one country, Zimbabwe would have achieved their MDG4 by 2017 (97%). In view of the uncertainty of the legitimacy of African debts we have also provided results where we excluded debt repayment from our analysis. Most countries would have met MDG4 target by curtailing these outflows. In order to release latent resources in SSA for development, action will be needed both by African countries and internationally. We consider that stemming these outflows, and thereby reducing the need for aid, can be achieved with a more transparent global financial system.

  7. Surface pKa of octanoic, nonanoic, and decanoic fatty acids at the air-water interface: applications to atmospheric aerosol chemistry.

    Science.gov (United States)

    Wellen, Bethany A; Lach, Evan A; Allen, Heather C

    2017-10-11

    There exists large uncertainty in the literature as to the pK a of medium-chain fatty acids at the air-water interface. Via surface tension titration, the surface-pK a values of octanoic (C 8 ), nonanoic (C 9 ), and decanoic (C 10 ) fatty acids are determined to be 4.9, 5.8, and 6.4, respectively. The surface-pK a determined with surface tension differs from the bulk value obtained during a standard acid-base titration. Near the surface-pK a of the C 8 and C 9 systems, surface tension minima are observed and are attributed to the formation of surface-active acid-soap complexes. The direction of the titration is shown to affect the surface-pK a of the C 9 system, as the value shifts to 5.2 with NaOH titrant due to a higher concentration of Na + ions at pH values close to the surface-pK a . As the reactivity and climate-relevant properties of sea spray aerosols (SSA) are partially dictated by the charge and surface activity of the organics at the aerosol-atmosphere interface, the results presented here on SSA-identified C 8 -C 10 fatty acids can be used to better predict the health and climate impact of particles with significant concentrations of medium-chain fatty acids.

  8. Technology of surface wastewater purification, including high-rise construction areas

    Science.gov (United States)

    Tsyba, Anna; Skolubovich, Yury

    2018-03-01

    Despite on the improvements in the quality of high-rise construction areas and industrial wastewater treatment, the pollution of water bodies continues to increase. This is due to the organized and unorganized surface untreated sewage entry into the reservoirs. The qualitative analysis of some cities' surface sewage composition is carried out in the work. Based on the published literature review, the characteristic contamination present in surface wastewater was identified. The paper proposes a new technology for the treatment of surface sewage and presents the results of preliminary studies.

  9. Nanoporous Ni with High Surface Area for Potential Hydrogen Storage Application.

    Science.gov (United States)

    Zhou, Xiaocao; Zhao, Haibo; Fu, Zhibing; Qu, Jing; Zhong, Minglong; Yang, Xi; Yi, Yong; Wang, Chaoyang

    2018-06-01

    Nanoporous metals with considerable specific surface areas and hierarchical pore structures exhibit promising applications in the field of hydrogen storage, electrocatalysis, and fuel cells. In this manuscript, a facile method is demonstrated for fabricating nanoporous Ni with a high surface area by using SiO₂ aerogel as a template, i.e., electroless plating of Ni into an SiO₂ aerogel template followed by removal of the template at moderate conditions. The effects of the prepared conditions, including the electroless plating time, temperature of the structure, and the magnetism of nanoporous Ni are investigated in detail. The resultant optimum nanoporous Ni with a special 3D flower-like structure exhibited a high specific surface area of about 120.5 m²/g. The special nanoporous Ni exhibited a promising prospect in the field of hydrogen storage, with a hydrogen capacity of 0.45 wt % on 4.5 MPa at room temperature.

  10. Evaluating polymer degradation with complex mixtures using a simplified surface area method.

    Science.gov (United States)

    Steele, Kandace M; Pelham, Todd; Phalen, Robert N

    2017-09-01

    Chemical-resistant gloves, designed to protect workers from chemical hazards, are made from a variety of polymer materials such as plastic, rubber, and synthetic rubber. One material does not provide protection against all chemicals, thus proper polymer selection is critical. Standardized testing, such as chemical degradation tests, are used to aid in the selection process. The current methods of degradation ratings based on changes in weight or tensile properties can be expensive and data often do not exist for complex chemical mixtures. There are hundreds of thousands of chemical products on the market that do not have chemical resistance data for polymer selection. The method described in this study provides an inexpensive alternative to gravimetric analysis. This method uses surface area change to evaluate degradation of a polymer material. Degradation tests for 5 polymer types against 50 complex mixtures were conducted using both gravimetric and surface area methods. The percent change data were compared between the two methods. The resulting regression line was y = 0.48x + 0.019, in units of percent, and the Pearson correlation coefficient was r = 0.9537 (p ≤ 0.05), which indicated a strong correlation between percent weight change and percent surface area change. On average, the percent change for surface area was about half that of the weight change. Using this information, an equivalent rating system was developed for determining the chemical degradation of polymer gloves using surface area.

  11. ITO nanoparticles reused from ITO scraps and their applications to sputtering target for transparent conductive electrode layer

    OpenAIRE

    Hong, Sung-Jei; Song, Sang-Hyun; Kim, Byeong Jun; Lee, Jae-Yong; Kim, Young-Sung

    2017-01-01

    In this study, ITO nanoparticles (ITO-NPs) were reused from ITO target scraps to synthesize low cost ITO-NPs and to apply to make sputtering target for transparent conductive electrodes (TCEs). By controlling heat-treatment temperature as 980??C, we achieved reused ITO-NPs having Brunauer, Emmett and Teller specific surface area (BET SSA) and average particle size 8.05?m2/g and 103.8?nm, respectively. The BET SSA decreases along with increasing heat-treatment temperature. The ITO-NPs were gro...

  12. TiSSA pleenum "Sotsiaaltöö kriisi ajal" : mida on sotsiaaltööl pakkuda ja kes saab sellest kasu? / Regina Lind

    Index Scriptorium Estoniae

    Lind, Regina

    2010-01-01

    22.-27. aug. 2010 toimus Tallinna Ülikoolis TiSSA doktorantide eelkonverents ja pleenum. Pleenumil peetud sotsiaalteadlaste ettekannetest. Esinesid: Holger Ziegler, Karin Böllert, Catrin Heite, Hans van Ewijk, Walter Lorenz, Mikko Mäntysaari, Heinz Sünker, Synnöve Karvinen-Niinikoski, Olga Borodkina

  13. Preparation of MgO with High Surface Area, and Modification of Its Pore Characteristics

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Moon Hee; Park, Dong Gon [Sookmyung Women' s University, Seoul (Korea, Republic of)

    2003-10-15

    Thermal decomposition of hydrated surface layer of Mg(OH){sub 2} at 500 .deg. C in vacuum turned non-porous MgO into porous one with high surface area of around 270 m{sup 2}/g. Most of its surface area, 74 %, was from micropores, and rest of it was from mesopores in wedge-shaped slits, exhibiting bimodal size distribution centered around 30 and 90 A. Rehydration followed by subsequent dehydration at 300 .deg. C in dynamic vacuum further raised the surface area to 340 m{sup 2}/g. Fraction of microporous surface area was increased to 93%, and the shape of the mesopores was modified into parallel slits with a specific dimension of 32 A. Application of Fe{sub 2}O{sub 3} over MgO via iron complex formation did not alter the pore characteristics of MgO core, except slightly increased pore dimension. Over the course of the modification, Fe{sub 2}O{sub 3} stayed on the surface possibly via spill-over reaction.

  14. Differential chemical fractionation of dissolved organic matter during sorption by Fe mineral phases in a tropical soil from the Luquillo Critical Zone Observatory

    Science.gov (United States)

    Plante, A. F.; Coward, E.; Ohno, T.; Thompson, A.

    2017-12-01

    Fe-bearing mineral phases contribute substantially to adsorption and stabilization of soil organic matter (SOM), due largely to their high specific surface area (SSA) and reactivity. While the importance of adsorption onto mineral surfaces has been well-elucidated, selectivity of various mineral and organic phases remains poorly understood. The goals of this work were to: 1) quantify the contributions of Fe-minerals of varying crystallinity to dissolved organic matter (DOM) sorption, and 2) characterize the molecular fractionation of DOM induced by reactions at the mineral interface, using a highly-weathered Oxisol from the Luquillo Critical Zone Observatory (LCZO). Three selective dissolution experiments targeting Fe-mineral phases were followed by specific surface area (SSA) analysis of the residues and characterization of extracted DOM by high resolution mass spectrometry (FT-ICR-MS). Fe-depleted extraction residue samples, untreated control soil samples, and Fe-enriched ferrihydrite-coated soil samples were then subjected to a batch sorption experiment with litter-derived DOM. Results of selective dissolution experiments indicated that a substantial proportion of soil SSA was derived from extracted Fe-bearing phases, and FT-ICR-MS analysis of extracted DOM revealed distinct chemical signatures. Sorbed C concentrations were well correlated with Fe contents induced by treatments, and thus SSA. Molecular characterization of the DOM post-sorption indicated that poorly crystalline Fe phases preferentially adsorbed highly unsaturated aromatic compounds, and higher-crystallinity Fe phases were associated with more aliphatic compounds. These findings suggests that molecular fractionation via organomineral complexation may act as a physicochemical filter of DOM released to the critical zone.

  15. Adsorption of water vapour and the specific surface area of arctic zone soils (Spitsbergen)

    Science.gov (United States)

    Cieśla, Jolanta; Sokołowska, Zofia; Witkowska-Walczak, Barbara; Skic, Kamil

    2018-01-01

    Water vapour/nitrogen adsorption were investigated and calculated the specific surface areas of arctic-zone soil samples (Turbic Cryosols) originating from different micro-relief forms (mud boils, cell forms and sorted circles) and from different depths. For the characterisation of the isotherms obtained for arctic soils, the Brunauer-Emmet-Teller model was then compared with the two other models (Aranovich-Donohue and Guggenheim-Anderson-de Boer) which were developed from Brunauer-Emmet-Teller. Specific surface area was calculated using the Brunauer-Emmet-Teller model at p p0-1 range of 0.05-0.35 for the water vapour desorption and nitrogen adsorption isotherms. The values of total specific surface area were the highest in Cryosols on mud boils, lower on cell forms, and the lowest on sorted circles. Such tendency was observed for the results obtained by both the water vapour and nitrogen adsorption. The differences in the values of specific surface area at two investigated layers were small. High determination coefficients were obtained for relationships between the specific surface areas and contents of clay and silt fraction in Cryosols. No statistically significant correlation between the total carbon amount and the values of specific surface area in Cryosols has been found.

  16. Induction of Osmoadaptive Mechanisms and Modulation of Cellular Physiology Help Bacillus licheniformis Strain SSA 61 Adapt to Salt Stress

    Energy Technology Data Exchange (ETDEWEB)

    Paul, Sangeeta; Aggarwal, Chetana; Thakur, Jyoti Kumar; Bandeppa, G. S.; Khan, Md. Aslam; Pearson, Lauren M.; Babnigg, Gyorgy; Giometti, Carol S.; Joachimiak, Andrzej

    2015-01-06

    Bacillus licheniformis strain SSA 61, originally isolated from Sambhar salt lake, was observed to grow even in the presence of 25 % salt stress. Osmoadaptive mechanisms of this halotolerant B. licheniformis strain SSA 61, for long-term survival and growth under salt stress, were determined. Proline was the preferentially accumulated compatible osmolyte. There was also increased accumulation of antioxidants ascorbic acid and glutathione. Among the different antioxidative enzymes assayed, superoxide dismutase played the most crucial role in defense against salt-induced stress in the organism. Adaptation to stress by the organism involved modulation of cellular physiology at various levels. There was enhanced expression of known proteins playing essential roles in stress adaptation, such as chaperones DnaK and GroEL, and general stress protein YfkM and polynucleotide phosphorylase/polyadenylase. Proteins involved in amino acid biosynthetic pathway, ribosome structure, and peptide elongation were also overexpressed. Salt stress-induced modulation of expression of enzymes involved in carbon metabolism was observed. There was up-regulation of a number of enzymes involved in generation of NADH and NADPH, indicating increased cellular demand for both energy and reducing power.

  17. Child health inequities in developing countries: differences across urban and rural areas.

    Science.gov (United States)

    Fotso, Jean-Christophe

    2006-07-11

    To document and compare the magnitude of inequities in child malnutrition across urban and rural areas, and to investigate the extent to which within-urban disparities in child malnutrition are accounted for by the characteristics of communities, households and individuals. The most recent data sets available from the Demographic and Health Surveys (DHS) of 15 countries in sub-Saharan Africa (SSA) are used. The selection criteria were set to ensure that the number of countries, their geographical spread across Western/Central and Eastern/Southern Africa, and their socioeconomic diversities, constitute a good yardstick for the region and allow us to draw some generalizations. A household wealth index is constructed in each country and area (urban, rural), and the odds ratio between its uppermost and lowermost category, derived from multilevel logistic models, is used as a measure of socioeconomic inequalities. Control variables include mother's and father's education, community socioeconomic status (SES) designed to represent the broad socio-economic ecology of the neighborhoods in which families live, and relevant mother- and child-level covariates. Across countries in SSA, though socioeconomic inequalities in stunting do exist in both urban and rural areas, they are significantly larger in urban areas. Intra-urban differences in child malnutrition are larger than overall urban-rural differentials in child malnutrition, and there seem to be no visible relationships between within-urban inequities in child health on the one hand, and urban population growth, urban malnutrition, or overall rural-urban differentials in malnutrition, on the other. Finally, maternal and father's education, community SES and other measurable covariates at the mother and child levels only explain a slight part of the within-urban differences in child malnutrition. The urban advantage in health masks enormous disparities between the poor and the non-poor in urban areas of SSA. Specific

  18. High surface area V-Mo-N materials synthesized from amine intercalated foams

    International Nuclear Information System (INIS)

    Krawiec, Piotr; Narayan Panda, Rabi; Kockrick, Emanuel; Geiger, Dorin; Kaskel, Stefan

    2008-01-01

    Nanocrystalline ternary V-Mo nitrides were prepared via nitridation of amine intercalated oxide foams or bulk ternary oxides. Specific surface areas were in the range between 40 and 198 m 2 g -1 and strongly depended on the preparation method (foam or bulk oxide). Foamed precursors were favorable for vanadium rich materials, while for molybdenum rich samples bulk ternary oxides resulted in higher specific surface areas. The materials were characterized via nitrogen physisorption at 77 K, X-ray diffraction patterns, electron microscopy, and elemental analysis. - Graphical abstract: Nanocrystalline ternary V-Mo nitrides were prepared via nitridation of amine intercalated oxide foams or bulk ternary oxides. Foamed precursors were favorable for vanadium rich materials, while for molybdenum rich samples bulk ternary oxides resulted in higher specific surface areas

  19. A longitudinal study: changes in cortical thickness and surface area during pubertal maturation.

    Directory of Open Access Journals (Sweden)

    Megan M Herting

    Full Text Available Sex hormones have been shown to contribute to the organization and function of the brain during puberty and adolescence. Moreover, it has been suggested that distinct hormone changes in girls versus boys may contribute to the emergence of sex differences in internalizing and externalizing behavior during adolescence. In the current longitudinal study, the influence of within-subject changes in puberty (physical and hormonal on cortical thickness and surface area was examined across a 2-year span, while controlling for age. Greater increases in Tanner Stage predicted less superior frontal thinning and decreases in precuneus surface area in both sexes. Significant Tanner Stage and sex interactions were also seen, with less right superior temporal thinning in girls but not boys, as well as greater decreases in the right bank of the superior temporal sulcus surface area in boys compared to girls. In addition, within-subject changes in testosterone over the 2-year follow-up period were found to relate to decreases in middle superior frontal surface area in boys, but increases in surface area in girls. Lastly, larger increases in estradiol in girls predicted greater middle temporal lobe thinning. These results show that within-subject physical and hormonal markers of puberty relate to region and sex-specific changes in cortical development across adolescence.

  20. A longitudinal study: changes in cortical thickness and surface area during pubertal maturation.

    Science.gov (United States)

    Herting, Megan M; Gautam, Prapti; Spielberg, Jeffrey M; Dahl, Ronald E; Sowell, Elizabeth R

    2015-01-01

    Sex hormones have been shown to contribute to the organization and function of the brain during puberty and adolescence. Moreover, it has been suggested that distinct hormone changes in girls versus boys may contribute to the emergence of sex differences in internalizing and externalizing behavior during adolescence. In the current longitudinal study, the influence of within-subject changes in puberty (physical and hormonal) on cortical thickness and surface area was examined across a 2-year span, while controlling for age. Greater increases in Tanner Stage predicted less superior frontal thinning and decreases in precuneus surface area in both sexes. Significant Tanner Stage and sex interactions were also seen, with less right superior temporal thinning in girls but not boys, as well as greater decreases in the right bank of the superior temporal sulcus surface area in boys compared to girls. In addition, within-subject changes in testosterone over the 2-year follow-up period were found to relate to decreases in middle superior frontal surface area in boys, but increases in surface area in girls. Lastly, larger increases in estradiol in girls predicted greater middle temporal lobe thinning. These results show that within-subject physical and hormonal markers of puberty relate to region and sex-specific changes in cortical development across adolescence.

  1. Infinitesimal-area 2D radiative analysis using parametric surface representation, through NURBS

    Energy Technology Data Exchange (ETDEWEB)

    Daun, K J; Hollands, K G.T.

    1999-07-01

    The use of form factors in the treatment of radiant enclosures requires that the radiosity and surface properties be treated as uniform over finite areas. This restriction can be relaxed by applying an infinitesimal-area analysis, where the radiant exchange is taken to be between infinitesimal areas, rather than finite areas. This paper presents a generic infinitesimal-area formulation that can be applied to two-dimensional enclosure problems. (Previous infinitesimal-area analyses have largely been restricted to specific, one-dimensional problems.) Specifically, the paper shows how the analytical expression for the kernel of the integral equation can be obtained without human intervention, once the enclosure surface has been defined parametrically. This can be accomplished by using a computer algebra package or by using NURBS algorithms, which are the industry standard for the geometrical representations used in CAD-CAM codes. Once the kernel has been obtained by this formalism, the 2D integral equation can be set up and solved numerically. The result is a single general-purpose infinitesimal-area analysis code that can proceed from surface specification to solution. The authors have implemented this 2D code and tested it on 1D problems, whose solutions have been given in the literature, obtaining agreement commensurate with the accuracy of the published solutions.

  2. Nanotechnological Advances in Catalytic Thin Films for Green Large-Area Surfaces

    Directory of Open Access Journals (Sweden)

    Suzan Biran Ay

    2015-01-01

    Full Text Available Large-area catalytic thin films offer great potential for green technology applications in order to save energy, combat pollution, and reduce global warming. These films, either embedded with nanoparticles, shaped with nanostructuring techniques, hybridized with other systems, or functionalized with bionanotechnological methods, can include many different surface properties including photocatalytic, antifouling, abrasion resistant and mechanically resistive, self-cleaning, antibacterial, hydrophobic, and oleophobic features. Thus, surface functionalization with such advanced structuring methods is of significance to increase the performance and wide usage of large-area thin film coatings specifically for environmental remediation. In this review, we focus on methods to increase the efficiency of catalytic reactions in thin film and hence improve the performance in relevant applications while eliminating high cost with the purpose of widespread usage. However, we also include the most recent hybrid architectures, which have potential to make a transformational change in surface applications as soon as high quality and large area production techniques are available. Hence, we present and discuss research studies regarding both organic and inorganic methods that are used to structure thin films that have potential for large-area and eco-friendly coatings.

  3. Influence of Ecological Factors on Estimation of Impervious Surface Area Using Landsat 8 Imagery

    Directory of Open Access Journals (Sweden)

    Yuqiu Jia

    2017-07-01

    Full Text Available Estimation of impervious surface area is important to the study of urban environments and social development, but surface characteristics, as well as the temporal, spectral, and spatial resolutions of remote sensing images, influence the estimation accuracy. To investigate the effects of regional environmental characteristics on the estimation of impervious surface area, we divided China into seven sub-regions based on climate, soil type, feature complexity, and vegetation phenology: arid and semi-arid areas, Huang-Huai-Hai winter wheat production areas, typical temperate regions, the Pearl River Delta, the middle and lower reaches of the Yangtze River, typical tropical and subtropical regions, and the Qinghai Tibet Plateau. Impervious surface area was estimated from Landsat 8 images of five typical cities, including Yinchuan, Shijiazhuang, Shenyang, Ningbo, and Kunming. Using the linear spectral unmixing method, impervious and permeable surface areas were determined at the pixel-scale based on end-member proportions. We calculated the producer’s accuracy, user’s accuracy, and overall accuracy to assess the estimation accuracy, and compared the accuracies among images acquired from different seasons and locations. In tropical and subtropical regions, vegetation canopies can confound the identification of impervious surfaces and, thus, images acquired in winter, early spring, and autumn are most suitable; estimations in the Pearl River Delta, the middle and lower reaches of the Yangtze River are influenced by soil, vegetation phenology, vegetation canopy, and water, and images acquired in spring, summer, and autumn provide the best results; in typical temperate areas, images acquired from spring to autumn are most effective for estimations; in winter wheat-growing areas, images acquired throughout the year are suitable; and in arid and semi-arid areas, summer and early autumn, during which vegetation is abundant, are the optimal seasons for

  4. Hand surface area estimation formula using 3D anthropometry.

    Science.gov (United States)

    Hsu, Yao-Wen; Yu, Chi-Yuang

    2010-11-01

    Hand surface area is an important reference in occupational hygiene and many other applications. This study derives a formula for the palm surface area (PSA) and hand surface area (HSA) based on three-dimensional (3D) scan data. Two-hundred and seventy subjects, 135 males and 135 females, were recruited for this study. The hand was measured using a high-resolution 3D hand scanner. Precision and accuracy of the scanner is within 0.67%. Both the PSA and HSA were computed using the triangular mesh summation method. A comparison between this study and previous textbook values (such as in the U.K. teaching text and Lund and Browder chart discussed in the article) was performed first to show that previous textbooks overestimated the PSA by 12.0% and HSA by 8.7% (for the male, PSA 8.5% and HSA 4.7%, and for the female, PSA 16.2% and HSA 13.4%). Six 1D measurements were then extracted semiautomatically for use as candidate estimators for the PSA and HSA estimation formula. Stepwise regressions on these six 1D measurements and variable dependency test were performed. Results show that a pair of measurements (hand length and hand breadth) were able to account for 96% of the HSA variance and up to 98% of the PSA variance. A test of the gender-specific formula indicated that gender is not a significant factor in either the PSA or HSA estimation.

  5. Role of particle size and composition in metal adsorption by solids deposited on urban road surfaces

    International Nuclear Information System (INIS)

    Gunawardana, Chandima; Egodawatta, Prasanna; Goonetilleke, Ashantha

    2014-01-01

    Despite common knowledge that the metal content adsorbed by fine particles is relatively higher compared to coarser particles, the reasons for this phenomenon have gained little research attention. The research study discussed in the paper investigated the variations in metal content for different particle sizes of solids associated with pollutant build-up on urban road surfaces. Data analysis confirmed that parameters favourable for metal adsorption to solids such as specific surface area, organic carbon content, effective cation exchange capacity and clay forming minerals content decrease with the increase in particle size. Furthermore, the mineralogical composition of solids was found to be the governing factor influencing the specific surface area and effective cation exchange capacity. There is high quartz content in particles >150 μm compared to particles <150 μm. As particle size reduces below 150 μm, the clay forming minerals content increases, providing favourable physical and chemical properties that influence adsorption. -- Highlights: • Physico-chemical parameters investigated in build-up samples from 32 road surfaces. • Mineralogical composition primarily governs the physico-chemical characteristics. • High clay forming mineral content in fine solids increases SSA and ECEC. • Characteristics influenced by quartz and amorphous content with particle size. • High quartz content in coarse particles contributes reduced metal adsorption. -- The mineralogical composition of solids is the governing factor influencing metal adsorption to solids in pollutant build-up on urban surfaces

  6. Ambient pressure dried tetrapropoxysilane-based silica aerogels with high specific surface area

    Science.gov (United States)

    Parale, Vinayak G.; Han, Wooje; Jung, Hae-Noo-Ree; Lee, Kyu-Yeon; Park, Hyung-Ho

    2018-01-01

    In the present paper, we report the synthesis of tetrapropoxysilane (TPOS)-based silica aerogels with high surface area and large pore volume. The silica aerogels were prepared by a two-step sol-gel process followed by surface modification via a simple ambient pressure drying approach. In order to minimize drying shrinkage and obtain hydrophobic aerogels, the surface of the alcogels was modified using trichloromethylsilane as a silylating agent. The effect of the sol-gel compositional parameters on the polymerization of aerogels prepared by TPOS, one of the precursors belonging to the Si(OR)4 family, was reported for the first time. The oxalic acid and NH4OH concentrations were adjusted to achieve good-quality aerogels with high surface area, low density, and high transparency. Controlling the hydrolysis and condensation reactions of the TPOS precursor turned out to be the most important factor to determine the pore characteristics of the aerogel. Highly transparent aerogels with high specific surface area (938 m2/g) and low density (0.047 g/cm3) could be obtained using an optimized TPOS/MeOH molar ratio with appropriate concentrations of oxalic acid and NH4OH.

  7. Growth of contact area between rough surfaces under normal stress

    Science.gov (United States)

    Stesky, R. M.; Hannan, S. S.

    1987-05-01

    The contact area between deforming rough surfaces in marble, alabaster, and quartz was measured from thin sections of surfaces bonded under load with low viscosity resin epoxy. The marble and alabaster samples had contact areas that increased with stress at an accelerating rate. This result suggests that the strength of the asperity contacts decreased progressively during the deformation, following some form of strain weakening relationship. This conclusion is supported by petrographic observation of the thin sections that indicate that much of the deformation was cataclastic, with minor twinning of calcite and kinking of gypsum. In the case of the quartz, the observed contact area was small and increased approximately linearly with normal stress. Only the irreversible cataclastic deformation was observed; however strain-induced birefringence and cracking of the epoxy, not observed with the other rocks, suggests that significant elastic deformation occurred, but recovered during unloading.

  8. Study of measurement methods of ultrafine aerosols surface-area for characterizing occupational exposure

    International Nuclear Information System (INIS)

    Bau, S.

    2008-12-01

    This work aims at improving knowledge on ultrafine aerosols surface-area measurement. Indeed, the development of nano-technologies may lead to occupational exposure to airborne nano-structured particles, which involves a new prevention issue. There is currently no consensus concerning what parameter (mass, surface-area, number) should be measured. However, surface-area could be a relevant metric, since it leads to a satisfying correlation with biological effects when nano-structured particles are inhaled. Hence, an original theoretical work was performed to position the parameter of surface-area in relation to other aerosol characteristics. To investigate measurement techniques of nano-structured aerosols surface-area, the experimental facility CAIMAN (Characterization of Instruments for the Measurement of Aerosols of Nano-particles) was designed and built. Within CAIMAN, it is possible to produce nano-structured aerosols with varying and controlled properties (size, concentration, chemical nature, morphology, state-of-charge), stable and reproducible in time. The generated aerosols were used to experimentally characterize the response of the instruments in study (NSAM and AeroTrak 9000 TSI, LQ1-DC Matter Engineering). The response functions measured with monodisperse aerosols show a good agreement with the corresponding theoretical curves in a large size range, from 15 to 520 nm. Furthermore, hypotheses have been formulated to explain the reasonable biases observed when measuring poly-disperse aerosols. (author)

  9. Models of bedrock surface and overburden thickness over Olkiluoto island and nearby sea area

    Energy Technology Data Exchange (ETDEWEB)

    Moenkkoenen, H. [WSP Finland Oy, Helsinki (Finland)

    2012-04-15

    In this report, a model of bedrock surface and a model of overburden thickness over the Olkiluoto Island and the nearby sea area are presented. Also in purpose to produce material for biosphere and radionuclide transport modelling, stratigraphy models of different sediment layers were created at two priority areas north and south of the Olkiluoto Island. The work concentrated on the collection and description of available data of bedrock surface and overburden thickness. Because the information on the bedrock surface and overburden is collected from different sources and is based on a number of types of data the quality and applicability of data sets varies. Consequently also the reliability in different parts of the models varies. Input data for the bedrock surface and overburden thickness models include 2928 single points and additional outcrops observations (611 polygons) in the modelled area. In addition, the input data include 173 seismic refraction lines (6534 points) and acousticseismic sounding lines (26655 points from which 13721 points are located in model area) in the Olkiluoto offshore area. The average elevation of bedrock surface in area is 2.1 metres above the sea level. The average thickness of overburden is 2.5 metres varying typically between 2 - 4 metres. Thickest overburden covers (approximately 16 metres) of terrestrial area are located at the western end of the Olkiluoto Island and in sea basin south of the island. (orig.)

  10. Models of bedrock surface and overburden thickness over Olkiluoto island and nearby sea area

    International Nuclear Information System (INIS)

    Moenkkoenen, H.

    2012-04-01

    In this report, a model of bedrock surface and a model of overburden thickness over the Olkiluoto Island and the nearby sea area are presented. Also in purpose to produce material for biosphere and radionuclide transport modelling, stratigraphy models of different sediment layers were created at two priority areas north and south of the Olkiluoto Island. The work concentrated on the collection and description of available data of bedrock surface and overburden thickness. Because the information on the bedrock surface and overburden is collected from different sources and is based on a number of types of data the quality and applicability of data sets varies. Consequently also the reliability in different parts of the models varies. Input data for the bedrock surface and overburden thickness models include 2928 single points and additional outcrops observations (611 polygons) in the modelled area. In addition, the input data include 173 seismic refraction lines (6534 points) and acousticseismic sounding lines (26655 points from which 13721 points are located in model area) in the Olkiluoto offshore area. The average elevation of bedrock surface in area is 2.1 metres above the sea level. The average thickness of overburden is 2.5 metres varying typically between 2 - 4 metres. Thickest overburden covers (approximately 16 metres) of terrestrial area are located at the western end of the Olkiluoto Island and in sea basin south of the island. (orig.)

  11. The influence of quorum sensing in compartment II of the MELiSSA loop

    Science.gov (United States)

    Condori, Sandra; Mastroleo, Felice; Wattiez, Ruddy; Leys, Natalie

    MELiSSA (Micro-Ecological Life Support System Alternative) has been conceived as a 5 compartments microorganisms and higher plants recycling system for long haul space flights. Rhodospirillum rubrum S1H colonizes compartment II. Previous work reported that continuous culture of the bacterium in a photobioreactor could lead to thick biofilm formation, leading to bioreactor arrest. Our aim is to investigate the unknown quorum sensing (QS) system of R. rubrum S1H, specifically under MELiSSA relevant culture conditions meaning light anaerobic (LAN) and using acetate as carbon source. In that purpose an autoinducer synthase gene (Rru_A3396) knockout mutant was constructed by allelic exchange generating strain M68. In addition phenotypic comparison between wild type (WT) and M68 was performed. Results of thin layer chromatography assay where Agrobacterium tumefaciens NT1 have been used as reporter strain showed that WT produces acyl-homoserine lactones (AHLs) from C4 to C12 acyl carbon chain length; however, in M68 no AHLs were detected confirming that gene Rru_A3396 (named rruI) encodes an autoinducer synthase. Interestingly under a low shear or static environment M68 showed cell aggregation similar as reported in a closely related bacterium Rhodobacter sphaeroides (cerI mutant). In contrast to WT, M68 did not form biofilm and exhibited a decreased motility and pigment content. M68 vs wild type transcriptomics results showed that 326 genes were statistically significant differentially expressed. Downregulation of genes related to photosynthesis e.g., reaction center subunits, light harvesting complex and photosynthetic assembly proteins was observed. Similar results were obtained for preliminary proteomic analysis. Results obtained showed that in R. rubrum S1H the AHL-based QS system regulates almost 8% of the genome which is linked to biofilm formation among other biological processes described above. Since strain M68 could not be used in compartment II due to its less

  12. Planar spatial correlations, anisotropy, and specific surface area of stationary random porous media

    International Nuclear Information System (INIS)

    Berryman, J.G.

    1998-01-01

    An earlier result of the author showed that an anisotropic spatial correlation function of a random porous medium could be used to compute the specific surface area when it is stationary as well as anisotropic by first performing a three-dimensional radial average and then taking the first derivative with respect to lag at the origin. This result generalized the earlier result for isotropic porous media of Debye et al. [J. Appl. Phys. 28, 679 (1957)]. The present article provides more detailed information about the use of spatial correlation functions for anisotropic porous media and in particular shows that, for stationary anisotropic media, the specific surface area can be related to the derivative of the two-dimensional radial average of the correlation function measured from cross sections taken through the anisotropic medium. The main concept is first illustrated using a simple pedagogical example for an anisotropic distribution of spherical voids. Then, a general derivation of formulas relating the derivative of the planar correlation functions to surface integrals is presented. When the surface normal is uniformly distributed (as is the case for any distribution of spherical voids), our formulas can be used to relate a specific surface area to easily measurable quantities from any single cross section. When the surface normal is not distributed uniformly (as would be the case for an oriented distribution of ellipsoidal voids), our results show how to obtain valid estimates of specific surface area by averaging measurements on three orthogonal cross sections. One important general observation for porous media is that the surface area from nearly flat cracks may be underestimated from measurements on orthogonal cross sections if any of the cross sections happen to lie in the plane of the cracks. This result is illustrated by taking the very small aspect ratio (penny-shaped crack) limit of an oblate spheroid, but holds for other types of flat surfaces as well

  13. Electromagnetic surface waves for large-area RF plasma productions between large-area planar electrodes

    International Nuclear Information System (INIS)

    Nonaka, S.

    1992-01-01

    Recently, large-area plasma production has been tested by means of a 13.56 MHz radio-frequency (RF) discharge between a pair of large-area planar electrodes, approximately 0.5 m x 1.4 m, as one of the semiconductor technologies for fabrication of large-area amorphous silicon solar cells in the ''Sunshine Project'' of the Agency of Industrial Science and Technology in Japan. We also confirmed long plasma production between a pair of long electrodes. In this paper, normal electromagnetic (EM) waves propagating in a region between a planar waveguide with one plasma and two dielectric layers are analyzed in order to study the feasibility of large-area plasma productions by EM wave-discharges between a pair of large-area RF electrodes larger than the half-wavelength of RF wave. In conclusion, plasmas higher than an electron plasma frequency will be produced by an odd TMoo surface mode. (author) 4 refs., 3 figs

  14. Measuring the specific surface area of natural and manmade glasses: effects of formation process, morphology, and particle size

    International Nuclear Information System (INIS)

    Papelis, Charalambos; Um, Wooyong; Russel, Charles E.; Chapman, Jenny B.

    2003-01-01

    The specific surface area of natural and manmade solid materials is a key parameter controlling important interfacial processes in natural environments and engineered systems, including dissolution reactions and sorption processes at solid-fluid interfaces. To improve our ability to quantify the release of trace elements trapped in natural glasses, the release of hazardous compounds trapped in manmade glasses, or the release of radionuclides from nuclear melt glass, we measured the specific surface area of natural and manmade glasses as a function of particle size, morphology, and composition. Volcanic ash, volcanic tuff, tektites, obsidian glass, and in situ vitrified rock were analyzed. Specific surface area estimates were obtained using krypton as gas adsorbent and the BET model. The range of surface areas measured exceeded three orders of magnitude. A tektite sample had the highest surface area (1.65 m2/g), while one of the samples of in situ vitrified rock had the lowest surf ace area (0.0016 m2/g). The specific surface area of the samples was a function of particle size, decreasing with increasing particle size. Different types of materials, however, showed variable dependence on particle size, and could be assigned to one of three distinct groups: (1) samples with low surface area dependence on particle size and surface areas approximately two orders of magnitude higher than the surface area of smooth spheres of equivalent size. The specific surface area of these materials was attributed mostly to internal porosity and surface roughness. (2) samples that showed a trend of decreasing surface area dependence on particle size as the particle size increased. The minimum specific surface area of these materials was between 0.1 and 0.01 m2/g and was also attributed to internal porosity and surface roughness. (3) samples whose surface area showed a monotonic decrease with increasing particle size, never reaching an ultimate surface area limit within the particle

  15. Estimation of surface area concentration of workplace incidental nanoparticles based on number and mass concentrations

    Science.gov (United States)

    Park, J. Y.; Ramachandran, G.; Raynor, P. C.; Kim, S. W.

    2011-10-01

    Surface area was estimated by three different methods using number and/or mass concentrations obtained from either two or three instruments that are commonly used in the field. The estimated surface area concentrations were compared with reference surface area concentrations (SAREF) calculated from the particle size distributions obtained from a scanning mobility particle sizer and an optical particle counter (OPC). The first estimation method (SAPSD) used particle size distribution measured by a condensation particle counter (CPC) and an OPC. The second method (SAINV1) used an inversion routine based on PM1.0, PM2.5, and number concentrations to reconstruct assumed lognormal size distributions by minimizing the difference between measurements and calculated values. The third method (SAINV2) utilized a simpler inversion method that used PM1.0 and number concentrations to construct a lognormal size distribution with an assumed value of geometric standard deviation. All estimated surface area concentrations were calculated from the reconstructed size distributions. These methods were evaluated using particle measurements obtained in a restaurant, an aluminum die-casting factory, and a diesel engine laboratory. SAPSD was 0.7-1.8 times higher and SAINV1 and SAINV2 were 2.2-8 times higher than SAREF in the restaurant and diesel engine laboratory. In the die casting facility, all estimated surface area concentrations were lower than SAREF. However, the estimated surface area concentration using all three methods had qualitatively similar exposure trends and rankings to those using SAREF within a workplace. This study suggests that surface area concentration estimation based on particle size distribution (SAPSD) is a more accurate and convenient method to estimate surface area concentrations than estimation methods using inversion routines and may be feasible to use for classifying exposure groups and identifying exposure trends.

  16. Estimation of surface area concentration of workplace incidental nanoparticles based on number and mass concentrations

    International Nuclear Information System (INIS)

    Park, J. Y.; Ramachandran, G.; Raynor, P. C.; Kim, S. W.

    2011-01-01

    Surface area was estimated by three different methods using number and/or mass concentrations obtained from either two or three instruments that are commonly used in the field. The estimated surface area concentrations were compared with reference surface area concentrations (SA REF ) calculated from the particle size distributions obtained from a scanning mobility particle sizer and an optical particle counter (OPC). The first estimation method (SA PSD ) used particle size distribution measured by a condensation particle counter (CPC) and an OPC. The second method (SA INV1 ) used an inversion routine based on PM1.0, PM2.5, and number concentrations to reconstruct assumed lognormal size distributions by minimizing the difference between measurements and calculated values. The third method (SA INV2 ) utilized a simpler inversion method that used PM1.0 and number concentrations to construct a lognormal size distribution with an assumed value of geometric standard deviation. All estimated surface area concentrations were calculated from the reconstructed size distributions. These methods were evaluated using particle measurements obtained in a restaurant, an aluminum die-casting factory, and a diesel engine laboratory. SA PSD was 0.7–1.8 times higher and SA INV1 and SA INV2 were 2.2–8 times higher than SA REF in the restaurant and diesel engine laboratory. In the die casting facility, all estimated surface area concentrations were lower than SA REF . However, the estimated surface area concentration using all three methods had qualitatively similar exposure trends and rankings to those using SA REF within a workplace. This study suggests that surface area concentration estimation based on particle size distribution (SA PSD ) is a more accurate and convenient method to estimate surface area concentrations than estimation methods using inversion routines and may be feasible to use for classifying exposure groups and identifying exposure trends.

  17. Description of surface systems. Preliminary site description Simpevarp sub area - Version 1.2

    Energy Technology Data Exchange (ETDEWEB)

    Lindborg, Tobias [ed.

