
Sample records for surface area ssa

  1. BOREAS AFM-08 ECMWF Hourly Surface and Upper Air Data for the SSA and NSA (United States)

    Viterbo, Pedro; Betts, Alan; Hall, Forrest G. (Editor); Newcomer, Jeffrey A.; Smith, David E. (Technical Monitor)


    The Boreal Ecosystem-Atmosphere Study (BOREAS) Airborne Fluxes and Meteorology (AFM)-8 team focused on modeling efforts to improve the understanding of the diurnal evolution of the convective boundary layer over the boreal forest. This data set contains hourly data from the European Center for for Medium-Range Weather Forecasts (ECMWF) operational model from below the surface to the top of the atmosphere, including the model fluxes at the surface. Spatially, the data cover a pair of the points that enclose the rawinsonde sites at Candle Lake, Saskatchewan, in the Southern Study Area (SSA) and Thompson, Manitoba, in the Northern Study Area (NSA). Temporally, the data include the two time periods of 13 May 1994 to 30 Sept 1994 and 01 Mar 1996 to 31 Mar 1997. The data are stored in tabular ASCII files. The number of records in the upper air data files may exceed 20,000, causing a problem for some software packages. The ECMWF hourly surface and upper air data are available from the Earth Observing System Data and Information System (EOSDIS) Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC). The data files are available on a CD-ROM (see document number 20010000884).

  2. BOREAS TF-06 SSA-YA Surface Energy Flux and Meteorological Data (United States)

    National Aeronautics and Space Administration — ABSTRACT: Contains meteorology data collected at the SSA-YA tower flux site by the TF6 group. These data were reported at 10 minute intervals. The flux and ancillary...

  3. Molecularly-Limited Fractal Surface Area of Mineral Powders

    Directory of Open Access Journals (Sweden)

    Petr Jandacka


    Full Text Available The topic of the specific surface area (SSA of powders is not sufficiently described in the literature in spite of its nontrivial contribution to adsorption and dissolution processes. Fractal geometry provides a way to determine this parameter via relation SSA ~ x(D − 3s(2 − D, where x (m is the particle size and s (m is a scale. Such a relation respects nano-, micro-, or macro-topography on the surface. Within this theory, the fractal dimension 2 ≤ D < 3 and scale parameter s plays a significant role. The parameter D may be determined from BET or dissolution measurements on several samples, changing the powder particle sizes or sizes of adsorbate molecules. If the fractality of the surface is high, the SSA does not depend on the particle size distribution and vice versa. In this paper, the SSA parameter is analyzed from the point of view of adsorption and dissolution processes. In the case of adsorption, a new equation for the SSA, depending on the term (2 − D∙(s2 − sBET/sBET, is derived, where sBET and s2 are effective cross-sectional diameters for BET and new adsorbates. Determination of the SSA for the dissolution process appears to be very complicated, since the fractality of the surface may change in the process. Nevertheless, the presented equations have good application potential.

  4. Ultraviolet radiation (UVR) induces cell-surface Ro/SSA antigen expression by human keratinocytes in vitro: a possible mechanism for the UVR induction of cutaneous lupus lesions

    International Nuclear Information System (INIS)

    Jones, S.K.


    Antinuclear antibodies are useful markers of connective tissue disease. In this study, UVB but not UVA induced the expression of Ro/SSA antigen on keratinocyte surfaces in vitro. This expression was also found with the extractable nuclear antigens RnP and Sm, but not with single or double-stranded DNA. The expression was prevented by blocking protein synthesis, suggesting that it was an active process. The results suggest that UVB exposure may result in the expression of Ro/SSA antigen on the surfaces of basal keratinocytes in vivo. This antigen could then bind circulating antibody leading to the cutaneous lesions in neonatal and subacute cutaneous lupus erythematosus. (Author)

  5. Preliminary Modelling of Mass Flux at the Surface of Plant Leaves within the MELiSSA Higher Plant Compartments (United States)

    Holmberg, Madeleine; Paille, Christel; Lasseur, Christophe

    The ESA project Micro Ecological Life Support System Alternative (MELiSSA) is an ecosystem of micro-organisms and higher plants, constructed with the objective of being operated as a tool to understand artificial ecosystems to be used for a long-term or permanent manned planetary base (e.g. Moon or Mars). The purpose of such a system is to provide for generation of food, water recycling, atmospheric regeneration and waste management within defined standards of quality and reliability. As MELiSSA consists of individual compartments which are connected to each other, the robustness of the system is fully dependent on the control of each compartment, as well as the flow management between them. Quality of consumables and reliability of the ecosystem rely on the knowledge, understanding and control of each of the components. This includes the full understanding of all processes related to the higher plants. To progress in that direction, this paper focuses on the mechanical processes driving the gas and liquid exchanges between the plant leaf and its environment. The process responsible for the mass transfer on the surface of plant leaves is diffusion. The diffusion flux is dependent on the behaviour of the stoma of the leaf and also on the leaf boundary layer (BL). In this paper, the physiology of the leaf is briefly examined in order to relate parameters such as light quality, light quantity, CO2 concentration, temperature, leaf water potential, humidity, vapour pressure deficit (VPD) gradients and pollutants to the opening or closing of stomata. The diffusion process is described theoretically and the description is compared to empirical approaches. The variables of the BL are examined and the effect airflow in the compartment has on the BL is investigated. Also presented is the impact changes in different environmental parameters may have on the fluid exchanges. Finally, some tests, to evaluate the accuracy of the concluded model, are suggested.

  6. A template-free solvent-mediated synthesis of high surface area boron nitride nanosheets for aerobic oxidative desulfurization. (United States)

    Wu, Peiwen; Zhu, Wenshuai; Chao, Yanhong; Zhang, Jinshui; Zhang, Pengfei; Zhu, Huiyuan; Li, Changfeng; Chen, Zhigang; Li, Huaming; Dai, Sheng


    Hexagonal boron nitride nanosheets (h-BNNs) with rather high specific surface area (SSA) are important two-dimensional layer-structured materials. Here, a solvent-mediated synthesis of h-BNNs revealed a template-free lattice plane control strategy that induced high SSA nanoporous structured h-BNNs with outstanding aerobic oxidative desulfurization performance.

  7. The MELiSSA GreenMOSS Study: Preliminary Design Considerations for a Greenhouse Module on the Lunar Surface (United States)

    Lobascio, Cesare; Paille, Christel; Lamantea, Matteo Maria; Boscheri, Giorgio; Rossetti, Vittorio

    Extended human presence on an extraterrestrial planetary surface will be made possible by the development of life support systems affordable in the long term. The key elements to support the goal will be the maximization of closure of air and water cycles, as well as the development of cost-effective and reliable hardware, including a careful strategic effort toward reduction of spare parts and consumables. Regenerative life support systems likely represent the final step toward long term sustainability of a space crew, allowing in situ food production and regeneration of organic waste. Referring to the MELiSSA loop, a key element for food production is the Higher Plant Compartment. The paper focuses on the preliminary design of a Greenhouse at the lunar South Pole, as performed within the “Greenhouse Module for Space System” (GreenMOSS) study, under a contract from the European Space Agency. The greenhouse is in support to a relatively small crew for provision of an energetic food complement. Resources necessary for the greenhouse such as water, carbon dioxide and nitrogen are assumed available, as required. The relevant mass and energy balances for incoming resources should be part of future studies, and should help integrate this element with the interfacing MELISSA compartments. Net oxygen production and harvested crop biomass from the greenhouse system will be quantified. This work presents the results of the two major trade-offs performed as part of this study: artificial vs natural illumination and monocrop vs multicrop solutions. Comparisons among possible design solutions were driven by the ALiSSE metric as far as practicable within this preliminary stage, considering mass and power parameters. Finally, the paper presents the mission duration threshold for determining the convenience of the designed solution with respect to other resources provision strategies

  8. Dynamic characterisation of the specific surface area for fracture networks (United States)

    Cvetkovic, V.


    One important application of chemical transport is geological disposal of high-level nuclear waste for which crystalline rock is a prime candidate for instance in Scandinavia. Interconnected heterogeneous fractures of sparsely fractured rock such as granite, act as conduits for transport of dissolved tracers. Fluid flow is known to be highly channelized in such rocks. Channels imply narrow flow paths, adjacent to essentially stagnant water in the fracture and/or the rock matrix. Tracers are transported along channelised flow paths and retained by minerals and/or stagnant water, depending on their sorption properties; this mechanism is critical for rocks to act as a barrier and ultimately provide safety for a geological repository. The sorbing tracers are retained by diffusion and sorption on mineral surfaces, whereas non-sorbing tracers can be retained only by diffusion into stagnant water of fractures. The retention and transport properties of a sparsely fractured rock will primarily depend on the specific surface area (SSA) of the fracture network which is determined by the heterogeneous structure and flow. The main challenge when characterising SSA on the field-scale is its dependence on the flow dynamics. We first define SSA as a physical quantity and clarify its importance for chemical transport. A methodology for dynamic characterisation of SSA in fracture networks is proposed that relies on three sets of data: i) Flow rate data as obtained by a flow logging procedure; ii) transmissivity data as obtained by pumping tests; iii) fracture network data as obtained from outcrop and geophysical observations. The proposed methodology utilises these data directly as well as indirectly through flow and particle tracking simulations in three-dimensional discrete fracture networks. The methodology is exemplified using specific data from the Swedish site Laxemar. The potential impact of uncertainties is of particular significance and is illustrated for radionuclide

  9. Synthesis and crystal structures of a novel layered silicate SSA-1 and its microporous derivatives by topotactic transformation. (United States)

    Takahashi, S; Kurita, Y; Ikeda, T; Miyamoto, M; Uemiya, S; Oumi, Y


    The synthesis of a novel layered silicate SSA-1 (SSA: silicate synthesized with a quaternary amine) was achieved in the SiO 2 -H 2 O-TEAOH (TEAOH: tetraethylammonium hydroxide - as an organic structural directing agent) system. The crystal structure of SSA-1 involved two silicate layers composed of bre [10T]-type CBU (Composite Building Unit) and TEAOH in interlayers. The topotactic transformation of SSA-1 by calcination was examined, resulting in a porous material (PML-1: porous material transformed from a layered silicate) with a 108 m 2 g -1 BET surface area and 0.035 cm 3 g -1 pore volume. PML-1 is a siliceous microporous material with silanols in the framework and possesses unique properties, such as hydrophilicity, in spite of all its silica composition. The most reasonable crystal structure of PML-1 was successfully determined on the basis of the crystal structure of SSA-1 by a combination of manual modelling, PXRD pattern simulation, DFT optimization and Rietveld analysis. Additionally, an interlayer expanded siliceous zeolite SSA-1 (IEZ-SSA-1) was also successfully prepared by silylation using trichloro(methyl)silane under acidic conditions. IEZ-SSA-1 showed hydrophilicity or hydrophobicity properties by changing the functional group of the pillar part in the interlayer. Additionally, IEZ-SSA-1 showed a large gas adsorption property (537 m 2 g -1 and 0.21 cm 3 g -1 ).

  10. SSA Disability Claim Data (United States)

    Social Security Administration — The dataset includes fiscal year data for initial claims for SSA disability benefits that were referred to a state agency for a disability determination. Specific...

  11. Experiment Study on Determination of Surface Area of Finegrained Soils by Mercury Intrusion Porosimetry (United States)

    Yan, X. Q.; Zhou, C. Y.; Fang, Y. G.; Lin, L. S.


    The specific surface area (SSA) has a great influence on the physical and chemical properties of fine-grained soils. Determination of specific surface area is an important content for fine-grained soils micro-meso analysis and characteristic research. In this paper, mercury intrusion porosimetry (MIP) was adopted to determine the SSA of fine-grained soils including quartz, kaolinite, bentonite and natural Shenzhen soft clay. The test results show that the average values of SSA obtained by MIP are 0.78m2/g, 11.31m2/g, 57.28m2/g and 27.15m2/g respectively for very fine-grained quartz, kaolin, bentonite and natural Shenzhen soft clay, and that it is feasible to apply MIP to obtain the SSA of fine-grained soils through statistical analysis of 97 samples. Through discussion, it is necessary to consider the state of fine-grained soils such as pore ratio when the SSA of fine-grained soils is determined by MIP.

  12. Dual Orlicz geominimal surface area

    Directory of Open Access Journals (Sweden)

    Tongyi Ma


    Full Text Available Abstract The L p $L_{p}$ -geominimal surface area was introduced by Lutwak in 1996, which extended the important concept of the geominimal surface area. Recently, Wang and Qi defined the p-dual geominimal surface area, which belongs to the dual Brunn-Minkowski theory. In this paper, based on the concept of the dual Orlicz mixed volume, we extend the dual geominimal surface area to the Orlicz version and give its properties. In addition, the isoperimetric inequality, a Blaschke-Santaló type inequality, and the monotonicity inequality for the dual Orlicz geominimal surface areas are established.


    Energy Technology Data Exchange (ETDEWEB)

    Daniel, G.


    The literature has been reviewed in December 2011 for calcination data of plutonium oxide (PuO{sub 2}) from plutonium oxalate Pu(C{sub 2}O{sub 4}){sub 2} precipitation with respect to the PuO{sub 2} specific surface area (SSA). A summary of the literature is presented for what are believed to be the dominant factors influencing SSA, the calcination temperature and time. The PuO{sub 2} from Pu(C{sub 2}O{sub 4}){sub 2} calcination data from this review has been regressed to better understand the influence of calcination temperature and time on SSA. Based on this literature review data set, calcination temperature has a bigger impact on SSA versus time. However, there is still some variance in this data set that may be reflecting differences in the plutonium oxalate preparation or different calcination techniques. It is evident from this review that additional calcination temperature and time data for PuO{sub 2} from Pu(C{sub 2}O{sub 4}){sub 2} needs to be collected and evaluated to better define the relationship. The existing data set has a lot of calcination times that are about 2 hours and therefore may be underestimating the impact of heating time on SSA. SRNL recommends that more calcination temperature and time data for PuO{sub 2} from Pu(C{sub 2}O{sub 4}){sub 2} be collected and this literature review data set be augmented to better refine the relationship between PuO{sub 2} SSA and its calcination parameters.

  14. Robot Towed Shortwave Infrared Camera for Specific Surface Area Retrieval of Surface Snow (United States)

    Elliott, J.; Lines, A.; Ray, L.; Albert, M. R.


    Optical grain size and specific surface area are key parameters for measuring the atmospheric interactions of snow, as well as tracking metamorphosis and allowing for the ground truthing of remote sensing data. We describe a device using a shortwave infrared camera with changeable optical bandpass filters (centered at 1300 nm and 1550 nm) that can be used to quickly measure the average SSA over an area of 0.25 m^2. The device and method are compared with calculations made from measurements taken with a field spectral radiometer. The instrument is designed to be towed by a small autonomous ground vehicle, and therefore rides above the snow surface on ultra high molecular weight polyethylene (UHMW) skis.

  15. AN EXAMPLE IN SURFACE AREA* (United States)

    Goffman, Casper


    For length and area, a central fact is that the value of the length of a curve or the area of a surface, as given by the Lebesgue theory, is at least as great as that given by the classical formula, whenever the latter has meaning. This is now found not to be valid in higher dimensions. We give an example of a continuous mapping of the unit cube into itself for which the value given by the formula exceeds the three-dimensional Lebesgue area of the corresponding suface. PMID:16591750

  16. Determination of retinal surface area. (United States)

    Nagra, Manbir; Gilmartin, Bernard; Thai, Ngoc Jade; Logan, Nicola S


    Previous attempts at determining retinal surface area and surface area of the whole eye have been based upon mathematical calculations derived from retinal photographs, schematic eyes and retinal biopsies of donor eyes. 3-dimensional (3-D) ocular magnetic resonance imaging (MRI) allows a more direct measurement, it can be used to image the eye in vivo, and there is no risk of tissue shrinkage. The primary purpose of this study is to compare, using T2-weighted 3D MRI, retinal surface areas for superior-temporal (ST), inferior-temporal (IT), superior-nasal (SN) and inferior-nasal (IN) retinal quadrants. An ancillary aim is to examine whether inter-quadrant variations in area are concordant with reported inter-quadrant patterns of susceptibility to retinal breaks associated with posterior vitreous detachment (PVD). Seventy-three adult participants presenting without retinal pathology (mean age 26.25 ± 6.06 years) were scanned using a Siemens 3-Tesla MRI scanner to provide T2-weighted MR images that demarcate fluid-filled internal structures for the whole eye and provide high-contrast delineation of the vitreous-retina interface. Integrated MRI software generated total internal ocular surface area (TSA). The second nodal point was used to demarcate the origin of the peripheral retina in order to calculate total retinal surface area (RSA) and quadrant retinal surface areas (QRSA) for ST, IT, SN, and IN quadrants. Mean spherical error (MSE) was -2.50 ± 4.03D and mean axial length (AL) 24.51 ± 1.57 mm. Mean TSA and RSA for the RE were 2058 ± 189 and 1363 ± 160 mm 2 , respectively. Repeated measures anova for QRSA data indicated a significant difference within-quadrants (P area/mm increase in AL. Although the differences between QRSAs are relatively small, there was evidence of concordance with reported inter-quadrant patterns of susceptibility to retinal breaks associated with PVD. The data allow AL to be converted to QRSAs, which will assist further

  17. SSA State Agency Workload Data (United States)

    Social Security Administration — The dataset is revised and expanded from 4 to 71 data fields. It includes monthly data from October 2000 onwards for SSA disability cases that were referred to the...

  18. Lp-dual affine surface area (United States)

    Wei, Wang; Binwu, He


    According to the notion of Lp-affine surface area by Lutwak, in this paper, we introduce the concept of Lp-dual affine surface area. Further, we establish the affine isoperimetric inequality and the Blaschke-Santaló inequality for Lp-dual affine surface area. Besides, the dual Brunn-Minkowski inequality for Lp-dual affine surface area is presented.

  19. Structure, specific surface area and thermal conductivity of the snowpack around Barrow, Alaska (United States)

    Domine, Florent; Gallet, Jean-Charles; Bock, Josué; Morin, Samuel


    The structure of the snowpack near Barrow was studied in March-April 2009. Vertical profiles of density, specific surface area (SSA) and thermal conductivity were measured on tundra, lakes and landfast ice. The average thickness was 41 cm on tundra and 21 cm on fast ice. Layers observed were diamond dust or recent wind drifts on top, overlaying wind slabs, occasional faceted crystals and melt-freeze crusts, and basal depth hoar layers. The top layer had a SSA between 45 and 224 m2 kg-1. All layers at Barrow had SSAs higher than at many other places because of the geographical and climatic characteristics of Barrow. In particular, a given snow layer was remobilized several times by frequent winds, which resulted in SSA increases each time. The average snow area index (SAI, the dimensionless vertically integrated SSA) on tundra was 3260, higher than in the Canadian High Arctic or in the Alaskan taiga. This high SAI, combined with low snow temperatures, imply that the Barrow snowpack efficiently traps persistent organic pollutants, as illustrated with simple calculations for PCB 28 and PCB 180. The average thermal conductivity was 0.21 Wm-1 K-1, and the average thermal resistance on tundra was 3.25 m2 K W-1. This low value partly explains why the snow-ground interface was cold, around -19°C. The high SAI and low thermal resistance values illustrate the interplay between climate, snow physical properties, and their potential impact on atmospheric chemistry, and the need to describe these relationships in models of polar climate and atmospheric chemistry, especially in a climate change context.

  20. Variation of solubility, biokinetics and dose coefficient of industrial uranium oxides according to the specific surface area

    International Nuclear Information System (INIS)

    Chazel, V.; Houpert, P.; Ansorbolo, E.; Henge-Napoli, M.H.; Paquet, F.


    The in vitro solubility, absorption to blood, lung retention and dose coefficient of industrial UO 2 samples were studied as a function of the specific surface area (SSA) of the particles. An in vitro study has been carried out on two samples of industrial UO 4 to compare the results with those obtained with UO 2 . Ten UO 2 samples supplied by different fuel factories or research laboratories, presented specific surface areas from 1.00 to 4.45 m 2 .g -1 . The wide range of values of SSA was due to the different conditions of fabrication. Dissolution tests in cell culture medium made on these ten samples have shown that the solubility increased 2.5-fold when the SSA increased 1.7-fold. The same tendency has been found for UO 4 , a soluble compound, and for U 3 O 8 , a moderately soluble compound. Four in vivo experiments carried out on rats by intratracheal instillation of dust suspensions of UO 2 , have highlighted the decrease in lung retention and the increase of absorption to blood with the SSA. The experimental absorption parameters calculated from the in vivo data allowed specific dose coefficients to be obtained which decreased from 6.6 to 4.3 μSv.Bq -1 when the SSA increased from 1.60 to 3.08 m 2 .g -1 . Thus, the medical monitoring of workers at the workplace has to take into account any change in the fabrication process of the uranium compound which can affect the physiochemical properties and consequently the dose coefficient. (author)

  1. Lp-mixed affine surface area (United States)

    Wang, Weidong; Leng, Gangsong


    According to the three notions of mixed affine surface area, Lp-affine surface area and Lp-mixed affine surface area proposed by Lutwak, in this article, we give the concept of ith Lp-mixed affine surface area such that the first and second notions of Lutwak are its special cases. Further, some Lutwak's results are extended associated with this concept. Besides, applying this concept, we establish an inequality for the volumes and dual quermassintegrals of a class of star bodies.

  2. Contact area measurements on structured surfaces

    DEFF Research Database (Denmark)

    Kücükyildiz, Ömer Can; Jensen, Sebastian Hoppe Nesgaard; De Chiffre, Leonardo

    In connection with the use of brass specimens featuring structured surfaces in a tribology test, an algorithm was developed for automatic measurement of the contact area by optical means.......In connection with the use of brass specimens featuring structured surfaces in a tribology test, an algorithm was developed for automatic measurement of the contact area by optical means....

  3. L p -Dual geominimal surface area

    Directory of Open Access Journals (Sweden)

    Weidong Wang


    Full Text Available Abstract Lutwak proposed the notion of Lp -geominimal surface area according to the Lp -mixed volume. In this article, associated with the Lp -dual mixed volume, we introduce the Lp -dual geominimal surface area and prove some inequalities for this notion. 2000 Mathematics Subject Classification: 52A20 52A40.

  4. Wetted surface area of recreational boats

    NARCIS (Netherlands)

    Bakker J; van Vlaardingen PLA; ICH; VSP


    The wetted surface area of recreational craft is often treated with special paint that prevents growth of algae and other organisms. The active substances in this paint (antifouling) are also emitted into the water. The extent of this emission is among others determined by the treated surface area.

  5. Arctic Region Space Weather Customers and SSA Services

    DEFF Research Database (Denmark)

    Høeg, Per; Kauristi, Kirsti; Wintoft, Peter

    Arctic inhabitants, authorities, and companies rely strongly on precise localization information and communication covering vast areas with low infrastructure and population density. Thus modern technology is crucial for establishing knowledge that can lead to growth in the region. At the same time...... and communication can be established without errors resulting from Space Weather effects. An ESA project have identified and clarified, how the products of the four ESA Space Weather Expert Service Centres (SWE) in the ESA Space Situational Awareness Programme (SSA), can contribute to the requirements of SSA...


    African Journals Online (AJOL)

    various temperatures of precipitates obtained from aqueous solutions in the ... The oxidation reactivity of VOCs is in the following order: alcohols > aldheydes > aromatics ... Specific surface areas (SSA) were calculated by the BET method from ...