    2005-03-01

    Swedish Nuclear Fuel and Waste Management Co is currently conducting site characterisation in the Simpevarp area. The area is divided into two subareas, the Simpevarp and the Laxemar subarea. The two subareas are surrounded by a common regional model area, the Simpevarp area. This report describes both the regional area and the subareas. This report is an interim version (model version 1.2) of the description of the surface systems at the Simpevarp area, and should be seen as a background report to the site description of the Simpevarp area, version 1.2, SKB-R--05-08. The basis for this description is quality-assured field data available in the SKB SICADA and GIS databases, together with generic data from the literature. The Surface system, here defined as everything above the bedrock, comprises a number of separate disciplines (e.g. hydrology, geology, topography, oceanography and ecology). Each discipline has developed descriptions and models for a number of properties that together represent the site description. The current methodology for developing the surface system description and the integration to ecosystem models is documented in a methodology strategy report SKB-R--03-06. The procedures and guidelines given in that report were followed in this report. Compared with version 1.1 of the surface system description SKB-R--04-25, this report presents considerable additional features, especially in the ecosystem description (Chapter 4) and in the description of the surface hydrology (Section 3.4). A first attempt has also been made to connect the flow of matter (carbon) between the different ecosystems into an overall ecosystem model at a landscape level. A summarised version of this report is also presented in SKB-R--05-08 together with geological-, hydrogeological-, transport properties-, thermal properties-, rock mechanics- and hydrogeochemical descriptions.

  18. Description of surface systems. Preliminary site description Simpevarp sub area - Version 1.2

    International Nuclear Information System (INIS)

    Lindborg, Tobias

    2005-03-01

    Swedish Nuclear Fuel and Waste Management Co is currently conducting site characterisation in the Simpevarp area. The area is divided into two subareas, the Simpevarp and the Laxemar subarea. The two subareas are surrounded by a common regional model area, the Simpevarp area. This report describes both the regional area and the subareas. This report is an interim version (model version 1.2) of the description of the surface systems at the Simpevarp area, and should be seen as a background report to the site description of the Simpevarp area, version 1.2, SKB-R--05-08. The basis for this description is quality-assured field data available in the SKB SICADA and GIS databases, together with generic data from the literature. The Surface system, here defined as everything above the bedrock, comprises a number of separate disciplines (e.g. hydrology, geology, topography, oceanography and ecology). Each discipline has developed descriptions and models for a number of properties that together represent the site description. The current methodology for developing the surface system description and the integration to ecosystem models is documented in a methodology strategy report SKB-R--03-06. The procedures and guidelines given in that report were followed in this report. Compared with version 1.1 of the surface system description SKB-R--04-25, this report presents considerable additional features, especially in the ecosystem description (Chapter 4) and in the description of the surface hydrology (Section 3.4). A first attempt has also been made to connect the flow of matter (carbon) between the different ecosystems into an overall ecosystem model at a landscape level. A summarised version of this report is also presented in SKB-R--05-08 together with geological-, hydrogeological-, transport properties-, thermal properties-, rock mechanics- and hydrogeochemical descriptions

  19. Constrained energy minimization applied to apparent reflectance and single-scattering albedo spectra: a comparison

    Science.gov (United States)

    Resmini, Ronald G.; Graver, William R.; Kappus, Mary E.; Anderson, Mark E.

    1996-11-01

    Constrained energy minimization (CEM) has been applied to the mapping of the quantitative areal distribution of the mineral alunite in an approximately 1.8 km2 area of the Cuprite mining district, Nevada. CEM is a powerful technique for rapid quantitative mineral mapping which requires only the spectrum of the mineral to be mapped. A priori knowledge of background spectral signatures is not required. Our investigation applies CEM to calibrated radiance data converted to apparent reflectance (AR) and to single scattering albedo (SSA) spectra. The radiance data were acquired by the 210 channel, 0.4 micrometers to 2.5 micrometers airborne Hyperspectral Digital Imagery Collection Experiment sensor. CEM applied to AR spectra assumes linear mixing of the spectra of the materials exposed at the surface. This assumption is likely invalid as surface materials, which are often mixtures of particulates of different substances, are more properly modeled as intimate mixtures and thus spectral mixing analyses must take account of nonlinear effects. One technique for approximating nonlinear mixing requires the conversion of AR spectra to SSA spectra. The results of CEM applied to SSA spectra are compared to those of CEM applied to AR spectra. The occurrence of alunite is similar though not identical to mineral maps produced with both the SSA and AR spectra. Alunite is slightly more widespread based on processing with the SSA spectra. Further, fractional abundances derived from the SSA spectra are, in general, higher than those derived from AR spectra. Implications for the interpretation of quantitative mineral mapping with hyperspectral remote sensing data are discussed.

  20. Heavy metal contamination in surface runoff sediments of the urban area of Vilnius, Lithuania

    Directory of Open Access Journals (Sweden)

    Gytautas Ignatavičius

    2017-02-01

    Full Text Available Surface runoff from urbanized territories carries a wide range of pollutants. Sediments in untreated runoff from direct discharge stormwater systems significantly contribute to urban waterway pollution. In this study, heavy metal (Pb, Zn, Cu, Cr, Ba, As and Fe contamination in surface runoff sediments of the urban area of the city of Vilnius was investigated. The surface runoff sediment samples were collected from seven dischargers with the highest volume rate of water flow and concentrations of suspended solids. The geospatial analysis of the distribution of heavy metals shows that there are several active pollution sources supplying the dischargers with contaminated sediments. Most of these areas are located in the central part of the city and in old town with intense traffic. Principal components analysis and t-test results clearly depicted the significantly different chemical compositions of winter and autumn surface sediment samples. The sampling approach and assessment of results provide a useful tool to examine the contamination that is generated in urban areas, distinguish pollution sources and give a better understanding of the importance of permeable surfaces and green areas.

  1. Investigation of Simultaneous Effects of Aerosol Properties and Aerosol Peak Height on the Air Mass Factors for Space-Borne NO2 Retrievals

    Directory of Open Access Journals (Sweden)

    Hyunkee Hong

    2017-02-01

    Full Text Available We investigate the simultaneous effects of aerosol peak height (APH, aerosol properties, measurement geometry, and other factors on the air mass factor for NO2 retrieval at sites with high NO2 concentration. A comparison of the effects of high and low surface reflectance reveals that NO2 air mass factor (AMF values over a snowy surface (surface reflectance 0.8 are generally higher than those over a deciduous forest surface (surface reflectance 0.05. Under high aerosol optical depth (AOD conditions, the aerosol shielding effect over a high-albedo surface is revealed to reduce the path-length of light at the surface, whereas high single scattering albedo (SSA conditions (e.g., SSA = 0.95 lead to an increase in the aerosol albedo effect, which results in an increased AMF over areas with low surface reflectance. We also conducted an in-depth study of the APH effect on AMF. For an AOD of 0.1 and half width (HW of 5 km, NO2 AMF decreases by 29% from 1.36 to 0.96 as APH changes from 0 to 2 km. In the case of high-AOD conditions (0.9 and HW of 5 km, the NO2 AMF decreases by 240% from 1.85 to 0.54 as APH changes from 0 to 2 km. The AMF variation due to error in the model input parameters (e.g., AOD, SSA, aerosol shape, and APH is also examined. When APH is 0 km with an AOD of 0.4, SSA of 0.88, and surface reflectance of 0.05, a 30% error in AOD induces an AMF error of between 4.85% and −3.67%, an SSA error of 0.04 leads to NO2 VCD errors of between 4.46% and −4.77%, and a 30% error in AOD induces an AMF error of between −9.53% and 8.35% with an APH of 3 km. In addition to AOD and SSA, APH is an important factor in calculating AMF, due to the 2 km error in APH under high-SZA conditions, which leads to an NO2 VCD error of over 60%. Aerosol shape is also found to have a measureable effect on AMF under high-AOD and small relative azimuth angle (RAA conditions. The diurnal effect of the NO2 profile is also examined and discussed.

  2. Sintering of uranium oxide of high specific surface area

    International Nuclear Information System (INIS)

    Bel, Alain; Francois, Bernard; Delmas, Roger; Caillat, Roger

    1959-01-01

    The extent to which a uranium oxide powder deriving from ammonium uranate or uranium peroxide lends itself to the sintering process depends largely on its specific surface area. When this is greater than 5 m 2 / g there is an optimum temperature for sintering in hydrogen. This temperature becomes less as the specific area of the powder is greater. Reprint of a paper published in Comptes rendus des seances de l'Academie des Sciences, t. 249, p. 1045-1047, sitting of 21 September 1959 [fr

  3. Drets lingüístics i ordenament constitucional. Seguretat lingüística vs jerarquia lingüística. Un estudi comparat de Suïssa i Espanya

    OpenAIRE

    Tasa Fuster, Vicenta

    2016-01-01

    Aquesta tesi doctoral té com a objecte l’anàlisi comparat del tractament legal que reben les diferents llengües d’Espanya i de Suïssa en les constitucions i en la legislació respectives, tot considerant que Espanya i Suïssa són dos estats plurilingües i amb una organització territorial complexa. El treball és fet dins del Dret Constitucional; però té en compte també altres ciències socials, com ara la Ciència Política, la Teoria Política, anàlisi de les polítiques públiques o la sociolingüíst...

  4. Interdependence between body surface area and ultraviolet B dose in vitamin D production

    DEFF Research Database (Denmark)

    Bogh, M K B; Schmedes, Anne; Philipsen, P A

    2011-01-01

    Ultraviolet (UV) B radiation increases serum vitamin D level expressed as 25-hydroxyvitamin-D(3) [25(OH)D], but the relationship to body surface area and UVB dose needs investigation.......Ultraviolet (UV) B radiation increases serum vitamin D level expressed as 25-hydroxyvitamin-D(3) [25(OH)D], but the relationship to body surface area and UVB dose needs investigation....

  5. Development of a certified reference material for specific surface area of quartz sand

    Directory of Open Access Journals (Sweden)

    Egor P Sobina

    2017-01-01

    Full Text Available The paper presents results of conducting research on the development of a certified reference material (CRM for specific surface area of quartz sand, which is practically non-porous and therefore has low specific surface area value ~ 0.8 m2/g. The standard uncertainty due to RM inhomogeneity, the standard uncertainty due to RM instability, as well as the standard uncertainty due to characterization were estimated using the State Primary Standard GET 210‑2014 for Units of Specific Absorption of Gases, Specific Surface Area, Specific Volume, and Pore Size of Solid Substances and Materials. The metrological characteristics of the CRM were determined using a low-temperature gas adsorption method. Krypton was used as an adsorbate to increase measurement accuracy.

  6. 30 CFR 903.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 903.761 Section 903.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, applies to surface coal mining...

  7. Colorectal Adenocarcinoma with an Alternative Serrated Pathway

    Directory of Open Access Journals (Sweden)

    Makoto Eizuka

    2018-04-01

    Full Text Available In a 64-year-old woman, we identified a flat, elevated lesion that was located at the caecum and was composed of 3 different areas (areas A, B, and C. We diagnosed it as “carcinoma with sessile serrated adenoma/polyp (SSA/P” histologically. Although area A was diagnosed as classical SSA/P, area B was regarded as a high-grade SSA/P. In contrast, area C showed a differentiated-type adenocarcinoma that invaded the submucosa. The patient had a recurrence of cancer 1.5 years after endoscopic resection. Overexpression of TP53 was detected in area C. Although BRAF mutation was detected in all areas, CpG island methylator phenotype-high cancer was found only in area C. The genomic phenotype of the cancerous tissue was classified as microsatellite stable (MLH1 gene not methylated. In the present case, we showed that a lesion with genetic alterations based on the histological sequence SSA/P → high-grade SSA/P → cancer in SSA/P and an alternative serrated pathway may exhibit aggressive behavior.

  8. 30 CFR 942.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 942.761 Section 942.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

  9. 30 CFR 910.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by Act of Congress. 910.761 Section 910.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

  10. 30 CFR 937.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Science.gov (United States)

    2010-07-01

    ... mining by Act of Congress. 937.761 Section 937.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... WITHIN EACH STATE OREGON § 937.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and...

  11. 30 CFR 921.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by Act of Congress. 921.761 Section 921.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

  12. 30 CFR 912.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Science.gov (United States)

    2010-07-01

    ... mining by act of Congress. 912.761 Section 912.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... WITHIN EACH STATE IDAHO § 912.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and...

  13. 30 CFR 947.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 947.761 Section 947.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

  14. 30 CFR 939.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by Act of Congress. 939.761 Section 939.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

  15. 30 CFR 941.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 941.761 Section 941.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

  16. 30 CFR 922.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 922.761 Section 922.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

  17. 30 CFR 905.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 905.761 Section 905.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

  18. Monitoring of Surface Subsidence of the Mining Area Based on Sbas

    Science.gov (United States)

    Zhu, Y.; Zhou, S.; Zang, D.; Lu, T.

    2018-05-01

    This paper has collected 7 scenes of L band PALSAR sensor radar data of a mine in FengCheng city, jiangxi province, using the Small-baseline Subset (SBAS) method to invert the surface subsidence of the mine. Baselines of interference less than 800m has been chosen to constitute short baseline differential interference atlas, using pixels whose average coherent coefficient was larger than or equal to 0.3 as like high coherent point target, using singular value decomposition (SVD) method to calculate deformation phase sequence based on these high coherent points, and the accumulation of settlements of study area of different period had been obtained, so as to reflect the ground surface settlement evolution of the settlement of the area. The results of the study has showed that: SBAS technology has overcome coherent problem of the traditionality D-InSAR technique, continuous deformation field of surface mining in time dimension of time could been obtained, characteristics of ground surface settlement of mining subsidence in different period has been displayed, so to improve the accuracy and reliability of the monitoring results.

  19. Radiative surface temperatures of the burned and unburned areas in a tallgrass prairie

    International Nuclear Information System (INIS)

    Asrar, G.; Harris, T.R.; Lapitan, R.L.; Cooper, D.I.

    1988-01-01

    This study was conducted in a natural tallgrass prairie area in the Flint Hills of Kansas. Our objective was to evaluate the surface radiative temperatures of burned and unburned treatments of the grassland as a means of delineating the areas covered by each treatment. Burning is used to remove the senescent vegetation resulting from the previous year's growth. Surface temperatures were obtained in situ and by an airborne scanner. Burned and unburned grass canopies had distinctly different diurnal surface radiative temperatures. Measurements of surface energy balance components revealed a difference in partitioning of the available energy between the two canopies, which resulted in the difference in their measured surface temperatures. The magnitude of this difference is dependent on the time of measurements and topographic conditions. (author)

  20. Roles of surface water areas for water and solute cycle in Hanoi city, Viet Nam

    Science.gov (United States)

    Hayashi, Takeshi; Kuroda, Keisuke; Do Thuan, An; Tran Thi Viet, Nga; Takizawa, Satoshi

    2013-04-01

    Hanoi city, the capital of Viet Nam, has developed beside the Red river. Recent rapid urbanization of this city has reduced a large number of natural water areas such as lakes, ponds and canals not only in the central area but the suburban area. Contrary, the urbanization has increased artificial water areas such as pond for fish cultivation and landscaping. On the other hand, the urbanization has induced the inflow of waste water from households and various kinds of factories to these water areas because of delay of sewerage system development. Inflow of the waste water has induced eutrophication and pollution of these water areas. Also, there is a possibility of groundwater pollution by infiltration of polluted surface water. However, the role of these water areas for water cycle and solute transport is not clarified. Therefore, this study focuses on the interaction between surface water areas and groundwater in Hanoi city to evaluate appropriate land development and groundwater resource management. We are carrying out three approaches: a) understanding of geochemical characteristics of surface water and groundwater, b) monitoring of water levels of pond and groundwater, c) sampling of soil and pond sediment. Correlation between d18O and dD of precipitation (after GNIP), the Red River (after GNIR) and the water samples of this study showed that the groundwater is composed of precipitation, the Red River and surface water that has evaporation process. Contribution of the surface water with evaporation process was widely found in the study area. As for groundwater monitoring, the Holocene aquifers at two sites were in unconfined condition in dry season and the groundwater levels in the aquifer continued to increase through rainy season. The results of isotopic analysis and groundwater level monitoring showed that the surface water areas are one of the major groundwater sources. On the other hand, concentrations of dissolved Arsenic (filtered by 0.45um) in the pore

  1. BOREAS RSS-8 BIOME-BGC SSA Simulation of Annual Water and Carbon Fluxes

    Science.gov (United States)

    Hall, Forrest G. (Editor); Nickeson, Jaime (Editor); Kimball, John

    2000-01-01

    The BOREAS RSS-8 team performed research to evaluate the effect of seasonal weather and landcover heterogeneity on boreal forest regional water and carbon fluxes using a process-level ecosystem model, BIOME-BGC, coupled with remote sensing-derived parameter maps of key state variables. This data set contains derived maps of landcover type and crown and stem biomass as model inputs to determine annual evapotranspiration, gross primary production, autotrophic respiration, and net primary productivity within the BOREAS SSA-MSA, at a 30-m spatial resolution. Model runs were conducted over a 3-year period from 1994-1996; images are provided for each of those years. The data are stored in binary image format. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  2. Effect of surface area of substrates aiming the optimization of carbon nanotube production from ferrocene

    International Nuclear Information System (INIS)

    Osorio, A.G.; Bergmann, C.P.

    2013-01-01

    Highlights: ► An optimized synthesis of CNTs by ferrocene is proposed. ► The surface area of substrates influences the nucleation of CNTs. ► The higher the surface area of substrates the lower the temperature of synthesis. ► Chemical composition of substrates has no influence on the growth of CNTs. - Abstract: Ferrocene is widely used for the synthesis of carbon nanotubes due to its ability to act as catalyst and precursor of the synthesis. This paper proposes an optimization of the synthesis of carbon nanotubes from ferrocene, using a substrate with high surface area for their nucleation. Four different surface areas of silica powder were tested: 0.5, 50, 200 and 300 m 2 /g. Raman spectroscopy and microscopy were used to characterize the product obtained and X-ray diffraction and thermal analysis were also performed to evaluate the phases of the material. It was observed that the silica powder with the highest surface area allowed the synthesis of carbon nanotubes to occur at a lower temperature (600 °C), whereas substrates with a surface area lower than 50 m 2 /g will only form carbon nanotubes at temperatures higher than 750 °C. In order to evaluate the influence of chemical composition of the substrate, three different ceramic powders were analyzed: alumina, silica and zirconia. carbon black and previously synthesized carbon nanotubes were also used as substrate for the synthesis and the results showed that the chemical composition of the substrate does not play a relevant role in the synthesis of carbon nanotubes, only the surface area showed an influence.

  3. Child health inequities in developing countries: differences across urban and rural areas

    Directory of Open Access Journals (Sweden)

    Fotso Jean-Christophe

    2006-07-01

    Full Text Available Abstract Objectives To document and compare the magnitude of inequities in child malnutrition across urban and rural areas, and to investigate the extent to which within-urban disparities in child malnutrition are accounted for by the characteristics of communities, households and individuals. Methods The most recent data sets available from the Demographic and Health Surveys (DHS of 15 countries in sub-Saharan Africa (SSA are used. The selection criteria were set to ensure that the number of countries, their geographical spread across Western/Central and Eastern/Southern Africa, and their socioeconomic diversities, constitute a good yardstick for the region and allow us to draw some generalizations. A household wealth index is constructed in each country and area (urban, rural, and the odds ratio between its uppermost and lowermost category, derived from multilevel logistic models, is used as a measure of socioeconomic inequalities. Control variables include mother's and father's education, community socioeconomic status (SES designed to represent the broad socio-economic ecology of the neighborhoods in which families live, and relevant mother- and child-level covariates. Results Across countries in SSA, though socioeconomic inequalities in stunting do exist in both urban and rural areas, they are significantly larger in urban areas. Intra-urban differences in child malnutrition are larger than overall urban-rural differentials in child malnutrition, and there seem to be no visible relationships between within-urban inequities in child health on the one hand, and urban population growth, urban malnutrition, or overall rural-urban differentials in malnutrition, on the other. Finally, maternal and father's education, community SES and other measurable covariates at the mother and child levels only explain a slight part of the within-urban differences in child malnutrition. Conclusion The urban advantage in health masks enormous disparities

  4. Surface water and groundwater interaction in selected areas of Indus basin

    International Nuclear Information System (INIS)

    Akram, W.; Ahmad, M.; Tariq, J.A.; Latif, Z.; Malik, M.R.

    2011-08-01

    Isotope hydrological investigations were carried out in Marala-Khanki Area of Punjab for elucidating various aspects of surface water and groundwater interaction. Groundwater samples were collected on seasonal basis (low and high river discharge periods) while surface water (Chenab River) samples were collected more frequently (weekly or monthly basis). Isotopic data suggested that there is no significant contribution of surface water to groundwater recharge in Marala-Khanki Area and rain is the prevailing source of groundwater recharge. The data further revealed that isotopic values of Tarbala lake are higher than those of main lake. Indus river meaning that there is significant contribution of base flow in this pocket. Isotopic data of Indus river showed an increase at Tunsa as compared to Chashma in flow period indicating the high contribution of base flow at this point in time. Stable isotopes were successfully used to quantify the base flow contribution. (author)

  5. Surface area and volume determination of subgingival calculus using laser fluorescence.

    Science.gov (United States)

    Shakibaie, Fardad; Walsh, Laurence J

    2014-03-01

    Visible red (655 nm) laser fluorescence (LF) devices are currently used for identifying deposits of subgingival calculus on the root surfaces of teeth during dental examination and treatment; however, it is not known how the fluorescence readings produced by commercially available LF systems correlate to the nature of the deposits. This laboratory study explored the correlation between LF digital readings and the surface area and volume of subgingival calculus deposits on teeth. A collection of 30 extracted human posterior teeth with various levels of subgingival deposits of calculus across 240 sites were used in a clinical simulation, with silicone impression material used to replicate periodontal soft tissues. The teeth were scored by two examiners by using three commercial LF systems (DIAGNOdent, DIAGNOdent Pen and KEY3). The silicone was removed, and the teeth were removed for photography at × 20 magnification under white or ultraviolet light. The surface area, thickness, and volume were calculated, and both linear least squares regression and nonlinear (Spearman's rank method) correlation coefficients were determined. Visible red LF digital readings showed better correlation to calculus volume than to surface area. Overall, the best performance was found for the KEY3 system (Spearman coefficient 0.59), compared to the Classic DIAGNOdent (0.56) and the DIAGNOdent Pen (0.49). These results indicate that while visible red LF systems vary somewhat in performance, their LF readings provide a useful estimation of the volume of subgingival calculus deposits present on teeth.

  6. High-resolution surface analysis for extended-range downscaling with limited-area atmospheric models

    Science.gov (United States)

    Separovic, Leo; Husain, Syed Zahid; Yu, Wei; Fernig, David

    2014-12-01

    High-resolution limited-area model (LAM) simulations are frequently employed to downscale coarse-resolution objective analyses over a specified area of the globe using high-resolution computational grids. When LAMs are integrated over extended time frames, from months to years, they are prone to deviations in land surface variables that can be harmful to the quality of the simulated near-surface fields. Nudging of the prognostic surface fields toward a reference-gridded data set is therefore devised in order to prevent the atmospheric model from diverging from the expected values. This paper presents a method to generate high-resolution analyses of land-surface variables, such as surface canopy temperature, soil moisture, and snow conditions, to be used for the relaxation of lower boundary conditions in extended-range LAM simulations. The proposed method is based on performing offline simulations with an external surface model, forced with the near-surface meteorological fields derived from short-range forecast, operational analyses, and observed temperatures and humidity. Results show that the outputs of the surface model obtained in the present study have potential to improve the near-surface atmospheric fields in extended-range LAM integrations.

  7. A Three-Dimensional Enormous Surface Area Aluminum Microneedle Array with Nanoporous Structure

    Directory of Open Access Journals (Sweden)

    Po Chun Chen

    2013-01-01

    Full Text Available We proposed fabricating an aluminum microneedle array with a nanochannel structure on the surface by combining micromachining, electrolyte polishing, and anodization methods. The microneedle array provides a three-dimensional (3D structure that possesses several hundred times more surface area than a traditional nanochannel template. Therefore, the microneedle array can potentially be used in many technology applications. This 3D microneedle array device can not only be used for painless injection or extraction, but also for storage, highly sensitive detection, drug delivery, and microelectrodes. From the calculation we made, the microneedle array not only increases surface area, but also enlarges the capacity of the device. Therefore, the microneedle array can further be used on many detecting, storing, or drug delivering applications.

  8. Investigation on large-area fabrication of vivid shark skin with superior surface functions

    Science.gov (United States)

    Chen, Huawei; Zhang, Xin; Ma, Lingxi; Che, Da; Zhang, Deyuan; Sudarshan, T. S.

    2014-10-01

    Shark skin has attracted worldwide attention because of its superior drag reduction, antifouling performance induced from its unique surface morphology. Although the vivid shark skin has been fabricated by a bio-replicated micro-imprinting approach in previous studies and superior drag reduction effect has been validated in water tunnel, continuous large-area fabrication is still an obstacle to wide apply. In this paper, one novel bio-replication coating technology is proposed for large-area transfer of shark skin based on rapid UV curable paint. Apart from design of coating system, bio-replication accuracy of surface morphology was validated about 97% by comparison between shark skin template and coating surface morphology. Finally, the drag reduction and anti-fouling function of coating surface were tested in water tunnel and open algae pond respectively. Drag reduction rate of coating surface was validated about 12% higher and anti-fouling was proved to about hundred times ameliorate, all of which are more excellent than simple 2D riblet surface.

  9. High Surface Area of Porous Silicon Drives Desorption of Intact Molecules

    Science.gov (United States)

    Northen, Trent R.; Woo, Hin-Koon; Northen, Michael T.; Nordström, Anders; Uritboonthail, Winnie; Turner, Kimberly L.; Siuzdak, Gary

    2007-01-01

    The surface structure of porous silicon used in desorption/ionization on porous silicon (DIOS) mass analysis is known to play a primary role in the desorption/ionization (D/I) process. In this study, mass spectrometry and scanning electron microscopy (SEM) are used to examine the correlation between intact ion generation with surface ablation, and surface morphology. The DIOS process is found to be highly laser energy dependent and correlates directly with the appearance of surface ions (Sin+ and OSiH+). A threshold laser energy for DIOS is observed (10 mJ/cm2), which supports that DIOS is driven by surface restructuring and is not a strictly thermal process. In addition, three DIOS regimes are observed which correspond to surface restructuring and melting. These results suggest that higher surface area silicon substrates may enhance DIOS performance. A recent example which fits into this mechanism is silicon nanowires surface which have a high surface energy and concomitantly requires lower laser energy for analyte desorpton. PMID:17881245

  10. Rational construction of an ssa-type of MOF through pre-organizing the ligand's conformation and its exceptional gas adsorption properties.

    Science.gov (United States)

    Wang, Yao; He, Minghui; Tian, Zhi; Zhong, Haoyan; Zhu, Lisha; Zhang, Yingying; Zhang, Xiaoping; Chen, De-Li; He, Yabing

    2018-02-13

    Ssa-type MOFs constructed from dicopper paddlewheels and bent diisophthalate ligands exhibit a promising potential for gas adsorption which benefits from their rich open copper sites and polyhedron-based cages with suitable sizes. However, the rational construction of such types of MOFs is exceedingly challenging because the bent diisophthalate ligands employed are inclined to exhibit various conformations and thus are prone to form MOFs with varied topologies. In this work, by pre-organizing the ligand's conformation, we successfully targeted an ssa-type MOF ZJNU-57 from a bent diisophthalate ligand. More significantly, ZJNU-57 exhibits excellent hydrolytic stability and high C 2 H 2 and CO 2 uptake capacities as well as impressive C 2 H 2 /CH 4 and CO 2 /CH 4 adsorption selectivities, indicating its promising potential for C 2 H 2 /CH 4 and CO 2 /CH 4 separation, which are relevant to acetylene production and natural gas purification. This work not only provides a rare water-stable MOF based on the Cu 2 (COO) 4 cluster for highly selective adsorption of C 2 H 2 and CO 2 from CH 4 , but also demonstrates that the ligand conformation-controlled assembly strategy may be an efficient approach toward the construction of MOF materials with definite topologies for specific applications.

  11. Automatic Satellite Telemetry Analysis for SSA using Artificial Intelligence Techniques

    Science.gov (United States)

    Stottler, R.; Mao, J.

    In April 2016, General Hyten, commander of Air Force Space Command, announced the Space Enterprise Vision (SEV) (http://www.af.mil/News/Article-Display/Article/719941/hyten-announces-space-enterprise-vision/). The SEV addresses increasing threats to space-related systems. The vision includes an integrated approach across all mission areas (communications, positioning, navigation and timing, missile warning, and weather data) and emphasizes improved access to data across the entire enterprise and the ability to protect space-related assets and capabilities. "The future space enterprise will maintain our nation's ability to deliver critical space effects throughout all phases of conflict," Hyten said. Satellite telemetry is going to become available to a new audience. While that telemetry information should be valuable for achieving Space Situational Awareness (SSA), these new satellite telemetry data consumers will not know how to utilize it. We were tasked with applying AI techniques to build an infrastructure to process satellite telemetry into higher abstraction level symbolic space situational awareness and to initially populate that infrastructure with useful data analysis methods. We are working with two organizations, Montana State University (MSU) and the Air Force Academy, both of whom control satellites and therefore currently analyze satellite telemetry to assess the health and circumstances of their satellites. The design which has resulted from our knowledge elicitation and cognitive task analysis is a hybrid approach which combines symbolic processing techniques of Case-Based Reasoning (CBR) and Behavior Transition Networks (BTNs) with current Machine Learning approaches. BTNs are used to represent the process and associated formulas to check telemetry values against anticipated problems and issues. CBR is used to represent and retrieve BTNs that represent an investigative process that should be applied to the telemetry in certain circumstances

  12. Large Area Diamond Tribological Surfaces with Negligible Wear in Extreme Environments, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — In Phase I we propose to demonstrate the processing of very large area diamond sliding bearings and tribological surfaces. The bearings and surfaces will experience...

  13. Accurate measurement of surface areas of anatomical structures by computer-assisted triangulation of computed tomography images

    Energy Technology Data Exchange (ETDEWEB)

    Allardice, J.T.; Jacomb-Hood, J.; Abulafi, A.M.; Williams, N.S. (Royal London Hospital (United Kingdom)); Cookson, J.; Dykes, E.; Holman, J. (London Hospital Medical College (United Kingdom))

    1993-05-01

    There is a need for accurate surface area measurement of internal anatomical structures in order to define light dosimetry in adjunctive intraoperative photodynamic therapy (AIOPDT). The authors investigated whether computer-assisted triangulation of serial sections generated by computed tomography (CT) scanning can give an accurate assessment of the surface area of the walls of the true pelvis after anterior resection and before colorectal anastomosis. They show that the technique of paper density tessellation is an acceptable method of measuring the surface areas of phantom objects, with a maximum error of 0.5%, and is used as the gold standard. Computer-assisted triangulation of CT images of standard geometric objects and accurately-constructed pelvic phantoms gives a surface area assessment with a maximum error of 2.5% compared with the gold standard. The CT images of 20 patients' pelves have been analysed by computer-assisted triangulation and this shows the surface area of the walls varies from 143 cm[sup 2] to 392 cm[sup 2]. (Author).

  14. Escaping the correction for body surface area when calculating glomerular filtration rate in children

    International Nuclear Information System (INIS)

    Piepsz, Amy; Tondeur, Marianne; Ham, Hamphrey

    2008-01-01

    51 Cr ethylene diamine tetraacetic acid ( 51 Cr EDTA) clearance is nowadays considered as an accurate and reproducible method for measuring glomerular filtration rate (GFR) in children. Normal values in function of age, corrected for body surface area, have been recently updated. However, much criticism has been expressed about the validity of body surface area correction. The aim of the present paper was to present the normal GFR values, not corrected for body surface area, with the associated percentile curves. For that purpose, the same patients as in the previous paper were selected, namely those with no recent urinary tract infection, having a normal left to right 99m Tc MAG3 uptake ratio and a normal kidney morphology on the early parenchymal images. A single blood sample method was used for 51 Cr EDTA clearance measurement. Clearance values, not corrected for body surface area, increased progressively up to the adolescence. The percentile curves were determined and allow, for a single patient, to estimate accurately the level of non-corrected clearance and the evolution with time, whatever the age. (orig.)

  15. Porous boron doped diamonds as metal-free catalysts for the oxygen reduction reaction in alkaline solution

    Science.gov (United States)

    Suo, Ni; Huang, Hao; Wu, Aimin; Cao, Guozhong; Hou, Xiaoduo; Zhang, Guifeng

    2018-05-01

    Porous boron doped diamonds (BDDs) were obtained on foam nickel substrates with a porosity of 80%, 85%, 90% and 95% respectively by hot filament chemical vapor deposition (HFCVD) technology. Scanning electron microscopy (SEM) reveals that uniform and compact BDDs with a cauliflower-like morphology have covered the overall frame of the foam nickel substrates. Raman spectroscopy shows that the BDDs have a poor crystallinity due to heavily doping boron. X-ray photoelectron spectroscopy (XPS) analysis effectively demonstrates that boron atoms can be successfully incorporated into the crystal lattice of diamonds. Electrochemical measurements indicate that the oxygen reduction potential is unaffected by the specific surface area (SSA), and both the onset potential and the limiting diffusion current density are enhanced with increasing SSA. It is also found that the durability and methanol tolerance of the boron doped diamond catalysts are attenuated as the increasing of SSA. The SSA of the catalyst is directly proportional to the oxygen reduction activity and inversely to the durability and methanol resistance. These results provide a reference to the application of porous boron doped diamonds as potential cathodic catalysts for the oxygen reduction reaction in alkaline solution by adjusting the SSA.

  16. Can We Trust Real Time Measurements of Lung Deposited Surface Area Concentrations in Dust from Powder Nanomaterials?

    DEFF Research Database (Denmark)

    Levin, Marcus; Witschger, Olivier; Bau, Sebastien

    2016-01-01

    A comparison between various methods for real-time measurements of lung deposited surface area (LDSA) using spherical particles and powder dust with specific surface area ranging from 0.03 to 112 m2 g-1 was conducted. LDSA concentrations measured directly using Nanoparticle Surface Area Monitor...... gravimetrical filter measurements and specific surface areas. Measurement of LDSA showed very good correlation in measurements of spherical particles (R2 > 0.97, Ratio 1.0 to 1.04). High surface area nanomaterial powders showed a fairly reliable correlation between NSAM and Aerotrak (R2 0...... present. We conclude that there is currently insufficient reliability and comparability between methods in the measurement of LDSA concentrations. Further development is required to enable use of LDSA for reliable dose metric and regulatory enforcement of exposure....

  17. A Three-Dimensional Enormous Surface Area Aluminum Microneedle Array with Nanoporous Structure

    International Nuclear Information System (INIS)

    Chen, P.Ch.; Zou, J.; Hsieh, Sh.J.; Chen, Ch.Ch.

    2013-01-01

    We proposed fabricating an aluminum micro needle array with a nano channel structure on the surface by combining micromachining, electrolyte polishing, and anodization methods. The micro needle array provides a three-dimensional (3D) structure that possesses several hundred times more surface area than a traditional nano channel template. Therefore, the micro needle array can potentially be used in many technology applications. This 3D micro needle array device can not only be used for painless injection or extraction, but also for storage, highly sensitive detection, drug delivery, and microelectrodes. From the calculation we made, the micro needle array not only increases surface area, but also enlarges the capacity of the device. Therefore, the micro needle array can further be used on many detecting, storing, or drug delivering applications.

  18. Particle size distribution effect on burn rate of ammonium nitrate based propellant

    NARCIS (Netherlands)

    Miedema, J.R.; Klein, A.J.J.; Zee, F.W.M.

    1995-01-01

    Burn rate control of a Phase Stabilised Ammonium Nitrate (PSAN) propellant by specific surface area (SSA) tuning of the PSAN oxidiser resulted in unexpected effects of applying a new batch of PSAN having a different particle size distribution. Analysis of the deviations and consultation of

  19. Large-area homogeneous periodic surface structures generated on the surface of sputtered boron carbide thin films by femtosecond laser processing

    Energy Technology Data Exchange (ETDEWEB)

    Serra, R., E-mail: ricardo.serra@dem.uc.pt [SEG-CEMUC, Mechanical Engineering Department, University of Coimbra, Rua Luís Reis Santos, 3030-788 Coimbra (Portugal); Oliveira, V. [ICEMS-Instituto de Ciência e Engenharia de Materiais e Superfícies, Avenida Rovisco Pais no 1, 1049-001 Lisbon (Portugal); Instituto Superior de Engenharia de Lisboa, Avenida Conselheiro Emídio Navarro no 1, 1959-007 Lisbon (Portugal); Oliveira, J.C. [SEG-CEMUC, Mechanical Engineering Department, University of Coimbra, Rua Luís Reis Santos, 3030-788 Coimbra (Portugal); Kubart, T. [The Ångström Laboratory, Solid State Electronics, P.O. Box 534, SE-751 21 Uppsala (Sweden); Vilar, R. [Instituto Superior de Engenharia de Lisboa, Avenida Conselheiro Emídio Navarro no 1, 1959-007 Lisbon (Portugal); Instituto Superior Técnico, Avenida Rovisco Pais no 1, 1049-001 Lisbon (Portugal); Cavaleiro, A. [SEG-CEMUC, Mechanical Engineering Department, University of Coimbra, Rua Luís Reis Santos, 3030-788 Coimbra (Portugal)

    2015-03-15

    Highlights: • Large-area LIPSS were formed by femtosecond laser processing B-C films surface. • The LIPSS spatial period increases with laser fluence (140–200 nm). • Stress-related sinusoidal-like undulations were formed on the B-C films surface. • The undulations amplitude (down to a few nanometres) increases with laser fluence. • Laser radiation absorption increases with surface roughness. - Abstract: Amorphous and crystalline sputtered boron carbide thin films have a very high hardness even surpassing that of bulk crystalline boron carbide (≈41 GPa). However, magnetron sputtered B-C films have high friction coefficients (C.o.F) which limit their industrial application. Nanopatterning of materials surfaces has been proposed as a solution to decrease the C.o.F. The contact area of the nanopatterned surfaces is decreased due to the nanometre size of the asperities which results in a significant reduction of adhesion and friction. In the present work, the surface of amorphous and polycrystalline B-C thin films deposited by magnetron sputtering was nanopatterned using infrared femtosecond laser radiation. Successive parallel laser tracks 10 μm apart were overlapped in order to obtain a processed area of about 3 mm{sup 2}. Sinusoidal-like undulations with the same spatial period as the laser tracks were formed on the surface of the amorphous boron carbide films after laser processing. The undulations amplitude increases with increasing laser fluence. The formation of undulations with a 10 μm period was also observed on the surface of the crystalline boron carbide film processed with a pulse energy of 72 μJ. The amplitude of the undulations is about 10 times higher than in the amorphous films processed at the same pulse energy due to the higher roughness of the films and consequent increase in laser radiation absorption. LIPSS formation on the surface of the films was achieved for the three B-C films under study. However, LIPSS are formed under

  20. Large-area homogeneous periodic surface structures generated on the surface of sputtered boron carbide thin films by femtosecond laser processing

    International Nuclear Information System (INIS)

    Serra, R.; Oliveira, V.; Oliveira, J.C.; Kubart, T.; Vilar, R.; Cavaleiro, A.

    2015-01-01

    Highlights: • Large-area LIPSS were formed by femtosecond laser processing B-C films surface. • The LIPSS spatial period increases with laser fluence (140–200 nm). • Stress-related sinusoidal-like undulations were formed on the B-C films surface. • The undulations amplitude (down to a few nanometres) increases with laser fluence. • Laser radiation absorption increases with surface roughness. - Abstract: Amorphous and crystalline sputtered boron carbide thin films have a very high hardness even surpassing that of bulk crystalline boron carbide (≈41 GPa). However, magnetron sputtered B-C films have high friction coefficients (C.o.F) which limit their industrial application. Nanopatterning of materials surfaces has been proposed as a solution to decrease the C.o.F. The contact area of the nanopatterned surfaces is decreased due to the nanometre size of the asperities which results in a significant reduction of adhesion and friction. In the present work, the surface of amorphous and polycrystalline B-C thin films deposited by magnetron sputtering was nanopatterned using infrared femtosecond laser radiation. Successive parallel laser tracks 10 μm apart were overlapped in order to obtain a processed area of about 3 mm 2 . Sinusoidal-like undulations with the same spatial period as the laser tracks were formed on the surface of the amorphous boron carbide films after laser processing. The undulations amplitude increases with increasing laser fluence. The formation of undulations with a 10 μm period was also observed on the surface of the crystalline boron carbide film processed with a pulse energy of 72 μJ. The amplitude of the undulations is about 10 times higher than in the amorphous films processed at the same pulse energy due to the higher roughness of the films and consequent increase in laser radiation absorption. LIPSS formation on the surface of the films was achieved for the three B-C films under study. However, LIPSS are formed under different

  1. Body surface area prediction in normal, hypermuscular, and obese mice.

    Science.gov (United States)

    Cheung, Michael C; Spalding, Paul B; Gutierrez, Juan C; Balkan, Wayne; Namias, Nicholas; Koniaris, Leonidas G; Zimmers, Teresa A

    2009-05-15

    Accurate determination of body surface area (BSA) in experimental animals is essential for modeling effects of burn injury or drug metabolism. Two-dimensional surface area is related to three-dimensional body volume, which in turn can be estimated from body mass. The Meeh equation relates body surface area to the two-thirds power of body mass, through a constant, k, which must be determined empirically by species and size. We found older values of k overestimated BSA in certain mice; thus we determined empirically k for various strains of normal, obese, and hypermuscular mice. BSA was computed from digitally scanned pelts and nonlinear regression analysis was used to determine the best-fit k. The empirically determined k for C57BL/6J mice of 9.82 was not significantly different from other inbred and outbred mouse strains of normal body composition. However, mean k of the nearly spheroid, obese lepr(db/db) mice (k = 8.29) was significantly lower than for normals, as were values for dumbbell-shaped, hypermuscular mice with either targeted deletion of the myostatin gene (Mstn) (k = 8.48) or with skeletal muscle specific expression of a dominant negative myostatin receptor (Acvr2b) (k = 8.80). Hypermuscular and obese mice differ substantially from normals in shape and density, resulting in considerably altered k values. This suggests Meeh constants should be determined empirically for animals of altered body composition. Use of these new, improved Meeh constants will allow greater accuracy in experimental models of burn injury and pharmacokinetics.

  2. Optimized preparation for large surface area activated carbon from date (Phoenix dactylifera L.) stone biomass

    International Nuclear Information System (INIS)

    Danish, Mohammed; Hashim, Rokiah; Ibrahim, M.N. Mohamad; Sulaiman, Othman

    2014-01-01

    The preparation of activated carbon from date stone treated with phosphoric acid was optimized using rotatable central composite design of response surface methodology (RSM). The chemical activating agent concentration and temperature of activation plays a crucial role in preparation of large surface area activated carbons. The optimized activated carbon was characterized using thermogravimetric analysis, field emission scanning electron microscopy, energy dispersive X-ray spectroscopy, powder X-ray diffraction, and Fourier transform infrared spectroscopy. The results showed that the larger surface area of activated carbon from date stone can be achieved under optimum activating agent (phosphoric acid) concentration, 50.0% (8.674 mol L −1 ) and activation temperature, 900 °C. The Brunauer–Emmett–Teller (BET) surface area of optimized activated carbon was found to be 1225 m 2  g −1 , and thermogravimetric analysis revealed that 55.2% mass of optimized activated carbon was found thermally stable till 900 °C. The leading chemical functional groups found in the date stone activated carbon were aliphatic carboxylic acid salt ν(C=O) 1561.22 cm −1 and 1384.52 cm −1 , aliphatic hydrocarbons ν(C–H) 2922.99 cm −1 (C–H sym./asym. stretch frequency), aliphatic phosphates ν(P–O–C) 1054.09 cm −1 , and secondary aliphatic alcohols ν(O–H) 3419.81 cm −1 and 1159.83 cm −1 . - Highlights: • RSM optimization was done for the production of large surface area activated carbon. • Two independent variables with two responses were selected for optimization. • Characterization was done for surface area, morphology and chemical constituents. • Optimized date stone activated carbon achieved surface area 1225 m 2  g −1

  3. Installation and performance evaluation of an indigenous surface area analyser

    International Nuclear Information System (INIS)

    Pillai, S.N.; Solapurkar, M.N.; Venkatesan, V.; Prakash, A.; Khan, K.B.; Kumar, Arun; Prasad, R.S.

    2014-01-01

    An indigenously available surface area analyser was installed inside glove box and checked for its performance by analyzing uranium oxide and thorium oxide powders at RMD. The unit has been made ready for analysis of Plutonium oxide powders after incorporating several important features. (author)

  4. Vertical variability of aerosol single-scattering albedo and equivalent black carbon concentration based on in-situ and remote sensing techniques during the iAREA campaigns in Ny-Ålesund

    Science.gov (United States)

    Markowicz, K. M.; Ritter, C.; Lisok, J.; Makuch, P.; Stachlewska, I. S.; Cappelletti, D.; Mazzola, M.; Chilinski, M. T.

    2017-09-01

    This work presents a methodology for obtaining vertical profiles of aerosol single scattering properties based on a combination of different measurement techniques. The presented data were obtained under the iAREA (Impact of absorbing aerosols on radiative forcing in the European Arctic) campaigns conducted in Ny-Ålesund (Spitsbergen) during the spring seasons of 2015-2017. The retrieval uses in-situ observations of black carbon concentration and absorption coefficient measured by a micro-aethalometer AE-51 mounted onboard a tethered balloon, as well as remote sensing data obtained from sun photometer and lidar measurements. From a combination of the balloon-borne in-situ and the lidar data, we derived profiles of single scattering albedo (SSA) as well as absorption, extinction, and aerosol number concentration. Results have been obtained in an altitude range from about 400 m up to 1600 m a.s.l. and for cases with increased aerosol load during the Arctic haze seasons of 2015 and 2016. The main results consist of the observation of increasing values of equivalent black carbon (EBC) and absorption coefficient with altitude, and the opposite trend for aerosol concentration for particles larger than 0.3 μm. SSA was retrieved with the use of lidar Raman and Klett algorithms for both 532 and 880 nm wavelengths. In most profiles, SSA shows relatively high temporal and altitude variability. Vertical variability of SSA computed from both methods is consistent; however, some discrepancy is related to Raman retrieval uncertainty and absorption coefficient estimation from AE-51. Typically, very low EBC concentration in Ny-Ålesund leads to large error in the absorbing coefficient. However, SSA uncertainty for both Raman and Klett algorithms seems to be reasonable, e.g. SSA of 0.98 and 0.95 relate to an error of ±0.01 and ± 0.025, respectively.

  5. An empirical method for estimating surface area of aggregates in hot mix asphalt

    Directory of Open Access Journals (Sweden)

    R.P. Panda

    2016-04-01

    Full Text Available Bitumen requirement in hot mix asphalt (HMA is directly dependent on the surface area of the aggregates in the mix, which in turn has effect on the asphalt film thickness and the flow characteristics. The surface area of aggregate blend in HMA is calculated using the specific surface area factors assigned to percentage passing through some specific standard sieve sizes and the imaging techniques. The first process is less capital intensive, but purely manual and labour intensive and prone to human errors. Imaging techniques though eliminating the human errors, still have limited use due to capital intensiveness and requirement of well-established laboratories with qualified technicians. Most of the developing countries like India are shortage of well-equipped laboratories and qualified technicians. To overcome these difficulties, the present mathematical model has been developed to estimate the surface area of aggregate blend of HMA from physical properties of aggregates evaluated using simple laboratory equipment. This model has been validated compared with the existing established methods of calculations and can be used as one of the tools in different developing and under developed countries for proper design of HMA.

  6. Escaping the correction for body surface area when calculating glomerular filtration rate in children

    Energy Technology Data Exchange (ETDEWEB)

    Piepsz, Amy; Tondeur, Marianne [CHU St. Pierre, Department of Radioisotopes, Brussels (Belgium); Ham, Hamphrey [University Hospital Ghent, Department of Nuclear Medicine, Ghent (Belgium)

    2008-09-15

    {sup 51}Cr ethylene diamine tetraacetic acid ({sup 51}Cr EDTA) clearance is nowadays considered as an accurate and reproducible method for measuring glomerular filtration rate (GFR) in children. Normal values in function of age, corrected for body surface area, have been recently updated. However, much criticism has been expressed about the validity of body surface area correction. The aim of the present paper was to present the normal GFR values, not corrected for body surface area, with the associated percentile curves. For that purpose, the same patients as in the previous paper were selected, namely those with no recent urinary tract infection, having a normal left to right {sup 99m}Tc MAG3 uptake ratio and a normal kidney morphology on the early parenchymal images. A single blood sample method was used for {sup 51}Cr EDTA clearance measurement. Clearance values, not corrected for body surface area, increased progressively up to the adolescence. The percentile curves were determined and allow, for a single patient, to estimate accurately the level of non-corrected clearance and the evolution with time, whatever the age. (orig.)

  7. Surface water areas significantly impacted 2014 dengue outbreaks in Guangzhou, China

    Energy Technology Data Exchange (ETDEWEB)

    Tian, Huaiyu; Huang, Shanqian [State Key Laboratory of Remote Sensing Science, College of Global Change and Earth System Science, Beijing Normal University, Beijing (China); Zhou, Sen [Ministry of Education Key Laboratory for Earth System Modelling, Center for Earth System Science, Tsinghua University, Beijing (China); Department of Pediatrics, Harvard Medical School, Boston, MA (United States); Bi, Peng [Discipline of Public Health, University of Adelaide, Adelaide (Australia); Yang, Zhicong, E-mail: yangzc@gzcdc.org.cn [Guangzhou Center for Disease Control and Prevention, Guangzhou (China); Li, Xiujun [School of Public Health, Shandong University, Jinan (China); Chen, Lifan [State Key Laboratory of Remote Sensing Science, College of Global Change and Earth System Science, Beijing Normal University, Beijing (China); Cazelles, Bernard [UMMISCO, UMI 209 IRD – UPMC, 93142 Bondy (France); Eco-Evolutionary Mathematic, IBENS UMR 8197, ENS, 75230 Paris Cedex 05 (France); Yang, Jing [State Key Laboratory of Remote Sensing Science, College of Global Change and Earth System Science, Beijing Normal University, Beijing (China); Luo, Lei; Jing, Qinlong [Guangzhou Center for Disease Control and Prevention, Guangzhou (China); Yuan, Wenping [State Key Laboratory of Earth Surface Processes and Resource Ecology, College of Global Change and Earth System Science, Beijing Normal University, Beijing (China); Pei, Yao; Sun, Zhe [Ministry of Education Key Laboratory for Earth System Modelling, Center for Earth System Science, Tsinghua University, Beijing (China); Yue, Tianxiang [State Key Laboratory of Resources and Environment Information System, Chinese Academy of Sciences, Beijing (China); Kwan, Mei-Po [Department of Geography and Geographic Information Science, University of Illinois at Urbana-Champaign, Champaign, IL 61820 (United States); and others

    2016-10-15

    Dengue transmission in urban areas is strongly influenced by a range of biological and environmental factors, yet the key drivers still need further exploration. To better understand mechanisms of environment–mosquito–urban dengue transmission, we propose an empirical model parameterized and cross-validated from a unique dataset including viral gene sequences, vector dynamics and human dengue cases in Guangzhou, China, together with a 36-year urban environmental change maps investigated by spatiotemporal satellite image fusion. The dengue epidemics in Guangzhou are highly episodic and were not associated with annual rainfall over time. Our results indicate that urban environmental changes, especially variations in surface area covered by water in urban areas, can substantially alter the virus population and dengue transmission. The recent severe dengue outbreaks in Guangzhou may be due to the surge in an artificial lake construction, which could increase infection force between vector (mainly Aedes albopictus) and host when urban water area significantly increased. Impacts of urban environmental change on dengue dynamics may not have been thoroughly investigated in the past studies and more work needs to be done to better understand the consequences of urbanization processes in our changing world. - Highlights: • Urban dengue outbreak is associated with water area in Guangzhou, 1978–2014. • Surface water area can alter population size of dengue virus in urban area. • Urban dengue outbreak is not associated with annual rainfall in Guangzhou. • Spatiotemporal satellite image fusion can investigate urban environmental change. • Urban environmental change could induce virus, vector, and dengue epidemic change.

  8. Surface water areas significantly impacted 2014 dengue outbreaks in Guangzhou, China

    International Nuclear Information System (INIS)

    Tian, Huaiyu; Huang, Shanqian; Zhou, Sen; Bi, Peng; Yang, Zhicong; Li, Xiujun; Chen, Lifan; Cazelles, Bernard; Yang, Jing; Luo, Lei; Jing, Qinlong; Yuan, Wenping; Pei, Yao; Sun, Zhe; Yue, Tianxiang; Kwan, Mei-Po

    2016-01-01

    Dengue transmission in urban areas is strongly influenced by a range of biological and environmental factors, yet the key drivers still need further exploration. To better understand mechanisms of environment–mosquito–urban dengue transmission, we propose an empirical model parameterized and cross-validated from a unique dataset including viral gene sequences, vector dynamics and human dengue cases in Guangzhou, China, together with a 36-year urban environmental change maps investigated by spatiotemporal satellite image fusion. The dengue epidemics in Guangzhou are highly episodic and were not associated with annual rainfall over time. Our results indicate that urban environmental changes, especially variations in surface area covered by water in urban areas, can substantially alter the virus population and dengue transmission. The recent severe dengue outbreaks in Guangzhou may be due to the surge in an artificial lake construction, which could increase infection force between vector (mainly Aedes albopictus) and host when urban water area significantly increased. Impacts of urban environmental change on dengue dynamics may not have been thoroughly investigated in the past studies and more work needs to be done to better understand the consequences of urbanization processes in our changing world. - Highlights: • Urban dengue outbreak is associated with water area in Guangzhou, 1978–2014. • Surface water area can alter population size of dengue virus in urban area. • Urban dengue outbreak is not associated with annual rainfall in Guangzhou. • Spatiotemporal satellite image fusion can investigate urban environmental change. • Urban environmental change could induce virus, vector, and dengue epidemic change.

  9. Child health inequities in developing countries: differences across urban and rural areas

    OpenAIRE

    Fotso Jean-Christophe

    2006-01-01

    Abstract Objectives To document and compare the magnitude of inequities in child malnutrition across urban and rural areas, and to investigate the extent to which within-urban disparities in child malnutrition are accounted for by the characteristics of communities, households and individuals. Methods The most recent data sets available from the Demographic and Health Surveys (DHS) of 15 countries in sub-Saharan Africa (SSA) are used. The selection criteria were set to ensure that the number ...

  10. Small carpal bone surface area, a characteristic of Turner's syndrome

    International Nuclear Information System (INIS)

    Cleveland, R.H.; Done, S.; Correia, J.A.; Crawford, J.D.; Kushner, D.C.; Herman, T.E.

    1985-01-01

    An abnormality which has received little attention but may be easily recognized on radiographs of the hand of patients with Turner's syndrome is described. Eleven of thirty-one patients (35.5%) with Turner's syndrome were shown on radiographs of the hand to have a visually detectable smallness of the bone surface area of the carpus when compared to the area of the second through fifth metacarpals. Values for the ''C/M'' ratio (the area of the carpals divided by the area of the second through fifth metacarpals) were calculated for films of 31 individuals with gonadal dysgenesis and compared with those from bone age-matched films of seventy-six individuals with normal development of the hand and wrist. A consistent difference with minimal overlap was documented. (orig./WL)

  11. Location of unaccessible implant surface areas during debridement in simulated peri-implantitis therapy.

    Science.gov (United States)

    Steiger-Ronay, Valerie; Merlini, Andrea; Wiedemeier, Daniel B; Schmidlin, Patrick R; Attin, Thomas; Sahrmann, Philipp

    2017-11-28

    An in vitro model for peri-implantitis treatment was used to identify areas that are clinically difficult to clean by analyzing the pattern of residual stain after debridement with commonly employed instruments. Original data from two previous publications, which simulated surgical (SA) and non-surgical (NSA) implant debridement on two different implant systems respectively, were reanalyzed regarding the localization pattern of residual stains after instrumentation. Two blinded examiners evaluated standardized photographs of 360 initially ink-stained dental implants, which were cleaned at variable defect angulations (30, 60, or 90°), using different instrument types (Gracey curette, ultrasonic scaler or air powder abrasive device) and treatment approaches (SA or NSA). Predefined implant surface areas were graded for residual stain using scores ranging from one (stain-covered) to six (clean). Score differences between respective implant areas were tested for significance by pairwise comparisons using Wilcoxon-rank-sum-tests with a significance level α = 5%. Best scores were found at the machined surface areas (SA: 5.58 ± 0.43, NSA: 4.76 ± 1.09), followed by the tips of the threads (SA: 4.29 ± 0.44, NSA: 4.43 ± 0.61), and areas between threads (SA: 3.79 ± 0.89, NSA: 2.42 ± 1.11). Apically facing threads were most difficult to clean (SA: 1.70 ± 0.92, NSA: 2.42 ± 1.11). Here, air powder abrasives provided the best results. Machined surfaces at the implant shoulder were well accessible and showed least amounts of residual stain. Apically facing thread surfaces constituted the area with most residual stain regardless of treatment approach.

  12. Lp-dual affine surface area forms of Busemann–Petty type problems

    Indian Academy of Sciences (India)

    Associated with the notion of Lp-intersection body which was defined ... Lp-dual affine surface area; Lp-intersection body; Busemann–Petty ..... [11] Schneider R, Convex Bodies: The Brunn–Minkowski Theory (1993) (Cambridge: Cam-.

  13. 30 CFR 933.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by Act of Congress. 933.761 Section 933.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated Unsuitable for Coal Mining by Act of Congress, with...

  14. A Mathematical Method to Calculate Tumor Contact Surface Area: An Effective Parameter to Predict Renal Function after Partial Nephrectomy.

    Science.gov (United States)

    Hsieh, Po-Fan; Wang, Yu-De; Huang, Chi-Ping; Wu, Hsi-Chin; Yang, Che-Rei; Chen, Guang-Heng; Chang, Chao-Hsiang

    2016-07-01

    We proposed a mathematical formula to calculate contact surface area between a tumor and renal parenchyma. We examined the applicability of using contact surface area to predict renal function after partial nephrectomy. We performed this retrospective study in patients who underwent partial nephrectomy between January 2012 and December 2014. Based on abdominopelvic computerized tomography or magnetic resonance imaging, we calculated the contact surface area using the formula (2*π*radius*depth) developed by integral calculus. We then evaluated the correlation between contact surface area and perioperative parameters, and compared contact surface area and R.E.N.A.L. (Radius/Exophytic/endophytic/Nearness to collecting system/Anterior/Location) score in predicting a reduction in renal function. Overall 35, 26 and 45 patients underwent partial nephrectomy with open, laparoscopic and robotic approaches, respectively. Mean ± SD contact surface area was 30.7±26.1 cm(2) and median (IQR) R.E.N.A.L. score was 7 (2.25). Spearman correlation analysis showed that contact surface area was significantly associated with estimated blood loss (p=0.04), operative time (p=0.04) and percent change in estimated glomerular filtration rate (p contact surface area and R.E.N.A.L. score independently affected percent change in estimated glomerular filtration rate (p contact surface area was a better independent predictor of a greater than 10% change in estimated glomerular filtration rate compared to R.E.N.A.L. score (AUC 0.86 vs 0.69). Using this simple mathematical method, contact surface area was associated with surgical outcomes. Compared to R.E.N.A.L. score, contact surface area was a better predictor of functional change after partial nephrectomy. Copyright © 2016 American Urological Association Education and Research, Inc. Published by Elsevier Inc. All rights reserved.

  15. Outlining precision boundaries among areas with different variability standards using magnetic susceptibility and geomorphic surfaces

    OpenAIRE

    Matias,Sammy S. R.; Marques Júnior,José; Siqueira,Diego S.; Pereira,Gener T.

    2014-01-01

    There is an increasing demand for detailed maps that represent in a simplified way the knowledge of the variability of a particular area or region maps. The objective was to outline precision boundaries among areas with different accuracy variability standards using magnetic susceptibility and geomorphic surfaces. The study was conducted in an area of 110 ha, which identified three compartment landscapes based on the geomorphic surfaces model. To determinate pH, organic matter, phosphorus, po...

  16. Application of indirect immunofluorescent test with an improved HEp-2 substrate tranfected with human Ro60/SSA autoantigens

    International Nuclear Information System (INIS)

    Lv Liangjing; Chen Shunle; Gu Yueying; Shen Nan; Bao Chunde; Wang Yuan; Xue Feng; Ye Peng; Yu Chongzhao

    2006-01-01

    To develop an improved substrate for indirect immunofluorescent test (IIF) to detect anti-Ro/SSA autoantibodies, the human 60-kDa Ro/SSA autoantigens (Ro60) cDNAs were obtained from placental cDNA library using PCR and were cloned into the mammalian expression vectorpEGFP-C1. Then the recombinant plasmids were transfected into HEp-2 cells. We con- firmed the overexpression, localization and antigenicity of fusion proteins in transfected cells by means of fluorescence microscopy, immunoblotting and IIF. HEp-2 and HEp-Ro60 was analyzed by IIF using a panel of 10 precipitinpositive anti-Ro human sera simultaneously. Stable expression of Ro60-GFP (green fluorescent protein) fusion proteins maintained ten more generations. And Ro60-GFP kept the antigenicity of Ro and had its own characteristic immunofluorescent pattern in HEp-Ro60 cells. The transfectants dramatically increased the sensitivity of IIF testing (a mean increase of 6.7-fold in endpoint titer, P<0.01). Eight (8/10) positive an- ti-Ro sera showed characteristic immunofluorescent pattern on HEp-Ro60, including two sera which were antinuclear antibodies (ANA) negative on untransfected HEp-2. IIF-ANA in all healthy sera were negative on HEp-Ro60. As a kind of new substrate of IIF, the Ro60 transfectants can be used to detect anti-Ro antibodies. In addition, transfected HEp-2 cells kept the immunofluorescent property of HEp-2 cells in IIF-ANA tests and could be employed as substrate for the routine IIF-ANA detection. The method improved the sensitivity of IIF-ANA. (authors)

  17. Influence of Ear Surface Area on Heat Tolerance of Composite ...

    African Journals Online (AJOL)

    Relative importance of ear surface area on heat tolerance of composite rabbit population was evaluated. The study was conducted during the dry and rainy seasons, climatic data were recorded to obtain categorical heat stress index. Physiological parameters, growth performance, ear length and ear width of the rabbits ...

  18. Is the planum temporale surface area a marker of hemispheric or regional language lateralization?

    Science.gov (United States)

    Tzourio-Mazoyer, Nathalie; Crivello, Fabrice; Mazoyer, Bernard

    2018-04-01

    We investigated the association between the left planum temporale (PT) surface area or asymmetry and the hemispheric or regional functional asymmetries during language production and perception tasks in 287 healthy adults (BIL&GIN) who were matched for sex and handedness. The measurements of the PT surface area were performed after manually delineating the region using brain magnetic resonance images (MRI) and considering the Heschl's gyrus (HG) duplication pattern; the measurements either included (PT tot ) or did not include (PT post ) the second gyrus. A region encompassing both the PT and HG (HGPT) was also studied. Regardless of the ROI measured, 80% of the sample had a positive left minus right PT asymmetry. We first tested whether the PT tot , PT post and HGPT surface areas in the left or right hemispheres or PT asymmetries differed in groups of individuals varying in language lateralization by assessing their hemispheric index during a sentence production minus word list production task. We then investigated the association between these different measures of the PT anatomy and the regional asymmetries measured during the task. Regardless of the anatomical definition used, we observed no correlations between the left surface areas or asymmetries and the hemispheric or regional functional asymmetries during the language production task. We then performed a similar analysis using the same sample measuring language functional lateralization during speech listening tasks (i.e., listening to sentences and lists of words). Although the hemispheric lateralization during speech listening was not correlated with the left PT tot , PT post or HGPT surface areas or the PT asymmetries, significant positive correlations were observed between the asymmetries in these regions and the regional functional asymmetries measured in areas adjacent to the end of the Sylvian fissure while participants listened to the word lists or sentences. The PT asymmetry thus appears to be

  19. Verification of surface source's characteristics using large-area 2π gas flow counter

    International Nuclear Information System (INIS)

    Abu Naser Waheed, M.M.; Mikami, S.; Kobayashi, H.; Noda, K.

    1998-09-01

    Power Reactor and Nuclear Fuel Development Corporation (PNC) has large-area 2π gas flow counter for the purpose of measuring activity of surface sources of alpha or beta ray emitter. Surface sources are used for the calibration of radiation measuring equipment for radiation control. Due to sequent use of sources, the surface of these sources are inclined to go in bad condition because of unwanted accidental incidents. For the better calibration achievement of radiation measuring instruments the rate of emission of these sources are to be checked periodically by the large-area 2π gas flow counter. In this paper described that eight U 3 O 8 surface sources were selected from many sources of PNC Tokai Works and activity of these sources was measured by the 2π gas flow counter. The results were compared with the values certified by Japan Radio Isotope Association (JRIA). It is evident from the result of comparison that the surface sources are in good condition, i.e., the sources are reliable to calibrate the radiation control instruments. (author)

  20. External Validation of Contact Surface Area as a Predictor of Postoperative Renal Function in Patients Undergoing Partial Nephrectomy.

    Science.gov (United States)

    Haifler, Miki; Ristau, Benjamin T; Higgins, Andrew M; Smaldone, Marc C; Kutikov, Alexander; Zisman, Amnon; Uzzo, Robert G

    2017-09-20

    We sought to externally validate a mathematical formula for tumor contact surface area as a predictor of postoperative renal function in patients undergoing partial nephrectomy for renal cell carcinoma. We queried a prospectively maintained kidney cancer database for patients who underwent partial nephrectomy between 2014 and 2016. Contact surface area was calculated using data obtained from preoperative cross-sectional imaging. The correlation between contact surface area and perioperative variables was examined. The correlation between postoperative renal functional outcomes, contact surface area and the R.E.N.A.L. (radius, exophytic/endophytic properties, nearness of tumor to collecting system or sinus, anterior/posterior, location relative to polar lines and tumor touches main renal artery or vein) nephrometry score was also assessed. A total of 257 patients who underwent partial nephrectomy had sufficient data to enter the study. Median contact surface area was 14.5 cm 2 (IQR 6.2-36) and the median nephrometry score was 9 (IQR 7-10). Spearman correlation analysis showed that contact surface area correlated with estimated blood loss (r s = 0.42, p contact surface area and nephrometry score were independent predictors of the absolute change in the estimated glomerular filtration rate (each p contact surface area was a better predictor of a greater than 20% postoperative decline in the estimated glomerular filtration rate compared with the nephrometry score (AUC 0.94 vs 0.80). Contact surface area correlated with the change in postoperative renal function after partial nephrectomy. It can be used in conjunction with the nephrometry score to counsel patients about the risk of renal functional decline after partial nephrectomy. Copyright © 2018 American Urological Association Education and Research, Inc. Published by Elsevier Inc. All rights reserved.

  1. Area densitometry using rotating Scheimpflug photography for posterior capsule opacification and surface light scattering analyses.

    Science.gov (United States)

    Minami, Keiichiro; Honbo, Masato; Mori, Yosai; Kataoka, Yasushi; Miyata, Kazunori

    2015-11-01

    To compare area densitometry analysis using rotating Scheimpflug photography in quantifications of posterior capsule opacification (PCO) and surface light scattering with previous anterior-segment analyzer measurement. Miyata Eye Hospital, Miyazaki, Japan. Prospective observational case series. Scheimpflug images of eyes with foldable intraocular lenses (IOLs) were obtained using rotating and fixed Scheimpflug photography. Area densitometry on the posterior and anterior surfaces was conducted for PCO and surface light scattering analyses, respectively, with an identical area size. Correlation between two measurements was analyzed using linear regression. The study included 105 eyes of 74 patients who received IOLs 1 to 18 years (mean, 4.9 ± 4.5 years) postoperatively. In the PCO analysis on the posterior IOL surface, there was a significant correlation between the two measurements (P photography exhibited saturation due to intensive scatterings. Area densitometry combined with a rotating Scheimpflug photography was exchangeable to previously established densitometry measurement, and allowed successive evaluation in longer-term observations. Copyright © 2015 ASCRS and ESCRS. Published by Elsevier Inc. All rights reserved.

  2. Stereological estimation of surface area and barrier thickness of fish gills in vertical sections.

    Science.gov (United States)

    Da Costa, Oscar T F; Pedretti, Ana Carolina E; Schmitz, Anke; Perry, Steven F; Fernandes, Marisa N

    2007-01-01

    Previous morphometric methods for estimation of the volume of components, surface area and thickness of the diffusion barrier in fish gills have taken advantage of the highly ordered structure of these organs for sampling and surface area estimations, whereas the thickness of the diffusion barrier has been measured orthogonally on perpendicularly sectioned material at subjectively selected sites. Although intuitively logical, these procedures do not have a demonstrated mathematical basis, do not involve random sampling and measurement techniques, and are not applicable to the gills of all fish. The present stereological methods apply the principles of surface area estimation in vertical uniform random sections to the gills of the Brazilian teleost Arapaima gigas. The tissue was taken from the entire gill apparatus of the right-hand or left-hand side (selected at random) of the fish by systematic random sampling and embedded in glycol methacrylate for light microscopy. Arches from the other side were embedded in Epoxy resin. Reference volume was estimated by the Cavalieri method in the same vertical sections that were used for surface density and volume density measurements. The harmonic mean barrier thickness of the water-blood diffusion barrier was calculated from measurements taken along randomly selected orientation lines that were sine-weighted relative to the vertical axis. The values thus obtained for the anatomical diffusion factor (surface area divided by barrier thickness) compare favourably with those obtained for other sluggish fish using existing methods.

  3. Updating sea spray aerosol emissions in the Community Multiscale Air Quality (CMAQ) model version 5.0.2

    Science.gov (United States)

    Gantt, B.; Kelly, J. T.; Bash, J. O.

    2015-11-01

    Sea spray aerosols (SSAs) impact the particle mass concentration and gas-particle partitioning in coastal environments, with implications for human and ecosystem health. Model evaluations of SSA emissions have mainly focused on the global scale, but regional-scale evaluations are also important due to the localized impact of SSAs on atmospheric chemistry near the coast. In this study, SSA emissions in the Community Multiscale Air Quality (CMAQ) model were updated to enhance the fine-mode size distribution, include sea surface temperature (SST) dependency, and reduce surf-enhanced emissions. Predictions from the updated CMAQ model and those of the previous release version, CMAQv5.0.2, were evaluated using several coastal and national observational data sets in the continental US. The updated emissions generally reduced model underestimates of sodium, chloride, and nitrate surface concentrations for coastal sites in the Bay Regional Atmospheric Chemistry Experiment (BRACE) near Tampa, Florida. Including SST dependency to the SSA emission parameterization led to increased sodium concentrations in the southeastern US and decreased concentrations along parts of the Pacific coast and northeastern US. The influence of sodium on the gas-particle partitioning of nitrate resulted in higher nitrate particle concentrations in many coastal urban areas due to increased condensation of nitric acid in the updated simulations, potentially affecting the predicted nitrogen deposition in sensitive ecosystems. Application of the updated SSA emissions to the California Research at the Nexus of Air Quality and Climate Change (CalNex) study period resulted in a modest improvement in the predicted surface concentration of sodium and nitrate at several central and southern California coastal sites. This update of SSA emissions enabled a more realistic simulation of the atmospheric chemistry in coastal environments where marine air mixes with urban pollution.

  4. Accessible surface area from NMR chemical shifts

    Energy Technology Data Exchange (ETDEWEB)

    Hafsa, Noor E.; Arndt, David; Wishart, David S., E-mail: david.wishart@ualberta.ca [University of Alberta, Department of Computing Science (Canada)

    2015-07-15

    Accessible surface area (ASA) is the surface area of an atom, amino acid or biomolecule that is exposed to solvent. The calculation of a molecule’s ASA requires three-dimensional coordinate data and the use of a “rolling ball” algorithm to both define and calculate the ASA. For polymers such as proteins, the ASA for individual amino acids is closely related to the hydrophobicity of the amino acid as well as its local secondary and tertiary structure. For proteins, ASA is a structural descriptor that can often be as informative as secondary structure. Consequently there has been considerable effort over the past two decades to try to predict ASA from protein sequence data and to use ASA information (derived from chemical modification studies) as a structure constraint. Recently it has become evident that protein chemical shifts are also sensitive to ASA. Given the potential utility of ASA estimates as structural constraints for NMR we decided to explore this relationship further. Using machine learning techniques (specifically a boosted tree regression model) we developed an algorithm called “ShiftASA” that combines chemical-shift and sequence derived features to accurately estimate per-residue fractional ASA values of water-soluble proteins. This method showed a correlation coefficient between predicted and experimental values of 0.79 when evaluated on a set of 65 independent test proteins, which was an 8.2 % improvement over the next best performing (sequence-only) method. On a separate test set of 92 proteins, ShiftASA reported a mean correlation coefficient of 0.82, which was 12.3 % better than the next best performing method. ShiftASA is available as a web server ( http://shiftasa.wishartlab.com http://shiftasa.wishartlab.com ) for submitting input queries for fractional ASA calculation.

  5. ERROR BOUNDS FOR SURFACE AREA ESTIMATORS BASED ON CROFTON’S FORMULA

    Directory of Open Access Journals (Sweden)

    Markus Kiderlen

    2011-05-01

    Full Text Available According to Crofton's formula, the surface area S(A of a sufficiently regular compact set A in Rd is proportional to the mean of all total projections pA (u on a linear hyperplane with normal u, uniformly averaged over all unit vectors u. In applications, pA (u is only measured in k directions and the mean is approximated by a finite weighted sum bS(A of the total projections in these directions. The choice of the weights depends on the selected quadrature rule. We define an associated zonotope Z (depending only on the projection directions and the quadrature rule, and show that the relative error bS (A/S (A is bounded from below by the inradius of Z and from above by the circumradius of Z. Applying a strengthened isoperimetric inequality due to Bonnesen, we show that the rectangular quadrature rule does not give the best possible error bounds for d =2. In addition, we derive asymptotic behavior of the error (with increasing k in the planar case. The paper concludes with applications to surface area estimation in design-based digital stereology where we show that the weights due to Bonnesen's inequality are better than the usual weights based on the rectangular rule and almost optimal in the sense that the relative error of the surface area estimator is very close to the minimal error.

  6. Indexing Glomerular Filtration Rate to Body Surface Area

    DEFF Research Database (Denmark)

    Redal-Baigorri, Belén; Rasmussen, Knud; Heaf, James Goya

    2014-01-01

    BACKGROUND: Kidney function is mostly expressed in terms of glomerular filtration rate (GFR). A common feature is the expression as ml/min per 1.73 m(2) , which represents the adjustment of the individual kidney function to a standard body surface area (BSA) to allow comparison between individuals....... We investigated the impact of indexing GFR to BSA in cancer patients, as this BSA indexation might affect the reported individual kidney function. METHODS: Cross-sectional study of 895 adults who had their kidney function measured with (51) chrome ethylene diamine tetraacetic acid. Mean values of BSA...

  7. Asymptotic variance of grey-scale surface area estimators

    DEFF Research Database (Denmark)

    Svane, Anne Marie

    Grey-scale local algorithms have been suggested as a fast way of estimating surface area from grey-scale digital images. Their asymptotic mean has already been described. In this paper, the asymptotic behaviour of the variance is studied in isotropic and sufficiently smooth settings, resulting...... in a general asymptotic bound. For compact convex sets with nowhere vanishing Gaussian curvature, the asymptotics can be described more explicitly. As in the case of volume estimators, the variance is decomposed into a lattice sum and an oscillating term of at most the same magnitude....

  8. Correlation of lung surface area to apoptosis and proliferation in human emphysema.

    Science.gov (United States)

    Imai, K; Mercer, B A; Schulman, L L; Sonett, J R; D'Armiento, J M

    2005-02-01

    Pulmonary emphysema is associated with alterations in matrix proteins and protease activity. These alterations may be linked to programmed cell death by apoptosis, potentially influencing lung architecture and lung function. To evaluate apoptosis in emphysema, lung tissue was analysed from 10 emphysema patients and six individuals without emphysema (normal). Morphological analysis revealed alveolar cells in emphysematous lungs with convoluted nuclei characteristic of apoptosis. DNA fragmentation was detected using terminal deoxynucleotide transferase-mediated dUTP nick-end labelling (TUNEL) and gel electrophoresis. TUNEL revealed higher apoptosis in emphysematous than normal lungs. Markers of apoptosis, including active caspase-3, proteolytic fragment of poly (ADP-ribose) polymerase, Bax and Bad, were detected in emphysematous lungs. Linear regression showed that apoptosis was inversely correlated with surface area. Emphysematous lungs demonstrated lower surface areas and increased cell proliferation. There was no correlation between apoptosis and proliferation, suggesting that, although both events increase during emphysema, they are not in equilibrium, potentially contributing to reduced lung surface area. In summary, cell-based mechanisms associated with emphysematous parenchymal damage include increased apoptosis and cell proliferation. Apoptosis correlated with airspace enlargement, supporting epidemiological evidence of the progressive nature of emphysema. These data extend the understanding of cell dynamics and structural changes within the lung during emphysema pathogenesis.

  9. Surface runoff from urban areas. New aspects; Neue Aspekte in der Behandlung von Siedlungsabfluessen

    Energy Technology Data Exchange (ETDEWEB)

    Fuchs, Stephan [Karlsruher Institut fuer Technologie (KIT), Karlsruhe (Germany). Bereich Siedlungswasserwirtschaft und Wasserguetewirtschaft; Lambert, Benedikt [Bioplan Landeskulturgesellschaft, Sinsheim (Germany); Grotehusmann, Dieter [Ingenieurgesellschaft fuer Stadthydrologie, Hannover (Germany)

    2010-12-15

    The surface runoff from urban areas is one of the most important sources of pollutants emitted into surface waters. Suspended solids which act as a transport vehicle for many anthropogenic pollutants (e. g. heavy metals, PAH) are a key factor in this regard. The development of efficient measures of storm water runoff treatment thus requires a further differentiation of suspended solids in a fine (clay and silt) and coarse (sand and gravel) fraction. Both fractions show distinctly different characteristics in pollutant loading, transport and retention on urban surfaces and sewer systems. The primary aim of storm water runoff treatment is the reduction of the fine particles which are always highly loaded with anthropogenic pollutants. In contrast the coarse particles are almost unpolluted especially if they have a low organic share. The widespread sedimentation tanks with surface loadings between 10 and 2 m/h are very inefficient. A significant, save and lasting reduction of the emitted load of fine particles requires a considerable reduction of the surface loads. That can be achieved with the installation of lamellar settler or the utilization of the very large volumes of flood management tanks frequently present in urban areas. Filtration plants are highly efficient but there application in urban areas is limited due to their high space demands. (orig.)

  10. Surface area-burnoff correlation for the steam--graphite reaction

    International Nuclear Information System (INIS)

    Stark, W.A. Jr.; Malinauskas, A.P.

    1977-01-01

    The oxidation of core graphite by steam of air represents a problem area of significant concern in safety analyses for the high temperature gas cooled reactor (HTGR). Core and core-support graphite integrity and strength deteriorate with oxidation of the graphite, and oxidation furthermore could affect the rate of fission product release under upset conditions. Consequently, modeling of core response during steam or air ingress conditions requires an expression for the rate of graphite interaction with those impurities. The steam--graphite reaction in particular is a complex interaction of mass transport within the graphite with chemi-sorption and reaction on accessible surfaces; experimental results from graphite to graphite are highly variable, and the description of the reaction is not yet completely consistent. A simple etch pit model relating surface area to burnoff has been proposed and shown to provide reasonable correlation with experimental data obtained from steam oxidation studies of nuclear grade H-327 graphite. Unaccounted differences between theory and experiment arise at burnoffs exceeding 3 to 5 percent. The model, while not complete nor comprehensive, is consistent with experimental observations of graphite oxidation by O 2 (air), CO 2 , or H 2 O, and could have some utility in safety analysis

  11. Solvent accessible surface area (ASA) of simulated phospholipid membranes

    DEFF Research Database (Denmark)

    Tuchsen, E.; Jensen, Morten Østergaard; Westh, P.