  7. Preliminary approach of the MELiSSA loop energy balance (United States)

    Poulet, Lucie; Lamaze, Brigitte; Lebrun, Jean

    Long duration missions, such as the establishment of permanent bases on the lunar surface or the travel to Mars, require a huge amount of life support consumables (e.g. food, water and oxygen). Current rockets are at the moment unable to launch such a mass from Earth. Consequently Regenerative Life Support Systems are necessary to sustain long-term manned space mission to increase recycling rates and so reduce the launched mass. Thus the European and Canadian research has been concentrating on the MELiSSA (Micro-Ecological Life Support System Alternative) project over the last 20 years. MELiSSA is an Environmental Controlled Life Support System (ECLSS), i.e. a closed regenerative loop inspired of a lake ecosystem. Using light as a source of energy, MELiSSA's goal is the recovery of food, water and oxygen from CO2 and organic wastes, using microorganisms and higher plants. The architecture of a ECLSS depends widely on the mission scenario. To compare several ECLSS architectures and in order to be able to evaluate them, ESA is developing a multi criteria evaluation tool: ALISSE (Advanced LIfe Support System Evaluator). One of these criteria is the energy needed to operate the ECLSS. Unlike other criteria like the physical mass, the energy criterion has not been investigated yet and needs hence a detailed analysis. It will consequently be the focus of this study. The main objective of the work presented here is to develop a dynamic tool able to estimate the energy balance for several configurations of the MELiSSA loop. The first step consists in establishing the energy balance using concrete figures from the MELiSSA Pilot Plant (MPP). This facility located at the Universitat Autonoma de Barcelona (UAB) is aimed at the ground demonstration of the MELiSSA loop. The MELiSSA loop is structured on several subsystems; each of them is characterized by supplies, exhausts and process reactions. For the purpose of this study (i.e. a generic tool) the solver EES (Engineering

  8. Surface moisture estimation in urban areas (United States)

    Jiang, Yitong

    Surface moisture is an important parameter because it modifies urban microclimate and surface layer meteorology. The primary objectives of this paper are: 1) to analyze the impact of surface roughness from buildings on surface moisture in urban areas; and 2) to quantify the impact of surface roughness resulting from urban trees on surface moisture. To achieve the objectives, two hypotheses were tested: 1) the distribution of surface moisture is associated with the structural complexity of buildings in urban areas; and 2) The distribution and change of surface moisture is associated with the distribution and vigor of urban trees. The study area is Indianapolis, Indiana, USA. In the part of the morphology of urban trees, Warren Township was selected due to the limitation of tree inventory data. To test the hypotheses, the research design was made to extract the aerodynamic parameters, such as frontal areas, roughness length and displacement height of buildings and trees from Terrestrial and Airborne LiDAR data, then to input the aerodynamic parameters into the urban surface energy balance model. The methodology was developed for comparing the impact of aerodynamic parameters from LiDAR data with the parameters that were derived empirically from land use and land cover data. The analytical procedures are discussed below: 1) to capture the spatial and temporal variation of surface moisture, daily and hourly Land Surface Temperature (LST) were downscaled from 4 km to 1 km, and 960 m to 30 m, respectively, by regression between LST and various components that impact LST; 2) to estimate surface moisture, namely soil moisture and evapotranspiration (ET), land surfaces were classified into soil, vegetation, and impervious surfaces, using Linear Spectral Mixture Analysis (LSMA); 3) aerodynamic parameters of buildings and trees were extracted from Airborne and Terrestrial LiDAR data; 4) the Temperature-Vegetation-Index (TVX) method, and the Two-Source-Energy-Balance (TSEB

  9. Surface area-volume ratios in insects. (United States)

    Kühsel, Sara; Brückner, Adrian; Schmelzle, Sebastian; Heethoff, Michael; Blüthgen, Nico


    Body mass, volume and surface area are important for many aspects of the physiology and performance of species. Whereas body mass scaling received a lot of attention in the literature, surface areas of animals have not been measured explicitly in this context. We quantified surface area-volume (SA/V) ratios for the first time using 3D surface models based on a structured light scanning method for 126 species of pollinating insects from 4 orders (Diptera, Hymenoptera, Lepidoptera, and Coleoptera). Water loss of 67 species was measured gravimetrically at very dry conditions for 2 h at 15 and 30 °C to demonstrate the applicability of the new 3D surface measurements and relevance for predicting the performance of insects. Quantified SA/V ratios significantly explained the variation in water loss across species, both directly or after accounting for isometric scaling (residuals of the SA/V ∼ mass 2/3 relationship). Small insects with a proportionally larger surface area had the highest water loss rates. Surface scans of insects to quantify allometric SA/V ratios thus provide a promising method to predict physiological responses, improving the potential of body mass isometry alone that assume geometric similarity. © 2016 Institute of Zoology, Chinese Academy of Sciences.

  10. The Case for GEO Hosted SSA Payloads (United States)

    Welsch, C.; Armand, B.; Repp, M.; Robinson, A.


    Space situational awareness (SSA) in the geosynchronous earth orbit (GEO) belt presents unique challenges, and given the national importance and high value of GEO satellites, is increasingly critical as space becomes more congested and contested. Space situational awareness capabilities can serve as an effective deterrent against potential adversaries if they provide accurate, timely, and persistent information and are resilient to the threat environment. This paper will demonstrate how simple optical SSA payloads hosted on GEO commercial and government satellites can complement the SSA mission and data provided by Space-Based Space Surveillance (SBSS) and the Geosynchronous Space Situational Awareness Program (GSSAP). GSSAP is built by Orbital Sciences Corporation and launched on July 28, 2014. Analysis performed for this paper will show how GEO hosted SSA payloads, working in combination with SBSS and GSSAP, can increase persistence and timely coverage of high value assets in the GEO belt. The potential to further increase GEO object identification and tracking accuracy by integrating SSA data from multiple sources across different viewing angles including GEO hosted SSA sources will be addressed. Hosting SSA payloads on GEO platforms also increases SSA mission architecture resiliency as the sensors are by distributed across multiple platforms including commercial platforms. This distributed architecture presents a challenging target for an adversary to attempt to degrade or disable. We will present a viable concept of operations to show how data from hosted SSA sensors could be integrated with SBSS and GSSAP data to present a comprehensive and more accurate data set to users. Lastly, we will present an acquisition approach using commercial practices and building on lessons learned from the Commercially Hosted Infra Red Payload CHIRP to demonstrate the affordability of GEO hosted SSA payloads.

  11. Brandon mathematical model describing the effect of calcination and reduction parameters on specific surface area of UO{sub 2} powders

    Energy Technology Data Exchange (ETDEWEB)

    Hung, Nguyen Trong; Thuan, Le Ba [Institute for Technology of Radioactive and Rare Elements (ITRRE), 48 Lang Ha, Dong Da, Ha Noi (Viet Nam); Van Khoai, Do [Micro-Emission Ltd., 1-1 Asahidai, Nomi, Ishikawa, 923-1211 (Japan); Lee, Jin-Young, E-mail: [Convergence Research Center for Development of Mineral Resources (DMR), Korea Institute of Geoscience and Mineral Resources (KIGAM), Daejeon, 305-350 (Korea, Republic of); Jyothi, Rajesh Kumar, E-mail: [Convergence Research Center for Development of Mineral Resources (DMR), Korea Institute of Geoscience and Mineral Resources (KIGAM), Daejeon, 305-350 (Korea, Republic of)


    Uranium dioxide (UO{sub 2}) powder has been widely used to prepare fuel pellets for commercial light water nuclear reactors. Among typical characteristics of the powder, specific surface area (SSA) is one of the most important parameter that determines the sintering ability of UO{sub 2} powder. This paper built up a mathematical model describing the effect of the fabrication parameters on SSA of UO{sub 2} powders. To the best of our knowledge, the Brandon model is used for the first time to describe the relationship between the essential fabrication parameters [reduction temperature (T{sub R}), calcination temperature (T{sub C}), calcination time (t{sub C}) and reduction time (t{sub R})] and SSA of the obtained UO{sub 2} powder product. The proposed model was tested with Wilcoxon's rank sum test, showing a good agreement with the experimental parameters. The proposed model can be used to predict and control the SSA of UO{sub 2} powder.

  12. Monitoring System for ALICE Surface Areas

    CERN Document Server

    Demirbasci, Oguz


    I have been at CERN for 12 weeks within the scope of Summer Student Programme working on a monitoring system project for surface areas of the ALICE experiment during this period of time. The development and implementation of a monitoring system for environmental parameters in the accessible areas where a cheap hardware setup can be deployed were aim of this project. This report explains how it was developed by using Arduino, Raspberry PI, WinCC OA and DIM protocol.

  13. Sessile serrated adenoma (SSA) vs. traditional serrated adenoma (TSA). (United States)

    Torlakovic, Emina Emilia; Gomez, Jose D; Driman, David K; Parfitt, Jeremy R; Wang, Chang; Benerjee, Tama; Snover, Dale C


    The morphologic distinction between various serrated polyps of the colorectum may be challenging. The distinction between sessile serrated adenoma (SSA) and traditional serrated adenoma (TSA) may be difficult using currently available criteria mostly based on cytologic characteristics. We have evaluated 66 serrated polyps including 29 SSA, 18 TSA, and 19 hyperplastic polyps for overall shape of the polyps, architectural features of individual crypts, the presence of eosinophilic cytoplasm, size and distribution of the proliferation and maturation zones, as well as Ki-67 and CK20 expression. The extent of the expression of CK20 and Ki-67 could not distinguish between the 3 types of serrated polyps, but the distribution of their expression was very helpful and differences were statistically significant. The distribution of Ki-67+ cells was the single most helpful distinguishing feature of the serrated polyp type (PTSA had low Ki-67 expression, which was limited to "ectopic crypts" and admixed tubular adenomalike areas. In serrated polyps, ectopic crypt formation (ECF) defined by the presence of ectopic crypts with their bases not seated adjacent to the muscularis mucosae was nearly exclusive to TSA and was found in all cases, while the presence of cytologic atypia and eosinophilia of the cytoplasm were characteristic, but not limited to TSA. No evidence of ECF, but nevertheless abnormal distribution of proliferation zone was characteristic of SSA, whereas HP had neither. The presence of the ECF defines TSA in a more rigorous fashion than previous diagnostic criteria and also explains the biologic basis of exuberant protuberant growth associated with TSA and the lack of such growth in SSA. Recognition of this phenomenon may also help in exploring the genetic and molecular basis for differences between SSA and TSA, because these architectural abnormalities may well be a reflection of abnormalities in genetically programmed mucosal development.

  14. Osmosis and Surface Area to Volume Ratio. (United States)

    Barrett, D. R. B.


    Describes an experiment designed to help students understand the concepts of osmosis and surface area to volume ratio (SA:VOL). The task for students is to compare water uptake in different sizes of potato cubes and relate differences to their SA:VOL ratios. (JN)

  15. Estimating surface area in early hominins.

    Directory of Open Access Journals (Sweden)

    Alan Cross

    Full Text Available Height and weight-based methods of estimating surface area have played an important role in the development of the current consensus regarding the role of thermoregulation in human evolution. However, such methods may not be reliable when applied to early hominins because their limb proportions differ markedly from those of humans. Here, we report a study in which this possibility was evaluated by comparing surface area estimates generated with the best-known height and weight-based method to estimates generated with a method that is sensitive to proportional differences. We found that the two methods yield indistinguishable estimates when applied to taxa whose limb proportions are similar to those of humans, but significantly different results when applied to taxa whose proportions differ from those of humans. We also found that the discrepancy between the estimates generated by the two methods is almost entirely attributable to inter-taxa differences in limb proportions. One corollary of these findings is that we need to reassess hypotheses about the role of thermoregulation in human evolution that have been developed with the aid of height and weight-based methods of estimating body surface area. Another is that we need to use other methods in future work on fossil hominin body surface areas.

  16. Nondestructive, stereological estimation of canopy surface area

    DEFF Research Database (Denmark)

    Wulfsohn, Dvora-Laio; Sciortino, Marco; Aaslyng, Jesper M.


    We describe a stereological procedure to estimate the total leaf surface area of a plant canopy in vivo, and address the problem of how to predict the variance of the corresponding estimator. The procedure involves three nested systematic uniform random sampling stages: (i) selection of plants from...... a canopy using the smooth fractionator, (ii) sampling of leaves from the selected plants using the fractionator, and (iii) area estimation of the sampled leaves using point counting. We apply this procedure to estimate the total area of a chrysanthemum (Chrysanthemum morifolium L.) canopy and evaluate both...... the time required and the precision of the estimator. Furthermore, we compare the precision of point counting for three different grid intensities with that of several standard leaf area measurement techniques. Results showed that the precision of the plant leaf area estimator based on point counting...

  17. BOREAS TE-01 SSA Soil Lab Data (United States)

    National Aeronautics and Space Administration — This data set provides a set of soil properties for the SSA. The soil samples were collected at sets of soil pits. Major soil properties include soil horizon; dry...

  18. BOREAS TE-01 SSA Soil Lab Data (United States)

    National Aeronautics and Space Administration — ABSTRACT: This data set provides a set of soil properties for the SSA. The soil samples were collected at sets of soil pits. Major soil properties include soil...

  19. High Surface Area Tunnels in Hexagonal WO₃. (United States)

    Sun, Wanmei; Yeung, Michael T; Lech, Andrew T; Lin, Cheng-Wei; Lee, Chain; Li, Tianqi; Duan, Xiangfeng; Zhou, Jun; Kaner, Richard B


    High surface area in h-WO3 has been verified from the intracrystalline tunnels. This bottom-up approach differs from conventional templating-type methods. The 3.67 Å diameter tunnels are characterized by low-pressure CO2 adsorption isotherms with nonlocal density functional theory fitting, transmission electron microscopy, and thermal gravimetric analysis. These open and rigid tunnels absorb H(+) and Li(+), but not Na(+) in aqueous electrolytes without inducing a phase transformation, accessing both internal and external active sites. Moreover, these tunnel structures demonstrate high specific pseudocapacitance and good stability in an H2SO4 aqueous electrolyte. Thus, the high surface area created from 3.67 Å diameter tunnels in h-WO3 shows potential applications in electrochemical energy storage, selective ion transfer, and selective gas adsorption.

  20. High surface area fibrous silica nanoparticles

    KAUST Repository

    Polshettiwar, Vivek; Basset, Jean-Marie


    Disclosed are high surface area nanoparticles that have a fibrous morphology. The nanoparticles have a plurality of fibers, wherein each fiber is in contact with one other fiber and each fiber has a length of between about 1 nm and about 5000 nm. Also disclosed are applications of the nanoparticles of the present invention, and methods of fabrication of the nanoparticles of the present invention.

  1. High surface area fibrous silica nanoparticles

    KAUST Repository

    Polshettiwar, Vivek


    Disclosed are high surface area nanoparticles that have a fibrous morphology. The nanoparticles have a plurality of fibers, wherein each fiber is in contact with one other fiber and each fiber has a length of between about 1 nm and about 5000 nm. Also disclosed are applications of the nanoparticles of the present invention, and methods of fabrication of the nanoparticles of the present invention.

  2. Dicty_cDB: SSA423 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA423 (Link to dictyBase) - - - - SSA423F (Link to Original s...ite) SSA423F 443 - - - - - - Show SSA423 Library SS (Link to library) Clone ID SSA423 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIA...VSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIAAGGAFLIIVFFFI CLCCCCCRRKKDKHYHNIQDDET

  3. Dicty_cDB: SSA581 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA581 (Link to dictyBase) - - - Contig-U12576-1 SSA581Z (Link... to Original site) - - SSA581Z 504 - - - - Show SSA581 Library SS (Link to library) Clone ID SSA581 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dict...SARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT DEDI...QHASARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT D

  4. Delivering SSA Capabilities to the Warfighter (United States)

    van Weezendonk, J.; Sherk, J.; Ryan, T.; McGuire, R.

    The Space Superiority Systems Wing at the Space and Missile Center (SMC/SY) equips US forces with Offensive Counterspace (OCS), Defensive Counterspace (DCS), and Space Situation Awareness (SSA) systems that further enhance space superiority. The Technology Division (SYT) mission is to identify, develop, and transition cutting-edge technologies to the warfighter. SYT invests in the most relevant technologies for SSA, DCS and OCS that enhance SMC/SY's portfolio. This presentation will provide an overview of the SMC/SY SSA Technology being worked and highlights several key programs. The presentation will also highlight how the SMC/SY SSA efforts fit into to a Space Superiority Architecture. SYT executes its own Space Control Technology program line and leverages technologies from various DoD and national laboratories, Federally Funded Research and Development Companies, national agencies, industry and academia to accomplish their mission. The portions of the SY FY06 SSA portfolio that will be discussed are: Precision Metrics, Star Sensor Studies, Multi-mission Deployable Optical System, Intelligent Agent Data Fusion efforts, ESSA ACTD and the GReAT tech demo.

  5. On semiautomatic estimation of surface area

    DEFF Research Database (Denmark)

    Dvorak, J.; Jensen, Eva B. Vedel


    and the surfactor. For ellipsoidal particles, it is shown that the flower estimator is equal to the pivotal estimator based on support function measurements along four perpendicular rays. This result makes the pivotal estimator a powerful approximation to the flower estimator. In a simulation study of prolate....... If the segmentation is correct the estimate is computed automatically, otherwise the expert performs the necessary measurements manually. In case of convex particles we suggest to base the semiautomatic estimation on the so-called flower estimator, a new local stereological estimator of particle surface area....... For convex particles, the estimator is equal to four times the area of the support set (flower set) of the particle transect. We study the statistical properties of the flower estimator and compare its performance to that of two discretizations of the flower estimator, namely the pivotal estimator...

  6. A Simple Proof of Cauchy's Surface Area Formula


    Tsukerman, Emmanuel; Veomett, Ellen


    We give a short and simple proof of Cauchy's surface area formula, which states that the average area of a projection of a convex body is equal to its surface area up to a multiplicative constant in the dimension.

  7. The colour potentials of SSA-containing mortar

    DEFF Research Database (Denmark)

    Kappel, Annemette; Ottosen, Lisbeth M.; Kirkelund, Gunvor Marie


    This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA is with a......This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA...

  8. Accessible surface area from NMR chemical shifts

    Energy Technology Data Exchange (ETDEWEB)

    Hafsa, Noor E.; Arndt, David; Wishart, David S., E-mail: [University of Alberta, Department of Computing Science (Canada)


    Accessible surface area (ASA) is the surface area of an atom, amino acid or biomolecule that is exposed to solvent. The calculation of a molecule’s ASA requires three-dimensional coordinate data and the use of a “rolling ball” algorithm to both define and calculate the ASA. For polymers such as proteins, the ASA for individual amino acids is closely related to the hydrophobicity of the amino acid as well as its local secondary and tertiary structure. For proteins, ASA is a structural descriptor that can often be as informative as secondary structure. Consequently there has been considerable effort over the past two decades to try to predict ASA from protein sequence data and to use ASA information (derived from chemical modification studies) as a structure constraint. Recently it has become evident that protein chemical shifts are also sensitive to ASA. Given the potential utility of ASA estimates as structural constraints for NMR we decided to explore this relationship further. Using machine learning techniques (specifically a boosted tree regression model) we developed an algorithm called “ShiftASA” that combines chemical-shift and sequence derived features to accurately estimate per-residue fractional ASA values of water-soluble proteins. This method showed a correlation coefficient between predicted and experimental values of 0.79 when evaluated on a set of 65 independent test proteins, which was an 8.2 % improvement over the next best performing (sequence-only) method. On a separate test set of 92 proteins, ShiftASA reported a mean correlation coefficient of 0.82, which was 12.3 % better than the next best performing method. ShiftASA is available as a web server ( ) for submitting input queries for fractional ASA calculation.

  9. High-surface-area active carbon

    International Nuclear Information System (INIS)

    O'Grady, T.M.; Wennerberg, A.N.


    This paper describes the preparation and properties of a unique active carbon having exceptionally high surface areas, over 2500 m 2 /gm, and extraordinary adsorptive capacities. The carbon is made by a direct chemical activation route in which petroleum coke or other carbonaceous sources are reacted with excess potassium hydroxide at 400 0 to 500 0 C to an intermediate product that is subsequently pyrolyzed at 800 0 to 900 0 C to active carbon containing potassium salts. These are removed by water washing and the carbon is dried to produce a powdered product. A granular carbon can also be made by further processing the powdered carbon by using specialized granulation techniques. Typical properties of the carbon include Iodine Numbers of 3000 to 3600, methylene blue adsorption of 650 to 750 mg/gm, pore volumes of 2.0 to 2.6 cc/gm and less than 3.0% ash. This carbon's high adsorption capacities make it uniquely suited for numerous demanding applications in the medical area, purifications, removal of toxic substances, as catalyst carriers, etc

  10. Hydraulic and mechanical behavior of landfill clay liner containing SSA in contact with leachate. (United States)

    Zhang, Qian; Lu, Haijun; Liu, Junzhu; Wang, Weiwei; Zhang, Xiong


    Sewage sludge ash (SSA) produced by municipal sludge can be used as a modified additive for clay liner, and improves the working performance of landfill clay liner in contact with leachate. Under the action of landfill leachate, the permeability, shear strength, phase composition, and pore structure of the modified clay are investigated through the flexible wall permeability test, triaxial shear test, thermal gravimetric and differential thermal analysis, and low-temperature nitrogen adsorption test, respectively. The hydraulic conductivity of the modified clay containing 0-5% SSA is in the range of 3.94 × 10 -8 -1.16 × 10 -7  cm/s, and the pollutant concentration of the sample without SSA was higher than others. The shear strength of the modified clay is more than that of the traditional clay liner, the cohesion rate of modified clay increases from 32.5 to 199.91 kPa, and the internal friction angle decreases from 32.5° to 15.6°. Furthermore, the weight loss rates of the samples are 15.69%, 17.92%, 18.06%, and 20.68%, respectively, when the SSA content increases from 0% to 5%. The total pore volume and average pore diameter of the modified clay decrease with the increase in the SSA content, respectively. However, the specific area of the modified clay increases with the increase in the SSA content.