    2003-01-01

    The membrane-solvent interface has been investigated through calculations of the solvent accessible surface area (ASA) for simulated membranes of DPPC and POPE. For DPPC at 52 degreesC we found an ASA of 126 +/- 8 Angstrom(2) per lipid molecule, equivalent to twice the projected lateral area......, even the most exposed parts of the PC head-group show average ASAs of less than half of its maximal or 'fully hydrated' value. The average ASA of a simulated POPE membrane was 96 +/- 7 Angstrom(2) per lipid. The smaller value than for DPPC reflects much lower ASA of the ammonium ion, which is partially...... compensated by increased exposure of the ethylene and phosphate moieties. The ASA of the polar moieties Of (PO4, NH3 and COO) constitutes 65% of the total accessible area for POPE, making this interface more polar than that of DPPC. It is suggested that ASA information can be valuable in attempts...

  12. Dye-Sensitized Solar Cells Based on High Surface Area Nanocrystalline Zinc Oxide Spheres

    Directory of Open Access Journals (Sweden)

    Pavuluri Srinivasu

    2011-01-01

    Full Text Available High surface area nanocrystalline zinc oxide material is fabricated using mesoporous nanostructured carbon as a sacrificial template through combustion process. The resulting material is characterized by XRD, N2 adsorption, HR-SEM, and HR-TEM. The nitrogen adsorption measurement indicates that the materials possess BET specific surface area ca. 30 m2/g. Electron microscopy images prove that the zinc oxide spheres possess particle size in the range of 0.12 μm–0.17 μm. The nanocrystalline zinc oxide spheres show 1.0% of energy conversion efficiency for dye-sensitized solar cells.

  13. Surface area of lactose and lactose granulates on consolidation and compaction

    NARCIS (Netherlands)

    Riepma, Klaas Alouis

    1993-01-01

    This dissertation discusses the effect of short time storage at different conditions on the strength and the specific BET surface area of lactose tablets. In addition, some aspects are studied of the consolidation and compaction properties of crystalline lactose fractions in heterogeneous systems.

  14. Comparison of 2 root surface area measurement methods: 3-dimensional laser scanning and cone-beam computed tomography

    International Nuclear Information System (INIS)

    Tasanapanont, Jintana; Apisariyakul, Janya; Wattanachai, Tanapan; Jotikasthira, Dhirawat; Sriwilas, Patiyut; Midtboe, Marit

    2017-01-01

    The aim of this study was to compare the use of 3-dimensional (3D) laser scanning and cone-beam computed tomography (CBCT) as methods of root surface measurement. Thirty teeth (15 maxillary first premolars and 15 mandibular first premolars) from 8 patients who required extractions for orthodontic treatment were selected. Before extraction, pre-treatment CBCT images of all the patients were recorded. First, a CBCT image was imported into simulation software (Mimics version 15.01; Materialise, Leuven, Belgium) and the root surface area of each tooth was calculated using 3-Matic (version 7.01, Materialise, Leuven, Belgium). After extraction, all the teeth were scanned and the root surface area of each extracted tooth was calculated. The root surface areas calculated using these 2 measurement methods were analyzed using the paired t-test (P<.05). Correlations between the 2 methods were determined by calculating the Pearson correlation coefficient. The intraclass correlation coefficient (ICC) was used to assess intraobserver reliability. The root surface area measurements (230.11±41.97 mm"2) obtained using CBCT were slightly greater than those (229.31±42.46 mm2) obtained using 3D laser scanning, but not significantly (P=.425). A high Pearson correlation coefficient was found between the CBCT and the 3D laser scanner measurements. The intraobserver ICC was 1.000 for 3D laser scanning and 0.990 for CBCT. This study presents a novel CBCT approach for measuring the root surface area; this technique can be used for estimating the root surface area of non-extracted teeth

  15. Comparison of 2 root surface area measurement methods: 3-dimensional laser scanning and cone-beam computed tomography

    Energy Technology Data Exchange (ETDEWEB)

    Tasanapanont, Jintana; Apisariyakul, Janya; Wattanachai, Tanapan; Jotikasthira, Dhirawat [Dept. of Orthodontics and Pediatric Dentistry, Faculty of Dentistry, Chiang Mai University, Chiang Mai (Thailand); Sriwilas, Patiyut [Dept. of Radiology, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok (Thailand); Midtboe, Marit [Dept. of Clinical Dentistry - Orthodontics, Faculty of Medicine and Dentistry, University of Bergen, Bergen (Norway)

    2017-06-15

    The aim of this study was to compare the use of 3-dimensional (3D) laser scanning and cone-beam computed tomography (CBCT) as methods of root surface measurement. Thirty teeth (15 maxillary first premolars and 15 mandibular first premolars) from 8 patients who required extractions for orthodontic treatment were selected. Before extraction, pre-treatment CBCT images of all the patients were recorded. First, a CBCT image was imported into simulation software (Mimics version 15.01; Materialise, Leuven, Belgium) and the root surface area of each tooth was calculated using 3-Matic (version 7.01, Materialise, Leuven, Belgium). After extraction, all the teeth were scanned and the root surface area of each extracted tooth was calculated. The root surface areas calculated using these 2 measurement methods were analyzed using the paired t-test (P<.05). Correlations between the 2 methods were determined by calculating the Pearson correlation coefficient. The intraclass correlation coefficient (ICC) was used to assess intraobserver reliability. The root surface area measurements (230.11±41.97 mm{sup 2}) obtained using CBCT were slightly greater than those (229.31±42.46 mm2) obtained using 3D laser scanning, but not significantly (P=.425). A high Pearson correlation coefficient was found between the CBCT and the 3D laser scanner measurements. The intraobserver ICC was 1.000 for 3D laser scanning and 0.990 for CBCT. This study presents a novel CBCT approach for measuring the root surface area; this technique can be used for estimating the root surface area of non-extracted teeth.

  16. A Three-Dimensional Enormous Surface Area Aluminum Microneedle Array with Nanoporous Structure

    OpenAIRE

    Chen, Po Chun; Hsieh, Sheng Jen; Chen, Chien Chon; Zou, Jun

    2013-01-01

    We proposed fabricating an aluminum microneedle array with a nanochannel structure on the surface by combining micromachining, electrolyte polishing, and anodization methods. The microneedle array provides a three-dimensional (3D) structure that possesses several hundred times more surface area than a traditional nanochannel template. Therefore, the microneedle array can potentially be used in many technology applications. This 3D microneedle array device can not only be used for painless inj...

  17. Modeled effects on permittivity measurements of water content in high surface area porous media

    International Nuclear Information System (INIS)

    Jones, S.B.; Or, Dani

    2003-01-01

    Time domain reflectometry (TDR) has become an important measurement technique for determination of porous media water content and electrical conductivity due to its accuracy, fast response and automation capability. Water content is inferred from the measured bulk dielectric constant based on travel time analysis along simple transmission lines. TDR measurements in low surface area porous media accurately describe water content using an empirical relationship. Measurement discrepancies arise from dominating influences such as bound water due to high surface area, extreme aspect ratio particles or atypical water phase configuration. Our objectives were to highlight primary factors affecting dielectric permittivity measurements for water content determination in porous mixtures, and demonstrate the influence of these factors on mixture permittivity as predicted by a three-phase dielectric mixture model. Modeled results considering water binding, higher porosity, constituent geometry or phase configuration suggest any of these effects individually are capable of causing permittivity reduction, though all likely contribute in high surface area porous media

  18. Potential hydrogen and oxygen partial pressures in legacy plutonium oxide packages at Oak Ridge

    Energy Technology Data Exchange (ETDEWEB)

    Veirs, Douglas K. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-07-07

    An approach to estimate the maximum hydrogen and oxygen partial pressures within sealed containers is described and applied to a set of packages containing high-purity plutonium dioxide. The approach uses experimentally determined maximum hydrogen and oxygen partial pressures and scales the experimentally determined pressures to the relevant packaged material properties. The important material properties are the specific wattage and specific surface area (SSA). Important results from the experimental determination of maximum partial pressures are (1) the ratio of hydrogen to oxygen is stoichiometric, and (2) the maximum pressures increase with increasing initial rates of production. The material properties that influence the rates are the material specific wattage and the SSA. The unusual properties of these materials, high specific wattage and high SSA, result in higher predicted maximum pressures than typical plutonium dioxide in storage. The pressures are well within the deflagration range for mixtures of hydrogen and oxygen.

  19. Accessing the Impact of Sea-Salt Emissions on Aerosol Chemical Formation and Deposition Over Pearl River Delta, China

    Science.gov (United States)

    Fan, Q.; Wang, X.; Liu, Y.; Wu, D.; Chan, P. W.; Fan, S.; Feng, Y.

    2015-12-01

    Sea-salt aerosol (SSA) emissions have a significant impact on aerosol pollution and haze formation in the coastal areas. In this study, Models-3/CMAQ modeling system was utilized to access the impact of SSA emissions on aerosol chemical formation and deposition over Pearl River Delta (PRD), China in July 2006. More SSAs were transported inland from the open-ocean under the southeast wind in summertime. Two experiments (with and without SSA emissions in the CMAQ model) were set up to compare the modeling results with each other. The results showed that the increase of sulfate concentrations were more attributable to the primary emissions of coarse SO42- particles in SSA, while the increase of nitrate concentrations were more attributable to secondary chemical formations, known as the mechanisms of chloride depletion in SSA. In the coastal areas, 17.62 % of SO42-, 26.6% of NO3- and 38.2% of PM10 were attributed to SSA emissions, while those portions were less than 1% in the inland areas. The increases of PM10 and its components due to SSA emissions resulted in higher deposition fluxes over PRD, particularly in the coastal areas, except for the wet deposition of nitrate. Nitrate was more sensitive to SSA emissions in chemical formations than sulfate and dry deposition of aerosol was also more sensitive than that for wet deposition. Process analysis of sulfate and nitrate was applied to find out the difference of physical and chemical mechanisms between Guangzhou (the inland areas) and Zhuhai (the coastal areas). The negative contributions of dry deposition process to both sulfate and nitrate concentrations increased if SSA emissions were taken into account in the model, especially for Zhuhai. The negative contributions of cloud process also increased due to cloud scavenging and wet deposition process. In the coastal area, the gas-to-particle conversions became more active with high contributions of aerosol process to nitrate concentrations.

  20. Mineral paragenesis on Mars: The roles of reactive surface area and diffusion.

    Science.gov (United States)

    Fairén, Alberto G; Gil-Lozano, Carolina; Uceda, Esther R; Losa-Adams, Elisabeth; Davila, Alfonso F; Gago-Duport, Luis

    2017-09-01

    Geochemical models of secondary mineral precipitation on Mars generally assume semiopen systems (open to the atmosphere but closed at the water-sediment interface) and equilibrium conditions. However, in natural multicomponent systems, the reactive surface area of primary minerals controls the dissolution rate and affects the precipitation sequences of secondary phases, and simultaneously, the transport of dissolved species may occur through the atmosphere-water and water-sediment interfaces. Here we present a suite of geochemical models designed to analyze the formation of secondary minerals in basaltic sediments on Mars, evaluating the role of (i) reactive surface areas and (ii) the transport of ions through a basalt sediment column. We consider fully open conditions, both to the atmosphere and to the sediment, and a kinetic approach for mineral dissolution and precipitation. Our models consider a geochemical scenario constituted by a basin (i.e., a shallow lake) where supersaturation is generated by evaporation/cooling and the starting point is a solution in equilibrium with basaltic sediments. Our results show that cation removal by diffusion, along with the input of atmospheric volatiles and the influence of the reactive surface area of primary minerals, plays a central role in the evolution of the secondary mineral sequences formed. We conclude that precipitation of evaporites finds more restrictions in basaltic sediments of small grain size than in basaltic sediments of greater grain size.

  1. Relationship between surface area for adhesion and tensile bond strength--evaluation of a micro-tensile bond test.

    Science.gov (United States)

    Sano, H; Shono, T; Sonoda, H; Takatsu, T; Ciucchi, B; Carvalho, R; Pashley, D H

    1994-07-01

    The purpose of this study was to test the null hypothesis that there is no relationship between the bonded surface area of dentin and the tensile strength of adhesive materials. The enamel was removed from the occlusal surface of extracted human third molars, and the entire flat surface was covered with resin composite bonded to the dentin to form a flat resin composite crown. Twenty-four hours later, the bonded specimens were sectioned parallel to the long axis of the tooth into 10-20 thin sections whose upper part was composed of resin composite with the lower half being dentin. These small sections were trimmed using a high speed diamond bur into an hourglass shape with the narrowest portion at the bonded interface. Surface area was varied by altering the specimen thickness and width. Tensile bond strength was measured using custom-made grips in a universal testing machine. Tensile bond strength was inversely related to bonded surface area. At surface areas below 0.4 mm2, the tensile bond strengths were about 55 MPa for Clearfil Liner Bond 2 (Kuraray Co., Ltd.), 38 MPa for Scotchbond MP (3M Dental Products), and 20 MPa for Vitremer (3M Dental Products). At these small surface areas all of the bond failures were adhesive in nature. This new method permits measurement of high bond strengths without cohesive failure of dentin. It also permits multiple measurements to be made within a single tooth.

  2. Assessing the influence of groundwater and land surface scheme in the modelling of land surface-atmosphere feedbacks over the FIFE area in Kansas, USA

    DEFF Research Database (Denmark)

    Larsen, Morten Andreas Dahl; Højmark Rasmussen, Søren; Drews, Martin

    2016-01-01

    The land surface-atmosphere interaction is described differently in large scale surface schemes of regional climate models and small scale spatially distributed hydrological models. In particular, the hydrological models include the influence of shallow groundwater on evapotranspiration during dry...... by HIRHAM simulated precipitation. The last two simulations include iv) a standard HIRHAM simulation, and v) a fully coupled HIRHAM-MIKE SHE simulation locally replacing the land surface scheme by MIKE SHE for the FIFE area, while HIRHAM in standard configuration is used for the remaining model area...

  3. Estimating Surface Area of Sponges and Marine Gorgonians as Indicators of Habitat Availability on Caribbean Coral Reefs

    Science.gov (United States)

    Surface area and topographical complexity are fundamental attributes of shallow tropical coral reefs and can be used to estimate habitat for fish and invertebrates. This study presents empirical methods for estimating surface area provided by sponges and gorgonians in the Central...

  4. Influence of Alkali Treatment on the Surface Area of Aluminium Dross

    Directory of Open Access Journals (Sweden)

    N. S. Ahmad Zauzi

    2016-01-01

    Full Text Available Aluminium dross is an industrial waste from aluminium refining industry and classified as toxic substances. However, the disposal of dross as a waste is a burden to aluminium manufacturer industries due to its negative effects to the ecosystem, surface, and ground water. Therefore the purpose of this study is to evaluate the influence of sodium hydroxide (NaOH on the surface area and pore size of aluminium dross. There were 3 stages in the treatment activities, which were leaching, precipitation, and calcination process. The optimum result from this study was the surface area of aluminium dross increases from 10.1 m2/g up to 80.0 m2/g at 40°C, 1% NaOH, and 15-minute reaction time. Thus, aluminium dross has a potential to be converted into other useful material such as catalyst and absorbent. The benefit of this research is that the hazardous industrial waste can be turned into wealth to be used in other applications such as in catalytic activities and absorber in waste water treatment. Further investigation on the physicochemical of aluminium dross with different acid or alkali should be conducted to get deeper understanding on the aluminium dross as a catalyst-type material.

  5. Discrimination of surface wear on obsidian tools using LSCM and RelA: pilot study results (area-scale analysis of obsidian tool surfaces).

    Science.gov (United States)

    Stemp, W James; Chung, Steven

    2011-01-01

    This pilot study tests the reliability of laser scanning confocal microscopy (LSCM) to quantitatively measure wear on experimental obsidian tools. To our knowledge, this is the first use of confocal microscopy to study wear on stone flakes made from an amorphous silicate like obsidian. Three-dimensional surface roughness or texture area scans on three obsidian flakes used on different contact materials (hide, shell, wood) were documented using the LSCM to determine whether the worn surfaces could be discriminated using area-scale analysis, specifically relative area (RelA). When coupled with the F-test, this scale-sensitive fractal analysis could not only discriminate the used from unused surfaces on individual tools, but was also capable of discriminating the wear histories of tools used on different contact materials. Results indicate that such discriminations occur at different scales. Confidence levels for the discriminations at different scales were established using the F-test (mean square ratios or MSRs). In instances where discrimination of surface roughness or texture was not possible above the established confidence level based on MSRs, photomicrographs and RelA assisted in hypothesizing why this was so. Copyright © 2011 Wiley Periodicals, Inc.

  6. Specific surface area of overlapping spheres in the presence of obstructions.

    Science.gov (United States)

    Jenkins, D R

    2013-02-21

    This study considers the random placement of uniform sized spheres, which may overlap, in the presence of another set of randomly placed (hard) spheres, which do not overlap. The overlapping spheres do not intersect the hard spheres. It is shown that the specific surface area of the collection of overlapping spheres is affected by the hard spheres, such that there is a minimum in the specific surface area as a function of the relative size of the two sets of spheres. The occurrence of the minimum is explained in terms of the break-up of pore connectivity. The configuration can be considered to be a simple model of the structure of a porous composite material. In particular, the overlapping particles represent voids while the hard particles represent fillers. Example materials are pervious concrete, metallurgical coke, ice cream, and polymer composites. We also show how the material properties of such composites are affected by the void structure.

  7. High-Surface-Area, Emulsion-Templated Carbon Foams by Activation of polyHIPEs Derived from Pickering Emulsions

    Directory of Open Access Journals (Sweden)

    Robert T. Woodward

    2016-09-01

    Full Text Available Carbon foams displaying hierarchical porosity and excellent surface areas of >1400 m2/g can be produced by the activation of macroporous poly(divinylbenzene. Poly(divinylbenzene was synthesized from the polymerization of the continuous, but minority, phase of a simple high internal phase Pickering emulsion. By the addition of KOH, chemical activation of the materials is induced during carbonization, producing Pickering-emulsion-templated carbon foams, or carboHIPEs, with tailorable macropore diameters and surface areas almost triple that of those previously reported. The retention of the customizable, macroporous open-cell structure of the poly(divinylbenzene precursor and the production of a large degree of microporosity during activation leads to tailorable carboHIPEs with excellent surface areas.

  8. Study of LiFePO{sub 4} cathode materials coated with high surface area carbon

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Cheng-Zhang; Fey, George Ting-Kuo [Department of Chemical and Materials Engineering, National Central University, Chung-Li 32054 (China); Kao, Hsien-Ming [Department of Chemistry, National Central University, Chung-Li 32054 (China)

    2009-04-01

    LiFePO{sub 4} is a potential cathode material for 4 V lithium-ion batteries. Carbon-coated lithium iron phosphates were prepared using a high surface area carbon to react precursors through a solid-state process, during which LiFePO{sub 4} particles were embedded in amorphous carbon. The carbonaceous materials were synthesized by the pyrolysis of peanut shells under argon, where they were carbonized in a two-step process that occurred between 573 and 873 K. The shells were also treated with a proprietary porogenic agent with the goal of altering the pore structure and surface area of the pyrolysis products. The electrochemical properties of the as-prepared LiFePO{sub 4}/C composite cathode materials were systematically characterized by X-ray diffraction, scanning electron microscope, element mapping, energy dispersive spectroscopy, Raman spectroscopy, and total organic carbon (TOC) analysis. In LiFePO{sub 4}/C composites, the carbon not only increases rate capability, but also stabilizes capacity. In fact, the capacity of the composites increased with the specific surface area of carbon. The best result was observed with a composite made of 8.0 wt.% with a specific surface area of 2099 m{sup 2} g{sup -1}. When high surface area carbon was used as a carbon source to produce LiFePO{sub 4}, overall conductivity increased from 10{sup -8} to 10{sup -4} S cm{sup -1}, because the inhibition of particle growth during the final sintering process led to greater specific capacity, improved cycling properties and better rate capability compared to a pure olivine LiFePO{sub 4} material. (author)

  9. Effect of high surface area activated carbon on thermal degradation of jet fuel

    Energy Technology Data Exchange (ETDEWEB)

    Gergova, K.; Eser, S.; Arumugam, R.; Schobert, H.H. [Pennsylvania State Univ., University Park, PA (United States)

    1995-05-01

    Different solid carbons added to jet fuel during thermal stressing cause substantial changes in pyrolytic degradation reactions. Activated carbons, especially high surface area activated carbons were found to be very effective in suppressing solid deposition on metal reactor walls during stressing at high temperatures (425 and 450{degrees}C). The high surface area activated carbon PX-21 prevented solid deposition on reactor walls even after 5h at 450{degrees}C. The differences seen in the liquid product composition when activated carbon is added indicated that the carbon surfaces affect the degradation reactions. Thermal stressing experiments were carried out on commercial petroleum-derived JPTS jet fuel. We also used n-octane and n-dodecane as model compounds in order to simplify the study of the chemical changes which take place upon activated carbon addition. In separate experiments, the presence of a hydrogen donor, decalin, together with PX-21 was also studied.

  10. Determination of the surface area and sizes of supported copper nanoparticles through organothiol adsorption—ñhemisorption

    Energy Technology Data Exchange (ETDEWEB)

    Ndolomingo, Matumuene Joe; Meijboom, Reinout, E-mail: rmeijboom@uj.ac.za

    2016-12-30

    Highlights: • Cu on γ-Al{sub 2}O{sub 3} catalysts were prepared and characterized. • The ligand sorption-based technique was used for the determination of specific surface area and particle sizes. • The ligand packing density on Cu nanoparticles was quantified. • A fair agreement was found between the Cu particle sizes obtained from ligand adsorption and TEM methods. • The oxidation of morin by hydrogen peroxide was used to evaluate the catalytic activities of the Cu supported catalysts. - Abstract: The mechanisms involving the nanoparticle surfaces in catalytic reactions are more difficult to elucidate due to the nanoparticle surface unevenness, size distributions, and morphological irregularity. True surface area and particle sizes determination are key aspects of the activity of metal nanoparticle catalysts. Here we report on the organothiol adsorption-based technique for the determination of specific surface area of Cu nanoparticles, and their resultant sizes on γ-Al{sub 2}O{sub 3} supports. Quantification of ligand packing density on copper nanoparticles is also reported. The concentration of the probe ligand, 2-mercaptobenzimidazole (2-MBI) before and after immersion of supported copper catalysts was determined by ultraviolet-visible spectrometry (UV–vis). The amount of ligand adsorbed was found to be proportional to the copper nanoparticles surface area. Atomic absorption spectrometry (AAS), N{sub 2}-physisorption (BET), transmission electron microscopy (TEM), scanning electron microscopy (SEM) and thermogravimetric analysis (TGA) were used for the characterization of the catalysts. A fair agreement was found between particle sizes obtained from ligand adsorption and TEM methods. The catalytic activity of the copper nanoparticles related to their inherent surface area was evaluated using the model reaction of the oxidation of morin by hydrogen peroxide.

  11. Negative plate macropore surfaces in lead-acid batteries: Porosity, Brunauer-Emmett-Teller area, and capacity

    Energy Technology Data Exchange (ETDEWEB)

    D' Alkaine, C.V.; de O. Brito, G.A. [Group of Electrochemistry and Polymers, DQ-UFSCar, Rodovia Washington Luis, Km 235, CP 676, 13565-905 Sao Carlos (SP) (Brazil)

    2009-06-01

    We propose an explanation for the production of an electrochemically active area during the electrochemical formation of lead-acid battery negative plates based on solid-state reactions. Our proposal is supported by experimental data. This study includes a critical review of the literature on charge/discharge mechanisms, porosity, and BET area. The critical review, through the latter two parameters, indicates the existence of both macro and micropores in positive plates, but only macropores in negative plates, with characteristic surface roughness. In the present paper the surface sulfation of the precursor is controlled using various acidic, neutral and alkaline solutions during an electrochemical formation process that does not include soaking. Our results confirm that variable roughness can be produced at the negative plate macropore surfaces. The morphological changes produced by different formation conditions are assessed by measuring the macroporosity, BET area, and capacity of single negative plates. Based on these concepts, a method was developed and applied to measure independently the contributions of geometrical surface macroporosity and roughness to the negative plate capacity. (author)

  12. Large area smoothing of surfaces by ion bombardment: fundamentals and applications

    International Nuclear Information System (INIS)

    Frost, F; Fechner, R; Ziberi, B; Voellner, J; Flamm, D; Schindler, A

    2009-01-01

    Ion beam erosion can be used as a process for achieving surface smoothing at microscopic length scales and for the preparation of ultrasmooth surfaces, as an alternative to nanostructuring of various surfaces via self-organization. This requires that in the evolution of the surface topography different relaxation mechanisms dominate over the roughening, and smoothing of initially rough surfaces can occur. This contribution focuses on the basic mechanisms as well as potential applications of surface smoothing using low energy ion beams. In the first part, the fundamentals for the smoothing of III/V semiconductors, Si and quartz glass surfaces using low energy ion beams (ion energy: ≤2000 eV) are reviewed using examples. The topography evolution of these surfaces with respect to different process parameters (ion energy, ion incidence angle, erosion time, sample rotation) has been investigated. On the basis of the time evolution of different roughness parameters, the relevant surface relaxation mechanisms responsible for surface smoothing are discussed. In this context, physical constraints as regards the effectiveness of surface smoothing by direct ion bombardment will also be addressed and furthermore ion beam assisted smoothing techniques are introduced. In the second application-orientated part, recent technological developments related to ion beam assisted smoothing of optically relevant surfaces are summarized. It will be demonstrated that smoothing by direct ion bombardment in combination with the use of sacrificial smoothing layers and the utilization of appropriate broad beam ion sources enables the polishing of various technologically important surfaces down to 0.1 nm root mean square roughness level, showing great promise for large area surface processing. Specific examples are given for ion beam smoothing of different optical surfaces, especially for substrates used for advanced optical applications (e.g., in x-ray optics and components for extreme

  13. Comparison of deposited surface area of airborne ultrafine particles generated from two welding processes.

    Science.gov (United States)

    Gomes, J F; Albuquerque, P C; Miranda, Rosa M; Santos, Telmo G; Vieira, M T

    2012-09-01

    This article describes work performed on the assessment of the levels of airborne ultrafine particles emitted in two welding processes metal-active gas (MAG) of carbon steel and friction-stir welding (FSW) of aluminium in terms of deposited area in alveolar tract of the lung using a nanoparticle surface area monitor analyser. The obtained results showed the dependence from process parameters on emitted ultrafine particles and clearly demonstrated the presence of ultrafine particles, when compared with background levels. The obtained results showed that the process that results on the lower levels of alveolar-deposited surface area is FSW, unlike MAG. Nevertheless, all the tested processes resulted in important doses of ultrafine particles that are to be deposited in the human lung of exposed workers.

  14. Impact of microstructure evolution on the difference between geometric and reactive surface areas in natural chalk

    Science.gov (United States)

    Yang, Y.; Bruns, S.; Stipp, S. L. S.; Sørensen, H. O.

    2018-05-01

    The coupling between flow and mineral dissolution drives the evolution of many natural and engineered flow systems. Pore surface changes as microstructure evolves but this transient behaviour has traditionally been difficult to model. We combined a reactor network model with experimental, greyscale tomography data to establish the morphological grounds for differences among geometric, reactive and apparent surface areas in dissolving chalk. This approach allowed us to study the effects of initial geometry and macroscopic flow rate independently. The simulations showed that geometric surface, which represents a form of local transport heterogeneity, increases in an imposed flow field, even when the porous structure is chemically homogeneous. Hence, the fluid-reaction coupling leads to solid channelisation, which further results in fluid focusing and an increase in geometric surface area. Fluid focusing decreases the area of reactive surface and the residence time of reactant, both contribute to the over-normalisation of reaction rate. In addition, the growing and merging of microchannels, near the fluid entrance, contribute to the macroscopic, fast initial dissolution rate of rocks.

  15. Albedo and land surface temperature shift in hydrocarbon seepage potential area, case study in Miri Sarawak Malaysia

    International Nuclear Information System (INIS)

    Suherman, A; Rahman, M Z A; Busu, I

    2014-01-01

    The presence of hydrocarbon seepage is generally associated with rock or mineral alteration product exposures, and changes of soil properties which manifest with bare development and stress vegetation. This alters the surface thermodynamic properties, changes the energy balance related to the surface reflection, absorption and emission, and leads to shift in albedo and LST. Those phenomena may provide a guide for seepage detection which can be recognized inexpensively by remote sensing method. District of Miri is used for study area. Available topographic maps of Miri and LANDSAT ETM+ were used for boundary construction and determination albedo and LST. Three land use classification methods, namely fixed, supervised and NDVI base classifications were employed for this study. By the intensive land use classification and corresponding statistical comparison was found a clearly shift on albedo and land surface temperature between internal and external seepage potential area. The shift shows a regular pattern related to vegetation density or NDVI value. In the low vegetation density or low NDVI value, albedo of internal area turned to lower value than external area. Conversely in the high vegetation density or high NDVI value, albedo of internal area turned to higher value than external area. Land surface temperature of internal seepage potential was generally shifted to higher value than external area in all of land use classes. In dense vegetation area tend to shift the temperature more than poor vegetation area

  16. Albedo and land surface temperature shift in hydrocarbon seepage potential area, case study in Miri Sarawak Malaysia

    Science.gov (United States)

    Suherman, A.; Rahman, M. Z. A.; Busu, I.

    2014-02-01

    The presence of hydrocarbon seepage is generally associated with rock or mineral alteration product exposures, and changes of soil properties which manifest with bare development and stress vegetation. This alters the surface thermodynamic properties, changes the energy balance related to the surface reflection, absorption and emission, and leads to shift in albedo and LST. Those phenomena may provide a guide for seepage detection which can be recognized inexpensively by remote sensing method. District of Miri is used for study area. Available topographic maps of Miri and LANDSAT ETM+ were used for boundary construction and determination albedo and LST. Three land use classification methods, namely fixed, supervised and NDVI base classifications were employed for this study. By the intensive land use classification and corresponding statistical comparison was found a clearly shift on albedo and land surface temperature between internal and external seepage potential area. The shift shows a regular pattern related to vegetation density or NDVI value. In the low vegetation density or low NDVI value, albedo of internal area turned to lower value than external area. Conversely in the high vegetation density or high NDVI value, albedo of internal area turned to higher value than external area. Land surface temperature of internal seepage potential was generally shifted to higher value than external area in all of land use classes. In dense vegetation area tend to shift the temperature more than poor vegetation area.

  17. n-Alkylamine-assisted preparation of a high surface area vanadyl phosphate/tetraethylorthosilicate nanocomposite

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, João Paulo L., E-mail: billbrujah@yahoo.com.br [Departamento de Química, Faculdade de Filosofia, Ciências e Letras de Ribeirão Preto, Universidade de São Paulo, Av. Bandeirantes 3900, Ribeirão Preto, SP 14040-901 (Brazil); Zampronio, Elaine C.; Oliveira, Herenilton P. [Departamento de Química, Faculdade de Filosofia, Ciências e Letras de Ribeirão Preto, Universidade de São Paulo, Av. Bandeirantes 3900, Ribeirão Preto, SP 14040-901 (Brazil)

    2013-02-15

    Graphical abstract: CuK{sub α} X-ray diffraction patterns of the VP, VPOc, VPOcT, VPOcT200 and VPOcT500. Highlights: ► TEOS and octylamine incorporation into the VP was achieved by expanding the lamellar. ► The specific surface area increased from 15 m{sup 2} g{sup −1} in VP to 237 m{sup 2} g{sup −1} in VPOcT. ► The VPOcT exhibited thermal resistance up to 200 °C in air. ► Upon thermal treatment up to 500 °C, the surface area increased to 838 m{sup 2} g{sup −1}. -- Abstract: We have developed a vanadyl phosphate/tetraethylorthosilicate (VPO/TEOS) nanocomposite comprised of silicate chains interleaved with VPO layers, prepared by using an n-alkylamines such as octylamine as the structure directing agent. The nanocomposites were synthesized by reacting amine-intercalated vanadyl phosphate with tetraethylorthosilicate via the soft chemistry approach. The synthetic procedure encompassed the exfoliation of the layered vanadyl phosphate as well as the reorganization of this exfoliated solid into a mesostructured lamellar phase with the same V–P–O connectivity as in the original matrix. TEOS incorporation into the vanadyl phosphate was achieved by expanding the lamellar structure with n-alkylamine (Δd = 13 Å with n-octylamine). The specific surface area increased from 15 m{sup 2} g{sup −1} in the vanadyl phosphate matrix to 237 m{sup 2} g{sup −1} in VPOcT, and the isotherm curves revealed the characteristic hysteresis of mesoporous materials. Upon thermal treatment up to 500 °C, the surface area increased to 837 m{sup 2} g{sup −1}, which is suitable for catalytic purposes.

  18. [Distribution, surface and protected area of palm-swamps in Costa Rica and Nicaragua].

    Science.gov (United States)

    Serrano-Sandí, Juan; Bonilla-Murillo, Fabian; Sasa, Mahmood

    2013-09-01

    In Central America, palm swamps are known collectively as yolillales. These wetlands are usually dominated by the raffia palm Raphia taedigera, but also by the royal palm Manicaria saccifera and -in lower extensions- by the American oil palm Elaeis oleifera. The yolillales tend to be poor in woody species and are characteristic of regions with high rainfall and extensive hydroperiods, so they remain flooded most of the year. The dominance of large raffia palm leaves in the canopy, allow these environments to be distinguishable in aerial photographs, which consequently has helped to map them along most of their distribution. However, while maps depicting yolillales are available, the extent of their surface area, perimeter and connectivity remains poorly understood. This is particularly true for yolillales in Costa Rica and Nicaragua, countries that share a good proportion of palm dominated swaps in the Rio San Juan Basin. In addition, it is not known the actual area of these environments that is under any category of protection according to the conservation systems of both countries. As a first step to catalog yolillal wetlands in Costa Rica and Nicaragua, this paper evaluates cartographic maps to delineate yolillales in the region. A subsample of yolillales mapped in this study were visited and we geo-referenced them and evaluate the extent and condition of the swamp. A total of 110 883.2ha are classified as yolillales in Nicaragua, equivalent to 22% of wetland surface area recorded for that country (excluding the Cocibolca and Xolothn Lakes). In Costa Rica, 53 931.3ha are covered by these palm dominated swamps, which represent 16.24% of the total surface area covered by wetlands. About 47% of the area covered by yolillales in Nicaragua is under some category of protection, the largest extensions protected by Cerro Silva, Laguna Tale Sulumas and Indio Maiz Nature Reserves. In Costa Rica, 55.5% of the area covered by yolillal is located within protected areas

  19. Developing Open-Ended Questions for Surface Area and Volume of Beam

    Science.gov (United States)

    Kurniawan, Henry; Putri, Ratu Ilma Indra; Hartono, Yusuf

    2018-01-01

    The purpose of this research was to show open-ended questions about surface area and beam volume which valid and practice, have potential effect. This research is research development which consists of two main phases: preliminary phase (preparation phase and problem design) and formative evaluation phase (evaluation and revision phases). The…

  20. Vegetation Coverage and Impervious Surface Area Estimated Based on the Estarfm Model and Remote Sensing Monitoring

    Science.gov (United States)

    Hu, Rongming; Wang, Shu; Guo, Jiao; Guo, Liankun

    2018-04-01

    Impervious surface area and vegetation coverage are important biophysical indicators of urban surface features which can be derived from medium-resolution images. However, remote sensing data obtained by a single sensor are easily affected by many factors such as weather conditions, and the spatial and temporal resolution can not meet the needs for soil erosion estimation. Therefore, the integrated multi-source remote sensing data are needed to carry out high spatio-temporal resolution vegetation coverage estimation. Two spatial and temporal vegetation coverage data and impervious data were obtained from MODIS and Landsat 8 remote sensing images. Based on the Enhanced Spatial and Temporal Adaptive Reflectance Fusion Model (ESTARFM), the vegetation coverage data of two scales were fused and the data of vegetation coverage fusion (ESTARFM FVC) and impervious layer with high spatiotemporal resolution (30 m, 8 day) were obtained. On this basis, the spatial variability of the seepage-free surface and the vegetation cover landscape in the study area was measured by means of statistics and spatial autocorrelation analysis. The results showed that: 1) ESTARFM FVC and impermeable surface have higher accuracy and can characterize the characteristics of the biophysical components covered by the earth's surface; 2) The average impervious surface proportion and the spatial configuration of each area are different, which are affected by natural conditions and urbanization. In the urban area of Xi'an, which has typical characteristics of spontaneous urbanization, landscapes are fragmented and have less spatial dependence.

  1. VEGETATION COVERAGE AND IMPERVIOUS SURFACE AREA ESTIMATED BASED ON THE ESTARFM MODEL AND REMOTE SENSING MONITORING

    Directory of Open Access Journals (Sweden)

    R. Hu

    2018-04-01

    Full Text Available Impervious surface area and vegetation coverage are important biophysical indicators of urban surface features which can be derived from medium-resolution images. However, remote sensing data obtained by a single sensor are easily affected by many factors such as weather conditions, and the spatial and temporal resolution can not meet the needs for soil erosion estimation. Therefore, the integrated multi-source remote sensing data are needed to carry out high spatio-temporal resolution vegetation coverage estimation. Two spatial and temporal vegetation coverage data and impervious data were obtained from MODIS and Landsat 8 remote sensing images. Based on the Enhanced Spatial and Temporal Adaptive Reflectance Fusion Model (ESTARFM, the vegetation coverage data of two scales were fused and the data of vegetation coverage fusion (ESTARFM FVC and impervious layer with high spatiotemporal resolution (30 m, 8 day were obtained. On this basis, the spatial variability of the seepage-free surface and the vegetation cover landscape in the study area was measured by means of statistics and spatial autocorrelation analysis. The results showed that: 1 ESTARFM FVC and impermeable surface have higher accuracy and can characterize the characteristics of the biophysical components covered by the earth's surface; 2 The average impervious surface proportion and the spatial configuration of each area are different, which are affected by natural conditions and urbanization. In the urban area of Xi'an, which has typical characteristics of spontaneous urbanization, landscapes are fragmented and have less spatial dependence.

  2. Urban surface energy fluxes based on remotely-sensed data and micrometeorological measurements over the Kansai area, Japan

    Science.gov (United States)

    Sukeyasu, T.; Ueyama, M.; Ando, T.; Kosugi, Y.; Kominami, Y.

    2017-12-01

    The urban heat island is associated with land cover changes and increases in anthropogenic heat fluxes. Clear understanding of the surface energy budget at urban area is the most important for evaluating the urban heat island. In this study, we develop a model based on remotely-sensed data for the Kansai area in Japan and clarify temporal transitions and spatial distributions of the surface energy flux from 2000 to 2016. The model calculated the surface energy fluxes based on various satellite and GIS products. The model used land surface temperature, surface emissivity, air temperature, albedo, downward shortwave radiation and land cover/use type from the moderate resolution imaging spectroradiometer (MODIS) under cloud free skies from 2000 to 2016 over the Kansai area in Japan (34 to 35 ° N, 135 to 136 ° E). Net radiation was estimated by a radiation budget of upward/downward shortwave and longwave radiation. Sensible heat flux was estimated by a bulk aerodynamic method. Anthropogenic heat flux was estimated by the inventory data. Latent heat flux was examined with residues of the energy budget and parameterization of bulk transfer coefficients. We validated the model using observed fluxes from five eddy-covariance measurement sites: three urban sites and two forested sites. The estimated net radiation roughly agreed with the observations, but the sensible heat flux were underestimated. Based on the modeled spatial distributions of the fluxes, the daytime net radiation in the forested area was larger than those in the urban area, owing to higher albedo and land surface temperatures in the urban area than the forested area. The estimated anthropogenic heat flux was high in the summer and winter periods due to increases in energy-requirements.

  3. Dependence of the specific surface area of the nuclear fuel with the matrix oxidation

    International Nuclear Information System (INIS)

    Gomez, F.; Quinones, J.; Iglesias, E.; Rodriguez, N.