  11. Adequacy of the default values for skin surface area used for risk assessment and French anthropometric data by a probabilistic approach. (United States)

    Dornic, N; Ficheux, A S; Bernard, A; Roudot, A C


    The notes of guidance for the testing of cosmetic ingredients and their safety evaluation by the Scientific Committee on Consumer Safety (SCCS) is a document dedicated to ensuring the safety of European consumers. This contains useful data for risk assessment such as default values for Skin Surface Area (SSA). A more in-depth study of anthropometric data across Europe reveals considerable variations. The default SSA value was derived from a study on the Dutch population, which is known to be one of the tallest nations in the World. This value could be inadequate for shorter populations of Europe. Data were collected in a survey on cosmetic consumption in France. Probabilistic treatment of these data and analysis of the case of methylisothiazolinone, a sensitizer recently evaluated by a deterministic approach submitted to SCCS, suggest that the default value for SSA used in the quantitative risk assessment might not be relevant for a significant share of the French female population. Others female populations of Southern Europe may also be excluded. This is of importance given that some studies show an increasing risk of developping skin sensitization among women. The disparities in anthropometric data across Europe should be taken into consideration. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Porous 3D graphene-based bulk materials with exceptional high surface area and excellent conductivity for supercapacitors (United States)

    Zhang, Long; Zhang, Fan; Yang, Xi; Long, Guankui; Wu, Yingpeng; Zhang, Tengfei; Leng, Kai; Huang, Yi; Ma, Yanfeng; Yu, Ao; Chen, Yongsheng


    Until now, few sp2 carbon materials simultaneously exhibit superior performance for specific surface area (SSA) and electrical conductivity at bulk state. Thus, it is extremely important to make such materials at bulk scale with those two outstanding properties combined together. Here, we present a simple and green but very efficient approach using two standard and simple industry steps to make such three-dimensional graphene-based porous materials at the bulk scale, with ultrahigh SSA (3523 m2/g) and excellent bulk conductivity. We conclude that these materials consist of mainly defected/wrinkled single layer graphene sheets in the dimensional size of a few nanometers, with at least some covalent bond between each other. The outstanding properties of these materials are demonstrated by their superior supercapacitor performance in ionic liquid with specific capacitance and energy density of 231 F/g and 98 Wh/kg, respectively, so far the best reported capacitance performance for all bulk carbon materials. PMID:23474952

  13. Evolution of ESA's SSA Conjunction Prediction Service (United States)

    Escobar, D.; Sancho, A. Tirado, J.; Agueda, A.; Martin, L.; Luque, F.; Fletcher, E.; Navarro, V.


    This paper presents the recent evolution of ESA's SSA Conjunction Prediction Service (CPS) as a result of an on-going activity in the Space Surveillance and Tracking (SST) Segment of ESA's Space Situational Awareness (SSA) Programme. The CPS is one of a number of precursor services being developed as part of the SST segment. It has been implemented as a service to provide external users with web-based access to conjunction information and designed with a service-oriented architecture. The paper encompasses the following topics: service functionality enhancements, integration with a live objects catalogue, all vs. all analyses supporting an operational concept based on low and high fidelity screenings, and finally conjunction detection and probability algorithms.

  14. Dicty_cDB: SSA564 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA564 (Link to dictyBase) - - - - SSA564F (Link to Original s...ite) SSA564F 653 - - - - - - Show SSA564 Library SS (Link to library) Clone ID SSA564 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL*l--- Frame C: tlkfvmplvmkictslvlvlkrstk*rklfmmenshqtldgl...bits) Value N M77492 |M77492.1 Dictyostelium discoideum glycoprotein phosphorylase 2 (glpD) gene, complete c

  15. Palatal Surface Area of Maxillary Plaster Casts

    DEFF Research Database (Denmark)

    Darvann, Tron Andre; Hermann, Nuno V.; Ersbøll, Bjarne Kjær


    Objective: To investigate the relationship between corresponding two-dimensional and three-dimensional measurements on maxillary plaster casts taken from photographs and three-dimensional surface scans, respectively. Materials and Methods: Corresponding two-dimensional and three-dimensional measu...

  16. Effect of impervious surface area and vegetation changes on mean ...

    African Journals Online (AJOL)

    adeniyi adeyemi

    Land surface temperature (LST) is measured by the surface energy balance, .... climatic and environmental conditions (Cheng et al., 2006). ..... urban areas have generally resulted in a high reflection and emission of solar radiation and greater.

  17. Electrochemical Properties of High Surface Area Vanadium Oxide Aerogels

    National Research Council Canada - National Science Library

    Dong, Winny


    .... Traditional composite electrode structures have prevented truly quantitative analysis of surface area effects in nanoscale battery materials, as well as a study of their innate electrochemical behavior...

  18. Surface Area Distribution Descriptor for object matching

    Directory of Open Access Journals (Sweden)

    Mohamed F. Gafar


    Full Text Available Matching 3D objects by their similarity is a fundamental problem in computer vision, computer graphics and many other fields. The main challenge in object matching is to find a suitable shape representation that can be used to accurately and quickly discriminate between similar and dissimilar shapes. In this paper we present a new volumetric descriptor to represent 3D objects. The proposed descriptor is used to match objects under rigid transformations including uniform scaling. The descriptor represents the object by dividing it into shells, acquiring the area distribution of the object through those shells. The computed areas are normalised to make the descriptor scale-invariant in addition to rotation and translation invariant. The effectiveness and stability of the proposed descriptor to noise and variant sampling density as well as the effectiveness of the similarity measures are analysed and demonstrated through experimental results.

  19. The Aesthetical quality of SSA-containing mortar and concrete

    DEFF Research Database (Denmark)

    Kappel, Annemette; Kirkelund, Gunvor Marie; Ottosen, Lisbeth M.


    that gives a characteristic red colour. The process of grinding SSA has shown to improve the compressive strength of SSA- containing mortar (Donatello et al. 2010). Thus, in this study SSA was grinded in 6 different intervals ranging from 0 – 10 min, and then added to the mortar mix replacing 20% of cement....... The experiment revealed that the colour of the SSA-containing mortar intensified as the time interval of the grinding process increased. Each of the 6 steps within the time interval provided an additional colour tone and generated a colour scale consisting of mortar samples ranging from greyish to a more...

  20. Why Do We Need the Derivative for the Surface Area? (United States)

    Hristova, Yulia; Zeytuncu, Yunus E.


    Surface area and volume computations are the most common applications of integration in calculus books. When computing the surface area of a solid of revolution, students are usually told to use the frustum method instead of the disc method; however, a rigorous explanation is rarely provided. In this note, we provide one by using geometric…

  1. On the specific surface area of nanoporous materials

    NARCIS (Netherlands)

    Detsi, E.; De Jong, E.; Zinchenko, A.; Vukovic, Z.; Vukovic, I.; Punzhin, S.; Loos, K.; ten Brinke, G.; De Raedt, H. A.; Onck, P. R.; De Hosson, J. T. M.


    A proper quantification of the specific surface area of nanoporous materials is necessary for a better understanding of the properties that are affected by the high surface-area-to-volume ratio of nanoporous metals, nanoporous polymers and nanoporous ceramics. In this paper we derive an analytical

  2. Lage-area planar RF plasma productions by surface waves

    International Nuclear Information System (INIS)

    Nonaka, S.


    Large-area rf plasmas are confirmed to be produced by means of RF discharges inside a large-area dielectric tube. The plasma space is 73 cm x 176 cm and 2.5 cm. The plasma is thought to be produced by an odd plasma-surface wave (PSW ο ) in case of using large-area electrodes and by an even plasma-surface wave (PSW ο ) in case of without the electrodes. (author). 7 refs, 4 figs

  3. 76 FR 41685 - Electronic Substitutions for Form SSA-538 (United States)


    ... visit our Internet site, Social Security Online, at . SUPPLEMENTARY... SOCIAL SECURITY ADMINISTRATION 20 CFR Part 416 [Docket No. SSA-2009-0027] RIN 0960-AH02 Electronic Substitutions for Form SSA-538 AGENCY: Social Security Administration. ACTION: Final rule with request for...

  4. Indexing aortic valve area by body surface area increases the prevalence of severe aortic stenosis

    DEFF Research Database (Denmark)

    Jander, Nikolaus; Gohlke-Bärwolf, Christa; Bahlmann, Edda


    To account for differences in body size in patients with aortic stenosis, aortic valve area (AVA) is divided by body surface area (BSA) to calculate indexed AVA (AVAindex). Cut-off values for severe stenosis are......To account for differences in body size in patients with aortic stenosis, aortic valve area (AVA) is divided by body surface area (BSA) to calculate indexed AVA (AVAindex). Cut-off values for severe stenosis are...

  5. Hand burns surface area: A rule of thumb. (United States)

    Dargan, Dallan; Mandal, Anirban; Shokrollahi, Kayvan


    Rapid estimation of acute hand burns is important for communication, standardisation of assessment, rehabilitation and research. Use of an individual's own thumbprint area as a fraction of their total hand surface area was evaluated to assess potential utility in hand burn evaluation. Ten health professionals used an ink-covered dominant thumb pulp to cover the surfaces of their own non-dominant hand using the contralateral thumb. Thumbprints were assessed on the web spaces, sides of digits and dorsum and palm beyond the distal wrist crease. Hand surface area was estimated using the Banerjee and Sen method, and thumbprint ellipse area calculated to assess correlation. Mean estimated total hand surface area was 390.0cm 2 ±SD 51.5 (328.3-469.0), mean thumbprint ellipse area was 5.5cm 2 ±SD 1.3 (3.7-8.4), and mean estimated print number was 73.5±SD 11.0 (range 53.1-87.8, 95% CI 6.8). The mean observed number of thumbprints on one hand was 80.1±SD 5.9 (range 70.0-88.0, 95% CI 3.7), χ 2 =0.009. The combined mean of digital prints was 42, comprising a mean of two prints each on volar, dorsal, radial and ulnar digit surfaces, except volar middle and ring (3 prints each). Palmar prints were 15 (11-19), dorsal 15 (11-19), ulnar palm border 3, first web space 2, and second, third and fourth web spaces one each. Using the surface of the palm alone, excluding digits, as 0.5% of total body surface area, the area of one thumbprint was approximated as 1/30th of 1%. We have demonstrated how thumbprint area serves as a simple method for evaluating hand burn surface area. Copyright © 2018 Elsevier Ltd and ISBI. All rights reserved.

  6. 77 FR 38880 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Railroad Retirement Board (SSA... (United States)


    ... Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program that... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0002] Privacy Act of 1974, as Amended...

  7. Particle surface area and bacterial activity in recirculating aquaculture systems

    DEFF Research Database (Denmark)

    Pedersen, Per Bovbjerg; von Ahnen, Mathis; Fernandes, Paulo


    Suspended particles in recirculating aquaculture systems (RAS) provide surface area that can be colonized by bacteria. More particles accumulate as the intensity of recirculation increases thus potentially increasing the bacterial carrying capacity of the systems. Applying a recent, rapid, culture...... but may provide significant surface area. Hence, the study substantiates that particles in RAS provide surface area supporting bacterial activity, and that particles play a key role in controlling the bacterial carrying capacity at least in less intensive RAS. Applying fast, culture-independent techniques......-independent fluorometric detection method (Bactiquant®) for measuring bacterial activity, the current study explored the relationship between total particle surface area (TSA, derived from the size distribution of particles >5 μm) and bacterial activity in freshwater RAS operated at increasing intensity of recirculation...

  8. On $L_p$ Affine Surface Area and Curvature Measures


    Zhao, Yiming


    The relationship between $L_p$ affine surface area and curvature measures is investigated. As a result, a new representation of the existing notion of $L_p$ affine surface area depending only on curvature measures is derived. Direct proofs of the equivalence between this new representation and those previously known are provided. The proofs show that the new representation is, in a sense, "polar" to that of Lutwak's and "dual" to that of Sch\\"utt & Werner's.

  9. Vector Topographic Map Data over the BOREAS NSA and SSA in SIF Format (United States)

    Knapp, David; Nickeson, Jaime; Hall, Forrest G. (Editor)


    This data set contains vector contours and other features of individual topographic map sheets from the National Topographic Series (NTS). The map sheet files were received in Standard Interchange Format (SIF) and cover the BOReal Ecosystem-Atmosphere Study (BOREAS) Northern Study Area (NSA) and Southern Study Area (SSA) at scales of 1:50,000 and 1:250,000. The individual files are stored in compressed Unix tar archives.

  10. Quantifying object and material surface areas in residences

    Energy Technology Data Exchange (ETDEWEB)

    Hodgson, Alfred T.; Ming, Katherine Y.; Singer, Brett C.


    The dynamic behavior of volatile organic compounds (VOCs) in indoor environments depends, in part, on sorptive interactions between VOCs in the gas phase and material surfaces. Since information on the types and quantities of interior material surfaces is not generally available, this pilot-scale study was conducted in occupied residences to develop and demonstrate a method for quantifying surface areas of objects and materials in rooms. Access to 33 rooms in nine residences consisting of bathrooms, bedroom/offices and common areas was solicited from among research group members living in the East San Francisco Bay Area. A systematic approach was implemented for measuring rooms and objects from 300 cm{sup 2} and larger. The ventilated air volumes of the rooms were estimated and surface area-to-volume ratios were calculated for objects and materials, each segregated into 20 or more categories. Total surface area-to-volume ratios also were determined for each room. The bathrooms had the highest total surface area-to-volume ratios. Bedrooms generally had higher ratios than common areas consisting of kitchens, living/dining rooms and transitional rooms. Total surface area-to-volume ratios for the 12 bedrooms ranged between 2.3 and 4.7 m{sup 2} m{sup -3}. The importance of individual objects and materials with respect to sorption will depend upon the sorption coefficients for the various VOC/materials combinations. When combined, the highly permeable material categories, which may contribute to significant interactions, had a median ratio of about 0.5 m{sup 2} m{sup -3} for all three types of rooms.

  11. BOREAS HYD-8 DEM Data Over the NSA-MSA and SSA-MSA in the UTM Projection (United States)

    Wang, Xue-Wen; Hall, Forrest G. (Editor); Knapp, David E. (Editor); Band, L. E.; Smith, David E. (Technical Monitor)


    The BOREAS HYD-8 team focused on describing the scaling behavior of water and carbon flux processes at local and regional scales. These DEMs were produced from digitized contours at a cell resolution of 100 meters. Vector contours of the area were used as input to a software package that interpolates between contours to create a DEM representing the terrain surface. The vector contours had a contour interval of 25 feet. The data cover the BOREAS MSAs of the SSA and NSA and are given in a UTM map projection. Most of the elevation data from which the DEM was produced were collected in the 1970s or 1980s. The data are stored in binary, image format files. The data files are available on a CD-ROM (see document number 20010000884) or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  12. Biomass-derived nitrogen-doped porous carbons with tailored hierarchical porosity and high specific surface area for high energy and power density supercapacitors (United States)

    Sun, Junting; Niu, Jin; Liu, Mengyue; Ji, Jing; Dou, Meiling; Wang, Feng


    Porous carbon materials with hierarchical structures attract intense interest for the development of high-performance supercapacitors. Herein, we demonstrate a facile and efficient strategy to synthesize nitrogen-doped hierarchically porous carbons with tailored porous structure combined with high specific surface area (SSA), which involves a pre-carbonization and a subsequent carbonization combined with KOH activation of silkworm cocoon precursors. Through adjusting the mass ratio of the activator (KOH) to pre-carbonized precursor in the activation process, the hierarchically porous carbon prepared at the mass ratio of 2 (referred to as NHPC-2) possesses a high defect density and a high SSA of 3386 m2 g-1 as well as the relatively high volumetric proportion of mesopores and macropores (45.5%). As a result, the energy density and power density of the symmetric supercapacitor based on NHPC-2 electrode are as high as 34.41 Wh kg-1 and 31.25 kW kg-1 in organic-solvent electrolyte, and are further improved to 112.1 Wh kg-1 and 23.91 kW kg-1 in ionic-liquid electrolyte.

  13. Quantification of lung surface area using computed tomography

    Directory of Open Access Journals (Sweden)

    Xing Li


    Full Text Available Abstract Objective To refine the CT prediction of emphysema by comparing histology and CT for specific regions of lung. To incorporate both regional lung density measured by CT and cluster analysis of low attenuation areas for comparison with histological measurement of surface area per unit lung volume. Methods The histological surface area per unit lung volume was estimated for 140 samples taken from resected lung specimens of fourteen subjects. The region of the lung sampled for histology was located on the pre-operative CT scan; the regional CT median lung density and emphysematous lesion size were calculated using the X-ray attenuation values and a low attenuation cluster analysis. Linear mixed models were used to examine the relationships between histological surface area per unit lung volume and CT measures. Results The median CT lung density, low attenuation cluster analysis, and the combination of both were important predictors of surface area per unit lung volume measured by histology (p Conclusion Combining CT measures of lung density and emphysematous lesion size provides a more accurate estimate of lung surface area per unit lung volume than either measure alone.

  14. Surface area considerations for corroding N reactor fuel

    International Nuclear Information System (INIS)

    Johnson, A.B. Jr.; Pitner, A.L.


    The N Reactor fuel is corroding at sites where the Zircaloy cladding was damaged when the fuel was discharged from the reactor. Corroding areas are clearly visible on the fuel stored in open cans in the K East Basin. There is a need to estimate the area of the corroding uranium to analyze aspects of fuel behavior as it is transitioned. from current wet storage to dry storage. In this report, the factors that contribute to open-quotes trueclose quotes surface area are analyzed in terms of what is currently known about the N Reactor fuel. Using observations from a visual examinations of the fuel in the K East wet storage facility, a value for the corroding geometric area is estimated. Based on observations of corroding uranium and surface roughness values for other metals, a surface roughness factor is also estimated and applied to the corroding K East fuel to provide an estimated open-quotes trueclose quotes surface area. While the estimated area may be modified as additional data become available from fuel characterization studies, the estimate provides a basis to assess effects of exposed uranium metal surfaces on fuel behavior in operations involved in transitioning from wet to dry storage, during shipment and staging, conditioning, and dry interim storage

  15. Assessment of dialyzer surface in online hemodiafiltration; objective choice of dialyzer surface area

    Directory of Open Access Journals (Sweden)

    Francisco Maduell


    Conclusion: The increase in 40% and 80% of dialyzer surface area entails an increase in convective volume of 6 and 16% respectively, showing minimal differences both in convective volume and clearance capacity when UFC was greater than 45 mL/h/mmHg. It is advisable to optimise dialyser efficiency to the smallest surface area possible, adjusting treatment prescription.

  16. Specific surface area evaluation method by using scanning electron microscopy

    International Nuclear Information System (INIS)

    Petrescu, Camelia; Petrescu, Cristian; Axinte, Adrian


    Ceramics are among the most interesting materials for a large category of applications, including both industry and health. Among the characteristic of the ceramic materials, the specific surface area is often difficult to evaluate.The paper presents a method of evaluation for the specific surface area of two ceramic powders by means of scanning electron microscopy measurements and an original method of computing the specific surface area.Cumulative curves are used to calculate the specific surface area under assumption that the values of particles diameters follow a normal logarithmic distribution. For two powder types, X7R and NPO the results are the following: - for the density ρ (g/cm 2 ), 5.5 and 6.0, respectively; - for the average diameter D bar (μm), 0.51 and 0.53, respectively; - for σ, 1.465 and 1.385, respectively; - for specific surface area (m 2 /g), 1.248 and 1.330, respectively. The obtained results are in good agreement with the values measured by conventional methods. (authors)

  17. Can foot anthropometric measurements predict dynamic plantar surface contact area?

    Directory of Open Access Journals (Sweden)

    Collins Natalie


    Full Text Available Abstract Background Previous studies have suggested that increased plantar surface area, associated with pes planus, is a risk factor for the development of lower extremity overuse injuries. The intent of this study was to determine if a single or combination of foot anthropometric measures could be used to predict plantar surface area. Methods Six foot measurements were collected on 155 subjects (97 females, 58 males, mean age 24.5 ± 3.5 years. The measurements as well as one ratio were entered into a stepwise regression analysis to determine the optimal set of measurements associated with total plantar contact area either including or excluding the toe region. The predicted values were used to calculate plantar surface area and were compared to the actual values obtained dynamically using a pressure sensor platform. Results A three variable model was found to describe the relationship between the foot measures/ratio and total plantar contact area (R2 = 0.77, p R2 = 0.76, p Conclusion The results of this study indicate that the clinician can use a combination of simple, reliable, and time efficient foot anthropometric measurements to explain over 75% of the plantar surface contact area, either including or excluding the toe region.

  18. BOREAS TF-01 SSA-OA Soil Characteristics Data (United States)

    National Aeronautics and Space Administration — Data collected in support of the effort to characterize and interpret soil information at the SSA-OA tower site in 1994. Data collected include soil respiration,...

  19. TiSSA eelkonverents doktorantidele Tallinnas / Koidu Saame

    Index Scriptorium Estoniae

    Saame, Koidu


    Tallinna Ülikoolis toimunud TiSSA doktorantide eelkonverentsist 22.-24. aug. 2010.a. Doktorantide ettekannetest. Esinesid: Hans-Uwe Otto, Andriy Yuryev, Tiina Naarits, Ivar Tröner, Koidu Saame, Maija Jäppinen, Janissa Miettinen

  20. BOREAS TF-01 SSA-OA Soil Characteristics Data (United States)

    National Aeronautics and Space Administration — ABSTRACT: Data collected in support of the effort to characterize and interpret soil information at the SSA-OA tower site in 1994. Data collected include soil...


    Directory of Open Access Journals (Sweden)

    Johanna Ziegel


    Full Text Available A sampling design of local stereology is combined with a method from digital stereology to yield a novel estimator of surface area based on counts of configurations observed in a digitization of an isotropic 2- dimensional slice with thickness s. As a tool, a result of the second author and J. Rataj on infinitesimal increase of volumes of morphological transforms is refined and used. The proposed surface area estimator is asymptotically unbiased in the case of sets contained in the ball centred at the origin with radius s and in the case of balls centred at the origin with unknown radius. For general shapes bounds for the asymptotic expected relative worst case error are given. A simulation example is discussed for surface area estimation based on 2×2×2-configurations.

  2. MCO gas composition for low reactive surface areas

    International Nuclear Information System (INIS)

    Packer, M.J.


    This calculation adjusts modeled output (HNF-SD-SNF-TI-040, Rev. 2) by considering lower reactive fuel surface areas and by increasing the input helium backfill overpressure from 0.5 to 1.5 atm (2.5 atm abs) to verify that MCO gas-phase oxygen concentrations can remain below 4 mole % over a 40 year interim period under a worst case condition of zero reactive surface area. Added backfill gas will dilute any gases generated during interim storage and is a strategy within the current design capability. The zero reactive surface area represents a hypothetical worst case example where there is no fuel scrap and/or damaged spent fuel rods in an MCO. Also included is a hypothetical case where only K East fuel exists in an MCO with an added backfill overpressure of 0.5 atm (1.5 atm abs)


    Energy Technology Data Exchange (ETDEWEB)

    Nugent, C. R. [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Mainzer, A.; Masiero, J.; Bauer, J.; Kramer, E.; Sonnett, S. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Wright, E. L. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Grav, T. [Planetary Science Institute, Tucson, AZ (United States)


    The rapid accumulation of thermal infrared observations and shape models of asteroids has led to increased interest in thermophysical modeling. Most of these infrared observations are unresolved. We consider what fraction of an asteroid’s surface area contributes the bulk of the emitted thermal flux for two model asteroids of different shapes over a range of thermal parameters. The resulting observed surface in the infrared is generally more fragmented than the area observed in visible wavelengths, indicating high sensitivity to shape. For objects with low values of the thermal parameter, small fractions of the surface contribute the majority of thermally emitted flux. Calculating observed areas could enable the production of spatially resolved thermal inertia maps from non-resolved observations of asteroids.

  4. Stereological estimation of surface area from digital images

    DEFF Research Database (Denmark)

    Ziegel, Johanna; Kiderlen, Markus


    A sampling design of local stereology is combined with a method from digital stereology to yield a novel estimator of surface area based on counts of configurations observed in a digitization of an isotropic 2- dimensional slice with thickness s. As a tool, a result of the second author and J....... Rataj on infinitesimal increase of volumes of morphological transforms is refined and used. The proposed surface area estimator is asymptotically unbiased in the case of sets contained in the ball centred at the origin with radius s and in the case of balls centred at the origin with unknown radius...

  5. Large area, surface discharge pumped, vacuum ultraviolet light source (United States)

    Sze, R.C.; Quigley, G.P.


    Large area, surface discharge pumped, vacuum ultraviolet (VUV) light source is disclosed. A contamination-free VUV light source having a 225 cm{sup 2} emission area in the 240-340 nm region of the electromagnetic spectrum with an average output power in this band of about 2 J/cm{sup 2} at a wall-plug efficiency of approximately 5% is described. Only ceramics and metal parts are employed in this surface discharge source. Because of the contamination-free, high photon energy and flux, and short pulse characteristics of the source, it is suitable for semiconductor and flat panel display material processing. 3 figs.

  6. High surface area carbon and process for its production

    Energy Technology Data Exchange (ETDEWEB)

    Romanos, Jimmy; Burress, Jacob; Pfeifer, Peter; Rash, Tyler; Shah, Parag; Suppes, Galen


    Activated carbon materials and methods of producing and using activated carbon materials are provided. In particular, biomass-derived activated carbon materials and processes of producing the activated carbon materials with prespecified surface areas and pore size distributions are provided. Activated carbon materials with preselected high specific surface areas, porosities, sub-nm (<1 nm) pore volumes, and supra-nm (1-5 nm) pore volumes may be achieved by controlling the degree of carbon consumption and metallic potassium intercalation into the carbon lattice during the activation process.

  7. Clay mineralogy in different geomorphic surfaces in sugarcane areas (United States)

    Camargo, L.; Marques, J., Jr.


    The crystallization of the oxides and hydroxides of iron and aluminum and kaolinite of clay fraction is the result of pedogenetic processes controlled by the relief. These minerals have influence on the physical and chemical attributes of soil and exhibit spatial dependence. The pattern of spatial distribution is influenced by forms of relief as the geomorphic surfaces. In this sense, the studies aimed at understanding the relationship between relief and the distribution pattern of the clay fraction attributes contribute to the delineation of specific areas of management in the field. The objective of this study was to evaluate the spatial distribution of oxides and hydroxides of iron and aluminum and kaolinite of clay fraction and its relationship with the physical and chemical attributes in different geomorphic surfaces. Soil samples were collected in a transect each 25 m (100 samples) and in the sides of the same (200 samples) as well as an area of 500 ha (1 sample each six hectare). Geomorphic surfaces (GS) in the transect were mapped in detail to support mapping the entire area. The soil samples were taken to the laboratory for chemical, physical, and mineralogical analysis, and the pattern of spatial distribution of soil attributes was obtained by statistics and geostatistics. The GS I is considered the oldest surface of the study area, with depositional character, and a slope ranging from 0 to 4%. GS II and III are considered to be eroded, and the surface II plan a gentle slope that extends from the edge of the surface until the beginning of I and III. The crystallographic characteristics of the oxides and hydroxides of iron and aluminum and kaolinite showed spatial dependence and the distribution pattern corresponding to the limits present of the GS in the field. Surfaces I and II showed the best environments to the degree of crystallinity of hematite and the surface III to the greatest degree of crystallinity of goethite agreeing to the pedoenvironment

  8. Installation and performance evaluation of an indigenous surface area analyser

    International Nuclear Information System (INIS)

    Pillai, S.N.; Solapurkar, M.N.; Venkatesan, V.; Prakash, A.; Khan, K.B.; Kumar, Arun; Prasad, R.S.


    An indigenously available surface area analyser was installed inside glove box and checked for its performance by analyzing uranium oxide and thorium oxide powders at RMD. The unit has been made ready for analysis of Plutonium oxide powders after incorporating several important features. (author)

  9. Influence of Ear Surface Area on Heat Tolerance of Composite ...

    African Journals Online (AJOL)

    Relative importance of ear surface area on heat tolerance of composite rabbit population was evaluated. The study was conducted during the dry and rainy seasons, climatic data were recorded to obtain categorical heat stress index. Physiological parameters, growth performance, ear length and ear width of the rabbits ...

  10. Surface water and groundwater interaction in Marala - Khanki area, Punjab

    International Nuclear Information System (INIS)

    Akram, W.; Ahmad, M.; Latif, Z.; Tariq, J.A.; Malik, M.R.


    Isotope hydrological investigations were carried out in two selected areas of Indus Basin viz. Haripur Area and Chashma- Taunsa Area for elucidating various aspects of surface water and groundwater interaction. Groundwater samples were collected on seasonal basis (low and high river discharge periods) while surface water samples were collected more frequently (weekly or monthly basis). Isotopic data suggested that there is no contribution of surface water to groundwater recharge in Haripur Area and rain is the prevailing source of groundwater recharge. The data further revealed that isotopic values of the Haripur pocket of Tarbela Lake are higher than those of Main Lake / Indus River meaning that there is a significant contribution of base flow in this pocket. Indus River appeared to be the dominant source of groundwater recharge at most of the locations in Chashma- Taunsa Area. Isotopic data of Indus River showed an increase at Taunsa as compared to Chashma in low flow period indicating the high contribution of base flow at this point in time. Stable isotopes were successfully used to quantify the base flow contribution. (author)

  11. Growth of contact area between rough surfaces under normal stress (United States)

    Stesky, R. M.; Hannan, S. S.


    The contact area between deforming rough surfaces in marble, alabaster, and quartz was measured from thin sections of surfaces bonded under load with low viscosity resin epoxy. The marble and alabaster samples had contact areas that increased with stress at an accelerating rate. This result suggests that the strength of the asperity contacts decreased progressively during the deformation, following some form of strain weakening relationship. This conclusion is supported by petrographic observation of the thin sections that indicate that much of the deformation was cataclastic, with minor twinning of calcite and kinking of gypsum. In the case of the quartz, the observed contact area was small and increased approximately linearly with normal stress. Only the irreversible cataclastic deformation was observed; however strain-induced birefringence and cracking of the epoxy, not observed with the other rocks, suggests that significant elastic deformation occurred, but recovered during unloading.

  12. Assessment of dialyzer surface in online hemodiafiltration; objective choice of dialyzer surface area


    Francisco Maduell; Raquel Ojeda; Marta Arias-Guillén; Giannina Bazan; Manel Vera; Néstor Fontseré; Elisabeth Massó; Miquel Gómez; Lida Rodas; Mario Jiménez-Hernández; Gastón Piñeiro; Nayra Rico


    Introduction: Online haemodiafiltration (OL-HDF) is most effective technique; several randomised studies and meta-analyses have shown a reduction in mortality, with a directly related association with convective volume. At present, it is not properly established whether the increasing in dialyser surface area may suppose better outcomes in terms of convective and clearance efficacy. The purpose of the study was to assess the effect of increase in dialyser surface area on the convective volume...

  13. Rapid assessment of populations trends of invasive species: Singular Spectrum Analysis (SSA

    Directory of Open Access Journals (Sweden)

    DANA, ED


    Full Text Available Singular Spectrum Analysis (SSA is a powerful analytical approach for biodi-versity management. Its main advan-tages are due to its intuitive processing and visualization, since mathematical workflow is conceptually similar to the widely accepted Principal Components Analysis. Detailed analyses of popula-tion trends with mathematical tools are often difficult to achieve for managers by a number of reasons (large numbers or areas monitored, large number of species, insufficient statistics skills, strong knowledge level in demographic analyses, etc.. SSA has been used since the 1970’s in signal processing to clarify signal vs. noisy information, but it has also been used in climate change analy-sis and other developmental areas. Be-sides, SSA is a rapid-learning method for technicians and managers with medium level of mathematical knowledge. Free software in Unix environment is avail-able. Unfortunately, no free and friendly software is available for Win-dows SO. Although R package may offer solutions for really advanced users, it does not fit real work situations for managers of biological invasions. Cater-pillar (Gistat Group, Ltd is by now, the best option found by the author in terms of price, facility for results inter-pretation and time consumed in learn-ing. The main disadvantage is the poor content of tutorial files

  14. Surface speciation and interactions between adsorbed chloride and water on cerium dioxide (United States)

    Sutherland-Harper, Sophie; Taylor, Robin; Hobbs, Jeff; Pimblott, Simon; Pattrick, Richard; Sarsfield, Mark; Denecke, Melissa; Livens, Francis; Kaltsoyannis, Nikolas; Arey, Bruce; Kovarik, Libor; Engelhard, Mark; Waters, John; Pearce, Carolyn


    Ceria particles with different specific surface areas (SSA) were contaminated with chloride and water, then heat treated at 500 and 900 °C to investigate sorption behaviour of these species on metal oxides. Results from x-ray photoelectron spectroscopy and infrared spectroscopy showed chloride and water adsorption onto particles increased with surface area and that these species were mostly removed on heat treatment (from 6.3 to 0.8 at% Cl- on high SSA and from 1.4 to 0.4 at% on low SSA particles). X-ray diffraction revealed that chloride was not incorporated into the bulk ceria structure, but crystal size increased upon contamination. Ce LIII-edge x-ray absorption spectroscopy confirmed that chloride was not present in the first co-ordination sphere around Ce(IV) ions, so was not bonded to Ce as chloride in the bulk structure. Sintering of contaminated high SSA particles occurred with heat treatment at 900 °C, and they resembled low SSA particles synthesised at this temperature. Physical chloride-particle interactions were investigated using electron microscopy and energy dispersive x-ray analysis, showing that chloride was homogeneously distributed on ceria and that reduction of porosity did not trap surface-sorbed chloride inside the particles as surface area was reduced during sintering. This has implications for stabilisation of chloride-contaminated PuO2 for long term storage.

  15. Small carpal bone surface area, a characteristic of Turner's syndrome

    International Nuclear Information System (INIS)

    Cleveland, R.H.; Done, S.; Correia, J.A.; Crawford, J.D.; Kushner, D.C.; Herman, T.E.


    An abnormality which has received little attention but may be easily recognized on radiographs of the hand of patients with Turner's syndrome is described. Eleven of thirty-one patients (35.5%) with Turner's syndrome were shown on radiographs of the hand to have a visually detectable smallness of the bone surface area of the carpus when compared to the area of the second through fifth metacarpals. Values for the ''C/M'' ratio (the area of the carpals divided by the area of the second through fifth metacarpals) were calculated for films of 31 individuals with gonadal dysgenesis and compared with those from bone age-matched films of seventy-six individuals with normal development of the hand and wrist. A consistent difference with minimal overlap was documented. (orig./WL)

  16. Sintering of uranium oxide of high specific surface area

    International Nuclear Information System (INIS)

    Bel, Alain; Francois, Bernard; Delmas, Roger; Caillat, Roger


    The extent to which a uranium oxide powder deriving from ammonium uranate or uranium peroxide lends itself to the sintering process depends largely on its specific surface area. When this is greater than 5 m 2 / g there is an optimum temperature for sintering in hydrogen. This temperature becomes less as the specific area of the powder is greater. Reprint of a paper published in Comptes rendus des seances de l'Academie des Sciences, t. 249, p. 1045-1047, sitting of 21 September 1959 [fr

  17. Spectral theory of infinite-area hyperbolic surfaces

    CERN Document Server

    Borthwick, David


    This text introduces geometric spectral theory in the context of infinite-area Riemann surfaces, providing a comprehensive account of the most recent developments in the field. For the second edition the context has been extended to general surfaces with hyperbolic ends, which provides a natural setting for development of the spectral theory while still keeping technical difficulties to a minimum. All of the material from the first edition is included and updated, and new sections have been added. Topics covered include an introduction to the geometry of hyperbolic surfaces, analysis of the resolvent of the Laplacian, scattering theory, resonances and scattering poles, the Selberg zeta function, the Poisson formula, distribution of resonances, the inverse scattering problem, Patterson-Sullivan theory, and the dynamical approach to the zeta function. The new sections cover the latest developments in the field, including the spectral gap, resonance asymptotics near the critical line, and sharp geometric constan...

  18. Thermal Desorption Analysis of Effective Specific Soil Surface Area (United States)

    Smagin, A. V.; Bashina, A. S.; Klyueva, V. V.; Kubareva, A. V.


    A new method of assessing the effective specific surface area based on the successive thermal desorption of water vapor at different temperature stages of sample drying is analyzed in comparison with the conventional static adsorption method using a representative set of soil samples of different genesis and degree of dispersion. The theory of the method uses the fundamental relationship between the thermodynamic water potential (Ψ) and the absolute temperature of drying ( T): Ψ = Q - aT, where Q is the specific heat of vaporization, and a is the physically based parameter related to the initial temperature and relative humidity of the air in the external thermodynamic reservoir (laboratory). From gravimetric data on the mass fraction of water ( W) and the Ψ value, Polyanyi potential curves ( W(Ψ)) for the studied samples are plotted. Water sorption isotherms are then calculated, from which the capacity of monolayer and the target effective specific surface area are determined using the BET theory. Comparative analysis shows that the new method well agrees with the conventional estimation of the degree of dispersion by the BET and Kutilek methods in a wide range of specific surface area values between 10 and 250 m2/g.

  19. Hand surface area estimation formula using 3D anthropometry. (United States)

    Hsu, Yao-Wen; Yu, Chi-Yuang


    Hand surface area is an important reference in occupational hygiene and many other applications. This study derives a formula for the palm surface area (PSA) and hand surface area (HSA) based on three-dimensional (3D) scan data. Two-hundred and seventy subjects, 135 males and 135 females, were recruited for this study. The hand was measured using a high-resolution 3D hand scanner. Precision and accuracy of the scanner is within 0.67%. Both the PSA and HSA were computed using the triangular mesh summation method. A comparison between this study and previous textbook values (such as in the U.K. teaching text and Lund and Browder chart discussed in the article) was performed first to show that previous textbooks overestimated the PSA by 12.0% and HSA by 8.7% (for the male, PSA 8.5% and HSA 4.7%, and for the female, PSA 16.2% and HSA 13.4%). Six 1D measurements were then extracted semiautomatically for use as candidate estimators for the PSA and HSA estimation formula. Stepwise regressions on these six 1D measurements and variable dependency test were performed. Results show that a pair of measurements (hand length and hand breadth) were able to account for 96% of the HSA variance and up to 98% of the PSA variance. A test of the gender-specific formula indicated that gender is not a significant factor in either the PSA or HSA estimation.

  20. Clinical and Pathological Roles of Ro/SSA Autoantibody System

    Directory of Open Access Journals (Sweden)

    Ryusuke Yoshimi


    Full Text Available Anti-Ro/SSA antibodies are among the most frequently detected autoantibodies against extractable nuclear antigens and have been associated with systemic lupus erythematosus (SLE and Sjögren's syndrome (SS. Although the presence of these autoantibodies is one of the criteria for the diagnosis and classification of SS, they are also sometimes seen in other systemic autoimmune diseases. In the last few decades, the knowledge of the prevalence of anti-Ro/SSA antibodies in various autoimmune diseases and symptoms has been expanded, and the clinical importance of these antibodies is increasing. Nonetheless, the pathological role of the antibodies is still poorly understood. In this paper, we summarize the milestones of the anti-Ro/SSA autoantibody system and provide new insights into the association between the autoantibodies and the pathogenesis of autoimmune diseases.

  1. Solvent accessible surface area (ASA) of simulated phospholipid membranes

    DEFF Research Database (Denmark)

    Tuchsen, E.; Jensen, Morten Østergaard; Westh, P.


    The membrane-solvent interface has been investigated through calculations of the solvent accessible surface area (ASA) for simulated membranes of DPPC and POPE. For DPPC at 52 degreesC we found an ASA of 126 +/- 8 Angstrom(2) per lipid molecule, equivalent to twice the projected lateral area......, even the most exposed parts of the PC head-group show average ASAs of less than half of its maximal or 'fully hydrated' value. The average ASA of a simulated POPE membrane was 96 +/- 7 Angstrom(2) per lipid. The smaller value than for DPPC reflects much lower ASA of the ammonium ion, which is partially...... compensated by increased exposure of the ethylene and phosphate moieties. The ASA of the polar moieties Of (PO4, NH3 and COO) constitutes 65% of the total accessible area for POPE, making this interface more polar than that of DPPC. It is suggested that ASA information can be valuable in attempts...

  2. Theoretical White Dwarf Spectra on Demand: TheoSSA (United States)

    Ringat, E.; Rauch, T.


    In the last decades, a lot of progress was made in spectral analysis. The quality (e.g. resolution, S/N ratio) of observed spectra has improved much and several model-atmosphere codes were developed. One of these is the ``Tübingen NLTE Model-Atmosphere Package'' (TMAP), that is a highly developed program for the calculation of model atmospheres of hot, compact objects. In the framework of the German Astrophysical Virtual Observatory (GAVO), theoretical spectral energy distributions (SEDs) can be downloaded via TheoSSA. In a pilot phase, TheoSSA is based on TMAP model atmospheres. We present the current state of this VO service.

  3. BOREAS RSS-7 Landsat TM LAI IMages of the SSA and NSA (United States)

    Hall, Forrest G. (Editor); Nickeson, Jaime (Editor); Chen, Jing; Cihlar, Josef


    The BOReal Ecosystem-Atmosphere Study Remote Sensing Science (BOREAS RSS-7) team used Landsat Thematic Mapper (TM) images processed at CCRS to produce images of Leaf Area Index (LAI) for the BOREAS study areas. Two images acquired on 06-Jun and 09-Aug-1991 were used for the SSA, and one image acquired on 09-Jun-1994 was used for the NSA. The LAI images are based on ground measurements and Landsat TM Reduced Simple Ratio (RSR) images. The data are stored in binary image-format files.

  4. Body surface area prediction in normal, hypermuscular, and obese mice. (United States)

    Cheung, Michael C; Spalding, Paul B; Gutierrez, Juan C; Balkan, Wayne; Namias, Nicholas; Koniaris, Leonidas G; Zimmers, Teresa A


    Accurate determination of body surface area (BSA) in experimental animals is essential for modeling effects of burn injury or drug metabolism. Two-dimensional surface area is related to three-dimensional body volume, which in turn can be estimated from body mass. The Meeh equation relates body surface area to the two-thirds power of body mass, through a constant, k, which must be determined empirically by species and size. We found older values of k overestimated BSA in certain mice; thus we determined empirically k for various strains of normal, obese, and hypermuscular mice. BSA was computed from digitally scanned pelts and nonlinear regression analysis was used to determine the best-fit k. The empirically determined k for C57BL/6J mice of 9.82 was not significantly different from other inbred and outbred mouse strains of normal body composition. However, mean k of the nearly spheroid, obese lepr(db/db) mice (k = 8.29) was significantly lower than for normals, as were values for dumbbell-shaped, hypermuscular mice with either targeted deletion of the myostatin gene (Mstn) (k = 8.48) or with skeletal muscle specific expression of a dominant negative myostatin receptor (Acvr2b) (k = 8.80). Hypermuscular and obese mice differ substantially from normals in shape and density, resulting in considerably altered k values. This suggests Meeh constants should be determined empirically for animals of altered body composition. Use of these new, improved Meeh constants will allow greater accuracy in experimental models of burn injury and pharmacokinetics.

  5. Indexing Glomerular Filtration Rate to Body Surface Area

    DEFF Research Database (Denmark)

    Redal-Baigorri, Belén; Rasmussen, Knud; Heaf, James Goya


    BACKGROUND: Kidney function is mostly expressed in terms of glomerular filtration rate (GFR). A common feature is the expression as ml/min per 1.73 m(2) , which represents the adjustment of the individual kidney function to a standard body surface area (BSA) to allow comparison between individuals....... We investigated the impact of indexing GFR to BSA in cancer patients, as this BSA indexation might affect the reported individual kidney function. METHODS: Cross-sectional study of 895 adults who had their kidney function measured with (51) chrome ethylene diamine tetraacetic acid. Mean values of BSA...

  6. Asymptotic variance of grey-scale surface area estimators

    DEFF Research Database (Denmark)

    Svane, Anne Marie

    Grey-scale local algorithms have been suggested as a fast way of estimating surface area from grey-scale digital images. Their asymptotic mean has already been described. In this paper, the asymptotic behaviour of the variance is studied in isotropic and sufficiently smooth settings, resulting...... in a general asymptotic bound. For compact convex sets with nowhere vanishing Gaussian curvature, the asymptotics can be described more explicitly. As in the case of volume estimators, the variance is decomposed into a lattice sum and an oscillating term of at most the same magnitude....



    Dody Prayitno; M. Irsyad


    Aluminum and steel are used to be a construction for a building outdoor panel. Aluminum and steel are connected by bolt and nut. An atmosphere due to a corrosion of the aluminum. The corrosion possibly to cause the hole diameter of bolt and nut to become larger. Thus the bolt and nut can not enough strong to hold the panel. The panel may collapse. The aim of the research is first to answer a question where does the corrosion starts. The second is to know the effect of ratio surface area of st...

  8. Evaluating Options for Civil Space Situational Awareness (SSA) (United States)

    Lal, B.; Carioscia, S. A.

    In recent years, the number of active satellites and human-made orbital space debris has increased dramatically. An expansion of activities in space, as is currently being proposed by many commercial and international entities, is expected to further exacerbate this challenge. The 18th Space Control Squadron under the Department of Defense (DOD) United States Strategic Command provides space situational awareness (SSA) services to users outside the national security community at no cost. International and commercial users demand better SSA service than is currently feasible, and the demand comes at a time when DOD is under pressure to better prepare for and respond to growing space-based threats to national security. Concerned about the possibility of overextending across conflicting missions in a fiscally constrained environment, some DOD officials have publicly noted a desire to move SSA services not related to national security out of DOD purview. Responding to a request from the Federal Aviation Administration (FAA) Office of Commercial Space Transportation (AST), researchers at the Science and Technology Policy Institute (STPI) identified and evaluated potential approaches for providing SSA services for civil and commercial operations in space. In this paper, we summarize the report [1] and present the pros and cons of four approaches to the provision of civil SSA services in the United States: (1) maintaining status quo through continued provision by DOD; (2) provision by a civil government entity; (3) industry self-provision; and (4) provision by an international organization. Within the second approach, assuming the provision of SSA by a civil agency, STPI further identified and discussed four options: (1) civil agency service capability embedded within DOD; (2) independent civil service capability, using DOD software and systems; (3) independent civil service capability, using commercial software and systems; and (4) the government certifies non

  9. Hierarchical nitrogen-doped porous carbon with high surface area derived from endothelium corneum gigeriae galli for high-performance supercapacitor

    International Nuclear Information System (INIS)

    Hong, Xiaoting; Hui, K.S.; Zeng, Zhi; Hui, K.N.; Zhang, Luojiang; Mo, Mingyue; Li, Min


    Highlights: • Porous carbons were prepared using endothelium corneum gigeriae galli as precursor. • Surface and structural properties strongly depend on carbonization temperatures. • Resultant carbons possess nitrogen heteroatom and high surface areas. • ECGG-900 sample exhibits excellent electrochemical capacitive performances. - Abstract: Endothelium corneum gigeriae galli derived 3D hierarchical nitrogen-doped porous carbon was for the first time prepared by preliminary carbonization at 450 °C and final KOH activation at high temperatures. The surface and structural properties of the as-synthesized samples are analyzed with Brunauer–Emmett–Teller surface analyzer apparatus, X-Ray Diffractometer, scanning electron microscopy, transmission electron microscopy, X-ray photoelectron spectrometer. The electrochemical performances are analyzed by cyclic voltammetry, galvanostatic charge/discharge cycling and electrochemical impedance spectroscopy. The obtained results show that the sample carbonized at 900 °C possesses the SSA of 2149.9 m 2 g −1 , average micropore diameter of 1.78 nm, and exhibits the highest initial specific capacitance of 198.0 F g −1 at current density of 1 A g −1 in 6 M KOH solution. It retains good specific capacitance retention of 91.6% after 3000 charge/discharge cycles at current density of 2 A g −1

  10. Non-traditional Sensor Tasking for SSA: A Case Study (United States)

    Herz, A.; Herz, E.; Center, K.; Martinez, I.; Favero, N.; Clark, C.; Therien, W.; Jeffries, M.