    2008-01-01

    This paper is focused on the study of the changes in the specific surface area measured using BET techniques. The objective is to obtain a relation between this parameter and the change in the matrix stoichiometry (i.e., oxidation increase). None of the actual models used for extrapolating the behaviour of the spent fuel matrix under repository conditions have included this dependence yet. In this work the specific surface area of different uranium oxide were measured using N 2 (g) and Kr(g). The starting material was UO 2+x (s) with a size powder distribution lower than 20 μm. The results included in this paper shown a strong dependence on specific surface area with the matrix stoichiometry, i.e., and increase of more than one order of magnitude (SUO 2 = 6 m 2 *g -1 and SU 3 O 8 = 16.07 m 2 *g -1 ). Furthermore, the particle size distribution measured as a function of the thermal treatment done shows changes on the powder size related to the changes observed in the uranium oxide stoichiometry. (authors)

  4. Interaction between surface water areas and groundwater in Hanoi city, Viet Nam

    Science.gov (United States)

    Hayashi, T.; Kuroda, K.; Do Thuan, A.; Tran Thi Viet, N.; Takizawa, S.

    2012-12-01

    Hanoi is the capital of Viet Nam and the second largest city in this country (population: 6.45 million in 2009). Hanoi city has developed along the Red River and has many lakes, ponds and canals. However, recent rapid urbanization of this city has reduced number of natural water areas such as ponds and lakes by reclamation not only in the central area but the suburban area. Canals also have been reclaimed or cut into pieces. Contrary, number of artificial water areas such as fish cultivation pond has rapidly increased. On the other hand, various kind of waste water flows into these natural and artificial water areas and induces pollution and eutrophication. These waste waters also have possibility of pollution of groundwater that is one of major water resources in this city. In addition, groundwater in this area has high concentrations of Arsenic, Fe and NH4. Thus, groundwater use may causes re-circulation of Arsenic. However, studies on the interaction between surface water areas and groundwater and on the role of surface water areas for solute transport with water cycle are a few. Therefore, we focused on these points and took water samples of river, pond and groundwater from four communities in suburban areas: two communities are located near the Red River and other two are far from the River. Also, columnar sediment samples of these ponds were taken and pore water was abstracted. Major dissolved ions, metals and stable isotopes of oxygen and hydrogen of water samples were analyzed. As for water cycle, from the correlation between δ18O and δD, the Red River water (after GNIR) were distributed along the LMWL (δD=8.2δ18O+14.1, calculated from precipitation (after GNIP)). On the other hand, although the pond waters in rainy season were distributed along the LMWL, that in dry season were distributed along the local evaporation line (LEL, slope=5.6). The LEL crossed with the LMWL at around the point of weighted mean values of precipitation in rainy season and of

  5. Simulating polarized light scattering in terrestrial snow based on bicontinuous random medium and Monte Carlo ray tracing

    International Nuclear Information System (INIS)

    Xiong, Chuan; Shi, Jiancheng

    2014-01-01

    To date, the light scattering models of snow consider very little about the real snow microstructures. The ideal spherical or other single shaped particle assumptions in previous snow light scattering models can cause error in light scattering modeling of snow and further cause errors in remote sensing inversion algorithms. This paper tries to build up a snow polarized reflectance model based on bicontinuous medium, with which the real snow microstructure is considered. The accurate specific surface area of bicontinuous medium can be analytically derived. The polarized Monte Carlo ray tracing technique is applied to the computer generated bicontinuous medium. With proper algorithms, the snow surface albedo, bidirectional reflectance distribution function (BRDF) and polarized BRDF can be simulated. The validation of model predicted spectral albedo and bidirectional reflectance factor (BRF) using experiment data shows good results. The relationship between snow surface albedo and snow specific surface area (SSA) were predicted, and this relationship can be used for future improvement of snow specific surface area (SSA) inversion algorithms. The model predicted polarized reflectance is validated and proved accurate, which can be further applied in polarized remote sensing. -- Highlights: • Bicontinuous random medium were used for real snow microstructure modeling. • Photon tracing technique with polarization status tracking ability was applied. • SSA–albedo relationship of snow is close to that of sphere based medium. • Validation of albedo and BRDF showed good results. • Validation of polarized reflectance showed good agreement with experiment data

  6. Characterization of chemical composition, surface area pore, and thermal properties of zeolites from Bayah, Tasikmalaya, and Lampung

    International Nuclear Information System (INIS)

    Ginting, Aslina Br.; Dian Anggraini; Sutri Indaryati; Rosika Kriswarini

    2007-01-01

    Characterization of chemical composition, surface area, pore radius, adsorption, and thermal properties of zeolites from Bayah, Tasikmalaya, and Lampung have been performed. The purpose of the characterization is to understand the characteristics of the three zeolites since different types of zeolite will yield different chemical composition, surface area, pore radius, and adsorption. The analysis shows that zeolites from Bayah, Tasikmalaya, and Lampung consist of chemical elements Al, Si, P, K, Ca, Ti, Fe, and S. The analysis of the surface area indicates that zeolite from Lampung has surface area of 10.0477 m 2 , pore radius of 16.0653 Å, and adsorption of 24.500 ml/g, which are greater than those of zeolite from Tasikmalaya with surface area of 6.3319 m2, pore radius of 16.2350 Å, adsorption of 13.2500 ml/g, zeolite from Bayah with surface area of 8.3528 m2, pore radius of 16.2350 Å, and adsorption of 13.250 ml/g. From of the thermal properties characterization it is shown the three zeolites experienced weight reduction from 5.93% to 8.33%, which results in the formation of new phases as indicated by endothermic reactions from 150 °C to 600 °C and from 850 °C to 1000 °C. The three zeolites experienced a decrease in heat capacity up to temperature of 199.96 °C, whereas at temperatures above 216.66 °C the zeolites experienced an increase in heat capacity up to 437.78 °C. The results of the characterization indicate that different types of zeolite do not yield significant difference in chemical composition and thermal characteristics as proven with F test, however different surface area, pore radius, and adsorption characteristics are observed. The characterization results are expected to be the first step in determining the characteristics of the three zeolites that are to be used for cesium ion exchange in the incoming research. (author)

  7. High surface area microporous activated carbons prepared from Fox nut (Euryale ferox) shell by zinc chloride activation

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Arvind; Mohan Jena, Hara, E-mail: hmjena@nitrkl.ac.in

    2015-11-30

    Graphical abstract: - Highlights: • Activated carbons have been prepared from Fox nutshell with chemical activation using ZnCl{sub 2}. • The thermal behavior of the raw material and impregnated raw material has been carried out by thermogravimetric analysis. • The characterizations of the prepared activated carbons have been determined by nitrogen adsorption–desorption isotherms, FTIR, XRD, and FESEM. • The BET surface area and total pore volume of prepared activated carbon has been obtained as 2869 m{sup 2}/g, 2124 m{sup 2}/g, and 1.96 cm{sup 3}/g, respectively. • The microporous surface area, micropore volume, and microporosity percentage of prepared activated carbon has been obtained as 2124 m{sup 2}/g, 1.68 cm{sup 3}/g, and 85.71%, respectively. - Abstract: High surface area microporous activated carbon has been prepared from Fox nutshell (Euryale ferox) by chemical activation with ZnCl{sub 2} as an activator. The process has been conducted at different impregnation (ZnCl{sub 2}/Fox nutshell) ratios (1–2.5) and carbonization temperatures (500–700 °C). The thermal decomposition behavior of Fox nutshell and impregnated Fox nutshell has been carried out by thermogravimetric analysis. The pore properties including the BET surface area, micropore surface area, micropore volume, and pore size distribution of the activated carbons have been determined by nitrogen adsorption–desorption isotherms at −196 °C using the BET, t-plot method, DR, and BJH methods. The BET surface area, the microporous surface area, total pore volume, and micropore volume have been obtained as 2869 m{sup 2}/g, 2124 m{sup 2}/g, 1.96 cm{sup 3}/g, and 1.68 cm{sup 3}/g, respectively, and the microporosity percentage of the prepared activated carbon is 85.71%. The prepared activated carbons have been also characterized with instrumental methods such as Fourier transform infrared spectroscopy (FTIR), X-ray diffraction (XRD), and field emission scanning electron microscopy (FESEM).

  8. High surface area microporous activated carbons prepared from Fox nut (Euryale ferox) shell by zinc chloride activation

    International Nuclear Information System (INIS)

    Kumar, Arvind; Mohan Jena, Hara

    2015-01-01

    Graphical abstract: - Highlights: • Activated carbons have been prepared from Fox nutshell with chemical activation using ZnCl 2 . • The thermal behavior of the raw material and impregnated raw material has been carried out by thermogravimetric analysis. • The characterizations of the prepared activated carbons have been determined by nitrogen adsorption–desorption isotherms, FTIR, XRD, and FESEM. • The BET surface area and total pore volume of prepared activated carbon has been obtained as 2869 m 2 /g, 2124 m 2 /g, and 1.96 cm 3 /g, respectively. • The microporous surface area, micropore volume, and microporosity percentage of prepared activated carbon has been obtained as 2124 m 2 /g, 1.68 cm 3 /g, and 85.71%, respectively. - Abstract: High surface area microporous activated carbon has been prepared from Fox nutshell (Euryale ferox) by chemical activation with ZnCl 2 as an activator. The process has been conducted at different impregnation (ZnCl 2 /Fox nutshell) ratios (1–2.5) and carbonization temperatures (500–700 °C). The thermal decomposition behavior of Fox nutshell and impregnated Fox nutshell has been carried out by thermogravimetric analysis. The pore properties including the BET surface area, micropore surface area, micropore volume, and pore size distribution of the activated carbons have been determined by nitrogen adsorption–desorption isotherms at −196 °C using the BET, t-plot method, DR, and BJH methods. The BET surface area, the microporous surface area, total pore volume, and micropore volume have been obtained as 2869 m 2 /g, 2124 m 2 /g, 1.96 cm 3 /g, and 1.68 cm 3 /g, respectively, and the microporosity percentage of the prepared activated carbon is 85.71%. The prepared activated carbons have been also characterized with instrumental methods such as Fourier transform infrared spectroscopy (FTIR), X-ray diffraction (XRD), and field emission scanning electron microscopy (FESEM).

  9. Greenland surface mass-balance observations from the ice-sheet ablation area and local glaciers

    NARCIS (Netherlands)

    Machguth, Horst; Thomsen, Henrik H.; Weidick, Anker; Ahlstrøm, Andreas P.; Abermann, Jakob; Andersen, Morten L.; Andersen, Signe B.; Bjørk, Anders A.; Box, Jason E.; Braithwaite, Roger J.; Bøggild, Carl E.; Citterio, Michele; Clement, Poul; Colgan, William; Fausto, Robert S.; Gleie, Karin; Gubler, Stefanie; Hasholt, Bent; Hynek, Bernhard; Knudsen, Niels T.; Larsen, Signe H.; Mernild, Sebastian H.; Oerlemans, Johannes; Oerter, Hans; Olesen, Ole B.; Smeets, C. J P Paul; Steffen, Konrad; Stober, Manfred; Sugiyama, Shin; Van As, Dirk; Van Den Broeke, Michiel R.; Van De Wal, Roderik S W

    2016-01-01

    Glacier surface mass-balance measurements on Greenland started more than a century ago, but no compilation exists of the observations from the ablation area of the ice sheet and local glaciers. Such data could be used in the evaluation of modelled surface mass balance, or to document changes in

  10. Stellar parameters for the central star of the planetary nebula PRTM 1 using the German Astrophysical Virtual Observatory service TheoSSA

    Science.gov (United States)

    Rauch, T.; Demleitner, M.; Hoyer, D.; Werner, K.

    2018-04-01

    The German Astrophysical Virtual Observatory (GAVO) developed the registered service TheoSSA (theoretical stellar spectra access) and the supporting registered VO tool TMAW (Tübingen Model-Atmosphere WWW interface). These allow individual spectral analyses of hot, compact stars with state-of-the-art non-local thermodynamical equilibrium (NLTE) stellar-atmosphere models that presently consider opacities of the elements H, He, C, N, O, Ne, Na, and Mg, without requiring detailed knowledge about the involved background codes and procedures. Presently, TheoSSA provides easy access to about 150 000 pre-calculated stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code. In the case of the exciting star of PN PRTM 1, we demonstrate the easy way to calculate individual NLTE stellar model-atmospheres to reproduce an observed optical spectrum. We measured T_eff = 98 000± 5 000 K, log (g / cm/s^2) = 5.0^{+0.3}_{-0.2}, and photospheric mass fractions of H =7.5 × 10-1 (1.02 times solar), He =2.4 × 10-1 (0.96), C =2.0 × 10-3 (0.84), N =3.2 × 10-4 (0.46), and O =8.5 × 10-3 (1.48) with uncertainties of ±0.2 dex. We determined the stellar mass and luminosity of 0.73^{+0.16}_{-0.15} M_{⊙} and log (L/L⊙) = 4.2 ± 0.4, respectively.

  11. Microbiology of the surface water samples in the high background radiation areas of Ramsar, Iran

    International Nuclear Information System (INIS)

    Motamedifar, Mohammad; Zamani, Khosrow; Sedigh, Hadi; Mortazavi, Seyed Mohammad Javad; Taeb, Shahram; Haghani, M.; Mortazavi, Seyed Ali Reza; Soofi, Amir

    2014-01-01

    Residents of high background radiation areas of Ramsar have lived in these areas for many generations and received radiation doses much higher than the dose limit recommended by ICRP for radiation workers. The radioactivity of the high background radiation areas of Ramsar is reported to be due to 226 Ra and its decay products, which have been brought to the surface by the waters of hot springs. Over the past years the department has focused on different aspects of the health effects of the elevated levels of natural radiation in Ramsar. This study was aimed to perform a preliminary investigation on the bioeffects of exposure to elevated levels of natural radiation on the microbiology of surface water samples. Water samples were collected from surface water streams in Talesh Mahalleh district, Ramsar as well as a nearby area with normal levels of background radiation. Only two strains of bacteria, that is, Providencia stuartii and Shimwellia blattae, could be isolated from the water samples collected from high background radiation areas, while seven strains (Escherichia coli, Enterobacter asburiae, Klebsiella pneumoniae, Shigella dysenteriae, Buttiauxella agerstis, Tatumella punctuata and Raoultella ornithinolytica) were isolated from the water samples collected from normal background radiation areas. All the bacteria isolated from water samples of high and normal background radiation areas were sensitive to ultraviolet radiation, heat, betadine, alcohol, and deconex. Although other investigators have reported that bacteria isolated from hot springs show radioresistance, the results reported here do not reveal any adaptive response. (author)

  12. Turbostratic boron nitride coated on high-surface area metal oxide templates

    DEFF Research Database (Denmark)

    Klitgaard, Søren Kegnæs; Egeblad, Kresten; Brorson, M.

    2007-01-01

    Boron nitride coatings on high-surface area MgAl2O4 and Al2O3 have been synthesized and characterized by transmission electron microscopy and by X-ray powder diffraction. The metal oxide templates were coated with boron nitride using a simple nitridation in a flow of ammonia starting from ammonium...

  13. Surface activity of lipid extract surfactant in relation to film area compression and collapse.

    Science.gov (United States)

    Schürch, S; Schürch, D; Curstedt, T; Robertson, B

    1994-08-01

    The physical properties of modified porcine surfactant (Curosurf), isolated from minced lungs by extraction with chloroform-methanol and further purified by liquid-gel chromatography, were investigated with the captive bubble technique. Bubble size, and thus the surface tension of an insoluble film at the bubble surface, is altered by changing the pressure within the closed bubble chamber. The film surface tension and area are determined from the shape (height and diameter) of the bubble. Adsorption of fresh Curosurf is characterized by stepwise decreases in surface tension, which can easily be observed by sudden quick movements of the bubble apex. These "adsorption clicks" imply a cooperative movement of large collective units of molecules, approximately 10(14) (corresponding to approximately 120 ng of phospholipid) or approximately 10(18) molecules/m2, into the interface during adsorption. Films formed in this manner are already highly enriched in dipalmitoyl phosphatidylcholine, as seen by the extremely low compressibility, close to that of dipalmitoyl phosphatidylcholine. Near-zero minimum tensions are obtained, even at phospholipid concentrations as low as 50 micrograms/ml. During dynamic cycling (20-50 cycles/min), low minimum surface tensions, good film stability, low compressibility, and maximum surface tensions between 30 and 40 mN/m are possible only if the films are not overcompressed near zero surface tension; i.e., the overall film area compression should not substantially exceed 30%.

  14. Greenland surface mass-balance observations from the ice-sheet ablation area and local glaciers

    DEFF Research Database (Denmark)

    Machguth, Horst; Thomsen, Henrik H.; Weidick, Anker

    2016-01-01

    Glacier surface mass-balance measurements on Greenland started more than a century ago, but no compilation exists of the observations from the ablation area of the ice sheet and local glaciers. Such data could be used in the evaluation of modelled surface mass balance, or to document changes in g...

  15. Extent of Stream Burial and Relationships to Watershed Area, Topography, and Impervious Surface Area

    Directory of Open Access Journals (Sweden)

    Roy E. Weitzell

    2016-11-01

    Full Text Available Stream burial—the routing of streams through culverts, pipes, and concrete lined channels, or simply paving them over—is common during urbanization, and disproportionately affects small, headwater streams. Burial undermines the physical and chemical processes governing life in streams, with consequences for water quality and quantity that may amplify from headwaters to downstream receiving waters. Knowledge of the extent of stream burial is critical for understanding cumulative impacts to stream networks, and for future decision-making allowing for urban development while protecting ecosystem function. We predicted stream burial across the urbanizing Potomac River Basin (USA for each 10-m stream segment in the basin from medium-resolution impervious cover data and training observations obtained from high-resolution aerial photography in a GIS. Results were analyzed across a range in spatial aggregation, including counties and independent cities, small watersheds, and regular spatial grids. Stream burial was generally correlated with total impervious surface area (ISA, with areas exhibiting ISA above 30% often subject to elevated ratios of stream burial. Recurring patterns in burial predictions related to catchment area and topographic slope were also detected. We discuss these results in the context of physiographic constraints on stream location and urban development, including implications for environmental management of aquatic resources.

  16. Interfacial Interaction in Anodic Aluminum Oxide Templates Modifies Morphology, Surface Area, and Crystallization of Polyamide-6 Nanofibers.

    Science.gov (United States)

    Xue, Junhui; Xu, Yizhuang; Jin, Zhaoxia

    2016-03-08

    Here, we demonstrated that, when the precipitation process of polyamide-6 (PA6) solution happens in cylindrical channels of an anodized aluminum oxide membrane (AAO), interface interactions between a solid surface, solvent, non-solvent, and PA6 will influence the obtained polymer nanostructures, resulting in complex morphologies, increased surface area, and crystallization changes. With the enhancing interaction of PA6 and the AAO surface, the morphology of PA6 nanostructures changes from solid nanofibers, mesoporous, to bamboo-like, while at the same time, metastable γ-phase domains increase in these PA6 nanostructures. Brunauer-Emmett-Teller (BET) surface areas of solid, bamboo-like, and mesoporous PA6 nanofibers rise from 16, 20.9, to 25 m(2)/g. This study shows that interfacial interaction in AAO template fabrication can be used in manipulating the morphology and crystallization of one-dimensional polymer nanostructures. It also provides us a simple and novel method to create porous PA6 nanofibers with a large surface area.

  17. Synthesis of partially graphitic ordered mesoporous carbons with high surface areas

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Wenjun; Wan, Ying [Department of Chemistry, Key Laboratory of Resource Chemistry of Ministry of Education, Shanghai Normal University, Shanghai 200234 (China); Dou, Yuqian; Zhao, Dongyuan [Department of Chemistry, Shanghai Key Laboratory of Molecular Catalysis and Innovative Materials, Fudan University, Shanghai 200433 (China)

    2011-01-01

    Graphitic carbons with ordered mesostructure and high surface areas (of great interest in applications such as energy storage) have been synthesized by a direct triblock-copolymer-templating method. Pluronic F127 is used as a structure-directing agent, with a low-molecular-weight phenolic resol as a carbon source, ferric oxide as a catalyst, and silica as an additive. Inorganic oxides can be completely eliminated from the carbon. Small-angle XRD and N{sub 2} sorption analysis show that the resultant carbon materials possess an ordered 2D hexagonal mesostructure, uniform bimodal mesopores (about 1.5 and 6 nm), high surface area ({proportional_to}1300 m{sup 2}/g), and large pore volumes ({proportional_to}1.50 cm{sup 3}/g) after low-temperature pyrolysis (900 C). All surface areas come from mesopores. Wide-angle XRD patterns demonstrate that the presence of the ferric oxide catalyst and the silica additive lead to a marked enhancement of graphitic ordering in the framework. Raman spectra provide evidence of the increased content of graphitic sp{sup 2} carbon structures. Transmission electron microscopy images confirm that numerous domains in the ordered mesostructures are composed of characteristic graphitic carbon nanostructures. The evolution of the graphitic structure is dependent on the temperature and the concentrations of the silica additive, and ferric oxide catalyst. Electrochemical measurements performed on this graphitic mesoporous carbon when used as an electrode material for an electrochemical double layer capacitor shows rectangular-shaped cyclic voltammetry curves over a wide range of scan rates, even up to 200 mV/s, with a large capacitance of 155 F/g in KOH electrolyte. This method can be widely applied to the synthesis of graphitized carbon nanostructures. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  18. The Genetic Association Between Neocortical Volume and General Cognitive Ability Is Driven by Global Surface Area Rather Than Thickness.

    Science.gov (United States)

    Vuoksimaa, Eero; Panizzon, Matthew S; Chen, Chi-Hua; Fiecas, Mark; Eyler, Lisa T; Fennema-Notestine, Christine; Hagler, Donald J; Fischl, Bruce; Franz, Carol E; Jak, Amy; Lyons, Michael J; Neale, Michael C; Rinker, Daniel A; Thompson, Wesley K; Tsuang, Ming T; Dale, Anders M; Kremen, William S

    2015-08-01

    Total gray matter volume is associated with general cognitive ability (GCA), an association mediated by genetic factors. It is expectable that total neocortical volume should be similarly associated with GCA. Neocortical volume is the product of thickness and surface area, but global thickness and surface area are unrelated phenotypically and genetically in humans. The nature of the genetic association between GCA and either of these 2 cortical dimensions has not been examined. Humans possess greater cognitive capacity than other species, and surface area increases appear to be the primary driver of the increased size of the human cortex. Thus, we expected neocortical surface area to be more strongly associated with cognition than thickness. Using multivariate genetic analysis in 515 middle-aged twins, we demonstrated that both the phenotypic and genetic associations between neocortical volume and GCA are driven primarily by surface area rather than thickness. Results were generally similar for each of 4 specific cognitive abilities that comprised the GCA measure. Our results suggest that emphasis on neocortical surface area, rather than thickness, could be more fruitful for elucidating neocortical-GCA associations and identifying specific genes underlying those associations. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  19. Preparation of high surface area and high conductivity polyaniline nanoparticles using chemical oxidation polymerization technique

    Science.gov (United States)

    Budi, S.; Yusmaniar; Juliana, A.; Cahyana, U.; Purwanto, A.; Imaduddin, A.; Handoko, E.

    2018-03-01

    In this work, polyaniline nanoparticles were synthesized using a chemical oxidation polymerization technique. The ammonium peroxydisulfate (APS)/aniline ratio, APS dropping time, and polymerization temperature were optimized to increase the surface area and conductivity of the polyaniline.The Fourier-transform infrared (FTIR) spectrum confirmed the formation of emeraldine salt polyaniline. X-ray diffraction (XRD) patterns indicated that amorphous and crystalline phases of the polyaniline were formed with crystallinity less than 40%. Scanning electron microscope (SEM) micrographs showed that the finest nanoparticles with uniform size distribution were obtained at the polymerization temperature of 0°C. A surface area analyzer (SAA) showed that the highest Brunauer-Emmett-Teller surface area (SBET ) of 42.14 m2/gwas obtained from an APS/aniline ratio of 0.75 with a dropping time of 0 s at a polymerization temperature of 0°C. A four-point probe measurement conducted at 75–300K indicated relatively high conductivity of the semiconductor characteristic of the polyaniline.

  20. Contribution to the study of techniques of measurement of interface surface area in bubble flows

    International Nuclear Information System (INIS)

    Veteau, Jean-Michel

    1981-01-01

    This research thesis addresses problems raised by the measurement of the interface area per volume unit in duct bubble flows. The author first reports a literature survey of existing methods (photographic, chemical and optical methods) which give access to the value of the parameter which is commonly named 'specific surface area'. He analyses under which conditions these methods lead to a rigorous determination of the SVIM (mean integral volume surface). The author highlights the theoretical contributions of models related to each of these methods which are indeed global methods as they allow the interface surface area to be directly obtained in a given volume of a two-phase mixture. Then, the author reports the development of an original technique based on the use of phase detecting local probes. In the next part, the author compares photographic and optical methods, on the one hand, and optical and local methods, on the other hand. Recommendations are made for the development of local methods [fr

  1. High sensitivity, high surface area Enzyme-linked Immunosorbent Assay (ELISA).

    Science.gov (United States)

    Singh, Harpal; Morita, Takahiro; Suzuki, Yuma; Shimojima, Masayuki; Le Van, An; Sugamata, Masami; Yang, Ming

    2015-01-01

    Enzyme-linked immunosorbent assays (ELISA) are considered the gold standard in the demonstration of various immunological reactions with an application in the detection of infectious diseases such as during outbreaks or in patient care. This study aimed to produce an ELISA-based diagnostic with an increased sensitivity of detection compared to the standard 96-well method in the immunologic diagnosis of infectious diseases. A '3DStack' was developed using readily available, low cost fabrication technologies namely nanoimprinting and press stamping with an increased surface area of 4 to 6 times more compared to 96-well plates. This was achieved by stacking multiple nanoimprinted polymer sheets. The flow of analytes between the sheets was enhanced by rotating the 3DStack and confirmed by Finite-Element (FE) simulation. An Immunoglobulin G (IgG) ELISA for the detection of antibodies in human serum raised against Rubella virus was performed for validation. An improved sensitivity of up to 1.9 folds higher was observed using the 3DStack compared to the standard method. The increased surface area of the 3DStack developed using nanoimprinting and press stamping technologies, and the flow pattern between sheets generated by rotating the 3DStack were potential contributors to a more sensitive ELISA-based diagnostic device.

  2. Changes in thickness and surface area of the human cortex and their relationship with intelligence.

    Science.gov (United States)

    Schnack, Hugo G; van Haren, Neeltje E M; Brouwer, Rachel M; Evans, Alan; Durston, Sarah; Boomsma, Dorret I; Kahn, René S; Hulshoff Pol, Hilleke E

    2015-06-01

    Changes in cortical thickness over time have been related to intelligence, but whether changes in cortical surface area are related to general cognitive functioning is unknown. We therefore examined the relationship between intelligence quotient (IQ) and changes in cortical thickness and surface over time in 504 healthy subjects. At 10 years of age, more intelligent children have a slightly thinner cortex than children with a lower IQ. This relationship becomes more pronounced with increasing age: with higher IQ, a faster thinning of the cortex is found over time. In the more intelligent young adults, this relationship reverses so that by the age of 42 a thicker cortex is associated with higher intelligence. In contrast, cortical surface is larger in more intelligent children at the age of 10. The cortical surface is still expanding, reaching its maximum area during adolescence. With higher IQ, cortical expansion is completed at a younger age; and once completed, surface area decreases at a higher rate. These findings suggest that intelligence may be more related to the magnitude and timing of changes in brain structure during development than to brain structure per se, and that the cortex is never completed but shows continuing intelligence-dependent development. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  3. Modification of Surface Roughness and Area of FeCrAl Substrate for Catalytic Converter using Ultrasonic Treatment

    Directory of Open Access Journals (Sweden)

    Yanuandri Putrasari

    2012-03-01

    Full Text Available Surface roughness and area play important role especially in deposition and reaction of the catalyst in the catalytic converter substrate. The aim of this paper is to show the modification of surface roughness and area of FeCrAl substrate for catalytic converter using ultrasonic method. The method was conducted by agitating the FeCrAl in 10 minutes 35 kHz ultrasonic cleaning bath. The  surface roughness, morphology, and chemical components of FeCrAl catalytic converter substrate after ultrasonic treatment were analyzed using atomic force microscope (AFM and examined with scanning electron microscope (SEM in combination with energy dispersive X-ray spectroscopy (EDS. The ultrasonic treatment assisted with Al2O3 powders successfully increased the roughness and surface area of FeCrAl better than SiC powders. 

  4. 30 CFR 717.15 - Disposal of excess rock and earth materials on surface areas.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Disposal of excess rock and earth materials on surface areas. 717.15 Section 717.15 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR INITIAL PROGRAM REGULATIONS UNDERGROUND MINING GENERAL PERFORMANCE STANDARDS § 717.15 Disposal of excess rock and...

  5. Hydrothermal Synthesis of Highly Water-dispersible Anatase Nanoparticles with Large Specific Surface Area and Their Adsorptive Properties

    Directory of Open Access Journals (Sweden)

    Hu Xueting

    2016-01-01

    Full Text Available Highly water-dispersible and very small TiO2 nanoparticles (~3 nm anatase with large specific surface area have been synthesized by hydrolysis and hydrothermal reactions of titanium butoxide and used for the removal of three azo dyes (Congo red, orange II, and methyl orange with different molecular structure from simulated wastewaters. The synthesized TiO2 nanoparticles are well dispersed in water with large specific surface area up to 417 m2 g−1. Adsorption experiments demonstrated that the water-dispersible TiO2 nanoparticles possess excellent adsorption capacities for Congo red, orange II, and methyl orange, which could be attributed to their good water-dispersibility and large specific surface area.

  6. Changes in Thickness and Surface Area of the Human Cortex and Their Relationship with Intelligence

    NARCIS (Netherlands)

    Schnack, H.G.; van Haren, N.E.M.; Brouwer, R.M.; Evans, A.; Durston, S.; Boomsma, D.I.; Kahn, R.S.; Hulshoff Pol, H.E.

    2015-01-01

    Changes in cortical thickness over time have been related to intelligence, but whether changes in cortical surface area are related to general cognitive functioning is unknown. We therefore examined the relationship between intelligence quotient (IQ) and changes in cortical thickness and surface

  7. Measuring stone surface area from a radiographic image is accurate and reproducible with the help of an imaging program.

    Science.gov (United States)

    Kurien, Abraham; Ganpule, Arvind; Muthu, V; Sabnis, R B; Desai, Mahesh

    2009-01-01

    The surface area of the stone from a radiographic image is one of the more suitable parameters defining stone bulk. The widely accepted method of measuring stone surface area is to count the number of square millimeters enclosed within a tracing of the stone outline on graph paper. This method is time consuming and cumbersome with potential for human error, especially when multiple measurements are needed. The purpose of this study was to evaluate the accuracy, efficiency, and reproducibility of a commercially available imaging program, Adobe Photoshop 7.0 for the measurement of stone surface area. The instructions to calculate area using the software are simple and easy in a Windows-based format. The accuracy of the imaging software was estimated by measuring surface areas of shapes of known mathematical areas. The efficiency and reproducibility were then evaluated from radiographs of 20 persons with radiopaque upper-tract urinary stones. The surface areas of stone images were measured using both graph paper and imaging software. Measurements were repeated after 10 days to assess the reproducibility of the techniques. The time taken to measure the area by the two methods was also assessed separately. The accuracy of the imaging software was estimated to be 98.7%. The correlation coefficient between the two methods was R(2) = 0.97. The mean percentage variation using the imaging software was 0.68%, while it was 6.36% with the graph paper. The mean time taken to measure using the image analyzer and graph paper was 1.9 +/- 0.8 minutes and 4.5 +/- 1.08 minutes, respectively (P stone surface area from radiographs compared with manual measurements using graph paper.

  8. Aggregate surface areas quantified through laser measurements for South African asphalt mixtures

    CSIR Research Space (South Africa)

    Anochie-Boateng, Joseph

    2012-02-01

    Full Text Available design. This paper introduces the use of a three-dimensional (3D) laser scanning method to directly measure the surface area of aggregates used in road pavements in South Africa. As an application of the laser-based measurements, the asphalt film...

  9. Evaluation of an atmospheric model with surface and ABL meteorological data for energy applications in structured areas

    Science.gov (United States)

    Triantafyllou, A. G.; Kalogiros, J.; Krestou, A.; Leivaditou, E.; Zoumakis, N.; Bouris, D.; Garas, S.; Konstantinidis, E.; Wang, Q.

    2018-03-01

    This paper provides the performance evaluation of the meteorological component of The Air Pollution Model (TAPM), a nestable prognostic model, in predicting meteorological variables in urban areas, for both its surface layer and atmospheric boundary layer (ABL) turbulence parameterizations. The model was modified by incorporating four urban land surface types, replacing the existing single urban surface. Control runs were carried out over the wider area of Kozani, an urban area in NW Greece. The model was evaluated for both surface and ABL meteorological variables by using measurements of near-surface and vertical profiles of wind and temperature. The data were collected by using monitoring surface stations in selected sites as well as an acoustic sounder (SOnic Detection And Ranging (SODAR), up to 300 m above ground) and a radiometer profiler (up to 600 m above ground). The results showed the model demonstrated good performance in predicting the near-surface meteorology in the Kozani region for both a winter and a summer month. In the ABL, the comparison showed that the model's forecasts generally performed well with respect to the thermal structure (temperature profiles and ABL height) but overestimated wind speed at the heights of comparison (mostly below 200 m) up to 3-4 ms-1.

  10. Description of climate, surface hydrology, and near-surface hydrogeology. Preliminary site description. Forsmark area - version 1.2

    Energy Technology Data Exchange (ETDEWEB)

    Johansson, Per-Olof [Artesia Grundvattenkonsult AB, Stockholm (Sweden); Werner, Kent [SWECO VIAK AB/Golder Associates AB, Stockholm (Sweden); Bosson, Emma; Berglund, Sten [Swedish Nuclear Fuel and Waste Management Co., Stockholm (Sweden); Juston, John [DBE Sweden, Uppsala (Sweden)

    2005-06-15

    The Swedish Nuclear Fuel and Waste Management Company (SKB) is conducting site investigations at two different locations, the Forsmark and Simpevarp areas, with the objective of siting a geological repository for spent nuclear fuel. The results from the investigations at the sites are used as a basic input to the development of Site Descriptive Models (SDM). The SDM shall summarise the current state of knowledge of the site, and provide parameters and models to be used in further analyses within Safety Assessment, Repository Design and Environmental Impact Assessment. The present report is a background report describing the meteorological conditions and the modelling of surface hydrology and near-surface hydrogeology in support of the Forsmark version 1.2 SDM based on the data available in the Forsmark 1.2 'data freeze' (July 31, 2004). The groundwater is very shallow, with groundwater levels within one meter below ground as an annual mean for almost all groundwater monitoring wells. Also, the annual groundwater level amplitude is less than 1.5 m for most wells. The shallow groundwater levels mean that there is a strong interaction between evapotranspiration, soil moisture and groundwater. In the modelling, surface water and near-surface groundwater divides are assumed to coincide. The small-scale topography implies that many local, shallow groundwater flow systems are formed in the Quaternary deposits, overlaying more large-scale flow systems associated with groundwater flows at greater depths. Groundwater level time series from wells in till and bedrock within the same areas show a considerably higher groundwater level in the till than in the bedrock. The observed differences in levels are not fully consistent with the good hydraulic contact between overburden and bedrock indicated by the hydraulic tests in the Quaternary deposits. However, the relatively lower groundwater levels in the bedrock may be caused by the horizontal to sub-horizontal highly

  11. Distributions of dissolved monosaccharides and polysaccharides in the surface microlayer and surface water of the Jiaozhou Bay and its adjacent area

    Science.gov (United States)

    Zhang, Yan-Ping; Yang, Gui-Peng; Lu, Xiao-Lan; Ding, Hai-Bing; Zhang, Hong-Hai

    2013-07-01

    Sea surface microlayer (SML) samples and corresponding bulk surface water (SW) samples were collected in the Jiaozhou Bay and its adjacent area in July and November 2008. The average concentrations of dissolved monosaccharides (MCHO) and polysaccharides (PCHO) revealed similar temporal variability, with higher concentrations during the green-tide period (in July) than during the non-green-tide period (in November). Average enrichment factors (EF) of MCHO and PCHO, defined as the ratio of the concentration in the SML to that in the SW, were 1.3 and 1.4 in July, respectively, while those values in November were 1.9 and 1.6. Our data also showed that the concentrations of MCHO and PCHO in the SML were strongly correlated with those in the SW, indicating that most of the organic materials in the SML came from the SW. The total dissolved carbohydrate concentrations (TDCHO) in the bulk surface water were closely correlated with salinity during the cruises (July: r=-0.580, n=18, P=0.01; November: r=-0.679, n=26, P<0.001), suggesting that riverine input had an important effect on the distribution of TDCHO in surface seawater of the study area.

  12. A process to enhance the specific surface area and capacitance of hydrothermally reduced graphene oxide

    KAUST Repository

    Alazmi, Amira

    2016-08-26

    The impact of post-synthesis processing in reduced graphene oxide materials for supercapacitor electrodes has been analyzed. A comparative study of vacuum, freeze and critical point drying was carried out for hydrothermally reduced graphene oxide demonstrating that the optimization of the specific surface area and preservation of the porous network are critical to maximize its supercapacitance performance. As described below, using a supercritical fluid as the drying medium, unprecedented values of the specific surface area (364 m2 g−1) and supercapacitance (441 F g−1) for this class of materials have been achieved.

  13. A process to enhance the specific surface area and capacitance of hydrothermally reduced graphene oxide

    KAUST Repository

    Alazmi, Amira; El Tall, Omar; Rasul, Shahid; Hedhili, Mohamed N.; Patole, Shashikant P.; Da Costa, Pedro M. F. J.

    2016-01-01

    The impact of post-synthesis processing in reduced graphene oxide materials for supercapacitor electrodes has been analyzed. A comparative study of vacuum, freeze and critical point drying was carried out for hydrothermally reduced graphene oxide demonstrating that the optimization of the specific surface area and preservation of the porous network are critical to maximize its supercapacitance performance. As described below, using a supercritical fluid as the drying medium, unprecedented values of the specific surface area (364 m2 g−1) and supercapacitance (441 F g−1) for this class of materials have been achieved.

  14. Estimation of the reactive mineral surface area during CO2-rich fluid-rock interaction: the influence of neogenic phases

    Science.gov (United States)

    Scislewski, A.; Zuddas, P.

    2010-12-01

    Mineral dissolution and precipitation reactions actively participate to control fluid chemistry during water-rock interaction. It is however, difficult to estimate and well normalize bulk reaction rates if the mineral surface area exposed to the aqueous solution and effectively participating on the reactions is unknown. We evaluated the changing of the reactive mineral surface area during the interaction between CO2-rich fluids and Albitite/Granitoid rocks (similar mineralogy but different abundances), reacting under flow-through conditions. Our methodology, adopting an inverse modeling approach, is based on the estimation of dissolution rate and reactive surface area of the different minerals participating in the reactions by the reconstruction the chemical evolution of the interacting fluids. The irreversible mass-transfer processes is defined by a fractional degree of advancement, while calculations were carried out for Albite, Microcline, Biotite and Calcite assuming that the ion activity of dissolved silica and aluminium ions was limited by the equilibrium with quartz and kaolinite. Irrespective of the mineral abundance in granite and albitite, we found that mineral dissolution rates did not change significantly in the investigated range of time where output solution’s pH remained in the range between 6 and 8, indicating that the observed variation in fluid composition depends not on pH but rather on the variation of the parent mineral’s reactive surface area. We found that the reactive surface area of Albite varied by more than 2 orders of magnitude, while Microcline, Calcite and Biotite surface areas changed by 1-2 orders of magnitude. We propose that parent mineral chemical heterogeneity and, particularly, the stability of secondary mineral phases may explain the observed variation of the reactive surface area of the minerals. Formation of coatings at the dissolving parent mineral surfaces significantly reduced the amount of surface available to react

  15. Evidence of micropore filling for sorption of nonpolar organic contaminants by condensed organic matter.

    Science.gov (United States)

    Ran, Yong; Yang, Yu; Xing, Baoshan; Pignatello, Joseph J; Kwon, Seokjoo; Su, Wei; Zhou, Li

    2013-01-01

    Although microporosity and surface area of natural organic matter (NOM) are crucial for mechanistic evaluation of the sorption process for nonpolar organic contaminants (NOCs), they have been underestimated by the N adsorption technique. We investigated the CO-derived internal hydrophobic microporosity () and specific surface area (SSA) obtained on dry samples and related them to sorption behaviors of NOCs in water for a wide range of condensed NOM samples. The is obtained from the total CO-derived microporosity by subtracting out the contribution of the outer surfaces of minerals and NOM using N adsorption-derived parameters. The correlation between or CO-SSA and fractional organic carbon content () is very significant, demonstrating that much of the microporosity is associated with internal NOM matrices. The average and CO-SSA are, respectively, 75.1 μL g organic carbon (OC) and 185 m g OC from the correlation analysis. The rigid aliphatic carbon significantly contributes to the microporosity of the Pahokee peat. A strong linear correlation is demonstrated between / and the OC-normalized sorption capacity at the liquid or subcooled liquid-state water solubility calculated via the Freundlich equation for each of four NOCs (phenanthrene, naphthalene, 1,3,5-trichlorobenzene, and 1,2-dichlorobenzene). We concluded that micropore filling ("adsorption") contributes to NOC sorption by condensed NOM, but the exact contribution requires knowing the relationship between the dry-state, CO-determined microporosity and the wet-state, NOC-available microporosity of the organic matter. The findings offer new clues for explaining the nonideal sorption behaviors of NOCs. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

  16. Surface and ground waters evaluation at Brazilian Multiproposed Reactor installation area

    International Nuclear Information System (INIS)

    Stellato, Thamiris B.; Silva, Tatiane B.S.C.da; Soares, Sabrina M.V.; Faustino, Mainara G.; Marques, Joyce R.; Oliveira, Cintia C. de; Monteiro, Lucilena R.; Pires, Maria A.F.; Cotrim, Marycel E.B.

    2017-01-01

    This study evaluates six surface and ground waters physicochemical characteristics on the area of the future Brazilian Multipurpose Reactor (RMB), at Iperó/SP. One of the main goals is to establish reference values for future operation monitoring programs, as well as for environmental permits and regulation. Considering analyzed parameters, all collection points presented values within CONAMA Resolution 396/08 and 357/05 regulation limits, showing similar characteristics among collection points.Only two points groundwater (RMB-005 and RMB-006) presented higher alkalinity, total dissolved solids and conductivity. The studied area was considered in good environmental conservation condition, as far as water quality is concerned. (author)

  17. Characterization of the intragranular water regime within subsurface sediments: pore volume, surface area, and mass transfer limitations

    Science.gov (United States)

    Hay, Michael B.; Stoliker, Deborah L.; Davis, James A.; Zachara, John M.

    2011-01-01

    Although "intragranular" pore space within grain aggregates, grain fractures, and mineral surface coatings may contain a relatively small fraction of the total porosity within a porous medium, it often contains a significant fraction of the reactive surface area, and can thus strongly affect the transport of sorbing solutes. In this work, we demonstrate a batch experiment procedure using tritiated water as a high-resolution diffusive tracer to characterize the intragranular pore space. The method was tested using uranium-contaminated sediments from the vadose and capillary fringe zones beneath the former 300A process ponds at the Hanford site (Washington). Sediments were contacted with tracers in artificial groundwater, followed by a replacement of bulk solution with tracer-free groundwater and the monitoring of tracer release. From these data, intragranular pore volumes were calculated and mass transfer rates were quantified using a multirate first-order mass transfer model. Tritium-hydrogen exchange on surface hydroxyls was accounted for by conducting additional tracer experiments on sediment that was vacuum dried after reaction. The complementary ("wet" and "dry") techniques allowed for the simultaneous determination of intragranular porosity and surface area using tritium. The Hanford 300A samples exhibited intragranular pore volumes of ~1% of the solid volume and intragranular surface areas of ~20%–35% of the total surface area. Analogous experiments using bromide ion as a tracer yielded very different results, suggesting very little penetration of bromide into the intragranular porosity.

  18. Thermal infrared imagery as a tool for analysing the variability of surface saturated areas at various temporal and spatial scales

    Science.gov (United States)

    Glaser, Barbara; Antonelli, Marta; Pfister, Laurent; Klaus, Julian

    2017-04-01

    Surface saturated areas are important for the on- and offset of hydrological connectivity within the hillslope-riparian-stream continuum. This is reflected in concepts such as variable contributing areas or critical source areas. However, we still lack a standardized method for areal mapping of surface saturation and for observing its spatiotemporal variability. Proof-of-concept studies in recent years have shown the potential of thermal infrared (TIR) imagery to record surface saturation dynamics at various temporal and spatial scales. Thermal infrared imagery is thus a promising alternative to conventional approaches, such as the squishy boot method or the mapping of vegetation. In this study we use TIR images to investigate the variability of surface saturated areas at different temporal and spatial scales in the forested Weierbach catchment (0.45 km2) in western Luxembourg. We took TIR images of the riparian zone with a hand-held FLIR infrared camera at fortnightly intervals over 18 months at nine different locations distributed over the catchment. Not all of the acquired images were suitable for a derivation of the surface saturated areas, as various factors influence the usability of the TIR images (e.g. temperature contrasts, shadows, fog). Nonetheless, we obtained a large number of usable images that provided a good insight into the dynamic behaviour of surface saturated areas at different scales. The images revealed how diverse the evolution of surface saturated areas can be throughout the hydrologic year. For some locations with similar morphology or topography we identified diverging saturation dynamics, while other locations with different morphology / topography showed more similar behaviour. Moreover, we were able to assess the variability of the dynamics of expansion / contraction of saturated areas within the single locations, which can help to better understand the mechanisms behind surface saturation development.

  19. Uncovering surface area and micropores in almond shell biochars by rainwater wash

    Science.gov (United States)

    Biochars have been considered for adsorption of contaminants in soil and water, as well as conditioning and improving soil quality. One important property of the biochar is surface area in the pores of the biochar. Biochars were created from almond shells from two almond varieties with different ash...

  20. Effects of acid treatment on the clay palygorskite: XRD, surface area, morphological and chemical composition

    Energy Technology Data Exchange (ETDEWEB)

    Xavier, Katiane Cruz Magalhaes; Santos, Maria do Socorro Ferreira dos; Santos, Maria Rita Morais Chaves; Oliveira, Marilia Evelyn Rodrigues; Osajima, Josy Antevelli; Silva Filho, Edson Cavalcanti da [Universidade Federal do Piaui (UFPI), Teresina, PI (Brazil); Carvalho, Maria Wilma Nunes Cordeiro, E-mail: edsonfilho@ufpi.edu.br [Universidade Federal de Campina Grande (UFCG), PB (Brazil)

    2014-08-15

    The palygorskite is an aluminum-magnesium silicate that has a fibrous morphology. Their physicochemical characteristics are the result of high surface area, porosity and thermal resistance which make it an attractive adsorbent. Its adsorption capacity can be increased through chemical reactions and/or heat treatments. The objective of this work is to verify the effects of acid activation on the palygorskite, treated with HCl at 90 °C at concentrations of 2, 4 and 6 mol L{sup -1} in 2 and 4 hours, with clay/acid solution ratio 1 g 10 mL{sup -1} and characterized by techniques: XRF, XRD and surface area. A significant increase in specific surface area was observed in the sample treated with HCl at the concentration 6 mol L{sup -1}. The changes were more pronounced at stricter concentrations of acidity, with decreasing intensity of reflection of the clay indicated in the XRD. These changes were confirmed in the XRF with the leaching of some oxides and with increasing concentration of SiO{sub 2}. (author)

  1. Acid/base bifunctional carbonaceous nanomaterial with large surface area: Preparation, characterization, and adsorption properties for cationic and anionic compounds

    Energy Technology Data Exchange (ETDEWEB)

    Li, Kai; Ma, Chun–Fang; Ling, Yuan; Li, Meng [Department of Chemistry, Faculty of Material Science and Chemistry, China University of Geosciences, Wuhan 430074 (China); Gao, Qiang, E-mail: gaoqiang@cug.edu.cn [Department of Chemistry, Faculty of Material Science and Chemistry, China University of Geosciences, Wuhan 430074 (China); Engineering Research Center of Nano-Geo Materials of Ministry of Education, China University of Geosciences, Wuhan 430074 (China); Luo, Wen–Jun, E-mail: heartnohome@yahoo.com.cn [Department of Chemistry, Faculty of Material Science and Chemistry, China University of Geosciences, Wuhan 430074 (China)

    2015-07-15

    Nanostructured carbonaceous materials are extremely important in the nano field, yet developing simple, mild, and “green” methods that can make such materials possess large surface area and rich functional groups on their surfaces still remains a considerable challenge. Herein, a one-pot and environment-friendly method, i.e., thermal treatment (180 °C; 18 h) of water mixed with glucose and chitosan (CTS), has been proposed. The resultant carbonaceous nanomaterials were characterized by field emitting scanning electron microscope, N{sub 2} adsorption/desorption, Fourier transform infrared spectroscope, X-ray photoelectron spectroscopy, and zeta-potential analysis. It was found that, in contrast to the conventional hydrothermally carbonized product from pure glucose, with low surface area (9.3 m{sup 2} g{sup −1}) and pore volume (0.016 cm{sup 3} g{sup −1}), the CTS-added carbonaceous products showed satisfactory textural parameters (surface area and pore volume up to 254 m{sup 2} g{sup −1} and 0.701 cm{sup 3} g{sup −1}, respectively). Moreover, it was also interestingly found that these CTS-added carbonaceous products possessed both acidic (–COOH) and basic (–NH{sub 2}) groups on their surfaces. Taking the advantages of large surface area and –COOH/–NH{sub 2} bifunctional surface, the carbonaceous nanomaterials exhibited excellent performance for adsorptions of cationic compound (i.e., methylene blue) at pH 10 and anionic compound (i.e., acid red 18) at pH 2, respectively. This work not only provides a simple and green route to prepare acid/base bifunctional carbonaceous nanomaterials with large surface area but also well demonstrates their potential for application in adsorption. - Highlights: • A simple and green method was proposed to prepare carbon nanomaterials. • The carbon product showed acid/base bifunctional surface with large surface area. • The carbon material could efficiently adsorb both cationic and anionic compounds.

  2. A synthesis method for cobalt doped carbon aerogels with high surface area and their hydrogen storage properties

    Energy Technology Data Exchange (ETDEWEB)

    Tian, H.Y.; Buckley, C.E. [Department of Imaging and Applied Physics, Curtin University of Technology, GPO Box U 1987, Perth 6845, WA (Australia); CSIRO National Hydrogen Materials Alliance, CSIRO Energy Centre, 10 Murray Dwyer Circuit, Steel River Estate, Mayfield West, NSW 2304 (Australia); Sheppard, D.A.; Paskevicius, M. [Department of Imaging and Applied Physics, Curtin University of Technology, GPO Box U 1987, Perth 6845, WA (Australia); Hanna, N. [CSIRO Process Science and Engineering, Waterford, WA (Australia)

    2010-12-15

    Carbon aerogels doped with nanoscaled Co particles were prepared by first coating activated carbon aerogels using a wet-thin layer coating process. The resulting metal-doped carbon aerogels had a higher surface area ({proportional_to}1667 m{sup 2} g{sup -1}) and larger micropore volume ({proportional_to}0.6 cm{sup 3} g{sup -1}) than metal-doped carbon aerogels synthesised using other methods suggesting their usefulness in catalytic applications. The hydrogen adsorption behaviour of cobalt doped carbon aerogel was evaluated, displaying a high {proportional_to}4.38 wt.% H{sub 2} uptake under 4.6 MPa at -196 C. The hydrogen uptake capacity with respect to unit surface area was greater than for pure carbon aerogel and resulted in {proportional_to}1.3 H{sub 2} (wt. %) per 500 m{sup 2} g{sup -1}. However, the total hydrogen uptake was slightly reduced as compared to pure carbon aerogel due to a small reduction in surface area associated with cobalt doping. The improved adsorption per unit surface area suggests that there is a stronger interaction between the hydrogen molecules and the cobalt doped carbon aerogel than for pure carbon aerogel. (author)

  3. Assessment of mercury erosion by surface water in Wanshan mercury mining area.

    Science.gov (United States)

    Dai, ZhiHui; Feng, Xinbin; Zhang, Chao; Shang, Lihai; Qiu, Guangle

    2013-08-01

    Soil erosion is a main cause of land degradation, and in its accelerated form is also one of the most serious ecological environmental problems. Moreover, there are few studies on migration of mercury (Hg) induced by soil erosion in seriously Hg-polluted districts. This paper selected Wanshan Hg mining area, SW China as the study area. Revised universal soil loss equation (RUSLE) and Geographic information system (GIS) methods were applied to calculate soil and Hg erosion and to classify soil erosion intensity. Our results show that the soil erosion rate can reach up to 600,884tkm(-2)yr(-1). Surfaces associated with very slight and extremely severe erosion include 76.6% of the entire land in Wanshan. Furthermore, the cumulative erosion rates in the area impacted by extremely severe erosion make up 90.5% of the total. On an annual basis, Hg surface erosion load was predicted to be 505kgyr(-1) and the corresponding mean migration flux of Hg was estimated to be 3.02kgkm(-2)yr(-1). The erosion loads of Hg resulting from farmland and meadow soil were 175 and 319kgyr(-1) respectively, which were enhanced compared to other landscape types due to the fact that they are generally located in the steep zones associated with significant reclamation. Contributing to establish a mass balance of Hg in Wanshan Hg mining area, this study supplies a dependable scientific basis for controlling soil and water erosion in the local ecosystems. Land use change is the most effective way for reducing Hg erosion load in Wanshan mining area. Copyright © 2013 Elsevier Inc. All rights reserved.

  4. Pure phase LaFeO3 perovskite with improved surface area synthesized using different routes and its characterization

    International Nuclear Information System (INIS)

    Gosavi, Priti V.; Biniwale, Rajesh B.

    2010-01-01

    Three different wet chemistry routes, namely co-precipitation, combustion and sol-gel methods were used to synthesize LaFeO 3 perovskite with improved surface area. The synthesized perovskite was characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), energy dispersive X-ray spectrometer (EDS), Brunauer-Emmett-Teller (BET) nitrogen adsorption, ultraviolet diffused reflectance spectroscopy (UVDRS) and Fourier transform infrared (FTIR) spectroscopy techniques. Improved surface area was observed for all three methods as compared to the previously reported values. The perovskite synthesized using sol-gel method yields comparatively pure, crystalline phase of LaFeO 3 and relatively higher surface area of 16.5 m 2 g -1 and porosity. The material synthesized using co-precipitation method yielded other phases in addition to the targeted phase. The morphology of perovskite synthesized using co-precipitation method was uniform agglomerates. Combustion method yields flakes type morphology and that of sol-gel method was open pore type morphology. The selection of method for perovskite synthesis largely depends on the targeted application and the desired properties of perovskites. The results reported in this study are useful for establishing a simple scalable method for preparation of high surface area LaFeO 3 as compared to solid-oxide method. Further, the typical heating cycle followed for calcinations resulted in relatively high surface area in the case of all three methods.

  5. Surface area of lactose and lactose granulates on consolidation and compaction

    OpenAIRE

    Riepma, Klaas Alouis

    1993-01-01

    This dissertation discusses the effect of short time storage at different conditions on the strength and the specific BET surface area of lactose tablets. In addition, some aspects are studied of the consolidation and compaction properties of crystalline lactose fractions in heterogeneous systems. The crystalline lactose types used are: a-lactose monohydrate, anhydrous a-lactose, crystalline B-lactose and roller dried B-lactose. ... Zie: Summary

  6. Description of climate, surface hydrology, and near-surface hydrogeology. Preliminary site description. Forsmark area - version 1.2

    International Nuclear Information System (INIS)

    Johansson, Per-Olof; Werner, Kent; Bosson, Emma; Berglund, Sten; Juston, John

    2005-06-01

    The present report is a background report describing the meteorological conditions and the modelling of surface hydrology and near-surface hydrogeology in support of the Forsmark version 1.2 SDM based on the data available in the Forsmark 1.2 ''data freeze'' (July 31, 2004). The area covered in the conceptual and descriptive modelling is characterised by a low relief and a small-scale topography. Almost the whole area is located below 20 m a s l (metres above sea level). The corrected mean annual precipitation is 600-650 mm and the mean annual evapotranspiration can be estimated to a little more than 400 mm, leaving approximately 200 mm x year-1 for runoff. Till is the dominating Quaternary deposit covering approximately 75% of the area. In most of the area, the till is sandy. Bedrock outcrops are frequent but cover only approximately 5% of the area. Direct groundwater recharge from precipitation is the dominant source of groundwater recharge. The small-scale topography implies that many local, shallow groundwater flow systems are formed in the Quaternary deposits, overlaying more large-scale flow systems associated with groundwater flows at greater depths. Groundwater level time series from wells in till and bedrock within the same areas show a considerably higher groundwater level in the till than in the bedrock. The sediment stratigraphy of lakes and wetlands is crucial for their function as discharge areas for groundwater. Comparisons between measured lake water levels and groundwater levels below and around lakes indicate that the lakes in some cases may act as sources of groundwater recharge. Specifically, observations from Lake Bolundsfjaerden and Lake Eckarfjaerden show that such conditions were at hand during the dry summer of 2003. However, whether the observed water level relations correspond to significant water fluxes depends also on the hydrogeological properties of the lake sediments and the underlying Quaternary deposits. ''Old'' water with high

  7. Changing surface-atmosphere energy exchange and refreezing capacity of the lower accumulation area, West Greenland

    Science.gov (United States)

    Charalampidis, C.; van As, D.; Box, J. E.; van den Broeke, M. R.; Colgan, W. T.; Doyle, S. H.; Hubbard, A. L.; MacFerrin, M.; Machguth, H.; Smeets, C. J. P. P.

    2015-11-01

    We present 5 years (2009-2013) of automatic weather station measurements from the lower accumulation area (1840 m a.s.l. - above sea level) of the Greenland ice sheet in the Kangerlussuaq region. Here, the summers of 2010 and 2012 were both exceptionally warm, but only 2012 resulted in a strongly negative surface mass budget (SMB) and surface meltwater run-off. The observed run-off was due to a large ice fraction in the upper 10 m of firn that prevented meltwater from percolating to available pore volume below. Analysis reveals an anomalously low 2012 summer-averaged albedo of 0.71 (typically ~ 0.78), as meltwater was present at the ice sheet surface. Consequently, during the 2012 melt season, the ice sheet surface absorbed 28 % (213 MJ m-2) more solar radiation than the average of all other years. A surface energy balance model is used to evaluate the seasonal and interannual variability of all surface energy fluxes. The model reproduces the observed melt rates as well as the SMB for each season. A sensitivity analysis reveals that 71 % of the additional solar radiation in 2012 was used for melt, corresponding to 36 % (0.64 m) of the 2012 surface lowering. The remaining 64 % (1.14 m) of surface lowering resulted from high atmospheric temperatures, up to a +2.6 °C daily average, indicating that 2012 would have been a negative SMB year at this site even without the melt-albedo feedback. Longer time series of SMB, regional temperature, and remotely sensed albedo (MODIS) show that 2012 was the first strongly negative SMB year, with the lowest albedo, at this elevation on record. The warm conditions of recent years have resulted in enhanced melt and reduction of the refreezing capacity in the lower accumulation area. If high temperatures continue, the current lower accumulation area will turn into a region with superimposed ice in coming years.

  8. Surface area loss and increased sphericity account for the splenic entrapment of subpopulations of Plasmodium falciparum ring-infected erythrocytes.

    Directory of Open Access Journals (Sweden)

    Innocent Safeukui

    Full Text Available Ex vivo perfusion of human spleens revealed innate retention of numerous cultured Plasmodium falciparum ring-infected red blood cells (ring-iRBCs. Ring-iRBC retention was confirmed by a microsphiltration device, a microbead-based technology that mimics the mechanical filtering function of the human spleen. However, the cellular alterations underpinning this retention remain unclear. Here, we use ImageStream technology to analyze infected RBCs' morphology and cell dimensions before and after fractionation with microsphiltration. Compared to fresh normal RBCs, the mean cell membrane surface area loss of trophozoite-iRBCs, ring-iRBCs and uninfected co-cultured RBCs (uRBCs was 14.2% (range: 8.3-21.9%, 9.6% (7.3-12.2% and 3.7% (0-8.4, respectively. Microsphilters retained 100%, ∼50% and 4% of trophozoite-iRBCs, ring-iRBCs and uRBCs, respectively. Retained ring-iRBCs display reduced surface area values (estimated mean, range: 17%, 15-18%, similar to the previously shown threshold of surface-deficient RBCs retention in the human spleen (surface area loss: >18%. By contrast, ring-iRBCs that successfully traversed microsphilters had minimal surface area loss and normal sphericity, suggesting that these parameters are determinants of their retention. To confirm this hypothesis, fresh normal RBCs were exposed to lysophosphatidylcholine to induce a controlled loss of surface area. This resulted in a dose-dependent retention in microsphilters, with complete retention occurring for RBCs displaying >14% surface area loss. Taken together, these data demonstrate that surface area loss and resultant increased sphericity drive ring-iRBC retention in microsphilters, and contribute to splenic entrapment of a subpopulation of ring-iRBCs. These findings trigger more interest in malaria research fields, including modeling of infection kinetics, estimation of parasite load, and analysis of risk factors for severe clinical forms. The determination of the threshold of

  9. Normalization in quantitative [18F]FDG PET imaging: the 'body surface area' may be a volume

    International Nuclear Information System (INIS)

    Laffon, Eric; Suarez, Kleydis; Berthoumieu, Yannick; Ducassou, Dominique; Marthan, Roger

    2006-01-01

    Non-invasive methods for quantifying [ 18 F]FDG uptake in tumours often require normalization to either body weight or body surface area (BSA), as a surrogate for [ 18 F]FDG distribution volume (DV). Whereas three dimensions are involved in DV and weight (assuming that weight is proportional to volume), only two dimensions are obviously involved in BSA. However, a fractal geometry interpretation, related to an allometric scaling, suggests that the so-called 'body surface area' may stand for DV. (note)

  10. Screening hydroxyapatite for cadmium and lead immobilization in aqueous solution and contaminated soil: The role of surface area.

    Science.gov (United States)

    Li, Hongying; Guo, Xisheng; Ye, Xinxin

    2017-02-01

    Hydroxyapatite (HAP) has been widely used to immobilize many cationic metals in water and soils. The specific reason why an increase in the surface area of HAP enhances cadmium (Cd) uptake, but has no effect on lead (Pb) uptake, is not clear. The aim of this study was to determine the factors causing the differences in sorption behavior between Cd and Pb by evaluating HAPs with different surface areas. We synthesized HAPs with two different surface areas, which were characterized by X-ray diffraction, N 2 adsorption, and scanning electron microscopy, and then evaluated them as sorbents for Cd and Pb removal by testing in single and binary systems. The sorption capacity of large surface area HAP (1.85mmol/g) for Cd in the single-metal system was higher than that of small surface area HAP (0.64mmol/g), but there were no differences between single- and binary-metal solutions containing Pb. After the Cd experiments, the HAP retained a stable structure and intact morphology, which promotes the accessibility of reactive sites for Cd. However, a newly formed precipitate covered the surface and blocked the channels in the presence of Pb, which reduced the number of potential adsorption sites on HAP for Cd and Pb. Remediation experiments using Cd- and Pb-contaminated soil produced similar results to the solution tests. These results indicate that alterations of the structure and morphology during the reaction is an important factor influencing metal sorption to HAP. Copyright © 2016. Published by Elsevier B.V.

  11. Area-Specific Cell Stimulation via Surface-Mediated Gene Transfer Using Apatite-Based Composite Layers

    Directory of Open Access Journals (Sweden)

    Yushin Yazaki

    2015-04-01

    Full Text Available Surface-mediated gene transfer systems using biocompatible calcium phosphate (CaP-based composite layers have attracted attention as a tool for controlling cell behaviors. In the present study we aimed to demonstrate the potential of CaP-based composite layers to mediate area-specific dual gene transfer and to stimulate cells on an area-by-area basis in the same well. For this purpose we prepared two pairs of DNA–fibronectin–apatite composite (DF-Ap layers using a pair of reporter genes and pair of differentiation factor genes. The results of the area-specific dual gene transfer successfully demonstrated that the cells cultured on a pair of DF-Ap layers that were adjacently placed in the same well showed specific gene expression patterns depending on the gene that was immobilized in theunderlying layer. Moreover, preliminary real-time PCR results indicated that multipotential C3H10T1/2 cells may have a potential to change into different types of cells depending on the differentiation factor gene that was immobilized in the underlying layer, even in the same well. Because DF-Ap layers have a potential to mediate area-specific cell stimulation on their surfaces, they could be useful in tissue engineering applications.

  12. Benefits of Applying Predictive Intelligence to the Space Situational Awareness (SSA) Mission

    Science.gov (United States)

    Lane, B.; Mann, B.; Millard, C.

    Recent events have heightened the interest in providing improved Space Situational Awareness (SSA) to the warfighter using novel techniques that are affordable and effective. The current Space Surveillance Network (SSN) detects, tracks, catalogs and identifies artificial objects orbiting earth and provides information on Resident Space Objects (RSO) as well as new foreign launch (NFL) satellites. The reactive nature of the SSN provides little to no warning on changes to the expected states of these RSOs or NFLs. This paper will detail the use of the historical data collected on RSOs to characterize what their steady state is, proactively help identify when changes or anomalies have occurred using a pattern-of-like activity based intelligence approach, and apply dynamic, adaptive mission planning to the observables that lead up to a NFL. Multiple hypotheses will be carried along with the intent or the changes to the steady state to assist the SSN in tasking the various sensors in the network to collect the relevant data needed to help prune the number of hypotheses by assigning likelihood to each of those activities. Depending on the hypothesis and thresholds set, these likelihoods will then be used in turn to alert the SSN operator with changes to the steady state, prioritize additional data collections, and provide a watch list of likely next activities.

  13. Detailed effects of particle size and surface area on 222Rn emanation of a phosphate rock.

    Science.gov (United States)

    Haquin, Gustavo; Yungrais, Zohar; Ilzycer, Danielle; Zafrir, Hovav; Weisbrod, Noam

    2017-12-01

    The dependency of radon emanation on soil texture was investigated using the closed chamber method. Ground phosphate rock with a large specific surface area was analyzed, and the presence of inner pores, as well as a high degree of roughness and heterogeneity in the phosphate particles, was found. The average radon emanation of the dry phosphate was 0.145 ± 0.016. The emanation coefficient was highest (0.169 ± 0.019) for the smallest particles (210 μm). The reduction rate followed an inverse power law. As expected, a linear dependence between the emanation coefficient and the specific surface area was found, being lower than predicted for the large specific surface area. This was most likely due to an increase in the embedding effect of radon atoms in adjacent grains separated by micropores. Results indicate that knowledge of grain radium distribution is crucial to making accurate emanation predictions. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Surface area and chemical reactivity characteristics of uranium metal corrosion products

    International Nuclear Information System (INIS)

    Totemeier, T. C.

    1998-01-01

    The results of an initial characterization of hydride-containing corrosion products from uranium metal Zero Power Physics Reactor (ZPPR) fuel plates are presented. Sorption analyses using the BET method with a Kr adsorbate were performed to measure the specific areas of corrosion product samples. The specific surface areas of the corrosion products varied from 0.66 to 1.01 m 2 /g. The reactivity of the products in Ar-9%O 2 and Ar-20%O 2 were measured at temperatures between 35 C and 150 C using a thermo-gravimetric analyzer. Ignition of the products occurred at temperatures of 150 C and above. The oxidation rates below ignition were comparable to rates observed for uranium metal

  15. Human cortical areas involved in perception of surface glossiness.

    Science.gov (United States)

    Wada, Atsushi; Sakano, Yuichi; Ando, Hiroshi

    2014-09-01

    Glossiness is the visual appearance of an object's surface as defined by its surface reflectance properties. Despite its ecological importance, little is known about the neural substrates underlying its perception. In this study, we performed the first human neuroimaging experiments that directly investigated where the processing of glossiness resides in the visual cortex. First, we investigated the cortical regions that were more activated by observing high glossiness compared with low glossiness, where the effects of simple luminance and luminance contrast were dissociated by controlling the illumination conditions (Experiment 1). As cortical regions that may be related to the processing of glossiness, V2, V3, hV4, VO-1, VO-2, collateral sulcus (CoS), LO-1, and V3A/B were identified, which also showed significant correlation with the perceived level of glossiness. This result is consistent with the recent monkey studies that identified selective neural response to glossiness in the ventral visual pathway, except for V3A/B in the dorsal visual pathway, whose involvement in the processing of glossiness could be specific to the human visual system. Second, we investigated the cortical regions that were modulated by selective attention to glossiness (Experiment 2). The visual areas that showed higher activation to attention to glossiness than that to either form or orientation were identified as right hV4, right VO-2, and right V3A/B, which were commonly identified in Experiment 1. The results indicate that these commonly identified visual areas in the human visual cortex may play important roles in glossiness perception. Copyright © 2014. Published by Elsevier Inc.

  16. Increase of surface solar irradiance across East China related to changes in aerosol properties during the past decade

    Science.gov (United States)

    Li, Jing; Jiang, Yiwei; Xia, Xiangao; Hu, Yongyun

    2018-03-01

    Previously, it was widely documented that an overall decrease in surface solar radiation occurred in China at least until 2005, in contrast to the general background of ‘global brightening’. Increased anthropogenic aerosol emissions were speculated to be the source of the reduction. In this study, we extend the trend analysis to the most recent decade from 2005-2015 and find that surface solar radiation has shifted from ‘dimming’ to ‘brightening’ over East China, with the largest increase over the northeast and southeast parts. Meanwhile, satellite and ground observation both indicate a reduction in aerosol optical depth (AOD) during the same period, whereas no significant trends in cloud amount show up. Detailed analysis using co-located radiation and aerosol observation at the XiangHe station in North China suggests that both AOD and single scattering albedo (SSA) changes contribute to the radiation trends. AOD reduction contributes to the increase of direct solar radiation, also decreasing the diffuse radiation, while the increase of SSA serves to increase the diffuse fraction. Simple calculations using a radiative transfer model confirm that the two effects combined explain changes in the global solar radiation and its components effectively. Our results have implications for potential climate effects with the reduction of China’s aerosol emissions, and the necessity to monitor aerosol composition in addition to its loading.

  17. Response of three instruments devoted to surface-area for monodisperse and polydisperse aerosols in molecular and transition regimes

    International Nuclear Information System (INIS)

    Bau, Sebastien; Witschger, Olivier; Gensdarmes, Francois; Thomas, Dominique

    2011-01-01

    An increasing number of experimental and theoretical studies focus on airborne nanoparticles (NP) in relation with many aspects of risk assessment. Indeed, our understanding of the hazards, the actual exposures in the workplace and the limits of engineering controls and personal protective equipment with regard to NP are still under development. Several studies have already identified surface-area as an important determinant of low solubility nanoparticles toxicity. As a consequence, the concept that surface-area could be a relevant metric for characterizing exposure to low solubility airborne NP has been proposed [1]. To provide NP surface-area concentration, some direct-reading instruments have been designed, based on diffusion charging. The actual available instruments providing airborne NP surface-area concentration are studied in this work: LQ1-DC (Matter Engineering), AeroTrak T M 9000 (TSI) and NSAM (TSI model 3550). Their performances regarding monodisperse carbon NP have been investigated by Bau et al.. This work aims at completing the instruments characterization regarding monodisperse NP of other chemical composition (aluminium, copper, silver) and studying their performances against polydisperse aerosols of NP.

  18. Response of three instruments devoted to surface-area for monodisperse and polydisperse aerosols in molecular and transition regimes

    Energy Technology Data Exchange (ETDEWEB)

    Bau, Sebastien; Witschger, Olivier [Institut National de Recherche et de Securite (INRS), Laboratoire de Metrologie des Aerosols, Rue du Morvan, CS 60027, 54519 Vandoeuvre Cedex (France); Gensdarmes, Francois [Institut de Radioprotection et de Surete Nucleaire (IRSN), Laboratoire de Physique et de Metrologie des Aerosols, BP 68, 91192 Gif-sur-Yvette (France); Thomas, Dominique, E-mail: sebastien.bau@inrs.fr [Laboratoire Reactions et Genie des Procedes (LRGP), groupe SAFE, 1 rue Grandville, BP 20041, 54001 Nancy Cedex (France)

    2011-07-06

    An increasing number of experimental and theoretical studies focus on airborne nanoparticles (NP) in relation with many aspects of risk assessment. Indeed, our understanding of the hazards, the actual exposures in the workplace and the limits of engineering controls and personal protective equipment with regard to NP are still under development. Several studies have already identified surface-area as an important determinant of low solubility nanoparticles toxicity. As a consequence, the concept that surface-area could be a relevant metric for characterizing exposure to low solubility airborne NP has been proposed [1]. To provide NP surface-area concentration, some direct-reading instruments have been designed, based on diffusion charging. The actual available instruments providing airborne NP surface-area concentration are studied in this work: LQ1-DC (Matter Engineering), AeroTrak{sup TM} 9000 (TSI) and NSAM (TSI model 3550). Their performances regarding monodisperse carbon NP have been investigated by Bau et al.. This work aims at completing the instruments characterization regarding monodisperse NP of other chemical composition (aluminium, copper, silver) and studying their performances against polydisperse aerosols of NP.

  19. Application of stereological methods to estimate post-mortem brain surface area using 3T MRI

    DEFF Research Database (Denmark)

    Furlong, Carolyn; García-Fiñana, Marta; Puddephat, Michael

    2013-01-01

    The Cavalieri and Vertical Sections methods of design based stereology were applied in combination with 3 tesla (i.e. 3T) Magnetic Resonance Imaging (MRI) to estimate cortical and subcortical volume, area of the pial surface, area of the grey-white matter boundary, and thickness of the cerebral...

  20. Nitrate and nitrite contamination of sub-surface water in some areas of North West Frontier Province (N.W.F.P.) Pakistan

    International Nuclear Information System (INIS)

    Khan, M.; Khawaja, M.A.; Imdadullah

    1998-01-01

    Over the past few years, nitrate and nitrite contamination of sub-surface water samples from Peshawar, Charsada, Mardan and Nowshera districts of NWFP has been studied. In all the areas under study, nitrate concentration of sub-surface water was found to be below WHO approved limit of 45 mg/l. Whereas city area after 1987 showed a decreasing level of nitrate contamination of sub-surface water, it appeared to be on the increase in water samples from the outskirts of Peshawar-Charsada road. No uniform increasing or decreasing patterns of nitrate contamination were observed for water samples from cantonment, University and Hayatabad, areas of Mardan, Charsada and Nowshera under study. The nitrate contamination of sub-surface water appeared to be due to both the agricultural activities as well as human and animal wastes. A few sub-surface water samples from Peshawar city, Mardan and Nowshera areas indicated high concentration of nitrite, which is alarming in view of the earlier reports showing absence of nitrite in water samples from these areas. However, since 1993, nitrite presence has not been detected in sub-surface water samples from all the areas under present investigation. (author)

  1. Hydrogen-terminated mesoporous silicon monoliths with huge surface area as alternative Si-based visible light-active photocatalysts

    KAUST Repository

    Li, Ting

    2016-07-21

    Silicon-based nanostructures and their related composites have drawn tremendous research interest in solar energy storage and conversion. Mesoporous silicon with a huge surface area of 400-900 m2 g-1 developed by electrochemical etching exhibits excellent photocatalytic ability and stability after 10 cycles in degrading methyl orange under visible light irradiation, owing to its unique mesoporous network, abundant surface hydrides and efficient light harvesting. This work showcases the profound effects of surface area, crystallinity, pore topology on charge migration/recombination and mass transportation. Therein the ordered 1D channel array has outperformed the interconnected 3D porous network by greatly accelerating the mass diffusion and enhancing the accessibility of the active sites on the extensive surfaces. © 2016 The Royal Society of Chemistry.

  2. Method development and validation for measuring the particle size distribution of pentaerythritol tetranitrate (PETN) powders.

    Energy Technology Data Exchange (ETDEWEB)

    Young, Sharissa Gay

    2005-09-01

    Currently, the critical particle properties of pentaerythritol tetranitrate (PETN) that influence deflagration-to-detonation time in exploding bridge wire detonators (EBW) are not known in sufficient detail to allow development of a predictive failure model. The specific surface area (SSA) of many PETN powders has been measured using both permeametry and gas absorption methods and has been found to have a critical effect on EBW detonator performance. The permeametry measure of SSA is a function of particle shape, packed bed pore geometry, and particle size distribution (PSD). Yet there is a general lack of agreement in PSD measurements between laboratories, raising concerns regarding collaboration and complicating efforts to understand changes in EBW performance related to powder properties. Benchmarking of data between laboratories that routinely perform detailed PSD characterization of powder samples and the determination of the most appropriate method to measure each PETN powder are necessary to discern correlations between performance and powder properties and to collaborate with partnering laboratories. To this end, a comparison was made of the PSD measured by three laboratories using their own standard procedures for light scattering instruments. Three PETN powder samples with different surface areas and particle morphologies were characterized. Differences in bulk PSD data generated by each laboratory were found to result from variations in sonication of the samples during preparation. The effect of this sonication was found to depend on particle morphology of the PETN samples, being deleterious to some PETN samples and advantageous for others in moderation. Discrepancies in the submicron-sized particle characterization data were related to an instrument-specific artifact particular to one laboratory. The type of carrier fluid used by each laboratory to suspend the PETN particles for the light scattering measurement had no consistent effect on the resulting

  3. In vitro degradation of calcium phosphates: Effect of multiscale porosity, textural properties and composition.

    Science.gov (United States)

    Diez-Escudero, A; Espanol, M; Beats, S; Ginebra, M-P

    2017-09-15

    The capacity of calcium phosphates to be replaced by bone is tightly linked to their resorbability. However, the relative importance of some textural parameters on their degradation behavior is still unclear. The present study aims to quantify the effect of composition, specific surface area (SSA), and porosity at various length scales (nano-, micro- and macroporosity) on the in vitro degradation of different calcium phosphates. Degradation studies were performed in an acidic medium to mimic the osteoclastic environment. Small degradations were found in samples with interconnected nano- and micropores with sizes below 3µm although they were highly porous (35-65%), with maximum weight loss of 8wt%. Biomimetic calcium deficient hydroxyapatite, with high SSA and low crystallinity, presented the highest degradation rates exceeding even the more soluble β-TCP. A dependence of degradation on SSA was indisputable when porosity and pore sizes were increased. The introduction of additional macroporosity with pore interconnections above 20µm significantly impacted degradation, more markedly in the substrates with high SSA (>15m 2 /g), whereas in sintered substrates with low SSA (calcium deficient hydroxyapatite did not increase its degradation rate. Overall, the study highlights the importance of textural properties, which can modulate or even outweigh the effect of other features such as the solubility of the compounds. The physicochemical features of calcium phosphates are crucial to tune biological events like resorption during bone remodeling. Understanding in vitro resorption can help to predict the in vivo behavior. Besides chemical composition, other parameters such as porosity and specific surface area have a strong influence on resorption. The complexity of isolating the contribution of each parameter lies in the close interrelation between them. In this work, a multiscale study was proposed to discern the extent to which each parameter influences degradation in

  4. Freeze-drying for sustainable synthesis of nitrogen doped porous carbon cryogel with enhanced supercapacitor and lithium ion storage performance

    International Nuclear Information System (INIS)

    Ling, Zheng; Yu, Chang; Fan, Xiaoming; Liu, Shaohong; Yang, Juan; Zhang, Mengdi; Wang, Gang; Xiao, Nan; Qiu, Jieshan

    2015-01-01

    A chitosan (CS) based nitrogen doped carbon cryogel with a high specific surface area (SSA) has been directly synthesized via a combined process of freeze-drying and high-temperature carbonization without adding any activation agents. The as-made carbon cryogel demonstrates an SSA up to 1025 m 2 g −1 and a high nitrogen content of 5.98 wt%, while its counterpart derived from CS powder only shows an SSA of 26 m 2 g −1 . Freeze-drying is a determining factor for the formation of carbon cryogel with a high SSA, where the CS powder with a size of ca. 200 μm is transformed into the sheet-shaped cryogel with a thickness of 5–8 μm. The as-made carbon cryogel keeps the sheet-shaped structure and the abundant pores are formed in situ and decorated inside the sheets during carbonization. The carbon cryogel shows significantly enhanced performance as supercapacitor and lithium ion battery electrodes in terms of capacity and rate capability due to its quasi two-dimensional (2D) structure with reduced thickness. The proposed method may provide a simple approach to configure 2D biomass-derived advanced carbon materials for energy storage devices. (paper)

  5. THE EFFECT OF STORAGE AT AMBIENT HUMIDITY ON THE BET-SPECIFIC SURFACE-AREA OF TABLETS COMPACTED FROM DIFFERENT MATERIALS

    NARCIS (Netherlands)

    RIEPMA, KA; DEKKER, BG; JAGER, RS; ELBERSE, PA; LERK, CF

    1993-01-01

    Tablets compacted from both water soluble and water insoluble particulate solids showed no change in BET-specific surface area when transferred immediately after ejection from the die in a dry atmosphere. Storage at ambient humidity resulted in an irreversible decrease in surface area, caused by

  6. Impact of membrane lung surface area and blood flow on extracorporeal CO2 removal during severe respiratory acidosis.

    Science.gov (United States)

    Karagiannidis, Christian; Strassmann, Stephan; Brodie, Daniel; Ritter, Philine; Larsson, Anders; Borchardt, Ralf; Windisch, Wolfram

    2017-12-01

    Veno-venous extracorporeal CO 2 removal (vv-ECCO 2 R) is increasingly being used in the setting of acute respiratory failure. Blood flow rates through the device range from 200 ml/min to more than 1500 ml/min, and the membrane surface areas range from 0.35 to 1.3 m 2 . The present study in an animal model with similar CO 2 production as an adult patient was aimed at determining the optimal membrane lung surface area and technical requirements for successful vv-ECCO 2 R. Four different membrane lungs, with varying lung surface areas of 0.4, 0.8, 1.0, and 1.3m 2 were used to perform vv-ECCO 2 R in seven anesthetized, mechanically ventilated, pigs with experimentally induced severe respiratory acidosis (pH 7.0-7.1) using a 20Fr double-lumen catheter with a sweep gas flow rate of 8 L/min. During each experiment, the blood flow was increased stepwise from 250 to 1000 ml/min. Amelioration of severe respiratory acidosis was only feasible when blood flow rates from 750 to 1000 ml/min were used with a membrane lung surface area of at least 0.8 m 2 . Maximal CO 2 elimination was 150.8 ml/min, with pH increasing from 7.01 to 7.30 (blood flow 1000 ml/min; membrane lung 1.3 m 2 ). The membrane lung with a surface of 0.4 m 2 allowed a maximum CO 2 elimination rate of 71.7 mL/min, which did not result in the normalization of pH, even with a blood flow rate of 1000 ml/min. Also of note, an increase of the surface area above 1.0 m 2 did not result in substantially higher CO 2 elimination rates. The pressure drop across the oxygenator was considerably lower (respiratory acidosis, irrespective of the surface area of the membrane lung being used. The converse was also true, low surface membrane lungs (0.4 m 2 ) were not capable of completely correcting severe respiratory acidosis across the range of blood flows used in this study.