    Industry has recognized that maintaining SSA of the orbital environment going forward is too challenging for the government alone. Consequently there are a significant number of commercial activities in various stages of development standing-up novel sensors and sensor networks to assist in SSA gathering and dissemination. Use of these systems will allow government and military operators to focus on the most sensitive space control issues while allocating routine or lower priority data gathering responsibility to the commercial side. The fact that there will be multiple (perhaps many) commercial sensor capabilities available in this new operational model begets a common access solution. Absent a central access point to assert data needs, optimized use of all commercial sensor resources is not possible and the opportunity for coordinated collections satisfying overarching SSA-elevating objectives is lost. Orbit Logic is maturing its Heimdall Web system - an architecture facilitating “data requestor” perspectives (allowing government operations centers to assert SSA data gathering objectives) and “sensor operator” perspectives (through which multiple sensors of varying phenomenology and capability are integrated via machine -machine interfaces). When requestors submit their needs, Heimdall’s planning engine determines tasking schedules across all sensors, optimizing their use via an SSA-specific figure-of-merit. ExoAnalytic was a key partner in refining the sensor operator interfaces, working with Orbit Logic through specific details of sensor tasking schedule delivery and the return of observation data. Scant preparation on both sides preceded several integration exercises (walk-then-run style), which culminated in successful demonstration of the ability to supply optimized schedules for routine public catalog data collection – then adapt sensor tasking schedules in real-time upon receipt of urgent data collection requests. This paper will provide a

  11. Surface States and Effective Surface Area on Photoluminescent P-Type Porous Silicon (United States)

    Weisz, S. Z.; Porras, A. Ramirez; Resto, O.; Goldstein, Y.; Many, A.; Savir, E.


    The present study is motivated by the possibility of utilizing porous silicon for spectral sensors. Pulse measurements on the porous-Si/electrolyte system are employed to determine the surface effective area and the surface-state density at various stages of the anodization process used to produce the porous material. Such measurements were combined with studies of the photoluminescence spectra. These spectra were found to shift progressively to the blue as a function of anodization time. The luminescence intensity increases initially with anodization time, reaches a maximum and then decreases with further anodization. The surface state density, on the other hand, increases with anodization time from an initial value of about 2 x 10(exp 12)/sq cm surface to about 1013 sq cm for the anodized surface. This value is attained already after -2 min anodization and upon further anodization remains fairly constant. In parallel, the effective surface area increases by a factor of 10-30. This behavior is markedly different from the one observed previously for n-type porous Si.

  12. BOREAS TF-8 NSA-OJP and SSA-OBS Ceilometer Data (United States)

    Moore, Kathleen E.; Hall, Forrest G. (Editor); Huemmrich, Karl (Editor); Fitzjarrald, David R.


    The BOREAS TF-8 team used ceilometers to collect data on the fraction of the sky covered with clouds and the cloud height. Included with these data is the surface-based lifting condensation level, derived from temperature and humidity values acquired at the flux tower at the NSA-OJP site. Ceilo-meter data were collected at the NSA-OJP site in 1994 and at the NSA-OJP and SSA-OBS sites in 1996. The data are available in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884).

  13. 30 CFR 785.19 - Surface coal mining and reclamation operations on areas or adjacent to areas including alluvial... (United States)


    ... alluvial valley floor exists if it finds that— (i) Unconsolidated streamlaid deposits holding streams are... on areas or adjacent to areas including alluvial valley floors in the arid and semiarid areas west of....19 Surface coal mining and reclamation operations on areas or adjacent to areas including alluvial...

  14. Electromagnetic surface waves for large-area RF plasma productions between large-area planar electrodes

    International Nuclear Information System (INIS)

    Nonaka, S.


    Recently, large-area plasma production has been tested by means of a 13.56 MHz radio-frequency (RF) discharge between a pair of large-area planar electrodes, approximately 0.5 m x 1.4 m, as one of the semiconductor technologies for fabrication of large-area amorphous silicon solar cells in the ''Sunshine Project'' of the Agency of Industrial Science and Technology in Japan. We also confirmed long plasma production between a pair of long electrodes. In this paper, normal electromagnetic (EM) waves propagating in a region between a planar waveguide with one plasma and two dielectric layers are analyzed in order to study the feasibility of large-area plasma productions by EM wave-discharges between a pair of large-area RF electrodes larger than the half-wavelength of RF wave. In conclusion, plasmas higher than an electron plasma frequency will be produced by an odd TMoo surface mode. (author) 4 refs., 3 figs

  15. Human cortical areas involved in perception of surface glossiness. (United States)

    Wada, Atsushi; Sakano, Yuichi; Ando, Hiroshi


    Glossiness is the visual appearance of an object's surface as defined by its surface reflectance properties. Despite its ecological importance, little is known about the neural substrates underlying its perception. In this study, we performed the first human neuroimaging experiments that directly investigated where the processing of glossiness resides in the visual cortex. First, we investigated the cortical regions that were more activated by observing high glossiness compared with low glossiness, where the effects of simple luminance and luminance contrast were dissociated by controlling the illumination conditions (Experiment 1). As cortical regions that may be related to the processing of glossiness, V2, V3, hV4, VO-1, VO-2, collateral sulcus (CoS), LO-1, and V3A/B were identified, which also showed significant correlation with the perceived level of glossiness. This result is consistent with the recent monkey studies that identified selective neural response to glossiness in the ventral visual pathway, except for V3A/B in the dorsal visual pathway, whose involvement in the processing of glossiness could be specific to the human visual system. Second, we investigated the cortical regions that were modulated by selective attention to glossiness (Experiment 2). The visual areas that showed higher activation to attention to glossiness than that to either form or orientation were identified as right hV4, right VO-2, and right V3A/B, which were commonly identified in Experiment 1. The results indicate that these commonly identified visual areas in the human visual cortex may play important roles in glossiness perception. Copyright © 2014. Published by Elsevier Inc.

  16. Assessment of Surface Area Characteristics of Dental Implants with Gradual Bioactive Surface Treatment (United States)

    Czan, Andrej; Babík, Ondrej; Miklos, Matej; Záušková, Lucia; Mezencevová, Viktória


    Since most of the implant surface is in direct contact with bone tissue, shape and integrity of said surface has great influence on successful osseointegration. Among other characteristics that predetermine titanium of different grades of pureness as ideal biomaterial, titanium shows high mechanical strength making precise miniature machining increasingly difficult. Current titanium-based implants are often anodized due to colour coding. This anodized layer has important functional properties for right usage and also bio-compatibility of dental implants. Physical method of anodizing and usage of anodizing mediums has a significant influence on the surface quality and itself functionality. However, basic requirement of the dental implant with satisfactory properties is quality of machined surface before anodizing. Roughness, for example, is factor affecting of time length of anodizing operation and so whole productivity. The paper is focused on monitoring of surface and area characteristics, such as roughness or surface integrity after different cutting conditions of miniature machining of dental implants and their impact on suitability for creation of satisfactory anodized layer with the correct biocompatible functional properties.

  17. Overview of Human-Centric Space Situational Awareness (SSA) Science and Technology (S&T) (United States)

    Ianni, J.; Aleva, D.; Ellis, S.


    A number of organizations, within the government, industry, and academia, are researching ways to help humans understand and react to events in space. The problem is both helped and complicated by the fact that there are numerous data sources that need to be planned (i.e., tasked), collected, processed, analyzed, and disseminated. A large part of the research is in support of the Joint Space Operational Center (JSpOC), National Air and Space Intelligence Center (NASIC), and similar organizations. Much recent research has been specifically targeting the JSpOC Mission System (JMS) which has provided a unifying software architecture. This paper will first outline areas of science and technology (S&T) related to human-centric space situational awareness (SSA) and space command and control (C2) including: 1. Object visualization - especially data fused from disparate sources. Also satellite catalog visualizations that convey the physical relationships between space objects. 2. Data visualization - improve data trend analysis as in visual analytics and interactive visualization; e.g., satellite anomaly trends over time, space weather visualization, dynamic visualizations 3. Workflow support - human-computer interfaces that encapsulate multiple computer services (i.e., algorithms, programs, applications) into a 4. Command and control - e.g., tools that support course of action (COA) development and selection, tasking for satellites and sensors, etc. 5. Collaboration - improve individuals or teams ability to work with others; e.g., video teleconferencing, shared virtual spaces, file sharing, virtual white-boards, chat, and knowledge search. 6. Hardware/facilities - e.g., optimal layouts for operations centers, ergonomic workstations, immersive displays, interaction technologies, and mobile computing. Secondly we will provide a survey of organizations working these areas and suggest where more attention may be needed. Although no detailed master plan exists for human

  18. Estimating the surface area of birds: using the homing pigeon (Columba livia as a model

    Directory of Open Access Journals (Sweden)

    Cristina R. Perez


    Full Text Available Estimation of the surface area of the avian body is valuable for thermoregulation and metabolism studies as well as for assessing exposure to oil and other surface-active organic pollutants from a spill. The use of frozen carcasses for surface area estimations prevents the ability to modify the posture of the bird. The surface area of six live homing pigeons in the fully extended flight position was estimated using a noninvasive method. An equation was derived to estimate the total surface area of a pigeon based on its body weight. A pigeon's surface area in the fully extended flight position is approximately 4 times larger than the surface area of a pigeon in the perching position. The surface area of a bird is dependent on its physical position, and, therefore, the fully extended flight position exhibits the maximum area of a bird and should be considered the true surface area of a bird.



    Hong Shen


    The concepts of curve profile, curve intercept, curve intercept density, curve profile area density, intersection density in containing intersection (or intersection density relied on intersection reference), curve profile intersection density in surface (or curve intercept intersection density relied on intersection of containing curve), and curve profile area density in surface (AS) were defined. AS expressed the amount of curve profile area of Y phase in the unit containing surface area, S...

  20. A hybrid intermediate language between SSA and CPS

    DEFF Research Database (Denmark)

    Torrens, Paulo; Vasconcellos, Cristiano; Gonçalves, Ju


    passing style (CPS) lambda calculus has been used as intermediate language for functional language compilers, they are (almost) equivalent and it is possible to draw syntactic translations between them. This short paper aims to present an untyped intermediate language which may be interpreted as both SSA...... and CPS, in order to provide a common language for both imperative and functional compilers, as well to take advantage of optimizations designed for either one of the approaches. Finally, potential variants and research opportunities are discussed....

  1. Automatic Satellite Telemetry Analysis for SSA using Artificial Intelligence Techniques (United States)

    Stottler, R.; Mao, J.

    In April 2016, General Hyten, commander of Air Force Space Command, announced the Space Enterprise Vision (SEV) ( The SEV addresses increasing threats to space-related systems. The vision includes an integrated approach across all mission areas (communications, positioning, navigation and timing, missile warning, and weather data) and emphasizes improved access to data across the entire enterprise and the ability to protect space-related assets and capabilities. "The future space enterprise will maintain our nation's ability to deliver critical space effects throughout all phases of conflict," Hyten said. Satellite telemetry is going to become available to a new audience. While that telemetry information should be valuable for achieving Space Situational Awareness (SSA), these new satellite telemetry data consumers will not know how to utilize it. We were tasked with applying AI techniques to build an infrastructure to process satellite telemetry into higher abstraction level symbolic space situational awareness and to initially populate that infrastructure with useful data analysis methods. We are working with two organizations, Montana State University (MSU) and the Air Force Academy, both of whom control satellites and therefore currently analyze satellite telemetry to assess the health and circumstances of their satellites. The design which has resulted from our knowledge elicitation and cognitive task analysis is a hybrid approach which combines symbolic processing techniques of Case-Based Reasoning (CBR) and Behavior Transition Networks (BTNs) with current Machine Learning approaches. BTNs are used to represent the process and associated formulas to check telemetry values against anticipated problems and issues. CBR is used to represent and retrieve BTNs that represent an investigative process that should be applied to the telemetry in certain circumstances

  2. Systematic Sustainability Assessment (SSA) Tool for Hydroelectric Project in Malaysia (United States)

    Turan, Faiz Mohd; Johan, Kartina


    Sustainably developed and managed hydropower has enormous potential to contribute to global sustainability goals. It is known that hydroelectricity contributing small amounts to greenhouse gas emissions and other atmospheric pollutants. However, developing the remaining hydroelectric potential offers many challenges, and public pressure and expectations on the environmental and social performance of hydroelectric tend to increase over time. This paper aims to develop Systematic Sustainability Assessment (SSA) Tool that promotes and guides more sustainable hydroelectric projects in the context of Malaysia. The proposed SSA tool which not only provide a quality and quantitative report of sustainability performance but also act as Self-Assessment Report (SAR) to provide roadmap to achieve greater level of sustainability in project management for continuous improvement. It is expected to provide a common language that allow government, civil society, financial institutions and the hydroelectric sector to talk about and evaluate sustainability issues. The advantage of SSA tool is it can be used at any stage of hydroelectric development, from the earliest planning stages right through to operation.

  3. The winds regime of surface in the Colombian coffee area

    International Nuclear Information System (INIS)

    Orlando Guzman Martinez; Lucia Gomez Gomez


    The characteristics of the address and gust of wind of the surface winds have been studied in 15 stations of the Colombian coffee area. It was found that the relief plays an important paper in the wind circulation so that during the day (7 a.m. - 7 p.m.) these they blow of the low sector toward the mountain and at night (7 p.m. - 7 a.m.) this situation is invested, that which is consistent with the characteristic pattern of circulation valley-mountain of the mountainous regions. For this fact, in most of the analyzed places a single day and night dominant address that it takes the orientation in that it is the respective hydrographic basin. It was not observed that the Alisios winds of the northeast and southeast modify the address settled down by the local circulation (valley-mountain) on the other hand a remarkable increase of the gust of wind was appreciated in July and August in the Florida and Ospina, stations located to the south of the country, as direct consequence of the Alisios of the southeast. The daily gust of wind in most of the studied places is low and it doesn't exceed of the 10 km/h, reason why it can consider that the Colombian coffee area is free of important damages for the action of the wind. Nevertheless, in some stations as Alban, Maracay and Paraguaicito the daily maximum gust of wind can surpass the 30 km/h and in occasions to cause damage mechanic to cultivations of high behavior and not well anchored facilities

  4. Extent of Stream Burial and Relationships to Watershed Area, Topography, and Impervious Surface Area

    Directory of Open Access Journals (Sweden)

    Roy E. Weitzell


    Full Text Available Stream burial—the routing of streams through culverts, pipes, and concrete lined channels, or simply paving them over—is common during urbanization, and disproportionately affects small, headwater streams. Burial undermines the physical and chemical processes governing life in streams, with consequences for water quality and quantity that may amplify from headwaters to downstream receiving waters. Knowledge of the extent of stream burial is critical for understanding cumulative impacts to stream networks, and for future decision-making allowing for urban development while protecting ecosystem function. We predicted stream burial across the urbanizing Potomac River Basin (USA for each 10-m stream segment in the basin from medium-resolution impervious cover data and training observations obtained from high-resolution aerial photography in a GIS. Results were analyzed across a range in spatial aggregation, including counties and independent cities, small watersheds, and regular spatial grids. Stream burial was generally correlated with total impervious surface area (ISA, with areas exhibiting ISA above 30% often subject to elevated ratios of stream burial. Recurring patterns in burial predictions related to catchment area and topographic slope were also detected. We discuss these results in the context of physiographic constraints on stream location and urban development, including implications for environmental management of aquatic resources.

  5. Discrepancy between body surface area and body composition in cancer. (United States)

    Stobäus, Nicole; Küpferling, Susanne; Lorenz, Marie-Luise; Norman, Kristina


    Calculation of cytostatic dose is typically based on body surface area (BSA) regardless of body composition. The aim of this study was to assess the discrepancy between BSA and low fat-free mass (FFM) by investigating the prevalence of low FFM with regard to BSA in 630 cancer patients. First, BSA was calculated according to DuBois and DuBois. Patients were divided into 6 categories with respect to their BSA. Each BSA category was further divided into 3 groups according to FFM: low (FFM), normal (-0.99 and 0.99 SD of mean FFM) or high (>1 SD of mean FFM), which was derived through bioelectric impedance analysis. FFM was reduced in 15.7% of patients, 69% had normal and 15.2% had high FFM. In patients with low FFM (i.e., more than-1 SD lower than the mean FFM within their BSA group), body mass index and fatigue were higher whereas functional status was reduced. Moreover, in the subcohort of patients receiving chemotherapy, absolute FFM [Hazard ratio (HR) = 0.970, P = 0.026] as well as the allocation to the low FFM group (HR = 1.644, P = 0.025) emerged as predictors of increased 1-yr mortality. In conclusion, there was a large discrepancy between FFM and BSA. Particularly women were affected by low FFM.

  6. Modeling surface area to volume effects on borosilicate glass dissolution

    International Nuclear Information System (INIS)

    Bourcier, W.L.; Ebert, W.L.; Feng, X.


    We simulated the reaction of SRL-131 glass with equilibrated J-13 water in order to investigate the effects of surface area to volume ratio (SA/V) on glass dissolution. We show that glass-fluid ion exchange causes solution pH to rise to progressively higher values as SA/V increases. Because the ion exchange is rapid relative to the duration of the glass dissolution experiment, the pH effect does not scale with (SA/V)*time. Experiments compared at the same (SA/V)*time value therefore have different pHs, with higher pHs at higher SA/V ratios. Both experimental data and our simulation results show similar trends of increasing reaction rate as a function of SA/V ratio when scaled to (SA/V)*time. Glasses which react in systems of differing SA/V ratio therefore follow different reaction paths and high SA/V ratios cannot be used to generate data which accurately scales to long time periods unless the ion exchange effect is taken into account. We suggest some simple test designs which enable more reliable high. SA/V accelerated tests

  7. Surface Rupture Effects on Earthquake Moment-Area Scaling Relations (United States)

    Luo, Yingdi; Ampuero, Jean-Paul; Miyakoshi, Ken; Irikura, Kojiro


    Empirical earthquake scaling relations play a central role in fundamental studies of earthquake physics and in current practice of earthquake hazard assessment, and are being refined by advances in earthquake source analysis. A scaling relation between seismic moment ( M 0) and rupture area ( A) currently in use for ground motion prediction in Japan features a transition regime of the form M 0- A 2, between the well-recognized small (self-similar) and very large (W-model) earthquake regimes, which has counter-intuitive attributes and uncertain theoretical underpinnings. Here, we investigate the mechanical origin of this transition regime via earthquake cycle simulations, analytical dislocation models and numerical crack models on strike-slip faults. We find that, even if stress drop is assumed constant, the properties of the transition regime are controlled by surface rupture effects, comprising an effective rupture elongation along-dip due to a mirror effect and systematic changes of the shape factor relating slip to stress drop. Based on this physical insight, we propose a simplified formula to account for these effects in M 0- A scaling relations for strike-slip earthquakes.

  8. Tracheobronchial and Alveolar Particle Surface Area Doses in Smokers

    Directory of Open Access Journals (Sweden)

    Fernanda Carmen Fuoco


    Full Text Available Cigarette smoke is the main cause of lung cancer events. Mainstream cigarette smoke (MSS is a direct concern for smokers, but also the secondhand smoke (SHS contributes to the smoker exposure. In addition, smoker exposure is affected by the “free-smoke” particle exposure (B, related to the micro-environments where smokers spend time. The aim of this paper is to evaluate the daily alveolar and tracheobronchial deposited fractions of airborne particles for smokers as the sum of these three contributions: MSS, SHS, and B. Measurements of particle surface area distributions in the MSS were performed through a Scanning Mobility Particle Sizer, an Aerodynamic Particle Sizer, and a Thermo-dilution system on five types of conventional cigarettes. A Monte Carlo method was then applied to evaluate the most probable value of dose received during the inhalation of MSS by smokers. Measurements of particle concentrations in SHS and at the “free-smoke” particle background (B were performed through 24-h monitoring at a personal scale of adult smoker through hand-held devices. This paper found that the total daily deposited dose for typical smokers was 1.03 × 105 mm2·day−1. The main contribution of such a huge daily dose was addressable to the MSS (98% while SHS contributed 1.1%, increasing up to 2% for people smoking only while traveling in a car.

  9. Effects of synthesis conditions on structure and surface properties of SmMn{sub 2}O{sub 5} mullite-type oxide

    Energy Technology Data Exchange (ETDEWEB)

    Thampy, Sampreetha; Ibarra, Venessa; Lee, Yun-Ju [Department of Materials Science and Engineering, University of Texas at Dallas, Richardson, TX 75080 (United States); McCool, Geoffrey [Nanostellar Inc., 3696 Haven Avenue, Redwood City, CA 94063 (United States); Cho, Kyeongjae [Department of Materials Science and Engineering, University of Texas at Dallas, Richardson, TX 75080 (United States); Hsu, Julia W.P., E-mail: [Department of Materials Science and Engineering, University of Texas at Dallas, Richardson, TX 75080 (United States)


    Highlights: • Investigate the effects of calcination temperature and precipitation pH on crystallinity, phase purity, particle size, surface composition, and NO adsorption capacity of SmMn{sub 2}O{sub 5}. • High calcination temperature increases mullite phase purity but decreases specific surface area (SSA). • Mullite phase purity is independent of pH while SSA monotonically increases. • SSA and surface Mn/Sm ratio determine NO uptake. - Abstract: A mixed-phase compound that contains SmMn{sub 2}O{sub 5} mullite-type oxides has been reported to display excellent catalytic activity for nitric oxide (NO) oxidation. Here we investigate the effects of calcination temperature and precipitation pH on structural, physical, chemical, and surface properties of SmMn{sub 2}O{sub 5}. As the calcination temperature increases from 750 °C to 1000 °C, mullite phase purity increases from 74% to 100%, while specific surface area (SSA) decreases from 23.6 m{sup 2}/g to 5.1 m{sup 2}/g with particle size increases correspondingly. Mullite phase purity (87%) is independent of pH between 8.5–10.4, whereas SSA monotonically increases from 12.5 m{sup 2}/g at pH 8.1 to 27.4 m{sup 2}/g at pH 13. X-ray photoelectron spectroscopy (XPS) studies reveal that the surface Mn/Sm ratio is similar to the bulk value and is unaffected by calcination temperature and pH values up to 10.4, whereas sample precipitated at pH 13 is surface-rich in Sm. NO chemisorption studies show that the SSA and surface Mn/Sm ratio determine NO uptake by SmMn{sub 2}O{sub 5} mullite oxides.