  7. Fabrication of a Horizontal and a Vertical Large Surface Area Nanogap Electrochemical Sensor

    Directory of Open Access Journals (Sweden)

    Jules L. Hammond

    2016-12-01

    Full Text Available Nanogap sensors have a wide range of applications as they can provide accurate direct detection of biomolecules through impedimetric or amperometric signals. Signal response from nanogap sensors is dependent on both the electrode spacing and surface area. However, creating large surface area nanogap sensors presents several challenges during fabrication. We show two different approaches to achieve both horizontal and vertical coplanar nanogap geometries. In the first method we use electron-beam lithography (EBL to pattern an 11 mm long serpentine nanogap (215 nm between two electrodes. For the second method we use inductively-coupled plasma (ICP reactive ion etching (RIE to create a channel in a silicon substrate, optically pattern a buried 1.0 mm × 1.5 mm electrode before anodically bonding a second identical electrode, patterned on glass, directly above. The devices have a wide range of applicability in different sensing techniques with the large area nanogaps presenting advantages over other devices of the same family. As a case study we explore the detection of peptide nucleic acid (PNA−DNA binding events using dielectric spectroscopy with the horizontal coplanar device.

  8. Surface area, crystal morphology and characterization of transition alumina powders from a new gibbsite precursor

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Vieira Coelho

    2007-06-01

    Full Text Available A new procedure was used to prepare a microcrystalline powder constituted by thin euhedral hexagonal gibbsite plates, 0.2 to 0.6 µm in diameter and 32 nm thick. The powder, fired between 200 and 1000 °C, produced chi and kappa transition aluminas. Alpha-alumina is formed from 1000 °C and recrystallized up to 1500 °C. At 1000 °C, kappa- and alpha-alumina coexisted, but kappa-alumina could only be characterized by SAED. The details of the internal organization of the transition alumina pseudomorphs were clearly observable in TEM due to the great thinness of the I-gibbsite plates. The specific surface area varied from pristine I-gibbsite (24.9 m².g-1 to chi- and kappa transition aluminas (25.4 m².g-1 at 1000 °C to alpha-alumina (4.0 m².g-1 at 1500 °C. The maximum value of specific surface area is 347 m².g-1 in chi-alumina powder at 300 °C, a difference from Bayer gibbsite, in which the chi-alumina highest surface area is 370 m².g-1 at 400 °C.

  9. Non-activated high surface area expanded graphite oxide for supercapacitors

    Energy Technology Data Exchange (ETDEWEB)

    Vermisoglou, E.C.; Giannakopoulou, T.; Romanos, G.E.; Boukos, N.; Giannouri, M. [Institute of Nanoscience and Nanotechnology “Demokritos”, 153 43 Ag. Paraskevi, Attikis (Greece); Lei, C.; Lekakou, C. [Division of Mechanical, Medical, and Aerospace Engineering, Faculty of Engineering and Physical Sciences, University of Surrey, Guildford GU2 7XH (United Kingdom); Trapalis, C., E-mail: c.trapalis@inn.demokritos.gr [Institute of Nanoscience and Nanotechnology “Demokritos”, 153 43 Ag. Paraskevi, Attikis (Greece)

    2015-12-15

    Graphical abstract: - Highlights: • One-step exfoliation and reduction of graphite oxide via microwave irradiation. • Effect of pristine graphite (type, flake size) on the microwave expanded material. • Effect of pretreatment and oxidation cycles on the produced expanded material. • Expanded graphene materials with high BET surface areas (940 m{sup 2}/g–2490 m{sup 2}/g). • Non-activated graphene based materials suitable for supercapacitors. - Abstract: Microwave irradiation of graphite oxide constitutes a facile route toward production of reduced graphene oxide, since during this treatment both exfoliation and reduction of graphite oxide occurs. In this work, the effect of pristine graphite (type, size of flakes), pretreatment and oxidation cycles on the finally produced expanded material was examined. All the types of graphite that were tested afforded materials with high BET surface areas ranging from 940 m{sup 2}/g to 2490 m{sup 2}/g, without intervening an activation stage at elevated temperature. SEM and TEM images displayed exfoliated structures, where the flakes were significantly detached and curved. The quality of the reduced graphene oxide sheets was evidenced both by X-ray photoelectron spectroscopy and Raman spectroscopy. The electrode material capacitance was determined via electrochemical impedance spectroscopy and cyclic voltammetry. The materials with PEDOT binder had better performance (∼97 F/g) at low operation rates while those with PVDF binder performed better (∼20 F/g) at higher rates, opening up perspectives for their application in supercapacitors.

  10. EFFECT OF RATIO OF SURFACE AREA ON THE CORROSION RATE

    OpenAIRE

    Dody Prayitno; M. Irsyad

    2018-01-01

    Aluminum and steel are used to be a construction for a building outdoor panel. Aluminum and steel are connected by bolt and nut. An atmosphere due to a corrosion of the aluminum. The corrosion possibly to cause the hole diameter of bolt and nut to become larger. Thus the bolt and nut can not enough strong to hold the panel. The panel may collapse. The aim of the research is first to answer a question where does the corrosion starts. The second is to know the effect of ratio surface area of st...

  11. Probing hot-electron effects in wide area plasmonic surfaces using X-ray photoelectron spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Ayas, Sencer; Cupallari, Andi; Dana, Aykutlu, E-mail: aykutlu@unam.bilkent.edu.tr [UNAM Institute of Materials Science and Nanotechnology, Bilkent University, 06800 Ankara (Turkey)

    2014-12-01

    Plasmon enhanced hot carrier formation in metallic nanostructures increasingly attracts attention due to potential applications in photodetection, photocatalysis, and solar energy conversion. Here, hot-electron effects in nanoscale metal-insulator-metal (MIM) structures are investigated using a non-contact X-ray photoelectron spectroscopy based technique using continuous wave X-ray and laser excitations. The effects are observed through shifts of the binding energy of the top metal layer upon excitation with lasers of 445, 532, and 650 nm wavelength. The shifts are polarization dependent for plasmonic MIM grating structures fabricated by electron beam lithography. Wide area plasmonic MIM surfaces fabricated using a lithography free route by the dewetting of evaporated Ag on HfO{sub 2} exhibit polarization independent optical absorption and surface photovoltage. Using a simple model and making several assumptions about the magnitude of the photoemission current, the responsivity and external quantum efficiency of wide area plasmonic MIM surfaces are estimated as 500 nA/W and 11 × 10{sup −6} for 445 nm illumination.

  12. Surface area and chemical reactivity characteristics of uranium metal corrosion products.

    Energy Technology Data Exchange (ETDEWEB)

    Totemeier, T. C.

    1998-02-17

    The results of an initial characterization of hydride-containing corrosion products from uranium metal Zero Power Physics Reactor (ZPPR) fuel plates are presented. Sorption analyses using the BET method with a Kr adsorbate were performed to measure the specific areas of corrosion product samples. The specific surface areas of the corrosion products varied from 0.66 to 1.01 m{sup 2}/g. The reactivity of the products in Ar-9%O{sub 2} and Ar-20%O{sub 2} were measured at temperatures between 35 C and 150 C using a thermo-gravimetric analyzer. Ignition of the products occurred at temperatures of 150 C and above. The oxidation rates below ignition were comparable to rates observed for uranium metal.

  13. Tritium absorption and desorption in ITER relevant materials: comparative study of tungsten dust and massive samples

    Energy Technology Data Exchange (ETDEWEB)

    Grisolia, C., E-mail: christian.grisolia@cea.fr [CEA, IRFM, F-13108 Saint Paul lez Durance (France); Hodille, E. [CEA, IRFM, F-13108 Saint Paul lez Durance (France); Chene, J.; Garcia-Argote, S.; Pieters, G.; El-Kharbachi, A. [CEA Saclay, SCBM, iBiTec-S, PC n° 108, 91191 Gifsur-Yvette (France); Marchetti, L.; Martin, F.; Miserque, F. [CEA Saclay, DEN/DPC/SCCME/LECA, F-91191 Gif-sur-Yvette (France); Vrel, D.; Redolfi, M. [LSPM, Université Paris 13, Sorbonne Paris Cité, UPR 3407 CNRS, 93430 Villetaneuse (France); Malard, V. [CEA, DSV, IBEB, Lab Biochim System Perturb, Bagnols-sur-Cèze F-30207 (France); Dinescu, G.; Acsente, T. [NILPRP, 409 Atomistilor Street, 77125 Magurele, Bucharest (Romania); Gensdarmes, F.; Peillon, S. [IRSN, PSN-RES/SCA/LPMA, Saclay, Gif-sur-Yvette, 91192 (France); Pegourié, B. [CEA, IRFM, F-13108 Saint Paul lez Durance (France); Rousseau, B. [CEA Saclay, SCBM, iBiTec-S, PC n° 108, 91191 Gifsur-Yvette (France)

    2015-08-15

    Tritium adsorption and desorption from well characterized tungsten dust are presented. The dust used are of different types prepared by planetary milling and by aggregation technique in plasma. For the milled powder, the surface specific area (SSA) is 15.5 m{sup 2}/g. The particles are poly-disperse with a maximum size of 200 nm for the milled powder and 100 nm for the aggregation one. Prior to tritiation the particles are carefully de-oxidized. Both samples are experiencing a high tritium inventory from 5 GBq/g to 35 GBq/g. From comparison with massive samples and considering that tritium inventory increases with SSA, it is shown that surface effects are predominant in the tritium trapping process. Extrapolation to the ITER environment is undertaken with the help of a Macroscopic Rate Equation model. It is shown that, during the life time of ITER, these particles can exceed rapidly 1 GBq/g.

  14. Human arachnoid granulations Part I: a technique for quantifying area and distribution on the superior surface of the cerebral cortex

    Directory of Open Access Journals (Sweden)

    Holman David W

    2007-07-01

    Full Text Available Abstract Background The arachnoid granulations (AGs are herniations of the arachnoid membrane into the dural venous sinuses on the surface of the brain. Previous morphological studies of AGs have been limited in scope and only one has mentioned surface area measurements. The purpose of this study was to investigate the topographic distribution of AGs on the superior surface of the cerebral cortex. Methods En face images were taken of the superior surface of 35 formalin-fixed human brains. AGs were manually identified using Adobe Photoshop, with a pixel location containing an AG defined as 'positive'. A set of 25 standard fiducial points was marked on each hemisphere for a total of 50 points on each image. The points were connected on each hemisphere to create a segmented image. A standard template was created for each hemisphere by calculating the average position of the 25 fiducial points from all brains. Each segmented image was mapped to the standard template using a linear transformation. A topographic distribution map was produced by calculating the proportion of AG positive images at each pixel in the standard template. The AG surface area was calculated for each hemisphere and for the total brain superior surface. To adjust for different brain sizes, the proportional involvement of AGs was calculated by dividing the AG area by the total area. Results The total brain average surface area of AGs was 78.53 ± 13.13 mm2 (n = 35 and average AG proportional involvement was 57.71 × 10-4 ± 7.65 × 10-4. Regression analysis confirmed the reproducibility of AG identification between independent researchers with r2 = 0.97. The surface AGs were localized in the parasagittal planes that coincide with the region of the lateral lacunae. Conclusion The data obtained on the spatial distribution and en face surface area of AGs will be used in an in vitro model of CSF outflow. With an increase in the number of samples, this analysis technique can be used

  15. Area-averaged surface fluxes and their time-space variability over the FIFE experimental domain

    Science.gov (United States)

    Smith, E. A.; Hsu, A. Y.; Crosson, W. L.; Field, R. T.; Fritschen, L. J.; Gurney, R. J.; Kanemasu, E. T.; Kustas, W. P.; Nie, D.; Shuttleworth, W. J.

    1992-01-01

    The underlying mean and variance properties of surface net radiation, sensible-latent heat fluxes and soil heat flux are studied over the densely instrumented grassland region encompassing FIFE. Flux variability is discussed together with the problem of scaling up to area-averaged fluxes. Results are compared and contrasted for cloudy and clear situations and examined for the influence of surface-induced biophysical controls (burn and grazing treatments) and topographic controls (aspect ratios and slope factors).

  16. Liquefied petroleum gas sensor based on manganese (III) oxide and zinc manganese (III) oxide nanoparticles

    Science.gov (United States)

    Sharma, Shiva; Chauhan, Pratima; Husain, Shahid

    2018-01-01

    In this paper, {{{Mn}}}2{{{O}}}3 and {{{ZnMn}}}2{{{O}}}4 nanoparticles (NPs) are successfully synthesized using chemical co-precipitation method at room temperature and further annealed at 450 °C. The structure, crystallite size, morphology, specific surface area (SSA) and band gap energy have been determined by x-ray diffraction, transmission electron microscopy, Brunauer-Emmett-Teller surface area analysis, scanning electron microscopy (SEM-EDS) and UV-visible spectrophotometer. The sensor films of the {{{Mn}}}2{{{O}}}3 NPs and {{{ZnMn}}}2{{{O}}}4 NPs have been fabricated onto glass substrate using spin coater system separately. These sensor films are investigated for different concentrations (200-1200 ppm) of liquefied petroleum gas (LPG) at different operating temperatures ranging from 100 °C to 400 °C. A comparative study of gas sensing properties shows that spinel {{{ZnMn}}}2{{{O}}}4 sensor film exhibit excellent response (≈ 80 % ) towards 1000 ppm LPG at 300 °C in comparison to {{{Mn}}}2{{{O}}}3 sensor films. The enhancement in the gas sensing characteristics of {{{ZnMn}}}2{{{O}}}4 sensor film is attributed to the reduced crystallite size, greater SSA, and modification in structure as well as morphology.

  17. The effect of grain size and surface area on organic matter, lignin and carbohydrate concentration, and molecular compositions in Peru Margin sediments

    Science.gov (United States)

    Bergamaschi, Brian A.; Tsamakis, Elizabeth; Keil, Richard G.; Eglinton, Timothy I.; Montluçon, Daniel B.; Hedges, John I.

    1997-03-01

    A C-rich sediment sample from the Peru Margin was sorted into nine hydrodynamically-determined grain size fractions to explore the effect of grain size distribution and sediment surface area on organic matter content and composition. The neutral monomeric carbohydrate composition, lignin oxidation product yields, total organic carbon, and total nitrogen contents were determined independently for each size fraction, in addition to sediment surface area and abundance of biogenic opal. The percent organic carbon and percent total nitrogen were strongly related to surface area in these sediments. In turn, the distribution of surface area closely followed mass distribution among the textural size classes, suggesting hydrodynamic controls on grain size also control organic carbon content. Nevertheless, organic compositional distinctions were observed between textural size classes. Total neutral carbohydrate yields in the Peru Margin sediments were found to closely parallel trends in total organic carbon, increasing in abundance among grain size fractions in proportion to sediment surface area. Coincident with the increases in absolute abundance, rhamnose and mannose increased as a fraction of the total carbohydrate yield in concert with surface area, indicating these monomers were preferentially represented in carbohydrates associated with surfaces. Lignin oxidation product yields varied with surface area when normalized to organic carbon, suggesting that the terrestrially-derived component may be diluted by sorption of marine derived material. Lignin-based parameters suggest a separate source for terrestrially derived material associated with sand-size material as opposed to that associated with silts and clays.

  18. Catalytic oxidation of 1,2-DCBz over V2O5/TiO2-CNTs: effect of CNT diameter and surface functional groups.

    Science.gov (United States)

    Du, Cuicui; Wang, Qiulin; Peng, Yaqi; Lu, Shengyong; Ji, Longjie; Ni, Mingjiang

    2017-02-01

    A series of V 2 O 5 /TiO 2 -carbon nanotube (CNT) catalysts were prepared and tested to decompose gaseous 1,2-dichlorobenzene (1,2-DCBz). Several physicochemical methods, including nitrogen adsorption, scanning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and H 2 temperature-programmed reduction (TPR) were employed to characterise their physicochemical properties. To better understand the effect of CNT properties on the reactivity of V 2 O 5 /TiO 2 -CNT catalysts, the 1,2-DCBz residue remaining in the off-gas and on the catalyst surface were both collected and analysed. The results indicate that the outer diameter and the surface functional groups (hydroxide radical and carboxyl) of CNTs significantly influence upon the catalytic activity of CNT-containing V 2 O 5 /TiO 2 catalysts: the CNT outer diameter mainly affects the aggregation of CNTs and the π-π interaction between the benzene ring and CNTs, while the introduction of -OH and -COOH groups by acid treatment can further enlarge specific surface area (SSA) and contribute to a higher average oxidation state of vanadium (V aos ) and supplemental surface chemisorbed oxygen (O ads ). In addition, the enhanced mobility of lattice oxygen (O latt) also improves the oxidation ability of the catalysts.

  19. Corrective Action Decision Document for Corrective Action Unit 417: Central Nevada Test Area Surface, Nevada

    International Nuclear Information System (INIS)

    1999-01-01

    This Corrective Action Decision Document (CADD) identifies and rationalizes the U.S. Department of Energy, Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 417: Central Nevada Test Area Surface, Nevada, under the Federal Facility Agreement and Consent Order. Located in Hot Creek Valley in Nye County, Nevada, and consisting of three separate land withdrawal areas (UC-1, UC-3, and UC-4), CAU 417 is comprised of 34 corrective action sites (CASs) including 2 underground storage tanks, 5 septic systems, 8 shaker pad/cuttings disposal areas, 1 decontamination facility pit, 1 burn area, 1 scrap/trash dump, 1 outlier area, 8 housekeeping sites, and 16 mud pits. Four field events were conducted between September 1996 and June 1998 to complete a corrective action investigation indicating that the only contaminant of concern was total petroleum hydrocarbon (TPH) which was found in 18 of the CASs. A total of 1,028 samples were analyzed. During this investigation, a statistical approach was used to determine which depth intervals or layers inside individual mud pits and shaker pad areas were above the State action levels for the TPH. Other related field sampling activities (i.e., expedited site characterization methods, surface geophysical surveys, direct-push geophysical surveys, direct-push soil sampling, and rotosonic drilling located septic leachfields) were conducted in this four-phase investigation; however, no further contaminants of concern (COCs) were identified. During and after the investigation activities, several of the sites which had surface debris but no COCs were cleaned up as housekeeping sites, two septic tanks were closed in place, and two underground storage tanks were removed. The focus of this CADD was to identify CAAs which would promote the prevention or mitigation of human exposure to surface and subsurface soils with contaminant

  20. Effect of particle surface area on ice active site densities retrieved from droplet freezing spectra

    Directory of Open Access Journals (Sweden)

    H. Beydoun

    2016-10-01

    Full Text Available Heterogeneous ice nucleation remains one of the outstanding problems in cloud physics and atmospheric science. Experimental challenges in properly simulating particle-induced freezing processes under atmospherically relevant conditions have largely contributed to the absence of a well-established parameterization of immersion freezing properties. Here, we formulate an ice active, surface-site-based stochastic model of heterogeneous freezing with the unique feature of invoking a continuum assumption on the ice nucleating activity (contact angle of an aerosol particle's surface that requires no assumptions about the size or number of active sites. The result is a particle-specific property g that defines a distribution of local ice nucleation rates. Upon integration, this yields a full freezing probability function for an ice nucleating particle. Current cold plate droplet freezing measurements provide a valuable and inexpensive resource for studying the freezing properties of many atmospheric aerosol systems. We apply our g framework to explain the observed dependence of the freezing temperature of droplets in a cold plate on the concentration of the particle species investigated. Normalizing to the total particle mass or surface area present to derive the commonly used ice nuclei active surface (INAS density (ns often cannot account for the effects of particle concentration, yet concentration is typically varied to span a wider measurable freezing temperature range. A method based on determining what is denoted an ice nucleating species' specific critical surface area is presented and explains the concentration dependence as a result of increasing the variability in ice nucleating active sites between droplets. By applying this method to experimental droplet freezing data from four different systems, we demonstrate its ability to interpret immersion freezing temperature spectra of droplets containing variable particle concentrations. It is shown

  1. Petroleum Hydrocarbon in Surface Sediment from Coastal Area of Putatan and Papar, Sabah

    International Nuclear Information System (INIS)

    Siti Aishah Mohd Ali; Rohana Tair; Yang, S.Z.; Masni Mohd Ali

    2013-01-01

    Total petroleum hydrocarbons (TPH) and percent total organic carbon (TOC) were investigated in surface sediments from coastal area of Papar and Putatan, Sabah. Samples were collected in five different stations in each area by using Ponar grab sampler. Samples were extracted with Soxhlet, concentrated and analyzed by using UV/ VIS spectrophotometer. The overall mean and range of TPH concentrations in the sediments from coastal area of Papar and Putatan were 1.95 (0.53-4.59 mg/ kg dw Miri crude oil equivalents) and 0.85 (0.26-1.64 mg/ kg dw Miri crude oil equivalents) respectively. Meanwhile, the TOC ranged from 0.81-2.32 % and 0.35-0.81 % respectively. Statistical analysis using Pearson correlation showed no significant differences between TPH and TOC (p<0.05) in both areas. (author)

  2. Cortical Thickness, Surface Area and Subcortical Volume Differentially Contribute to Cognitive Heterogeneity in Parkinson's Disease.

    Science.gov (United States)

    Gerrits, Niels J H M; van Loenhoud, Anita C; van den Berg, Stan F; Berendse, Henk W; Foncke, Elisabeth M J; Klein, Martin; Stoffers, Diederick; van der Werf, Ysbrand D; van den Heuvel, Odile A

    2016-01-01

    Parkinson's disease (PD) is often associated with cognitive deficits, although their severity varies considerably between patients. Recently, we used voxel-based morphometry (VBM) to show that individual differences in gray matter (GM) volume relate to cognitive heterogeneity in PD. VBM does, however, not differentiate between cortical thickness (CTh) and surface area (SA), which might be independently affected in PD. We therefore re-analyzed our cohort using the surface-based method FreeSurfer, and investigated (i) CTh, SA, and (sub)cortical GM volume differences between 93 PD patients and 45 matched controls, and (ii) the relation between these structural measures and cognitive performance on six neuropsychological tasks within the PD group. We found cortical thinning in PD patients in the left pericalcarine gyrus, extending to cuneus, precuneus and lingual areas and left inferior parietal cortex, bilateral rostral middle frontal cortex, and right cuneus, and increased cortical surface area in the left pars triangularis. Within the PD group, we found negative correlations between (i) CTh of occipital areas and performance on a verbal memory task, (ii) SA and volume of the frontal cortex and visuospatial memory performance, and, (iii) volume of the right thalamus and scores on two verbal fluency tasks. Our primary findings illustrate that i) CTh and SA are differentially affected in PD, and ii) VBM and FreeSurfer yield non-overlapping results in an identical dataset. We argue that this discrepancy is due to technical differences and the subtlety of the PD-related structural changes.

  3. High surface area TiO2/SBA-15 nanocomposites: Synthesis, microstructure and adsorption-enhanced photocatalysis

    Science.gov (United States)

    Wei, J. Q.; Chen, X. J.; Wang, P. F.; Han, Y. B.; Xu, J. C.; Hong, B.; Jin, H. X.; Jin, D. F.; Peng, X. L.; Li, J.; Yang, Y. T.; Ge, H. L.; Wang, X. Q.

    2018-06-01

    Mesoporous SBA-15 was used to anchor TiO2 nanoparticles into the mesopores to form high surface area TiO2/SBA-15 nanocomposites, and then the influence of mesoporous-structure on the photocatalytic performance was investigated. TiO2/SBA-15 nanocomposites possessed the high specific surface area and appropriate pore size, indicating the excellent adsorption performance. TiO2/SBA-15 nanocomposites exhibited the higher photocatalytic activity to degrade dyes (methylene blue: MB) than TiO2 (removing SBA-15), which should attributed to the excellent adsorption performance of the nanocomposites. MB was absorbed to form the higher concentration near TiO2/SBA-15 photocatalysts, and the photocatalytic degradation for MB was improved.

  4. U(VI) sorption on granite: prediction and experiments

    International Nuclear Information System (INIS)

    Nebelung, C.; Brendler, V.

    2010-01-01

    One widely accepted approach - component additivity (CA) - to describe the sorption of contaminants onto complex materials such as rocks or soils is based on the assumption that the surface of a complex mineral assemblage is composed of a mixture of mineral constituents whose surface properties are known from independent studies. An internally consistent SCM (surface complexation model) database can be developed that describes the adsorption reactions of solutes to each phase. Here, the capability of such a methodology was tested, using the code MINTEQA2 including thermodynamic data of the NEA-TDB, and literature data for SCM, namely the DDL model. The sorption characteristics of U(VI) on granite (from Eibenstock, Saxony, Germany, with the main components quartz, albite, orthoclase, and muscovite) was predicted and then compared to batch experiments. Granite plays an important role in the remediation of former uranium ore mining and milling sites, but is also one of the host rocks considered for final disposal of nuclear materials. Safety assessment requires a detailed understanding of this system and its retention potential with regard to hazardous components. Namely the sorption of uranium in this complex rock is not fully understood yet. The experiments thus also provided a better understanding of the far-field behaviour in granitic geological nuclear repositories. The robustness of the prediction was tested by variation of the granite composition and the variation of the specific surface area (SSA) - first all components were predicted with a uniform granite SSA, second with a distinct SSA for each granite component (determined on pure minerals for the same grain size fractions). Changes in compositions yielded only marginal differences in the prediction. Different approaches to SSA showed somewhat larger deviations. In conclusion, the CA methodology is a valid and robust approach to U(VI) sorption onto complex substrates such as granite, provided sufficient

  5. Preparation of MgO Catalytic Support in Shaped Mesoporous High Surface Area Form

    Czech Academy of Sciences Publication Activity Database

    Gulková, Daniela; Šolcová, Olga; Zdražil, Miroslav

    2004-01-01

    Roč. 76, 1-3 (2004), s. 137-149 ISSN 1387-1811 R&D Projects: GA AV ČR IAA4072306 Institutional research plan: CEZ:AV0Z4072921 Keywords : MgO support * sigh Surface area * texture Subject RIV: CC - Organic Chemistry Impact factor: 2.093, year: 2004

  6. Hydrothermal Synthesis of Highly Water-dispersible Anatase Nanoparticles with Large Specific Surface Area and Their Adsorptive Properties

    OpenAIRE

    Hu Xueting; Zhang Dongyun; Zhao Siqin; Asuha Sin

    2016-01-01

    Highly water-dispersible and very small TiO2 nanoparticles (~3 nm anatase) with large specific surface area have been synthesized by hydrolysis and hydrothermal reactions of titanium butoxide and used for the removal of three azo dyes (Congo red, orange II, and methyl orange) with different molecular structure from simulated wastewaters. The synthesized TiO2 nanoparticles are well dispersed in water with large specific surface area up to 417 m2 g−1. Adsorption experiments demonstrated that th...

  7. New Technology-Large-Area Three- Dimensional Surface Profiling Using Only Focused Air-Coupled Ultrasound-Given 1999 R&D 100 Award

    Science.gov (United States)

    Roth, Don J.; Kautz, Harold E.; Abel, Phillip B.; Whalen, Mike F.; Hendricks, J. Lynne; Bodis, James R.

    2000-01-01

    Surface topography, which significantly affects the performance of many industrial components, is normally measured with diamond-tip profilometry over small areas or with optical scattering methods over larger areas. To develop air-coupled surface profilometry, the NASA Glenn Research Center at Lewis Field initiated a Space Act Agreement with Sonix, Inc., through two Glenn programs, the Advanced High Temperature Engine Materials Program (HITEMP) and COMMTECH. The work resulted in quantitative surface topography profiles obtained using only high-frequency, focused ultrasonic pulses in air. The method is nondestructive, noninvasive, and noncontact, and it does not require light-reflective surfaces. Air surface profiling may be desirable when diamond-tip or laserbased methods are impractical, such as over large areas, when a significant depth range is required, or for curved surfaces. When the configuration is optimized, the method is reasonably rapid and all the quantitative analysis facilities are online, including two- and three-dimensional visualization, extreme value filtering (for faulty data), and leveling.

  8. 4STAR Sky-Scanning Retrievals of Aerosol Intensive Optical Properties from Multiple Field Campaigns with Detailed Comparisons of SSA Reported During SEAC4RS

    Science.gov (United States)

    Flynn, Connor; Dahlgren, R. P.; Dunagan, S.; Johnson, R.; Kacenelenbogen, M.; LeBlanc, S.; Livingston, J.; Redemann, J.; Schmid, B.; Segal Rozenhaimer, M.; hide

    2015-01-01

    The 4STAR (Spectrometer for Sky-Scanning, Sun-Tracking Atmospheric Research) instrument combines airborne sun tracking capabilities of the Ames Airborne Tracking Sun Photometer (AATS-14) with AERONET-like sky-scanning capability and adds state-of-the-art fiber-coupled grating spectrometry to yield hyper spectral measurements of direct solar irradiance and angularly resolved sky radiance. The combination of sun-tracking and sky-scanning capability enables retrievals of wavelength-dependent aerosol optical depth (AOD), mode-resolved aerosol size distribution (SD), asphericity, and complex refractive index, and thus also the scattering phase function, asymmetry parameter, single-scattering albedo (SSA), and absorption aerosol optical thickness (AAOT).From 2012 to 2014 4STAR participated in four major field campaigns: the U.S. Dept. of Energy TCAP I II campaigns, and NASAs SEAC4RS and ARISE campaigns. Establishing a strong performance record, 4STAR operated successfully on all flights conducted during each of these campaigns. Sky radiance spectra from scans in either constant azimuth (principal plane) or constant zenith angle (almucantar) were interspersed with direct beam measurements during level legs. During SEAC4RS and ARISE, 4STAR airborne measurements were augmented with flight-level albedo from the collocated Shortwave Spectral Flux Radiometer (SSFR) providing improved specification of below-aircraft radiative conditions for the retrieval. Calibrated radiances and retrieved products will be presented with particular emphasis on detailed comparisons of ambient SSA retrievals and measurements during SEAC4RS from 4STAR, AERONET, HSRL2, and from in situ measurements.

  9. Polyaniline nanofibers with a high specific surface area and an improved pore structure for supercapacitors

    Science.gov (United States)

    Xu, Hailing; Li, Xingwei; Wang, Gengchao

    2015-10-01

    Polyaniline (PANI) with a high specific surface area and an improved pore structure (HSSA-PANI) has been prepared by using a facile method, treating PANI nanofibers with chloroform (CHCl3), and its structure, morphology and pore structure are investigated. The specific surface area and pore volume of HSSA-PANI are 817.3 m2 g-1 and 0.6 cm3 g-1, and those of PANI are 33.6 m2 g-1 and 0.2 cm3 g-1. As electrode materials, a large specific surface area and pore volume can provide high electroactive regions, accelerate the diffusion of ions, and mitigate the electrochemical degradation of active materials. Compared with PANI, the capacity retention rate of HSSA-PANI is 90% with a growth of current density from 5.0 to 30 A g-1, and that of PANI is 29%. At a current density of 30 A g-1, the specific capacitance of HSSA-PANI still reaches 278.3 F g-1, and that of PANI is 86.7 F g-1. At a current density of 5.0 A g-1, the capacitance retention of HSSA-PANI is 53.1% after 2000 cycles, and that of PANI electrode is only 28.1%.

  10. Comparisons of spectral aerosol single scattering albedo in Seoul, South Korea

    Science.gov (United States)

    Mok, Jungbin; Krotkov, Nickolay A.; Torres, Omar; Jethva, Hiren; Li, Zhanqing; Kim, Jhoon; Koo, Ja-Ho; Go, Sujung; Irie, Hitoshi; Labow, Gordon; Eck, Thomas F.; Holben, Brent N.; Herman, Jay; Loughman, Robert P.; Spinei, Elena; Lee, Seoung Soo; Khatri, Pradeep; Campanelli, Monica

    2018-04-01

    Quantifying aerosol absorption at ultraviolet (UV) wavelengths is important for monitoring air pollution and aerosol amounts using current (e.g., Aura/OMI) and future (e.g., TROPOMI, TEMPO, GEMS, and Sentinel-4) satellite measurements. Measurements of column average atmospheric aerosol single scattering albedo (SSA) are performed on the ground by the NASA AERONET in the visible (VIS) and near-infrared (NIR) wavelengths and in the UV-VIS-NIR by the SKYNET networks. Previous comparison studies have focused on VIS and NIR wavelengths due to the lack of co-incident measurements of aerosol and gaseous absorption properties in the UV. This study compares the SKYNET-retrieved SSA in the UV with the SSA derived from a combination of AERONET, MFRSR, and Pandora (AMP) retrievals in Seoul, South Korea, in spring and summer 2016. The results show that the spectrally invariant surface albedo assumed in the SKYNET SSA retrievals leads to underestimated SSA compared to AMP values at near UV wavelengths. Re-processed SKYNET inversions using spectrally varying surface albedo, consistent with the AERONET retrieval improve agreement with AMP SSA. The combined AMP inversions allow for separating aerosol and gaseous (NO2 and O3) absorption and provide aerosol retrievals from the shortest UVB (305 nm) through VIS to NIR wavelengths (870 nm).

  11. Improved capacity to evaluate changes in intestinal mucosal surface area using mathematical modeling.

    Science.gov (United States)

    Greig, Chasen J; Cowles, Robert A

    2017-07-01

    Quantification of intestinal mucosal growth typically relies on morphometric parameters, commonly villus height, as a surrogate for presumed changes in mucosal surface area (MSA). We hypothesized that using mathematical modeling based on multiple unique measurements would improve discrimination of the effects of interventions on MSA compared to standard measures. To determine the ability of mathematical modeling to resolve differences in MSA, a mouse model with enhanced serotonin (5HT) signaling known to stimulate mucosal growth was used. 5-HT signaling is potentiated by targeting the serotonin reuptake transporter (SERT) molecule. Selective serotonin reuptake inhibitor-treated wild-type (WT-SSRI), SERT-knockout (SERTKO), and wild-type C57Bl/6 (WT) mice were used. Distal ileal sections were H&E-stained. Villus height (VH), width (VW), crypt width (CW), and bowel diameter were used to calculate surface area enlargement factor (SEF) and MSA. VH alone for SERTKO and SSRI was significantly increased compared to WT, without a difference between SERTKO and WT-SSRI. VW and CW were significantly decreased for both SERTKO and WT-SSRI compared to WT, and VW for WT-SSRI was also decreased compared to SERTKO. These changes increased SEF and MSA for SERTKO and WT-SSRI compared to WT. Additionally, SEF and MSA were significantly increased for WT-SSRI compared to SERTKO. Mathematical modeling provides a valuable tool for differentiating changes in intestinal MSA. This more comprehensive assessment of surface area does not appear to correlate linearly with standard morphometric measures and represents a more comprehensive method for discriminating between therapies aimed at increasing functional intestinal mucosa. © 2017 Wiley Periodicals, Inc.

  12. Relationship between screw sagittal angle and stress on endplate of adjacent segments after anterior cervical corpectomy and fusion with internal fixation: a Chinese finite element study.

    Science.gov (United States)

    Zhang, Yu; Tang, Yibo; Shen, Hongxing

    2017-12-01

    In order to reduce the incidence of adjacent segment disease (ASD), the current study was designed to establish Chinese finite element models of normal 3rd~7th cervical vertebrae (C3-C7) and anterior cervical corpectomy and fusion (ACCF) with internal fixation , and analyze the influence of screw sagittal angle (SSA) on stress on endplate of adjacent cervical segments. Mimics 8.1 and Abaqus/CAE 6.10 softwares were adopted to establish finite element models. For C4 superior endplate and C6 inferior endplate, their anterior areas had the maximum stress in anteflexion position, and their posterior areas had the maximum stress in posterior extension position. As SSA increased, the stress reduced. With an increase of 10° in SSA, the stress on anterior areas of C4 superior endplate and C6 inferior endplate reduced by 12.67% and 7.99% in anteflexion position, respectively. With an increase of 10° in SSA, the stress on posterior areas of C4 superior endplate and C6 inferior endplate reduced by 9.68% and 10.22% in posterior extension position, respectively. The current study established Chinese finite element models of normal C3-C7 and ACCF with internal fixation , and demonstrated that as SSA increased, the stress on endplate of adjacent cervical segments decreased. In clinical surgery, increased SSA is able to play important role in protecting the adjacent cervical segments and reducing the incidence of ASD.

  13. Estimation of small reservoir storage capacities in the São Francisco, Limpopo, Bandama and Volta river basins using remotely sensed surface areas

    Science.gov (United States)

    Rodrigues, Lineu; Senzanje, Aidan; Cecchi, Philippe; Liebe, Jens

    2010-05-01

    People living in areas with highly variable rainfall, experience droughts and floods and often have insecure livelihoods. Small multi-purpose reservoirs (SR) are a widely used form of infrastructures to provide people in such areas with water during the dry season, e.g. in the basins of São Francisco, Brazil, Limpopo, Zimbabwe, Bandama, Ivory Coast and Volta, Ghana. In these areas, the available natural flow in the streams is sometimes less than the flow required for water supply or irrigation, however water can be stored in times of surplus, for example, from a wet season to a dry season. Efficient water management and sound reservoir planning are hindered by the lack of information about the functioning of these reservoirs. Reservoirs in these regions were constructed in a series of projects funded by different agencies, at different times, with little or no coordination among the implementing partners. Poor record keeping and the lack of appropriate institutional support result in deficiencies of information on the capacity, operation, and maintenance of these structures. Estimating the storage capacity of dams is essential to the responsible management of water diversion. Most of SR in these basins have never been evaluated, possibly because the tools currently used for such measurement are labor-intensive, costly and time-consuming. The objective of this research was to develop methodology to estimate small reservoir capacities as a function of their remotely sensed surface areas in the São Francisco, Limpopo, Bandama and Volta basins, as a way to contribute to improve the water resource management in those catchments. Remote sensing was used to identify, localize and characterize small reservoirs. The surface area of each was calculated from satellite images. A sub-set of reservoirs was selected. For each reservoir in the sub-set, the surface area was estimated from field surveys, and storage capacity was estimated using information on reservoir surface

  14. Investigation on the growth of DAST crystals of large surface area for THz applications

    International Nuclear Information System (INIS)

    Vijay, R. Jerald; Melikechi, N.; Thomas, Tina; Gunaseelan, R.; Arockiaraj, M. Antony; Sagayaraj, P.