  10. 3-D image-based numerical computations of snow permeability: links to specific surface area, density, and microstructural anisotropy

    Directory of Open Access Journals (Sweden)

    N. Calonne


    Full Text Available We used three-dimensional (3-D images of snow microstructure to carry out numerical estimations of the full tensor of the intrinsic permeability of snow (K. This study was performed on 35 snow samples, spanning a wide range of seasonal snow types. For several snow samples, a significant anisotropy of permeability was detected and is consistent with that observed for the effective thermal conductivity obtained from the same samples. The anisotropy coefficient, defined as the ratio of the vertical over the horizontal components of K, ranges from 0.74 for a sample of decomposing precipitation particles collected in the field to 1.66 for a depth hoar specimen. Because the permeability is related to a characteristic length, we introduced a dimensionless tensor K*=K/res2, where the equivalent sphere radius of ice grains (res is computed from the specific surface area of snow (SSA and the ice density (ρi as follows: res=3/(SSA×ρi. We define K and K* as the average of the diagonal components of K and K*, respectively. The 35 values of K* were fitted to snow density (ρs and provide the following regression: K = (3.0 ± 0.3 res2 exp((−0.0130 ± 0.0003ρs. We noted that the anisotropy of permeability does not affect significantly the proposed equation. This regression curve was applied to several independent datasets from the literature and compared to other existing regression curves or analytical models. The results show that it is probably the best currently available simple relationship linking the average value of permeability, K, to snow density and specific surface area.

  11. Production characteristics of lettuce Lactuca sativa L. in the frame of the first crop tests in the Higher Plant Chamber integrated into the MELiSSA Pilot Plant (United States)

    Tikhomirova, Natalia; Lawson, Jamie; Stasiak, Michael; Dixon, Mike; Paille, Christel; Peiro, Enrique; Fossen, Arnaud; Godia, Francesc

    Micro-Ecological Life Support System Alternative (MELiSSA) is an artificial closed ecosystem that is considered a tool for the development of a bioregenerative life support system for manned space missions. One of the five compartments of MELiSSA loop -Higher Plant Chamber was recently integrated into the MELiSSA Pilot Plant facility at Universitat Aut`noma deo Barcelona. The main contributions expected by integration of this photosynthetic compartment are oxygen, water, vegetable food production and CO2 consumption. Production characteristics of Lactuca sativa L., as a MELiSSA candidate crop, were investigated in this work in the first crop experiments in the MELiSSA Pilot Plant facility. The plants were grown in batch culture and totaled 100 plants with a growing area 5 m long and 1 m wide in a sealed controlled environment. Several replicates of the experiments were carried out with varying duration. It was shown that after 46 days of lettuce cultivation dry edible biomass averaged 27, 2 g per plant. However accumulation of oxygen in the chamber, which required purging of the chamber, and decrease in the food value of the plants was observed. Reducing the duration of the tests allowed uninterrupted test without opening the system and also allowed estimation of the crop's carbon balance. Results of productivity, tissue composition, nutrient uptake and canopy photosynthesis of lettuce regardless of test duration are discussed in the paper.

  12. Estimation of Specific Surface Area using Langmuir Isotherm ...

    African Journals Online (AJOL)

    Michael Horsfall

    Y= KCe/(1+KCe) (1) where Y is the fraction of fish carbon surface covered ..... transmigration of adsorbate in the plane surface. (Hameed et al., 2006). ... and to the Technologists of Agric Soil Science. Laboratory of ... Biosorption of Heavy Metals by Activated. Sludge and their Desorption Characteristics. J. Environ Mgt. 84: ...

  13. High-surface-area silica nanospheres (KCC-1) with a fibrous morphology

    KAUST Repository

    Polshettiwar, Vivek; Cha, Dong Kyu; Zhang, Xixiang; Basset, Jean-Marie


    Fibrous nanosilica: A new family of high-surface-area silica nanospheres (KCC-1) have been prepared (see picture). KCC-1 features excellent physical properties, including high surface area, unprecedented fibrous surface morphology, high thermal (up to 950 °C) and hydrothermal stabilities, and high mechanical stability. Copyright © 2010 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Determining eyeball surface area directly exposed to the effects of external factors. (United States)

    Juliszewski, Tadeusz; Kadłuczka, Filip; Kiełbasa, Paweł


    This article discusses determining the surface area of eyeballs of men and women exposed to the direct effects of external factors in the working environment. For one eye, the mean surface is 172-182 mm(2). The determined surface area can be used in formulas for calculating the exposure of eyeballs to harmful chemical substances in workplace air.

  15. 30 CFR 942.761 - Areas designated unsuitable for surface coal mining by act of Congress. (United States)


    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 942.761 Section 942.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

  16. 30 CFR 903.761 - Areas designated unsuitable for surface coal mining by act of Congress. (United States)


    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 903.761 Section 903.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, applies to surface coal mining...

  17. 30 CFR 910.761 - Areas designated unsuitable for surface coal mining by Act of Congress. (United States)


    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by Act of Congress. 910.761 Section 910.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

  18. 30 CFR 937.761 - Areas designated unsuitable for surface coal mining by Act of Congress. (United States)


    ... mining by Act of Congress. 937.761 Section 937.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... WITHIN EACH STATE OREGON § 937.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and...

  19. 30 CFR 921.761 - Areas designated unsuitable for surface coal mining by Act of Congress. (United States)


    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by Act of Congress. 921.761 Section 921.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

  20. 30 CFR 912.761 - Areas designated unsuitable for surface coal mining by act of Congress. (United States)


    ... mining by act of Congress. 912.761 Section 912.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... WITHIN EACH STATE IDAHO § 912.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and...

  1. 30 CFR 947.761 - Areas designated unsuitable for surface coal mining by act of Congress. (United States)


    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 947.761 Section 947.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

  2. 30 CFR 939.761 - Areas designated unsuitable for surface coal mining by Act of Congress. (United States)


    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by Act of Congress. 939.761 Section 939.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

  3. 30 CFR 941.761 - Areas designated unsuitable for surface coal mining by act of Congress. (United States)


    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 941.761 Section 941.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

  4. 30 CFR 922.761 - Areas designated unsuitable for surface coal mining by act of Congress. (United States)


    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 922.761 Section 922.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

  5. 30 CFR 905.761 - Areas designated unsuitable for surface coal mining by act of Congress. (United States)


    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 905.761 Section 905.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

  6. High-surface-area silica nanospheres (KCC-1) with a fibrous morphology

    KAUST Repository

    Polshettiwar, Vivek


    Fibrous nanosilica: A new family of high-surface-area silica nanospheres (KCC-1) have been prepared (see picture). KCC-1 features excellent physical properties, including high surface area, unprecedented fibrous surface morphology, high thermal (up to 950 °C) and hydrothermal stabilities, and high mechanical stability. Copyright © 2010 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. Restoration of eroded surfaces in Serbian ski-areas

    Directory of Open Access Journals (Sweden)

    Ristić Ratko


    Full Text Available The environmental impacts in Serbian ski areas are very strong, leading to landscape degradation and functionality losses. Construction or improvement works cause serious destruction of topsoil and native vegetation. Some activities enhance erosion production and sediment yield: clear cuttings; trunk transport down the slope; road construction and large excavations. Also, lack of erosion control works in ski areas, especially between April and October, result in various forms of land degradation such as furrows, gullies, landslides, or debris from rock weathering. The consequences of mismanagement in ski areas are noticeable in downstream sections of river beds, causing floods and bed-load deposition. Planning and designing activities, with the application of technical and biotechnical erosion control structures, through the concept of restoration, are necessary measures in the protection of ski areas.

  8. Assessment of large aperture scintillometry for large-area surface ...

    Indian Academy of Sciences (India)


    1995), flat pastoral surfaces. (McAneny ... heat flux using net radiometer and soil heat flux plate, respectively and synchronized with ..... order to facilitates development of satellite based application for ET and drought monitoring, the .... daytime sensible heat flux and momentum fluxes;Boundary- Layer Meteorol.,68 357-373.

  9. Surface albedo measurements in Mexico City metropolitan area

    Energy Technology Data Exchange (ETDEWEB)

    Castro, T; Mar, B; Longoria, R; Ruiz Suarez, L. G [Centro de Ciencias de la Atmosfera, UNAM, Mexico, D.F. (Mexico); Morales, L [Instituto de Geografia, UNAM, Mexico, D.F. (Mexico)


    Optical and thermal properties of soils are important input data for the meteorological and photochemical modules of air quality models. As development of these models increase on spatial resolution good albedo data become more important. In this paper measurements of surface albedo of UV (295-385 nm) and visible (450-550 nm) radiation are reported for different urban and rural surfaces in the vicinity of Mexico City. It was found for the downtown zone and average albedo value of 0.05 which is in very good agreement with reported values for urban surfaces. Our albedo values measured in UV region for grey cement and green grass are of 0.10 and 0.009, respectively, and quite similar to those found at the literature of 0.11 and 0.008 for those type of surfaces. [Spanish] Las propiedades opticas y termicas de suelos son datos importantes para los modulos meteorologicos y fotoquimicos de los modelos de calidad del aire. Conforme aumenta la resolucion espacial del modelo se vuelve mas importante contar con buenos datos de albedo. En este articulo se presentan mediciones de albedo superficial de radiacion Ultravioleta (295-385 nm) y visible (450-550 nm) para diferentes superficies urbanas. Los valores medidos de albedo en la region UV para cemento gris y pasto verde son de 0.10 y 0.009, respectivamente, y son muy similares a los reportados en la literatura, 0.11 y 0.008 para este tipo de superficies.

  10. Large Area Diamond Tribological Surfaces with Negligible Wear in Extreme Environments, Phase I (United States)

    National Aeronautics and Space Administration — In Phase I we propose to demonstrate the processing of very large area diamond sliding bearings and tribological surfaces. The bearings and surfaces will experience...

  11. Possibilities of surface waters monitoring at mining areas using UAV (United States)

    Lisiecka, Ewa; Motyka, Barbara; Motyka, Zbigniew; Pierzchała, Łukasz; Szade, Adam


    The selected, remote measurement methods are discussed, useful for determining surface water properties using mobile unmanned aerial platforms (UAV). The possibilities of using this type of solutions in the scope of measuring spatial, physicochemical and biological parameters of both natural and anthropogenic water reservoirs, including flood polders, water-filled pits, settling tanks and mining sinks were analyzed. Methods of remote identification of the process of overgrowing this type of ecosystems with water and coastal plant formations have also been proposed.

  12. Estimating the surface area of birds: using the homing pigeon (Columba livia) as a model. (United States)

    Perez, Cristina R; Moye, John K; Pritsos, Chris A


    Estimation of the surface area of the avian body is valuable for thermoregulation and metabolism studies as well as for assessing exposure to oil and other surface-active organic pollutants from a spill. The use of frozen carcasses for surface area estimations prevents the ability to modify the posture of the bird. The surface area of six live homing pigeons in the fully extended flight position was estimated using a noninvasive method. An equation was derived to estimate the total surface area of a pigeon based on its body weight. A pigeon's surface area in the fully extended flight position is approximately 4 times larger than the surface area of a pigeon in the perching position. The surface area of a bird is dependent on its physical position, and, therefore, the fully extended flight position exhibits the maximum area of a bird and should be considered the true surface area of a bird. © 2014. Published by The Company of Biologists Ltd | Biology Open.

  13. Comparison of diffusion charging and mobility-based methods for measurement of aerosol agglomerate surface area. (United States)

    Ku, Bon Ki; Kulkarni, Pramod


    We compare different approaches to measure surface area of aerosol agglomerates. The objective was to compare field methods, such as mobility and diffusion charging based approaches, with laboratory approach, such as Brunauer, Emmett, Teller (BET) method used for bulk powder samples. To allow intercomparison of various surface area measurements, we defined 'geometric surface area' of agglomerates (assuming agglomerates are made up of ideal spheres), and compared various surface area measurements to the geometric surface area. Four different approaches for measuring surface area of agglomerate particles in the size range of 60-350 nm were compared using (i) diffusion charging-based sensors from three different manufacturers, (ii) mobility diameter of an agglomerate, (iii) mobility diameter of an agglomerate assuming a linear chain morphology with uniform primary particle size, and (iv) surface area estimation based on tandem mobility-mass measurement and microscopy. Our results indicate that the tandem mobility-mass measurement, which can be applied directly to airborne particles unlike the BET method, agrees well with the BET method. It was also shown that the three diffusion charging-based surface area measurements of silver agglomerates were similar within a factor of 2 and were lower than those obtained from the tandem mobility-mass and microscopy method by a factor of 3-10 in the size range studied. Surface area estimated using the mobility diameter depended on the structure or morphology of the agglomerate with significant underestimation at high fractal dimensions approaching 3.

  14. A review of plutonium oxalate decomposition reactions and effects of decomposition temperature on the surface area of the plutonium dioxide product

    International Nuclear Information System (INIS)

    Orr, R.M.; Sims, H.E.; Taylor, R.J.


    Plutonium (IV) and (III) ions in nitric acid solution readily form insoluble precipitates with oxalic acid. The plutonium oxalates are then easily thermally decomposed to form plutonium dioxide powder. This simple process forms the basis of current industrial conversion or ‘finishing’ processes that are used in commercial scale reprocessing plants. It is also widely used in analytical or laboratory scale operations and for waste residues treatment. However, the mechanisms of the thermal decompositions in both air and inert atmospheres have been the subject of various studies over several decades. The nature of intermediate phases is of fundamental interest whilst understanding the evolution of gases at different temperatures is relevant to process control. The thermal decomposition is also used to control a number of powder properties of the PuO_2 product that are important to either long term storage or mixed oxide fuel manufacturing. These properties are the surface area, residual carbon impurities and adsorbed volatile species whereas the morphology and particle size distribution are functions of the precipitation process. Available data and experience regarding the thermal and radiation-induced decompositions of plutonium oxalate to oxide are reviewed. The mechanisms of the thermal decompositions are considered with a particular focus on the likely redox chemistry involved. Also, whilst it is well known that the surface area is dependent on calcination temperature, there is a wide variation in the published data and so new correlations have been derived. Better understanding of plutonium (III) and (IV) oxalate decompositions will assist the development of more proliferation resistant actinide co-conversion processes that are needed for advanced reprocessing in future closed nuclear fuel cycles. - Highlights: • Critical review of plutonium oxalate decomposition reactions. • New analysis of relationship between SSA and calcination temperature. • New SEM

  15. A review of plutonium oxalate decomposition reactions and effects of decomposition temperature on the surface area of the plutonium dioxide product

    Energy Technology Data Exchange (ETDEWEB)

    Orr, R.M.; Sims, H.E.; Taylor, R.J., E-mail:


    Plutonium (IV) and (III) ions in nitric acid solution readily form insoluble precipitates with oxalic acid. The plutonium oxalates are then easily thermally decomposed to form plutonium dioxide powder. This simple process forms the basis of current industrial conversion or ‘finishing’ processes that are used in commercial scale reprocessing plants. It is also widely used in analytical or laboratory scale operations and for waste residues treatment. However, the mechanisms of the thermal decompositions in both air and inert atmospheres have been the subject of various studies over several decades. The nature of intermediate phases is of fundamental interest whilst understanding the evolution of gases at different temperatures is relevant to process control. The thermal decomposition is also used to control a number of powder properties of the PuO{sub 2} product that are important to either long term storage or mixed oxide fuel manufacturing. These properties are the surface area, residual carbon impurities and adsorbed volatile species whereas the morphology and particle size distribution are functions of the precipitation process. Available data and experience regarding the thermal and radiation-induced decompositions of plutonium oxalate to oxide are reviewed. The mechanisms of the thermal decompositions are considered with a particular focus on the likely redox chemistry involved. Also, whilst it is well known that the surface area is dependent on calcination temperature, there is a wide variation in the published data and so new correlations have been derived. Better understanding of plutonium (III) and (IV) oxalate decompositions will assist the development of more proliferation resistant actinide co-conversion processes that are needed for advanced reprocessing in future closed nuclear fuel cycles. - Highlights: • Critical review of plutonium oxalate decomposition reactions. • New analysis of relationship between SSA and calcination temperature.

  16. Human Decision Processes: Implications for SSA Support Tools (United States)

    Picciano, P.


    Despite significant advances in computing power and artificial intelligence (AI), few critical decisions are made without a human decision maker in the loop. Space Situational Awareness (SSA) missions are both critical and complex, typically adhering to the human-in-the-loop (HITL) model. The collection of human operators injects a needed diversity of expert knowledge, experience, and authority required to successfully fulfill SSA tasking. A wealth of literature on human decision making exists citing myriad empirical studies and offering a varied set of prescriptive and descriptive models of judgment and decision making (Hastie & Dawes, 2001; Baron, 2000). Many findings have been proven sufficiently robust to allow information architects or system/interface designers to take action to improve decision processes. For the purpose of discussion, these concepts are bifurcated in two groups: 1) vulnerabilities to mitigate, and 2) capabilities to augment. These vulnerabilities and capabilities refer specifically to the decision process and should not be confused with a shortcoming or skill of a specific human operator. Thus the framing of questions and orders, the automated tools with which to collaborate, priming and contextual data, and the delivery of information all play a critical role in human judgment and choice. Evaluating the merits of any decision can be elusive; in order to constrain this discussion, ‘rational choice' will tend toward the economic model characteristics such as maximizing utility and selection consistency (e.g., if A preferred to B, and B preferred to C, than A should be preferred to C). Simple decision models often encourage one to list the pros and cons of a decision, perhaps use a weighting schema, but one way or another weigh the future benefit (or harm) of making a selection. The result (sought by the rationalist models) should drive toward higher utility. Despite notable differences in researchers' theses (to be discussed in the full

  17. MELiSSA Food Characterization general approach and current status (United States)

    Weihreter, Martin; Chaerle, Laury; Secco, Benjamin; Molders, Katrien; van der Straeten, Dominique; Duliere, Eric; Pieters, Serge; Maclean, Heather; Dochain, Denis; Quinet, Muriel; Lutts, Stanley; Graham, Thomas; Stasiak, Michael; Rondeau Vuk, Theresa; Zheng, Youbin; Dixon, Mike; Laniau, Martine; Larreture, Alain; Timsit, Michel; Aronne, Giovanna; Barbieri, Giancarlo; Buonomo, Roberta; Veronica; Paradiso, Roberta; de Pascale, Stafania; Galbiati, Massimo; Troia, A. R.; Nobili, Matteo; Bucchieri, Lorenzo; Page, Valérie; Feller, Urs; Lasseur, Christophe

    Higher plants play an important role in closed ecological life support systems as oxygen pro-ducers, carbon dioxide and water recyclers, and as a food source. For an integration of higher plant chambers into the MELiSSA (Micro Ecological Life Support System Alternative) loop, a detailed characterization and optimization of the full food production and preparation chain is needed. This implies the prediction and control of the nutritional quality of the final products consumed by the crew, the prediction of the wastes quality and quantity produced along the chain for further waste treatment (MELiSSA waste treatment) and the optimization of overall efficiencies. To reach this goal several issues have to be studied in an integrated manner: the physiological responses of crops to a range of environmental parameters, crop yield efficiencies and respective ratio and composition of edible and inedible biomass, the processability and storability of the produced food and last but not least composition of wastes in view of further degradation (fiber content). Within the Food Characterization (FC) project several compar-ative plant growth bench tests were carried out to obtain preliminary data regarding these aspects. Four pre-selected cultivars of each of the four energy-rich crops with worldwide usage -wheat, durum wheat, potato and soybean -were grown under well-characterized environmental conditions. The different cultivars of each species are screened for their performance in view of a closed loop application by parameter ranking. This comprises the characterization of edi-ble/inedible biomass ratio, nutritional quality, processability and overall performance under the specific conditions of hydroponic cultivation and artificial illumination. A second closely linked goal of the FC project is to develop a mechanistic physiological plant model, which will ease the integration of higher plants compartments in the MELiSSA concept by virtue of its predictive abilities

  18. Tritium in Precipitation, Surface and Groundwaters in the Zagreb Area

    International Nuclear Information System (INIS)

    Horvatincic, N.; Baresic, J.; Sironic, A.; Krajcar Bronic, I.; Obelic, B.


    Radioactive isotope tritium (3H) and stable isotopes of hydrogen (2H/1H) and oxygen (18O/16O) were measured in Sava River, precipitation and groundwater at 3 monitoring wells (piezometers) and 1 production well of the Petrusevec aquifer, close to the Sava River. Samples were collected monthly during 2010. The investigation is included in the Regional IAEA Project RER/8/016 Using Environmental Isotopes for Evaluation of Streamwater/Groundwater Interactions in Selected Aquifers in the Danube Basin. Sava River is a tributary of Danube River and the aim of the investigation is to determine the influence of surface stream of Sava River to the groundwater of aquifer used for water exploitation. In this work only 3H results were presented. 3H was measured by liquid scintillation counter Quantulus 1220, using electrolytic enrichment for all samples. 3H activity in precipitation showed slight seasonal fluctuation between 4 TU and 14 TU, with higher values in summer. 3H activity of Sava River and groundwater of the Petrusevec aquifer followed 3H of precipitation till May 2010. Significant increase of 3H in Sava River was observed in June, (199 @ 20) TU, and in the next month it fell down at 6 TU. Increase of 3H was also observed in groundwater but with damped response (maximum 60 TU) and with delay of 2 - 3 months related to Sava River. Different response of different piezometers and the well indicated the different infiltration times of surface water of Sava River to groundwater of the Petrusevec aquifer. The increased 3H activity in surface and groundwaters was caused by release of tritiated water from the Krsko Nuclear Power Plant, 30 km upstream from Zagreb. The results of 3H, 2H/1H and 18O/16O measurements will be used to determine the infiltration time of groundwater of the Petrusevec aquifer using conceptual and mathematical models. (author)

  19. Possibilities of surface waters monitoring at mining areas using UAV

    Directory of Open Access Journals (Sweden)

    Lisiecka Ewa


    Full Text Available The selected, remote measurement methods are discussed, useful for determining surface water properties using mobile unmanned aerial platforms (UAV. The possibilities of using this type of solutions in the scope of measuring spatial, physicochemical and biological parameters of both natural and anthropogenic water reservoirs, including flood polders, water-filled pits, settling tanks and mining sinks were analyzed. Methods of remote identification of the process of overgrowing this type of ecosystems with water and coastal plant formations have also been proposed.

  20. Effect of solution and leaf surface polarity on droplet spread area and contact angle. (United States)

    Nairn, Justin J; Forster, W Alison; van Leeuwen, Rebecca M


    How much an agrochemical spray droplet spreads on a leaf surface can significantly influence efficacy. This study investigates the effect solution polarity has on droplet spreading on leaf surfaces and whether the relative leaf surface polarity, as quantified using the wetting tension dielectric (WTD) technique, influences the final spread area. Contact angles and spread areas were measured using four probe solutions on 17 species. Probe solution polarity was found to affect the measured spread area and the contact angle of the droplets on non-hairy leaves. Leaf hairs skewed the spread area measurement, preventing investigation of the influence of surface polarity on hairy leaves. WTD-measured leaf surface polarity of non-hairy leaves was found to correlate strongly with the effect of solution polarity on spread area. For non-polar leaf surfaces the spread area decreases with increasing solution polarity, for neutral surfaces polarity has no effect on spread area and for polar leaf surfaces the spread area increases with increasing solution polarity. These results attest to the use of the WTD technique as a means to quantify leaf surface polarity. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.

  1. 77 FR 43639 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA... (United States)


    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0090] Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA)/Department of Veterans Affairs (VA.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503...

  2. 77 FR 54943 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA... (United States)


    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0016] Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA)/Department of Veterans Affairs (VA.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503...

  3. A method of analyzing rectal surface area irradiated and rectal complications in prostate conformal radiotherapy

    International Nuclear Information System (INIS)

    Lu Yong; Song, Paul Y.; Li Shidong; Spelbring, Danny R.; Vijayakumar, Srinivasan; Haraf, Daniel J.; Chen, George T.Y.


    Purpose: To develop a method of analyzing rectal surface area irradiated and rectal complications in prostate conformal radiotherapy. Methods and Materials: Dose-surface histograms of the rectum, which state the rectal surface area irradiated to any given dose, were calculated for a group of 27 patients treated with a four-field box technique to a total (tumor minimum) dose ranging from 68 to 70 Gy. Occurrences of rectal toxicities as defined by the Radiation Therapy Oncology Group (RTOG) were recorded and examined in terms of dose and rectal surface area irradiated. For a specified end point of rectal complication, the complication probability was analyzed as a function of dose irradiated to a fixed rectal area, and as a function of area receiving a fixed dose. Lyman's model of normal tissue complication probability (NTCP) was used to fit the data. Results: The observed occurrences of rectal complications appear to depend on the rectal surface area irradiated to a given dose level. The patient distribution of each toxicity grade exhibits a maximum as a function of percentage surface area irradiated, and the maximum moves to higher values of percentage surface area as the toxicity grade increases. The dependence of the NTCP for the specified end point on dose and percentage surface area irradiated was fitted to Lyman's NTCP model with a set of parameters. The curvature of the NTCP as a function of the surface area suggests that the rectum is a parallel structured organ. Conclusions: The described method of analyzing rectal surface area irradiated yields interesting insight into understanding rectal complications in prostate conformal radiotherapy. Application of the method to a larger patient data set has the potential to facilitate the construction of a full dose-surface-complication relationship, which would be most useful in guiding clinical practice

  4. The organic fraction of bubble-generated, accumulation mode Sea Spray Aerosol (SSA

    Directory of Open Access Journals (Sweden)

    R. L. Modini


    Full Text Available Recent studies have detected a dominant accumulation mode (~100 nm in the Sea Spray Aerosol (SSA number distribution. There is evidence to suggest that particles in this mode are composed primarily of organics. To investigate this hypothesis we conducted experiments on NaCl, artificial SSA and natural SSA particles with a Volatility-Hygroscopicity-Tandem-Differential-Mobility-Analyser (VH-TDMA. NaCl particles were atomiser generated and a bubble generator was constructed to produce artificial and natural SSA particles. Natural seawater samples for use in the bubble generator were collected from biologically active, terrestrially-affected coastal water in Moreton Bay, Australia. Differences in the VH-TDMA-measured volatility curves of artificial and natural SSA particles were used to investigate and quantify the organic fraction of natural SSA particles. Hygroscopic Growth Factor (HGF data, also obtained by the VH-TDMA, were used to confirm the conclusions drawn from the volatility data. Both datasets indicated that the organic fraction of our natural SSA particles evaporated in the VH-TDMA over the temperature range 170–200 °C. The organic volume fraction for 71–77 nm natural SSA particles was 8±6%. Organic volume fraction did not vary significantly with varying water residence time (40 s to 24 h in the bubble generator or SSA particle diameter in the range 38–173 nm. At room temperature we measured shape- and Kelvin-corrected HGF at 90% RH of 2.46±0.02 for NaCl, 2.35±0.02 for artifical SSA and 2.26±0.02 for natural SSA particles. Overall, these results suggest that the natural accumulation mode SSA particles produced in these experiments contained only a minor organic fraction, which had little effect on hygroscopic growth. Our measurement of 8±6% is an order of magnitude below two previous measurements of the organic fraction in SSA particles of comparable sizes. We stress that our results were obtained using coastal seawater and

  5. Large area optical mapping of surface contact angle. (United States)

    Dutra, Guilherme; Canning, John; Padden, Whayne; Martelli, Cicero; Dligatch, Svetlana


    Top-down contact angle measurements have been validated and confirmed to be as good if not more reliable than side-based measurements. A range of samples, including industrially relevant materials for roofing and printing, has been compared. Using the top-down approach, mapping in both 1-D and 2-D has been demonstrated. The method was applied to study the change in contact angle as a function of change in silver (Ag) nanoparticle size controlled by thermal evaporation. Large area mapping reveals good uniformity for commercial Aspen paper coated with black laser printer ink. A demonstration of the forensic and chemical analysis potential in 2-D is shown by uncovering the hidden CsF initials made with mineral oil on the coated Aspen paper. The method promises to revolutionize nanoscale characterization and industrial monitoring as well as chemical analyses by allowing rapid contact angle measurements over large areas or large numbers of samples in ways and times that have not been possible before.

  6. BLM National Surface Management Agency: Area Polygons, Withdrawal Area Polygons, and Special Public Purpose Withdrawal Area Polygons (United States)

    Federal Geographic Data Committee — The SMA implementation is comprised of one feature dataset, with several polygon feature classes, rather than a single feature class. SurfaceManagementAgency: The...

  7. Surface and subsurface conditions in permafrost areas - a literature review

    International Nuclear Information System (INIS)

    Vidstrand, Patrik


    This report contains a summary of some of the information within existing technical and scientific literature on permafrost. Permafrost is viewed as one of the future climate driven process domains that may exist in Scandinavia, and that may give rise to significantly different surface and subsurface conditions than the present. Except for changes in the biosphere, permafrost may impact hydraulic, mechanical, and chemical subsurface processes and conditions. Permafrost and its influences on the subsurface conditions are thus of interest for the performance and safety assessments of deep geological waste repositories. The definition of permafrost is 'ground that stays at or below 0 deg C for at least two consecutive years'. Permafrost will effect the geological subsurface to some depth. How deep the permafrost may grow is a function of the heat balance, thermal conditions at the surface and within the ground, and the geothermal heat flux from the Earth's inner parts. The main chapters of the report summaries the knowledge on permafrost evolution, occurrence and distribution, and extracts information concerning hydrology and mechanical and chemical impacts due to permafrost related conditions. The results of a literature review are always dependent on the available literature. Concerning permafrost there is some literature available from investigations in the field of long-term repositories and some from mining industries. However, reports of these investigations are few and the bulk of permafrost literature comes from the science departments concerned with surficial processes (e.g. geomorphology, hydrology, agriculture, etc) and from engineering concerns, such as foundation of constructions and pipeline design. This focus within the permafrost research inevitably yields a biased but also an abundant amount of information on localised surficial processes and a limited amount on regional and deep permafrost characteristics. Possible conclusions are that there is

  8. Surface and subsurface conditions in permafrost areas - a literature review

    Energy Technology Data Exchange (ETDEWEB)

    Vidstrand, Patrik [Bergab, Goeteborg (Sweden)


    This report contains a summary of some of the information within existing technical and scientific literature on permafrost. Permafrost is viewed as one of the future climate driven process domains that may exist in Scandinavia, and that may give rise to significantly different surface and subsurface conditions than the present. Except for changes in the biosphere, permafrost may impact hydraulic, mechanical, and chemical subsurface processes and conditions. Permafrost and its influences on the subsurface conditions are thus of interest for the performance and safety assessments of deep geological waste repositories. The definition of permafrost is 'ground that stays at or below 0 deg C for at least two consecutive years'. Permafrost will effect the geological subsurface to some depth. How deep the permafrost may grow is a function of the heat balance, thermal conditions at the surface and within the ground, and the geothermal heat flux from the Earth's inner parts. The main chapters of the report summaries the knowledge on permafrost evolution, occurrence and distribution, and extracts information concerning hydrology and mechanical and chemical impacts due to permafrost related conditions. The results of a literature review are always dependent on the available literature. Concerning permafrost there is some literature available from investigations in the field of long-term repositories and some from mining industries. However, reports of these investigations are few and the bulk of permafrost literature comes from the science departments concerned with surficial processes (e.g. geomorphology, hydrology, agriculture, etc) and from engineering concerns, such as foundation of constructions and pipeline design. This focus within the permafrost research inevitably yields a biased but also an abundant amount of information on localised surficial processes and a limited amount on regional and deep permafrost characteristics. Possible conclusions are that

  9. 30 CFR 933.761 - Areas designated unsuitable for surface coal mining by Act of Congress. (United States)


    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by Act of Congress. 933.761 Section 933.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated Unsuitable for Coal Mining by Act of Congress, with...

  10. Surface area of antimony oxide by isotope exchange and other methods

    Energy Technology Data Exchange (ETDEWEB)

    Rao, Y.K.; Acharya, B.V.; Rangamannar, B.


    Specific surface areas of antimony oxide samples, one commercial, the other prepared from antimony trichloride were measured by heterogeneous isotope exchange, gas adsorption, air permeability and microscopic methods. Specific surface areas obtained by these four methods for the two samples were compared and the observed differences are explained.

  11. Preliminary study of the space adaptation of the MELiSSA life support system (United States)

    Mas-Albaigès, Joan L.; Duatis, Jordi; Podhajsky, Sandra; Guirado, Víctor; Poughon, Laurent

    MELiSSA (Micro-Ecological Life Support System Alternative) is an European Space Agency (ESA) project focused on the development of a closed regenerative life support system to aid the development of technologies for future life support systems for long term manned planetary missions, e.g. a lunar base or missions to Mars. In order to understand the potential evolution of the MELiSSA concept towards its future use in the referred manned planetary mission context the MELiSSA Space Adaptation (MSA) activity has been undertaken. MSA's main objective is to model the different MELiSSA compartments using EcosimPro R , a specialized simulation tool for life support applications, in order to define a preliminary MELiSSA implementation for service in a man-tended lunar base scenario, with a four-member crew rotating in six-month increments, and performing the basic LSS functions of air revitalization, food production, and waste and water recycling. The MELiSSA EcosimPro R Model features a dedicated library for the different MELiSSA elements (bioreactors, greenhouse, crew, interconnecting elements, etc.). It is used to dimension the MELiSSA system in terms of major parameters like mass, volume and energy needs, evaluate the accuracy of the results and define the strategy for a progressive loop closure from the initial required performance (approx.100 The MELiSSA configuration(s) obtained through the EcosimPro R simulation are further analysed using the Advanced Life Support System Evaluation (ALISSE) metric, relying on mass, energy, efficiency, human risk, system reliability and crew time, for trade-off and optimization of results. The outcome of the MSA activity is, thus, a potential Life Support System architecture description, based on combined MELiSSA and other physico-chemical technologies, defining its expected performance, associated operational conditions and logistic needs.

  12. The protection of urban areas from surface wastewater pollutions

    Directory of Open Access Journals (Sweden)

    Vialkova Elena


    Full Text Available In this paper it considered the problem of collection, treatment and discharge into waters of rain and melted wastewater. To reduce the load on the combined sewer system, there are engineering solutions collect rain and melt water for use in the irrigation of lawns and green spaces. Research carried out at the department “Water supply and sanitation”, (Russia, confirm the high pollution concentrations of meltwater and rainfall in urban arias. Series of measurements of heavy metal in rainwater runoff carried out in Hungary demonstrates clearly the differences in concentrations in the function of distance from the edge of the road. Also differences are introduced between pollution concentrations in runoff water from within and outside urban traffic roads. The quality of snow cover, forming meltwater is observed to be changing in dependence on roadway location. Quality characteristics of surface runoff and its sediments can be effectively improved with super-high frequency radiation (SHF treatment which is presented in this paper.

  13. High surface area silicon materials: fundamentals and new technology. (United States)

    Buriak, Jillian M


    Crystalline silicon forms the basis of just about all computing technologies on the planet, in the form of microelectronics. An enormous amount of research infrastructure and knowledge has been developed over the past half-century to construct complex functional microelectronic structures in silicon. As a result, it is highly probable that silicon will remain central to computing and related technologies as a platform for integration of, for instance, molecular electronics, sensing elements and micro- and nanoelectromechanical systems. Porous nanocrystalline silicon is a fascinating variant of the same single crystal silicon wafers used to make computer chips. Its synthesis, a straightforward electrochemical, chemical or photochemical etch, is compatible with existing silicon-based fabrication techniques. Porous silicon literally adds an entirely new dimension to the realm of silicon-based technologies as it has a complex, three-dimensional architecture made up of silicon nanoparticles, nanowires, and channel structures. The intrinsic material is photoluminescent at room temperature in the visible region due to quantum confinement effects, and thus provides an optical element to electronic applications. Our group has been developing new organic surface reactions on porous and nanocrystalline silicon to tailor it for a myriad of applications, including molecular electronics and sensing. Integration of organic and biological molecules with porous silicon is critical to harness the properties of this material. The construction and use of complex, hierarchical molecular synthetic strategies on porous silicon will be described.

  14. Measurement of the specific surface area of loose copper deposit by electrochemical methods

    Directory of Open Access Journals (Sweden)

    E. A. Dolmatova


    Full Text Available In the work the surface area of the electrode with dispersed copper deposit obtained within 30 seconds was evaluated by techniques of chronopotentiometry (CPM and impedance spectroscopy. In method CPM the electrode surface available for measurement depends on the value of the polarizing current. At high currents during the transition time there is a change of surface relief that can not determine the full surface of loose deposit. The electrochemical impedance method is devoid of this shortcoming since the measurements are carried out in indifferent electrolyte in the absence of current. The area measured by the impedance is tens of times higher than the value obtained by chronopotentiometry. It is found that from a solution containing sulfuric acid the deposits form with a high specific surface area. Based on these data it was concluded that the method of impedance spectroscopy can be used to measure in situ the surface area of the dispersed copper deposits.

  15. Size and surface AREA analysis of some metallic and intermetallic powders

    International Nuclear Information System (INIS)

    Elmasry, M.A.A.; Elsayed, A.A.; Abadir, M.F.


    The powder characterization of three intermetallic compounds ( Cr B, B 4 c and S ib 4 ) and three metallic powders (Fe, Co, and Ni) has been performed. This included the determination of powder density, chemical analysis, impurity analysis, shape factor, particle size analysis and specific surface area. The particle size analysis for the six powders was carried out using three techniques, namely; the 0-23, the microtrac and the fisher sub sieve and size. It was found that the analysis of the two powders and deviates from the log-normal probability distribution and the deviation was corrected. The specific surface area of the powders was measured using the high speed surface area analysis (BET method), and it was also calculated from surface area analysis findings, the BET technique was found to give the highest specific surface area values, and was attributed to the inclusion of internal porosity in the measurement. 8 fig., 10 tab

  16. Surface and groundwater Nitrate distribution in the area of Vicenza

    International Nuclear Information System (INIS)

    Altissimo, L.; Dal Pra, A.


    Public aqueducts in the Province of Vicenza (Italy) are supplied entirely by various kinds of water sources: the sub river bed strata of the mountain valleys, water-bearing aquifers of the high plan, pressurized water-bearing aquifers of the middle plain, karstic reservoirs of the mountain massifs and local springs. Progressive increase in nitrate concentration has long been detected in the underground water of many parts of the Vicenza region. The nitrates originate from various sources: human waste, industrial dumping (e.g. the tanning industry) and the use of animal and chemical fertilizers. Nitrate distribution was studied in all wells used for extracting underground water including source waters which replenishing underground aquifers. During the study period ('91-'95), water courses in the recharge areas were found to have nitrate concentrations ranging between 2.0 and 42.0 mg/l. These values remained substantially stable in time. Underground aquifers showed stable nitrate concentration between 5.0 mg/l (mountain karstic aquifers; sub-river bed strata of valley bottom) and 44.0 mg/l (water bearing strata of the high plain of Astico and Brenta rivers). The pressurized flooding aquifers of the middle plain have lower concentrations (6.0-21.0 mg/l) but tend to increase by about 0.5 mg/l per year [it

  17. Long-term studies on the effects of nonvolatile organic compounds on porous media surface areas. (United States)

    Khachikian, Crist S; Harmon, Thomas C


    This paper investigates the long-term behavior of porous media contaminated by nonvolatile organic compounds (NVOC) in terms of specific interfacial surface area. Specifically, a natural sand, Moffett sand (MS), was contaminated with naphthalene and the surface area was measured repeatedly over time using nitrogen adsorption-desorption techniques. A field-contaminated sand affected by lamp-black material (LB) from former manufactured gas plant operations was also studied. Lampblack is a carbonaceous skeleton containing polycyclic aromatic hydrocarbons (PAHs) and other hydrocarbons. It is hypothesized that soils contaminated by these types of chemicals will exhibit significantly less surface area than their clean counterparts. The surface areas for the contaminated MS samples increased toward their clean-MS values during the 700-h aging period, but achieved the clean values only after pentane extraction or heating at 60 degrees C. Heating at 50 degrees C failed to achieve a similar recovery of the clean-MS surface area value. Nonspecific mass loss tracked the increase in surface area as indirect evidence that naphthalene loss was the cause of the surface area increase. For the LB samples, aging at 100 degrees C produced a slight decrease in surface area and mass while aging at 250 degrees C caused the surface area to increase roughly threefold while the mass decreased by approximately 1%. These results suggest that, under moderate heating and over the time scale of this investigation, there is a redistribution of the complex contaminant mixture on the solid matrix. Greater temperatures remove mass more efficiently and therefore exhibited the surface area increase expected in this experiment.

  18. Surface Area, and Oxidation Effects on Nitridation Kinetics of Silicon Powder Compacts (United States)

    Bhatt, R. T.; Palczer, A. R.


    Commercially available silicon powders were wet-attrition-milled from 2 to 48 hr to achieve surface areas (SA's) ranging from 1.3 to 70 sq m/g. The surface area effects on the nitridation kinetics of silicon powder compacts were determined at 1250 or 1350 C for 4 hr. In addition, the influence of nitridation environment, and preoxidation on nitridation kinetics of a silicon powder of high surface area (approximately equals 63 sq m/g) was investigated. As the surface area increased, so did the percentage nitridation after 4 hr in N2 at 1250 or 1350 C. Silicon powders of high surface area (greater than 40 sq m/g) can be nitrided to greater than 70% at 1250 C in 4 hr. The nitridation kinetics of the high-surface-area powder compacts were significantly delayed by preoxidation treatment. Conversely, the nitridation environment had no significant influence on the nitridation kinetics of the same powder. Impurities present in the starting powder, and those accumulated during attrition milling, appeared to react with the silica layer on the surface of silicon particles to form a molten silicate layer, which provided a path for rapid diffusion of nitrogen and enhanced the nitridation kinetics of high surface area silicon powder.

  19. Environmental and geochemical assessment of surface sediments on irshansk ilmenite deposit area

    Directory of Open Access Journals (Sweden)

    Наталия Олеговна Крюченко


    Full Text Available It is revealed the problem of pollution of surface sediments of Irshansk ilmenite deposit area of various chemical elements hazard class (Mn, V, Ba, Ni, Co, Cr, Mo, Cu, Pb, Zn. It is determined its average content in surface sediments of various functional areas (forest and agricultural land, flood deposits, reclaimed land, calculated geochemical criteria, so given ecological and geochemical assessment of area

  20. Outlining precision boundaries among areas with different variability standards using magnetic susceptibility and geomorphic surfaces


    Matias,Sammy S. R.; Marques Júnior,José; Siqueira,Diego S.; Pereira,Gener T.


    There is an increasing demand for detailed maps that represent in a simplified way the knowledge of the variability of a particular area or region maps. The objective was to outline precision boundaries among areas with different accuracy variability standards using magnetic susceptibility and geomorphic surfaces. The study was conducted in an area of 110 ha, which identified three compartment landscapes based on the geomorphic surfaces model. To determinate pH, organic matter, phosphorus, po...

  1. Changes in the Surface Area of Glaciers in Northern Eurasia (United States)

    Khromova, T.; Nosenko, G.


    Glaciers are widely recognized as key indicators of climate change. Recent evidence suggests an acceleration of glacier mass loss in several key mountain regions. Glacier recession implies the landscape changes in the glacial zone, origin of new lakes and activation of natural disaster processes, catastrophic mudflows, ice avalanches, outburst floods, and etc. The presence of glaciers in itself threats to human life, economic activity and growing infrastructure. Economical and recreational human activity in mountain regions requires relevant information on snow and ice objects. Absence or inadequacy of such information results in financial and human losses. A more comprehensive evaluation of glacier changes is imperative to assess ice contributions to global sea level rise and the future of water resources from glacial basins. One of the urgent steps is a full inventory of all ice bodies, their volume and changes The first estimation of glaciers state and glaciers distribution in the big part of Northern Eurasia has been done in the USSR Glacier Inventory published in 1966 -1980 as a part of IHD activity. The Inventory is based on topographic maps and air photos and reflects the status of the glaciers in 1957-1970y. There is information about 23796 glaciers with area of 78222.3 km2 in the Inventory. It covers 23 glacier systems on Northern Eurasia. In the 80th the USSR Glacier Inventory has been transformed in the digital form as a part of the World Glacier Inventory. Recent satellite data provide a unique opportunity to look again at these glaciers and to evaluate changes in glacier extent for the second part of XX century. In the paper we report about 15 000 glaciers outlines for Caucasus, Pamir, Tien-Shan, Altai, Syntar-Khayata, Cherskogo Range, Kamchatka and Russian Arctic which have been derived from ASTER and Landsat imagery and could be used for glacier changes evaluation. The results show that glaciers are retreating in all these regions. There is, however

  2. BOREAS HYP-8 DEM Data Over The NSA-MSA and SSA-MSA in The AEAC Projection (United States)

    Knapp, David E.; Hall, Forrest G. (Editor); Wang, Xue-Wen; Band, L. E.; Smith, David E. (Technical Monitor)


    These data were derived from the original Digital Elevation Models (DEMs) produced by the Boreal Ecosystem-Atmosphere Study (BOREAS) Hydrology (HYD)-8 team. The original DEMs were in the Universal Transverse Mercator (UTM) projection, while this product is projected in the Albers Equal-Area Conic (AEAC) projection. The pixel size of the data is 100 meters, which is appropriate for the 1:50,000-scale contours from which the DEMs were made. The original data were compiled from information available in the 1970s and 1980s. This data set covers the two Modeling Sub-Areas (MSAs) that are contained within the Southern Study Area (SSA) and the Northern Study Area (NSA). The data are stored in binary, image format files. The DEM data over the NSA-MSA and SSA-MSA in the AEAC projection are available from the Earth Observing System Data and Information System (EOSDIS) Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC). The data files are available on a CD-ROM (see document number 20010000884).

  3. Development of cortical thickness and surface area in autism spectrum disorder

    Directory of Open Access Journals (Sweden)

    Vincent T. Mensen


    Full Text Available Autism spectrum disorder (ASD is a neurodevelopmental disorder often associated with changes in cortical volume. The constituents of cortical volume – cortical thickness and surface area – have separable developmental trajectories and are related to different neurobiological processes. However, little is known about the developmental trajectories of cortical thickness and surface area in ASD. In this magnetic resonance imaging (MRI study, we used an accelerated longitudinal design to investigate the cortical development in 90 individuals with ASD and 90 typically developing controls, aged 9 to 20 years. We quantified cortical measures using the FreeSurfer software package, and then used linear mixed model analyses to estimate the developmental trajectories for each cortical measure. Our primary finding was that the development of surface area follows a linear trajectory in ASD that differs from typically developing controls. In typical development, we found a decline in cortical surface area between the ages of 9 and 20 that was absent in ASD. We found this pattern in all regions where developmental trajectories for surface area differed between groups. When we applied a more stringent correction that takes the interdependency of measures into account, this effect on cortical surface area retained significance for left banks of superior temporal sulcus, postcentral area, and right supramarginal area. These areas have previously been implicated in ASD and are involved in the interpretation and processing of audiovisual social stimuli and distinction between self and others. Although some differences in cortical volume and thickness were found, none survived the more stringent correction for multiple testing. This study underscores the importance of distinguishing between cortical surface area and thickness in investigating cortical development, and suggests the development of cortical surface area is of importance to ASD.