    2012-01-01

    Graphical abstract: It is evident from the photographs that the crystal tend to grow as a needle (Fig. 1a) in the lower concentration region (2–3 g/200 mL); whereas, in the high concentration region (5 g/200 mL) though there is a marked enlargement in the size of the crystal, the morphology of the resulting DAST crystal is slightly irregular (Fig. 1d) in nature. Among the four concentrations employed, best result was obtained with the DAST–methanol solution of concentration 4 g/200 mL; which resulted in the DAST crystal of large surface area (270 mm 2 ) with high transparency and nearly square shape (Fig. 1c) in a growth period of 20–25 days. Highlights: ► DAST crystals of different sizes are obtained for different concentrations. ► The main focus is to grow DAST crystals with large surface area. ► Structural, optical, thermal and mechanical properties are investigated. - Abstract: The growth of high quality 4-N,N-dimethylamino-4-N-methyl-stilbazoliumtosylate (DAST) crystal with large surface area is reported by adopting the slope nucleation coupled slow evaporation method (SNM-SE). The structure and composition of the crystal are studied by single crystal X-ray diffraction and CHN analyses. The linear optical properties are investigated by UV–vis absorption. The melting point and thermal behavior of DAST are investigated using differential scanning calorimetric (DSC) and thermogravimetric analyses (TGA). The Vickers microhardness number (VHN) and work hardening coefficient of the grown crystal have been determined. The surface features of the DAST crystal are analyzed by scanning electron microscopy (SEM) and it confirmed the presence of narrow line defects (NLDs) in the sample.

  15. Atomic layer deposition of highly dispersed Pt nanoparticles on a high surface area electrode backbone for electrochemical promotion of catalysis

    NARCIS (Netherlands)

    Hajar, Y.; di Palma, V.; Kyriakou, V.; Verheijen, M. A.; Baranova, E. A.; Vernoux, P.; Kessels, W. M. M.; Creatore, M.; van de Sanden, M. C. M.; Tsampas, M. N.

    2017-01-01

    A novel catalyst design for electrochemical promotion of catalysis (EPOC) is proposed which overcomes the main bottlenecks that limit EPOC commercialization, i.e., the low dispersion and small surface area of metal catalysts. We have increased the surface area by using a porous composite electrode

  16. Synthesis and characterization of high-surface-area millimeter-sized silica beads with hierarchical multi-modal pore structure by the addition of agar

    Energy Technology Data Exchange (ETDEWEB)

    Han, Yosep; Choi, Junhyun [Department of Mineral Resources and Energy Engineering, Chonbuk National University, 567 Baekje-daero, Deokjin-gu, Jeonju-si, Jeollabuk-do 561–756 (Korea, Republic of); Tong, Meiping, E-mail: tongmeiping@iee.pku.edu.cn [The Key Laboratory of Water and Sediment Sciences, Ministry of Education, College of Environmental Sciences and Engineering, Peking University, Beijing 100871 (China); Kim, Hyunjung, E-mail: kshjkim@jbnu.ac.kr [Department of Mineral Resources and Energy Engineering, Chonbuk National University, 567 Baekje-daero, Deokjin-gu, Jeonju-si, Jeollabuk-do 561–756 (Korea, Republic of)

    2014-04-01

    Millimeter-sized spherical silica foams (SSFs) with hierarchical multi-modal pore structure featuring high specific surface area and ordered mesoporous frameworks were successfully prepared using aqueous agar addition, foaming and drop-in-oil processes. The pore-related properties of the prepared spherical silica (SSs) and SSFs were systematically characterized by field emission-scanning electron microscopy (FE-SEM), transmission electron microscopy (TEM), small-angle X-ray diffraction (SAXRD), Hg intrusion porosimetry, and N{sub 2} adsorption–desorption isotherm measurements. Improvements in the BET surface area and total pore volume were observed at 504 m{sup 2} g{sup −1} and 5.45 cm{sup 3} g{sup −1}, respectively, after an agar addition and foaming process. Despite the increase in the BET surface area, the mesopore wall thickness and the pore size of the mesopores generated from the block copolymer with agar addition were unchanged based on the SAXRD, TEM, and BJH methods. The SSFs prepared in the present study were confirmed to have improved BET surface area and micropore volume through the agar loading, and to exhibit interconnected 3-dimensional network macropore structure leading to the enhancement of total porosity and BET surface area via the foaming process. - Highlights: • Millimeter-sized spherical silica foams (SSFs) are successfully prepared. • SSFs exhibit high BET surface area and ordered hierarchical pore structure. • Agar addition improves BET surface area and micropore volume of SSFs. • Foaming process generates interconnected 3-D network macropore structure of SSFs.

  17. Cortical thickness, surface area and volume measures in Parkinson's disease, multiple system atrophy and progressive supranuclear palsy.

    Directory of Open Access Journals (Sweden)

    Amanda Worker

    Full Text Available Parkinson's disease (PD, Multiple System Atrophy (MSA and Progressive Supranuclear Palsy (PSP are neurodegenerative diseases that can be difficult to distinguish clinically. The objective of the current study was to use surface-based analysis techniques to assess cortical thickness, surface area and grey matter volume to identify unique morphological patterns of cortical atrophy in PD, MSA and PSP and to relate these patterns of change to disease duration and clinical features.High resolution 3D T1-weighted MRI volumes were acquired from 14 PD patients, 18 MSA, 14 PSP and 19 healthy control participants. Cortical thickness, surface area and volume analyses were carried out using the automated surface-based analysis package FreeSurfer (version 5.1.0. Measures of disease severity and duration were assessed for correlation with cortical morphometric changes in each clinical group.Results show that in PSP, widespread cortical thinning and volume loss occurs within the frontal lobe, particularly the superior frontal gyrus. In addition, PSP patients also displayed increased surface area in the pericalcarine. In comparison, PD and MSA did not display significant changes in cortical morphology.These results demonstrate that patients with clinically established PSP exhibit distinct patterns of cortical atrophy, particularly affecting the frontal lobe. These results could be used in the future to develop a useful clinical application of MRI to distinguish PSP patients from PD and MSA patients.

  18. Groundwater impacts on surface water quality and nutrient loads in lowland polder catchments: monitoring the greater Amsterdam area

    Science.gov (United States)

    Yu, Liang; Rozemeijer, Joachim; van Breukelen, Boris M.; Ouboter, Maarten; van der Vlugt, Corné; Broers, Hans Peter

    2018-01-01

    The Amsterdam area, a highly manipulated delta area formed by polders and reclaimed lakes, struggles with high nutrient levels in its surface water system. The polders receive spatially and temporally variable amounts of water and nutrients via surface runoff, groundwater seepage, sewer leakage, and via water inlets from upstream polders. Diffuse anthropogenic sources, such as manure and fertiliser use and atmospheric deposition, add to the water quality problems in the polders. The major nutrient sources and pathways have not yet been clarified due to the complex hydrological system in lowland catchments with both urban and agricultural areas. In this study, the spatial variability of the groundwater seepage impact was identified by exploiting the dense groundwater and surface water monitoring networks in Amsterdam and its surrounding polders. A total of 25 variables (concentrations of total nitrogen (TN), total phosphorus (TP), NH4, NO3, HCO3, SO4, Ca, and Cl in surface water and groundwater, N and P agricultural inputs, seepage rate, elevation, land-use, and soil type) for 144 polders were analysed statistically and interpreted in relation to sources, transport mechanisms, and pathways. The results imply that groundwater is a large source of nutrients in the greater Amsterdam mixed urban-agricultural catchments. The groundwater nutrient concentrations exceeded the surface water environmental quality standards (EQSs) in 93 % of the polders for TP and in 91 % for TN. Groundwater outflow into the polders thus adds to nutrient levels in the surface water. High correlations (R2 up to 0.88) between solutes in groundwater and surface water, together with the close similarities in their spatial patterns, confirmed the large impact of groundwater on surface water chemistry, especially in the polders that have high seepage rates. Our analysis indicates that the elevated nutrient and bicarbonate concentrations in the groundwater seepage originate from the decomposition of

  19. Groundwater impacts on surface water quality and nutrient loads in lowland polder catchments: monitoring the greater Amsterdam area

    Directory of Open Access Journals (Sweden)

    L. Yu

    2018-01-01

    Full Text Available The Amsterdam area, a highly manipulated delta area formed by polders and reclaimed lakes, struggles with high nutrient levels in its surface water system. The polders receive spatially and temporally variable amounts of water and nutrients via surface runoff, groundwater seepage, sewer leakage, and via water inlets from upstream polders. Diffuse anthropogenic sources, such as manure and fertiliser use and atmospheric deposition, add to the water quality problems in the polders. The major nutrient sources and pathways have not yet been clarified due to the complex hydrological system in lowland catchments with both urban and agricultural areas. In this study, the spatial variability of the groundwater seepage impact was identified by exploiting the dense groundwater and surface water monitoring networks in Amsterdam and its surrounding polders. A total of 25 variables (concentrations of total nitrogen (TN, total phosphorus (TP, NH4, NO3, HCO3, SO4, Ca, and Cl in surface water and groundwater, N and P agricultural inputs, seepage rate, elevation, land-use, and soil type for 144 polders were analysed statistically and interpreted in relation to sources, transport mechanisms, and pathways. The results imply that groundwater is a large source of nutrients in the greater Amsterdam mixed urban–agricultural catchments. The groundwater nutrient concentrations exceeded the surface water environmental quality standards (EQSs in 93 % of the polders for TP and in 91 % for TN. Groundwater outflow into the polders thus adds to nutrient levels in the surface water. High correlations (R2 up to 0.88 between solutes in groundwater and surface water, together with the close similarities in their spatial patterns, confirmed the large impact of groundwater on surface water chemistry, especially in the polders that have high seepage rates. Our analysis indicates that the elevated nutrient and bicarbonate concentrations in the groundwater seepage originate

  20. Measuring Surface Deformation in Glacier Retreated Areas Based on Ps-Insar - Geladandong Glacier as a Case Study

    Science.gov (United States)

    Mohamadi, B.; Balz, T.

    2018-04-01

    Glaciers are retreating in many parts of the world as a result of global warming. Many researchers consider Qinghai-Tibetan Plateau as a reference for climate change by measuring glaciers retreat on the plateau. This retreat resulted in some topographic changes in retreated areas, and in some cases can lead to geohazards as landslides, and rock avalanches, which is known in glacier retreated areas as paraglacial slope failure (PSF). In this study, Geladandong biggest and main glacier mass was selected to estimate surface deformation on its glacier retreated areas and define potential future PSF based on PS-InSAR technique. 56 ascending and 49 descending images were used to fulfill this aim. Geladandong glacier retreated areas were defined based on the maximum extent of the glacier in the little ice age. Results revealed a general uplift in the glacier retreated areas with velocity less than 5mm/year. Obvious surface motion was revealed in seven parts surround glacier retreated areas with high relative velocity reached ±60mm/year in some parts. Four parts were considered as PSF potential motion, and two of them showed potential damage for the main road in the study area in case of rock avalanche into recent glacier lakes that could result in glacier lake outburst flooding heading directly to the road. Finally, further analysis and field investigations are needed to define the main reasons for different types of deformation and estimate future risks of these types of surface motion in the Qinghai-Tibetan Plateau.

  1. Anterior cingulate cortex surface area relates to behavioral inhibition in adolescents with and without heavy prenatal alcohol exposure.

    Science.gov (United States)

    Migliorini, Robyn; Moore, Eileen M; Glass, Leila; Infante, M Alejandra; Tapert, Susan F; Jones, Kenneth Lyons; Mattson, Sarah N; Riley, Edward P

    2015-10-01

    Prenatal alcohol exposure is associated with behavioral disinhibition, yet the brain structure correlates of this deficit have not been determined with sufficient detail. We examined the hypothesis that the structure of the anterior cingulate cortex (ACC) relates to inhibition performance in youth with histories of heavy prenatal alcohol exposure (AE, n = 32) and non-exposed controls (CON, n = 21). Adolescents (12-17 years) underwent structural magnetic resonance imaging yielding measures of gray matter volume, surface area, and thickness across four ACC subregions. A subset of subjects were administered the NEPSY-II Inhibition subtest. MANCOVA was utilized to test for group differences in ACC and inhibition performance and multiple linear regression was used to probe ACC-inhibition relationships. ACC surface area was significantly smaller in AE, though this effect was primarily driven by reduced right caudal ACC (rcACC). AE also performed significantly worse on inhibition speed but not on inhibition accuracy. Regression analyses with the rcACC revealed a significant group × ACC interaction. A smaller rcACC surface area was associated with slower inhibition completion time for AE but was not significantly associated with inhibition in CON. After accounting for processing speed, smaller rcACC surface area was associated with worse (i.e., slower) inhibition regardless of group. Examining processing speed independently, a decrease in rcACC surface area was associated with faster processing speed for CON but not significantly associated with processing speed in AE. Results support the theory that caudal ACC may monitor reaction time in addition to inhibition and highlight the possibility of delayed ACC neurodevelopment in prenatal alcohol exposure. Copyright © 2015 Elsevier B.V. All rights reserved.

  2. High surface area mesoporous activated carbon-alginate beads for efficient removal of methylene blue.

    Science.gov (United States)

    Nasrullah, Asma; Bhat, A H; Naeem, Abdul; Isa, Mohamed Hasnain; Danish, Mohammed

    2018-02-01

    High surface area mesoporous activated carbon-alginate (AC-alginate) beads were successfully synthesized by entrapping activated carbon powder derived from Mangosteen fruit peel into calcium-alginate beads for methylene blue (MB) removal from aqueous solution. The structure and surface characteristics of AC-alginate beads were analyzed using Fourier transform infra-red (FTIR) spectroscopy, scanning electron microscopy (SEM) and surface area analysis (S BET ), while thermal properties were tested using thermogravimetric analysis (TGA). The effect of AC-alginate dose, pH of solution, contact time, initial concentration of MB solution and temperature on MB removal was elucidated. The results showed that the maximum adsorption capacity of 230mg/g was achieved for 100mg/L of MB solution at pH 9.5 and temperature 25°C. Furthermore, the adsorption of MB on AC-alginate beads followed well pseudo-second order equation and equilibrium adsorption data were better fitted by the Freundlich isotherm model. The findings reveal the feasibility of AC-alginate beads composite to be used as a potential and low cost adsorbent for removal of cationic dyes. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Net primary productivity distribution in the BOREAS region from a process model using satellite and surface data

    Science.gov (United States)

    Liu, J.; Chen, J. M.; Cihlar, J.; Chen, W.

    1999-11-01

    The purpose of this paper is to upscale tower measurements of net primary productivity (NPP) to the Boreal Ecosystem-Atmosphere Study (BOREAS) study region by means of remote sensing and modeling. The Boreal Ecosystem Productivity Simulator (BEPS) with a new daily canopy photosynthesis model was first tested in one coniferous and one deciduous site. The simultaneous CO2 flux measurements above and below the tree canopy made it possible to isolate daily net primary productivity of the tree canopy for model validation. Soil water holding capacity and gridded daily meteorological data for the region were used as inputs to BEPS, in addition to 1 km resolution land cover and leaf area index (LAI) maps derived from the advanced very high resolution radiometer (AVHRR) data. NPP statistics for the various cover types in the BOREAS region and in the southern study area (SSA) and the northern study area (NSA) are presented. Strong dependence of NPP on LAI was found for the three major cover types: coniferous forest, deciduous forest and cropland. Since BEPS can compute total photosynthetically active radiation absorbed by the canopy in each pixel, light use efficiencies for NPP and gross primary productivity could also be analyzed. From the model results, the following area-averaged statistics were obtained for 1994: (1) mean NPP for the BOREAS region of 217 g C m-2 yr-1; (2) mean NPP of forests (excluding burnt areas in the region) equal to 234 g C m-2 yr-1; (3) mean NPP for the SSA and the NSA of 297 and 238 g C m-2 yr-1, respectively; and (4) mean light use efficiency for NPP equal to 0.40, 0.20, and 0.33 g C (MJ APAR)-1 for deciduous forest, coniferous forest, and crops, respectively.

  4. Temporal variations of surface water quality in urban, suburban and rural areas during rapid urbanization in Shanghai, China

    International Nuclear Information System (INIS)

    Wang Junying; Da Liangjun; Song Kun; Li Bailian

    2008-01-01

    As the economic and financial center of China, Shanghai has experienced an extensive urban expansion since the early 1980s, with an attendant cost in environmental degradation. We use an integrated pollution index to study the temporal variations of surface water quality in urban, suburban and rural areas between 1982 and 2005. Data on monitored cross-sections were collected from the Shanghai Environmental Monitoring Center. The results indicated that the spatial pattern of surface water quality was determined by the level of urbanization. Surface water qualities in urban and suburban areas were improved by strengthening the environmental policies and management, but were worsening in rural areas. The relationship between economic growth and surface water quality in Shanghai showed an inversed-U-shaped curve, which reflected a similar pattern in most developed countries. This research suggests that decision makers and city officials should be more aware of the recent pollution increases in Shanghai. - An integrated pollution index documents the deterioration of water quality in greater Shanghai, recently most serious in rural sections

  5. High surface area carbon for bifunctional air electrodes applied in zinc-air batteries

    Energy Technology Data Exchange (ETDEWEB)

    Arai, H [on leave from NTT Laboratories (Japan); Mueller, S; Haas, O [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1999-08-01

    Bifunctional air electrodes with high surface area carbon substrates showed low reduction overpotential, thus are promising for enhancing the energy efficiency and power capability of zinc-air batteries. The improved performance is attributed to lower overpotential due to diffusion of the reaction intermediate, namely the peroxide ion. (author) 1 fig., 2 refs.

  6. Supercritical processing as a route to high internal surface areas and permanent microporosity in metal-organic framework materials.

    Science.gov (United States)

    Nelson, Andrew P; Farha, Omar K; Mulfort, Karen L; Hupp, Joseph T

    2009-01-21

    Careful processing of four representative metal-organic framework (MOF) materials with liquid and supercritical carbon dioxide (ScD) leads to substantial, or in some cases spectacular (up to 1200%), increases in gas-accessible surface area. Maximization of surface area is key to the optimization of MOFs for many potential applications. Preliminary evidence points to inhibition of mesopore collapse, and therefore micropore accessibility, as the basis for the extraordinarily efficacious outcome of ScD-based activation.

  7. DISCOVERY OF A DAMPED Lyα ABSORBER AT z = 3.3 ALONG A GALAXY SIGHT-LINE IN THE SSA22 FIELD

    Energy Technology Data Exchange (ETDEWEB)

    Mawatari, K.; Inoue, A. K. [College of General Education, Osaka Sangyo University, 3-1-1, Nakagaito, Daito, Osaka, 574-8530 (Japan); Kousai, K.; Hayashino, T. [Research Center for Neutrino Science, General School of Science, Tohoku University, Aoba, Aramaki, Aoba-ku, Sendai, Miyagi, 980-8578 (Japan); Cooke, R.; Prochaska, J. X. [Department of Astronomy and Astrophysics, UCO/Lick Observatory, University of California, 1156 High Street, Santa Cruz, CA 95064 (United States); Yamada, T. [Astronomical Institute, Tohoku University, Aoba, Aramaki, Aoba-ku, Sendai, Miyagi, 980-8578 (Japan); Matsuda, Y., E-mail: mawatari@las.osaka-sandai.ac.jp [National Astronomical Observatory of Japan, Osawa 2-21-1, Mitaka, Tokyo 181-8588 (Japan)

    2016-02-01

    Using galaxies as background light sources to map the Lyα absorption lines is a novel approach to study Damped Lyα Absorbers (DLAs). We report the discovery of an intervening z = 3.335 ± 0.007 DLA along a galaxy sight-line identified among 80 Lyman Break Galaxy (LBG) spectra obtained with our Very Large Telescope/Visible Multi-Object Spectrograph survey in the SSA22 field. The measured DLA neutral hydrogen (H i) column density is log(N{sub H} {sub i}/cm{sup −2}) = 21.68 ± 0.17. The DLA covering fraction over the extended background LBG is >70% (2σ), yielding a conservative constraint on the DLA area of ≳1 kpc{sup 2}. Our search for a counterpart galaxy hosting this DLA concludes that there is no counterpart galaxy with star formation rate larger than a few M{sub ⊙} yr{sup −1}, ruling out an unobscured violent star formation in the DLA gas cloud. We also rule out the possibility that the host galaxy of the DLA is a passive galaxy with M{sub *} ≳ 5 × 10{sup 10}M{sub ⊙} or a heavily dust-obscured galaxy with E(B − V) ≳ 2. The DLA may coincide with a large-scale overdensity of the spectroscopic LBGs. The occurrence rate of the DLA is compatible with that of DLAs found in QSO sight-lines.

  8. The health and wellbeing of young people in sub-Saharan Africa: an under-researched area?

    OpenAIRE

    Kabiru, Caroline W; Izugbara, Chimaraoke O; Beguy, Donatien

    2013-01-01

    Abstract A third of sub-Saharan Africa’s (SSA) population comprises persons aged 10–24 years. These youth are growing up in a context marked by pervasive poverty, limited educational opportunities, high HIV/AIDS prevalence, widespread conflict, and weak social controls. Published research on the broad issues that affect youth health and wellbeing in SSA is limited and centers heavily on sexual and reproductive health. In this commentary, we provide a broad overview of sub-Saharan African yout...

  9. Volumes, Masses, and Surface Areas for Shippingport LWBR Spent Nuclear Fuel in a DOE SNF Canister

    International Nuclear Information System (INIS)

    J.W. Davis

    1999-01-01

    The purpose of this calculation is to estimate volumes, masses, and surface areas associated with (a) an empty Department of Energy (DOE) 18-inch diameter, 15-ft long spent nuclear fuel (SNF) canister, (b) an empty DOE 24-inch diameter, 15-ft long SNF canister, (c) Shippingport Light Water Breeder Reactor (LWBR) SNF, and (d) the internal basket structure for the 18-in. canister that has been designed specifically to accommodate Seed fuel from the Shippingport LWBR. Estimates of volumes, masses, and surface areas are needed as input to structural, thermal, geochemical, nuclear criticality, and radiation shielding calculations to ensure the viability of the proposed disposal configuration

  10. Surface area and pore size characteristics of nanoporous gold subjected to thermal, mechanical, or surface modification studied using gas adsorption isotherms, cyclic voltammetry, thermogravimetric analysis, and scanning electron microscopy

    Science.gov (United States)

    Tan, Yih Horng; Davis, Jason A.; Fujikawa, Kohki; Ganesh, N. Vijaya; Demchenko, Alexei V.

    2012-01-01

    Nitrogen adsorption/desorption isotherms are used to investigate the Brunauer, Emmett, and Teller (BET) surface area and Barrett-Joyner-Halenda (BJH) pore size distribution of physically modified, thermally annealed, and octadecanethiol functionalized np-Au monoliths. We present the full adsorption-desorption isotherms for N2 gas on np-Au, and observe type IV isotherms and type H1 hysteresis loops. The evolution of the np-Au under various thermal annealing treatments was examined using scanning electron microscopy (SEM). The images of both the exterior and interior of the thermally annealed np-Au show that the porosity of all free standing np-Au structures decreases as the heat treatment temperature increases. The modification of the np-Au surface with a self-assembled monolayer (SAM) of C18-SH (coverage of 2.94 × 1014 molecules cm−2 based from the decomposition of the C18-SH using thermogravimetric analysis (TGA)), was found to reduce the strength of the interaction of nitrogen gas with the np-Au surface, as reflected by a decrease in the ‘C’ parameter of the BET equation. From cyclic voltammetry studies, we found that the surface area of the np-Au monoliths annealed at elevated temperatures followed the same trend with annealing temperature as found in the BET surface area study and SEM morphology characterization. The study highlights the ability to control free-standing nanoporous gold monoliths with high surface area, and well-defined, tunable pore morphology. PMID:22822294

  11. Should blood flow during cardiopulmonary bypass be individualized more than to body surface area?

    DEFF Research Database (Denmark)

    Thomassen, Sisse Anette; Larsson, A; Andreasen, Jan Jesper

    Blood flow during cardiopulmonary bypass (CPB) is calculated on body surface area (BSA). Increasing comorbidity, age and weight of today's cardiac patients question this calculation as it may not reflect individual metabolic requirement. The hypothesis was that a measured cardiac index (CI) prior...

  12. The Virtual Observatory Service TheoSSA: Establishing a Database of Synthetic Stellar Flux Standards I. NLTE Spectral Analysis of the DA-Type White Dwarf G191-B2B *,**,***,****

    Science.gov (United States)

    Rauch, T.; Werner, K.; Bohlin, R.; Kruk, J. W.

    2013-01-01

    Hydrogen-rich, DA-type white dwarfs are particularly suited as primary standard stars for flux calibration. State-of-the-art NLTE models consider opacities of species up to trans-iron elements and provide reliable synthetic stellar-atmosphere spectra to compare with observations. Aims. We will establish a database of theoretical spectra of stellar flux standards that are easily accessible via a web interface. Methods. In the framework of the Virtual Observatory, the German Astrophysical Virtual Observatory developed the registered service TheoSSA. It provides easy access to stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code. In case of the DA white dwarf G191-B2B, we demonstrate that the model reproduces not only its overall continuum shape but also the numerous metal lines exhibited in its ultraviolet spectrum. Results. TheoSSA is in operation and contains presently a variety of SEDs for DA-type white dwarfs. It will be extended in the near future and can host SEDs of all primary and secondary flux standards. The spectral analysis of G191-B2B has shown that our hydrostatic models reproduce the observations best at Teff =60 000 +/- 2000K and log g=7.60 +/- 0.05.We newly identified Fe vi, Ni vi, and Zn iv lines. For the first time, we determined the photospheric zinc abundance with a logarithmic mass fraction of -4.89 (7.5 × solar). The abundances of He (upper limit), C, N, O, Al, Si, O, P, S, Fe, Ni, Ge, and Sn were precisely determined. Upper abundance limits of about 10% solar were derived for Ti, Cr, Mn, and Co. Conclusions. The TheoSSA database of theoretical SEDs of stellar flux standards guarantees that the flux calibration of all astronomical data and cross-calibration between different instruments can be based on the same models and SEDs calculated with different model-atmosphere codes and are easy to compare.

  13. Decadal changes of surface elevation over permafrost area estimated using reflected GPS signals

    Science.gov (United States)

    Liu, Lin; Larson, Kristine M.

    2018-02-01

    Conventional benchmark-based survey and Global Positioning System (GPS) have been used to measure surface elevation changes over permafrost areas, usually once or a few times a year. Here we use reflected GPS signals to measure temporal changes of ground surface elevation due to dynamics of the active layer and near-surface permafrost. Applying the GPS interferometric reflectometry technique to the multipath signal-to-noise ratio data collected by a continuously operating GPS receiver mounted deep in permafrost in Barrow, Alaska, we can retrieve the vertical distance between the antenna and reflecting surface. Using this unique kind of observables, we obtain daily changes of surface elevation during July and August from 2004 to 2015. Our results show distinct temporal variations at three timescales: regular thaw settlement within each summer, strong interannual variability that is characterized by a sub-decadal subsidence trend followed by a brief uplift trend, and a secular subsidence trend of 0.26 ± 0.02 cm year-1 during 2004 and 2015. This method provides a new way to fully utilize data from continuously operating GPS sites in cold regions for studying dynamics of the frozen ground consistently and sustainably over a long time.

  14. Evaluation of The Surface Ozone Concentrations In Greater Cairo Area With Emphasis On Helwan, Egypt

    International Nuclear Information System (INIS)

    Ramadan, A.; Kandil, A.T.; Abd Elmaged, S.M.; Mubarak, I.

    2011-01-01

    Various biogenic and anthropogenic sources emit huge quantities of surface ozone. The main purpose of this study is to evaluate the surface ozone levels present at Helwan area in order to improve the knowledge and understanding troposphere processes. Surface Ozone has been measured at 2 sites at Helwan; these sites cover the most populated area in Helwan. Ozone concentration is continuously monitored by UV absorption photometry using the equipment O 3 41 M UV Photometric Ozone Analyzer. The daily maximum values of the ozone concentration in the greater Cairo area have approached but did not exceeded the critical levels during the year 2008. Higher ozone concentrations at Helwan are mainly due to the transport of ozone from regions further to the north of greater Cairo and to a lesser extent of ozone locally generated by photochemical smog process. The summer season has the largest diurnal variation, with the tendency of the daily ozone maxima occur in the late afternoon. The night time concentration of ozone was significantly higher at Helwan because there are no fast acting sinks, destroying ozone since the average night time concentration of ozone is maintained at 40 ppb at the site. No correlation between the diurnal total suspended particulate (TSP) matter and the diurnal cumulative ozone concentration was observed during the Khamasin period

  15. A high surface area Zr(IV)-based metal–organic framework showing stepwise gas adsorption and selective dye uptake

    Energy Technology Data Exchange (ETDEWEB)

    Lv, Xiu-Liang [Beijing Key Laboratory for Green Catalysis and Separation, Department of Chemistry and Chemical Engineering, Beijing University of Technology, Beijing 100124 (China); Tong, Minman; Huang, Hongliang [College of Chemical Engineering, Beijing University of Chemical Technology, Beijing 100029 (China); Wang, Bin; Gan, Lei [Beijing Key Laboratory for Green Catalysis and Separation, Department of Chemistry and Chemical Engineering, Beijing University of Technology, Beijing 100124 (China); Yang, Qingyuan [College of Chemical Engineering, Beijing University of Chemical Technology, Beijing 100029 (China); Zhong, Chongli [College of Chemical Engineering, Beijing University of Chemical Technology, Beijing 100029 (China); State Key Laboratory of Organic–Inorganic Composites, Beijing University of Chemical Technology, Beijing 100029 (China); Li, Jian-Rong, E-mail: jrli@bjut.edu.cn [Beijing Key Laboratory for Green Catalysis and Separation, Department of Chemistry and Chemical Engineering, Beijing University of Technology, Beijing 100124 (China); State Key Laboratory of Organic–Inorganic Composites, Beijing University of Chemical Technology, Beijing 100029 (China)

    2015-03-15

    Exploitation of new metal–organic framework (MOF) materials with high surface areas has been attracting great attention in related research communities due to their broad potential applications. In this work, a new Zr(IV)-based MOF, [Zr{sub 6}O{sub 4}(OH){sub 4}(eddb){sub 6}] (BUT-30, H{sub 2}eddb=4,4′-(ethyne-1,2-diyl)dibenzoic acid) has been solvothermally synthesized, characterized, and explored for gases and dyes adsorptions. Single-crystal X-ray diffraction analysis demonstrates a three-dimensional cubic framework structure of this MOF, in which each Zr{sub 6}O{sub 4}(OH){sub 4} building unit is linked by 12 linear eddb ligands. BUT-30 has been found stable up to 400 °C and has a Brunauer–Emmett–Teller (BET) surface area as high as 3940.6 m{sup 2} g{sup −1} (based on the N{sub 2} adsorption at 77 K) and total pore volume of 1.55 cm{sup 3} g{sup −1}. It is more interesting that this MOF exhibits stepwise adsorption behaviors for Ar, N{sub 2}, and CO{sub 2} at low temperatures, and selective uptakes towards different ionic dyes. - Graphical abstract: A new Zr(IV)-based MOF with high surface area has been synthesized and structurally characterized, which shows stepwise gas adsorption at low temperature and selective dye uptake from solution. - Highlights: • A new Zr-based MOF was synthesized and structurally characterized. • This MOF shows a higher surface area compared with its analogous UiO-67 and 68. • This MOF shows a rare stepwise adsorption towards light gases at low temperature. • This MOF performs selective uptakes towards cationic dyes over anionic ones. • Using triple-bond spacer is confirmed feasible in enhancing MOF surface areas.

  16. Single-row modified mason-allen versus double-row arthroscopic rotator cuff repair: a biomechanical and surface area comparison.

    Science.gov (United States)

    Nelson, Cory O; Sileo, Michael J; Grossman, Mark G; Serra-Hsu, Frederick

    2008-08-01

    The purpose of this study was to compare the time-zero biomechanical strength and the surface area of repair between a single-row modified Mason-Allen rotator cuff repair and a double-row arthroscopic repair. Six matched pairs of sheep infraspinatus tendons were repaired by both techniques. Pressure-sensitive film was used to measure the surface area of repair for each configuration. Specimens were biomechanically tested with cyclic loading from 20 N to 30 N for 20 cycles and were loaded to failure at a rate of 1 mm/s. Failure was defined at 5 mm of gap formation. Double-row suture anchor fixation restored a mean surface area of 258.23 +/- 69.7 mm(2) versus 148.08 +/- 75.5 mm(2) for single-row fixation, a 74% increase (P = .025). Both repairs had statistically similar time-zero biomechanics. There was no statistical difference in peak-to-peak displacement or elongation during cyclic loading. Single-row fixation showed a higher mean load to failure (110.26 +/- 26.4 N) than double-row fixation (108.93 +/- 21.8 N). This was not statistically significant (P = .932). All specimens failed at the suture-tendon interface. Double-row suture anchor fixation restores a greater percentage of the anatomic footprint when compared with a single-row Mason-Allen technique. The time-zero biomechanical strength was not significantly different between the 2 study groups. This study suggests that the 2 factors are independent of each other. Surface area and biomechanical strength of fixation are 2 independent factors in the outcome of rotator cuff repair. Maximizing both factors may increase the likelihood of complete tendon-bone healing and ultimately improve clinical outcomes. For smaller tears, a single-row modified Mason-Allen suture technique may provide sufficient strength, but for large amenable tears, a double row can provide both strength and increased surface area for healing.

  17. Uptake of acetone, ethanol and benzene to snow and ice: effects of surface area and temperature

    International Nuclear Information System (INIS)

    Abbatt, J P D; Bartels-Rausch, T; Ullerstam, M; Ye, T J

    2008-01-01

    The interactions of gas-phase acetone, ethanol and benzene with smooth ice films and artificial snow have been studied. In one technique, the snow is packed into a cylindrical column and inserted into a low-pressure flow reactor coupled to a chemical-ionization mass spectrometer for gas-phase analysis. At 214 and 228 K, it is found for acetone and ethanol that the adsorbed amounts per surface area match those for adsorption to thin films of ice formed by freezing liquid water, when the specific surface area of the snow (as determined from Kr adsorption at 77 K) and the geometric surface area of the ice films are used. This indicates that freezing thin films of water leads to surfaces that are smooth at the molecular level. Experiments performed to test the effect of film growth on ethanol uptake indicate that uptake is independent of ice growth rate, up to 2.4 μm min -1 . In addition, traditional Brunauer-Emmett-Teller (BET) experiments were performed with these gases on artificial snow from 238 to 266.5 K. A transition from a BET type I isotherm indicative of monolayer formation to a BET type II isotherm indicative of multilayer uptake is observed for acetone at T≥263 K and ethanol at T≥255 K, arising from solution formation on the ice. When multilayer formation does not occur, as was the case for benzene at T≤263 K and for acetone at T≤255 K, the saturated surface coverage increased with increasing temperature, consistent with the quasi-liquid layer affecting adsorption prior to full dissolution/multilayer formation.

  18. Preparation of High Surface Area Activated Carbon from Spent Phenolic Resin by Microwave Heating and KOH Activation

    Science.gov (United States)

    Cheng, Song; Zhang, Libo; Zhang, Shengzhou; Xia, Hongying; Peng, Jinhui

    2018-01-01

    The spent phenolic resin is as raw material for preparing high surface area activated carbon (HSAAC) by microwave-assisted KOH activation. The effects of microwave power, activation duration and impregnation ratio (IR) on the iodine adsorption capability and yield of HSAAC were investigated. The surface characteristics of HSAAC were characterized by nitrogen adsorption isotherms, FTIR, SEM and TEM. The operating variables were optimized utilizing the response surface methodology (RSM) and were identified to be microwave power of 700 W, activation duration of 15 min and IR of 4, corresponding to a yield of 51.25 % and an iodine number of 2,384 mg/g. The pore structure parameters of the HSAAC, i. e., Brunauer-Emmett-Teller (BET) surface area, total pore volume, and average pore diameter were estimated to be 4,269 m2/g, 2.396 ml/g and 2.25 nm, respectively, under optimum conditions. The findings strongly support the feasibility of microwave-assisted KOH activation for preparation of HSAAC from spent phenolic resin.

  19. FIBRIN-TYPE FIBRINOID IN HUMAN PLACENTA: A STEREOLOGICAL ANALYSIS OF ITS ASSOCIATION WITH INTERVILLOUS VOLUME AND VILLOUS SURFACE AREA

    Directory of Open Access Journals (Sweden)

    Terry M Mayhew

    2011-05-01

    Full Text Available Stereological methods were used to examine fibrin-type fibrinoid deposition in the intervillous spaces of human placentas collected during gestation (12-41 weeks and from term pregnancies at low (400 m and high (3.6 km altitude. The main aim was to test predictions about the relationships between fibrinoid deposits and either the volume of intervillous space or the surface area of (intermediate + terminal villi. Fields of view on Masson trichrome-stained paraffin sections were selected as part of a systematic sampling design which randomised section location and orientation. Relative and absolute volumes were estimated by test point counting and surfaces by intersection counting. Apparent differences were tested by analyses of variance and relationships by correlation and regression analysis. Fibrinoid volume increased during gestation and correlated positively with intervillous volume and villous surface area. However, relative to intervillous volume, the main increase in fibrinoid occurred towards term (36-41 weeks. At high altitude, placentas contained more intervillous space but less fibrinoid. At both altitudes, there were significant correlations between fibrinoid volume and villous surface area. In all cases, changes in fibrinoid volume were commensurate with changes in villous surface area. Whilst findings lend support to the notion that fibrinoid deposition during normal gestation is influenced by the quality of vascular perfusion, they also emphasise that the extent of the villous surface is a more generally important factor. The villous surface may influence the steady state between coagulation and fibrinolysis since some pro-coagulatory events operate at the trophoblastic epithelium. They occur notably at sites of trophoblast de-epithelialisation and these arise following trauma or during the extrusion phase of normal epithelial turnover.

  20. Sea Spray Aerosol Production over the North Atlantic

    Science.gov (United States)

    Bates, T. S.; Quinn, P.

    2017-12-01

    Breaking waves on the ocean surface generate air bubbles that scavenge organic matter from the surrounding seawater. When injected into the atmosphere, these bubbles burst, yielding sea spray aerosol (SSA), a mixture of organic and inorganic compounds with the organic matter enriched relative to seawater. SSA mass is well documented as the dominant component of aerosol light scattering over the remote oceans. The importance of SSA number to marine boundary layer cloud condensation nuclei (CCN) is much less certain. During the Western Atlantic Climate Study cruises (WACS-1 - August 2012 and WACS-2 - May-June 2014) and the North Atlantic Aerosols and Marine Ecosystem Study cruises (NAAMES-1 - November 2015, NAAMES-2 - May 2016, and NAAMES-3 - September 2017), we generated and measured freshly emitted SSA using the Sea Sweep SSA generator. During the 2017 cruise we also generated SSA with a Marine Aerosol Reference Tank (MART). Using the data generated on these 5 cruises and a large database of remote marine boundary layer aerosol measurements we will address three questions during this presentation: 1 - Do phytoplankton ecosystems affect the organic enrichment of freshly emitted SSA?, 2 - Do plankton ecosystems affect the number production flux of SSA?, and 3 - Is SSA a significant source of atmospheric CCN?