  4. Root surface area measurement of permanent dentition in Indian population – CBCT analysis

    Directory of Open Access Journals (Sweden)

    Kanika Lakhani


    Full Text Available The area of the root surface of human teeth has been investigated extensively in the dental literature. All previous attempts mainly rely on the use of physical methods to calculate surface area on extracted teeth or use virtual 3D Models for the same. The aim is to develop an algorithm using MATLAB software that estimates the dimensions of 3-D image produced with the help of CBCT so that the same can be utilized to calculate the root surface area of teeth among Indian population. Present research utilizes CBCT images of samples of extracted teeth mounted on a customized jpg. A descriptive chart for statistical analysis has been prepared to obtain average root surface area of each tooth type. The currently developed algorithm has been successfully applied to the CBCT images of complete sample of teeth to obtain their root surface area. The algorithm developed to calculate root surface area of the teeth holds wide spread application in the field of dentistry pursuing its high expediency in even various specializations of dentistry including orthodontics, prosthodontics, periodontology and implantalogy. It is concluded that it has now become a reality to accurately determine the surface area of the root of human teeth without extracting them using the CBCT radiographs of the patients.

  5. Rapid fabrication of large-area, corrosion-resistant superhydrophobic Mg alloy surfaces. (United States)

    Xu, Wenji; Song, Jinlong; Sun, Jing; Lu, Yao; Yu, Ziyuan


    A superhydrophobic magnesium (Mg) alloy surface was successfully fabricated via a facile electrochemical machining process, and subsequently covered with a fluoroalkylsilane (FAS) film. The surface morphologies and chemical compositions were investigated using a scanning electron microscope (SEM) equipped with an energy-dispersive spectroscopy (EDS) and a Fourier-transform infrared spectrophotometer (FTIR). The results show hierarchal rough structures and an FAS film with a low surface energy on the Mg alloy surfaces, which confers good superhydrophobicity with a water contact angle of 165.2° and a water tilting angle of approximately 2°. The processing conditions, such as the processing time and removal rate per unit area at a constant removal mass per unit area, were investigated to determine their effects on the superhydrophobicity. Interestingly, when the removal mass per unit area is constant at approximately 11.10 mg/cm(2), the superhydrophobicity does not change with the removal rate per unit area. Therefore, a superhydrophobic Mg alloy surface can be rapidly fabricated based on this property. A large-area superhydrophobic Mg alloy surface was also fabricated for the first time using a small-area moving cathode. The corrosion resistance and durability of the superhydrophobic surfaces were also examined.

  6. Water redistribution at the soil surface : ponding and surface runoff in flat areas

    NARCIS (Netherlands)

    Appels, W.M.


    In The Netherlands, one of the most important targets for the improvement of surface water quality as aimed for in the European Water Framework Directive, is the reduction of nutrient concentrations (both nitrogen and phosphorus). To identify the most suitable and effective measures for reducing the

  7. Influence of Ecological Factors on Estimation of Impervious Surface Area Using Landsat 8 Imagery

    Directory of Open Access Journals (Sweden)

    Yuqiu Jia


    Full Text Available Estimation of impervious surface area is important to the study of urban environments and social development, but surface characteristics, as well as the temporal, spectral, and spatial resolutions of remote sensing images, influence the estimation accuracy. To investigate the effects of regional environmental characteristics on the estimation of impervious surface area, we divided China into seven sub-regions based on climate, soil type, feature complexity, and vegetation phenology: arid and semi-arid areas, Huang-Huai-Hai winter wheat production areas, typical temperate regions, the Pearl River Delta, the middle and lower reaches of the Yangtze River, typical tropical and subtropical regions, and the Qinghai Tibet Plateau. Impervious surface area was estimated from Landsat 8 images of five typical cities, including Yinchuan, Shijiazhuang, Shenyang, Ningbo, and Kunming. Using the linear spectral unmixing method, impervious and permeable surface areas were determined at the pixel-scale based on end-member proportions. We calculated the producer’s accuracy, user’s accuracy, and overall accuracy to assess the estimation accuracy, and compared the accuracies among images acquired from different seasons and locations. In tropical and subtropical regions, vegetation canopies can confound the identification of impervious surfaces and, thus, images acquired in winter, early spring, and autumn are most suitable; estimations in the Pearl River Delta, the middle and lower reaches of the Yangtze River are influenced by soil, vegetation phenology, vegetation canopy, and water, and images acquired in spring, summer, and autumn provide the best results; in typical temperate areas, images acquired from spring to autumn are most effective for estimations; in winter wheat-growing areas, images acquired throughout the year are suitable; and in arid and semi-arid areas, summer and early autumn, during which vegetation is abundant, are the optimal seasons for

  8. Porous silicon structures with high surface area/specific pore size (United States)

    Northrup, M.A.; Yu, C.M.; Raley, N.F.


    Fabrication and use of porous silicon structures to increase surface area of heated reaction chambers, electrophoresis devices, and thermopneumatic sensor-actuators, chemical preconcentrates, and filtering or control flow devices. In particular, such high surface area or specific pore size porous silicon structures will be useful in significantly augmenting the adsorption, vaporization, desorption, condensation and flow of liquids and gases in applications that use such processes on a miniature scale. Examples that will benefit from a high surface area, porous silicon structure include sample preconcentrators that are designed to adsorb and subsequently desorb specific chemical species from a sample background; chemical reaction chambers with enhanced surface reaction rates; and sensor-actuator chamber devices with increased pressure for thermopneumatic actuation of integrated membranes. Examples that benefit from specific pore sized porous silicon are chemical/biological filters and thermally-activated flow devices with active or adjacent surfaces such as electrodes or heaters. 9 figs.

  9. Structural dynamics of fore-crisis area on a heat emission surface of a fuel element's

    International Nuclear Information System (INIS)

    Sharaevskij, I.G.; Fialko, N.M.; Sharaevskaya, E.I.


    The known theoretical and experimental data regarding the nature of dry spots evolution are reviewed and the idea regarding the mechanism of heat emission from the heated surface in fore-crisis area are defined more precisely.

  10. Lp-dual affine surface area forms of Busemann–Petty type problems

    Indian Academy of Sciences (India)

    Associated with the notion of Lp-intersection body which was defined ... Lp-dual affine surface area; Lp-intersection body; Busemann–Petty ..... [11] Schneider R, Convex Bodies: The Brunn–Minkowski Theory (1993) (Cambridge: Cam-.

  11. Estimation of surface area concentration of workplace incidental nanoparticles based on number and mass concentrations (United States)

    Park, J. Y.; Ramachandran, G.; Raynor, P. C.; Kim, S. W.


    Surface area was estimated by three different methods using number and/or mass concentrations obtained from either two or three instruments that are commonly used in the field. The estimated surface area concentrations were compared with reference surface area concentrations (SAREF) calculated from the particle size distributions obtained from a scanning mobility particle sizer and an optical particle counter (OPC). The first estimation method (SAPSD) used particle size distribution measured by a condensation particle counter (CPC) and an OPC. The second method (SAINV1) used an inversion routine based on PM1.0, PM2.5, and number concentrations to reconstruct assumed lognormal size distributions by minimizing the difference between measurements and calculated values. The third method (SAINV2) utilized a simpler inversion method that used PM1.0 and number concentrations to construct a lognormal size distribution with an assumed value of geometric standard deviation. All estimated surface area concentrations were calculated from the reconstructed size distributions. These methods were evaluated using particle measurements obtained in a restaurant, an aluminum die-casting factory, and a diesel engine laboratory. SAPSD was 0.7-1.8 times higher and SAINV1 and SAINV2 were 2.2-8 times higher than SAREF in the restaurant and diesel engine laboratory. In the die casting facility, all estimated surface area concentrations were lower than SAREF. However, the estimated surface area concentration using all three methods had qualitatively similar exposure trends and rankings to those using SAREF within a workplace. This study suggests that surface area concentration estimation based on particle size distribution (SAPSD) is a more accurate and convenient method to estimate surface area concentrations than estimation methods using inversion routines and may be feasible to use for classifying exposure groups and identifying exposure trends.

  12. Estimation of surface area concentration of workplace incidental nanoparticles based on number and mass concentrations

    International Nuclear Information System (INIS)

    Park, J. Y.; Ramachandran, G.; Raynor, P. C.; Kim, S. W.


    Surface area was estimated by three different methods using number and/or mass concentrations obtained from either two or three instruments that are commonly used in the field. The estimated surface area concentrations were compared with reference surface area concentrations (SA REF ) calculated from the particle size distributions obtained from a scanning mobility particle sizer and an optical particle counter (OPC). The first estimation method (SA PSD ) used particle size distribution measured by a condensation particle counter (CPC) and an OPC. The second method (SA INV1 ) used an inversion routine based on PM1.0, PM2.5, and number concentrations to reconstruct assumed lognormal size distributions by minimizing the difference between measurements and calculated values. The third method (SA INV2 ) utilized a simpler inversion method that used PM1.0 and number concentrations to construct a lognormal size distribution with an assumed value of geometric standard deviation. All estimated surface area concentrations were calculated from the reconstructed size distributions. These methods were evaluated using particle measurements obtained in a restaurant, an aluminum die-casting factory, and a diesel engine laboratory. SA PSD was 0.7–1.8 times higher and SA INV1 and SA INV2 were 2.2–8 times higher than SA REF in the restaurant and diesel engine laboratory. In the die casting facility, all estimated surface area concentrations were lower than SA REF . However, the estimated surface area concentration using all three methods had qualitatively similar exposure trends and rankings to those using SA REF within a workplace. This study suggests that surface area concentration estimation based on particle size distribution (SA PSD ) is a more accurate and convenient method to estimate surface area concentrations than estimation methods using inversion routines and may be feasible to use for classifying exposure groups and identifying exposure trends.

  13. Interdependence between body surface area and ultraviolet B dose in vitamin D production

    DEFF Research Database (Denmark)

    Bogh, M K B; Schmedes, Anne; Philipsen, P A


    Ultraviolet (UV) B radiation increases serum vitamin D level expressed as 25-hydroxyvitamin-D(3) [25(OH)D], but the relationship to body surface area and UVB dose needs investigation.......Ultraviolet (UV) B radiation increases serum vitamin D level expressed as 25-hydroxyvitamin-D(3) [25(OH)D], but the relationship to body surface area and UVB dose needs investigation....

  14. Lake Chad Total Surface Water Area as Derived from Land Surface Temperature and Radar Remote Sensing Data

    Directory of Open Access Journals (Sweden)

    Frederick Policelli


    Full Text Available Lake Chad, located in the middle of the African Sahel belt, underwent dramatic decreases in the 1970s and 1980s leaving less than ten percent of its 1960s surface water extent as open water. In this paper, we present an extended record (dry seasons 1988–2016 of the total surface water area of the lake (including both open water and flooded vegetation derived using Land Surface Temperature (LST data (dry seasons 2000–2016 from the NASA Terra MODIS sensor and EUMETSAT Meteosat-based LST measurements (dry seasons 1988–2001 from an earlier study. We also examine the total surface water area for Lake Chad using radar data (dry seasons 2015–2016 from the ESA Sentinel-1a mission. For the limited number of radar data sets available to us (18 data sets, we find on average a close match between the estimates from these data and the corresponding estimates from LST, though we find spatial differences in the estimates using the two types of data. We use these spatial differences to adjust the record (dry seasons 2000–2016 from MODIS LST. Then we use the adjusted record to remove the bias of the existing LST record (dry seasons 1988–2001 derived from Meteosat measurements and combine the two records. From this composite, extended record, we plot the total surface water area of the lake for the dry seasons of 1988–1989 through 2016–2017. We find for the dry seasons of 1988–1989 to 2016–2017 that the maximum total surface water area of the lake was approximately 16,800 sq. km (February and May, 2000, the minimum total surface water area of the lake was approximately 6400 sq. km (November, 1990, and the average was approximately 12,700 sq. km. Further, we find the total surface water area of the lake to be highly variable during this period, with an average rate of increase of approximately 143 km2 per year.

  15. Assessment of nanoparticle surface area by measuring unattached fraction of radon progeny

    Energy Technology Data Exchange (ETDEWEB)

    Ruzer, Lev S. [Ernest Orlando Lawrence Berkeley National Laboratory, Indoor Environment Department (United States)], E-mail:


    A number of studies on the exposure of nanometer aerosols have indicated that health effects associated with low-solubility inhaled particles in the range of 1-100 nm may be more appropriately associated with particulate surface area than mass concentration. Such data on correlation between number, surface area and mass concentration are needed for exposure investigations, but the means for measuring aerosol surface area are not readily available. In this paper we propose a method for particle surface area assessment based on a new approach, deposition of the 'unattached fraction of radon progeny' onto nanometer aerosols.The proposed approach represents a synthesis of:(1) Derived direct analytical correlation between the 'unattached fraction' of radon progeny and surface area particle concentration in the range of 1-100 nm particle diameter;(2) Experimental data on correlation between the unattached fraction of radon progeny and particle surface area for particles with diameter in the range of 44 nm-2.1 {mu}m.

  16. Adsorption of water vapour and the specific surface area of arctic zone soils (Spitsbergen) (United States)

    Cieśla, Jolanta; Sokołowska, Zofia; Witkowska-Walczak, Barbara; Skic, Kamil


    Water vapour/nitrogen adsorption were investigated and calculated the specific surface areas of arctic-zone soil samples (Turbic Cryosols) originating from different micro-relief forms (mud boils, cell forms and sorted circles) and from different depths. For the characterisation of the isotherms obtained for arctic soils, the Brunauer-Emmet-Teller model was then compared with the two other models (Aranovich-Donohue and Guggenheim-Anderson-de Boer) which were developed from Brunauer-Emmet-Teller. Specific surface area was calculated using the Brunauer-Emmet-Teller model at p p0-1 range of 0.05-0.35 for the water vapour desorption and nitrogen adsorption isotherms. The values of total specific surface area were the highest in Cryosols on mud boils, lower on cell forms, and the lowest on sorted circles. Such tendency was observed for the results obtained by both the water vapour and nitrogen adsorption. The differences in the values of specific surface area at two investigated layers were small. High determination coefficients were obtained for relationships between the specific surface areas and contents of clay and silt fraction in Cryosols. No statistically significant correlation between the total carbon amount and the values of specific surface area in Cryosols has been found.

  17. Greenland surface mass-balance observations from the ice-sheet ablation area and local glaciers

    DEFF Research Database (Denmark)

    Machguth, Horst; Thomsen, Henrik H.; Weidick, Anker


    Glacier surface mass-balance measurements on Greenland started more than a century ago, but no compilation exists of the observations from the ablation area of the ice sheet and local glaciers. Such data could be used in the evaluation of modelled surface mass balance, or to document changes in g...

  18. Determining surface areas of marine alga cells by acid-base titration method. (United States)

    Wang, X; Ma, Y; Su, Y


    A new method for determining the surface area of living marine alga cells was described. The method uses acid-base titration to measure the surface acid/base amount on the surface of alga cells and uses the BET (Brunauer, Emmett, and Teller) equation to estimate the maximum surface acid/base amount, assuming that hydrous cell walls have carbohydrates or other structural compounds which can behave like surface Brönsted acid-base sites due to coordination of environmental H2O molecules. The method was applied to 18 diverse alga species (including 7 diatoms, 2 flagellates, 8 green algae and 1 red alga) maintained in seawater cultures. For the species examined, the surface areas of individual cells ranged from 2.8 x 10(-8) m2 for Nannochloropsis oculata to 690 x 10(-8) m2 for Dunaliella viridis, specific surface areas from 1,030 m2.g-1 for Dunaliella salina to 28,900 m2.g-1 for Pyramidomonas sp. Measurement accuracy was 15.2%. Preliminary studies show that the method may be more promising and accurate than light/electron microscopic measurements for coarse estimation of the surface area of living algae.

  19. 30 CFR 717.15 - Disposal of excess rock and earth materials on surface areas. (United States)


    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Disposal of excess rock and earth materials on surface areas. 717.15 Section 717.15 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR INITIAL PROGRAM REGULATIONS UNDERGROUND MINING GENERAL PERFORMANCE STANDARDS § 717.15 Disposal of excess rock and...

  20. Greenland surface mass-balance observations from the ice-sheet ablation area and local glaciers

    NARCIS (Netherlands)

    Machguth, Horst; Thomsen, Henrik H.; Weidick, Anker; Ahlstrøm, Andreas P.; Abermann, Jakob; Andersen, Morten L.; Andersen, Signe B.; Bjørk, Anders A.; Box, Jason E.; Braithwaite, Roger J.; Bøggild, Carl E.; Citterio, Michele; Clement, Poul; Colgan, William; Fausto, Robert S.; Gleie, Karin; Gubler, Stefanie; Hasholt, Bent; Hynek, Bernhard; Knudsen, Niels T.; Larsen, Signe H.; Mernild, Sebastian H.; Oerlemans, Johannes; Oerter, Hans; Olesen, Ole B.; Smeets, C. J P Paul; Steffen, Konrad; Stober, Manfred; Sugiyama, Shin; Van As, Dirk; Van Den Broeke, Michiel R.; Van De Wal, Roderik S W


    Glacier surface mass-balance measurements on Greenland started more than a century ago, but no compilation exists of the observations from the ablation area of the ice sheet and local glaciers. Such data could be used in the evaluation of modelled surface mass balance, or to document changes in

  1. Changes in Thickness and Surface Area of the Human Cortex and Their Relationship with Intelligence

    NARCIS (Netherlands)

    Schnack, H.G.; van Haren, N.E.M.; Brouwer, R.M.; Evans, A.; Durston, S.; Boomsma, D.I.; Kahn, R.S.; Hulshoff Pol, H.E.


    Changes in cortical thickness over time have been related to intelligence, but whether changes in cortical surface area are related to general cognitive functioning is unknown. We therefore examined the relationship between intelligence quotient (IQ) and changes in cortical thickness and surface

  2. VBA SSA Acc To Fed Rec Online (SAFRO) - Also known as Veterans Benefit Administration Query (VBAQ). (United States)

    Social Security Administration — The purpose of this query is to provide SSA field office personnel with real-time access to military discharge data from the VA BIRLS database. This information is...

  3. Shock Hazard Prevention through Self-Healing Insulative Coating on SSA Metallic Bearings, Phase II (United States)

    National Aeronautics and Space Administration — The space suit assembly (SSA) contains metallic bearings at the wrist, neck, and waist, which are exposed to space environment, and pose a potential shock hazard....

  4. BOREAS TF-02 SSA-OA Tethersonde Meteorological and Ozone Data (United States)

    National Aeronautics and Space Administration — ABSTRACT: The BOREAS TF-02 team collected various trace gas and energy flux data along with meteorological parameters at the SSA-OA site. This data set contains...

  5. BOREAS TF-02 SSA-OA Tethersonde Meteorological and Ozone Data (United States)

    National Aeronautics and Space Administration — The BOREAS TF-02 team collected various trace gas and energy flux data along with meteorological parameters at the SSA-OA site. This data set contains meteorological...

  6. A New Trend-Following Indicator: Using SSA to Design Trading Rules (United States)

    Leles, Michel Carlo Rodrigues; Mozelli, Leonardo Amaral; Guimarães, Homero Nogueira

    Singular Spectrum Analysis (SSA) is a non-parametric approach that can be used to decompose a time-series as trends, oscillations and noise. Trend-following strategies rely on the principle that financial markets move in trends for an extended period of time. Moving Averages (MAs) are the standard indicator to design such strategies. In this study, SSA is used as an alternative method to enhance trend resolution in comparison with the traditional MA. New trading rules using SSA as indicator are proposed. This paper shows that for the Down Jones Industrial Average (DJIA) and Shangai Securities Composite Index (SSCI) time-series the SSA trading rules provided, in general, better results in comparison to MA trading rules.

  7. Surface-Casting Synthesis of Mesoporous Zirconia with a CMK-5-Like Structure and High Surface Area. (United States)

    Gu, Dong; Schmidt, Wolfgang; Pichler, Christian M; Bongard, Hans-Josef; Spliethoff, Bernd; Asahina, Shunsuke; Cao, Zhengwen; Terasaki, Osamu; Schüth, Ferdi


    About 15 years ago, the Ryoo group described the synthesis of CMK-5, a material consisting of a hexagonal arrangement of carbon nanotubes. Extension of the surface casting synthesis to oxide compositions, however, was not possible so far, in spite of many attempts. Here it is demonstrated, that crystalline mesoporous hollow zirconia materials with very high surface areas up to 400 m 2  g -1 , and in selected cases in the form of CMK-5-like, are indeed accessible via such a surface casting process. The key for the successful synthesis is an increased interaction between the silica hard template surface and the zirconia precursor species by using silanol group-rich mesoporous silica as a hard template. The surface areas of the obtained zirconias exceed those of conventionally hard-templated ones by a factor of two to three. The surface casting process seems to be applicable also to other oxide materials. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. Models of bedrock surface and overburden thickness over Olkiluoto island and nearby sea area

    International Nuclear Information System (INIS)

    Moenkkoenen, H.


    In this report, a model of bedrock surface and a model of overburden thickness over the Olkiluoto Island and the nearby sea area are presented. Also in purpose to produce material for biosphere and radionuclide transport modelling, stratigraphy models of different sediment layers were created at two priority areas north and south of the Olkiluoto Island. The work concentrated on the collection and description of available data of bedrock surface and overburden thickness. Because the information on the bedrock surface and overburden is collected from different sources and is based on a number of types of data the quality and applicability of data sets varies. Consequently also the reliability in different parts of the models varies. Input data for the bedrock surface and overburden thickness models include 2928 single points and additional outcrops observations (611 polygons) in the modelled area. In addition, the input data include 173 seismic refraction lines (6534 points) and acousticseismic sounding lines (26655 points from which 13721 points are located in model area) in the Olkiluoto offshore area. The average elevation of bedrock surface in area is 2.1 metres above the sea level. The average thickness of overburden is 2.5 metres varying typically between 2 - 4 metres. Thickest overburden covers (approximately 16 metres) of terrestrial area are located at the western end of the Olkiluoto Island and in sea basin south of the island. (orig.)

  9. Models of bedrock surface and overburden thickness over Olkiluoto island and nearby sea area

    Energy Technology Data Exchange (ETDEWEB)

    Moenkkoenen, H. [WSP Finland Oy, Helsinki (Finland)


    In this report, a model of bedrock surface and a model of overburden thickness over the Olkiluoto Island and the nearby sea area are presented. Also in purpose to produce material for biosphere and radionuclide transport modelling, stratigraphy models of different sediment layers were created at two priority areas north and south of the Olkiluoto Island. The work concentrated on the collection and description of available data of bedrock surface and overburden thickness. Because the information on the bedrock surface and overburden is collected from different sources and is based on a number of types of data the quality and applicability of data sets varies. Consequently also the reliability in different parts of the models varies. Input data for the bedrock surface and overburden thickness models include 2928 single points and additional outcrops observations (611 polygons) in the modelled area. In addition, the input data include 173 seismic refraction lines (6534 points) and acousticseismic sounding lines (26655 points from which 13721 points are located in model area) in the Olkiluoto offshore area. The average elevation of bedrock surface in area is 2.1 metres above the sea level. The average thickness of overburden is 2.5 metres varying typically between 2 - 4 metres. Thickest overburden covers (approximately 16 metres) of terrestrial area are located at the western end of the Olkiluoto Island and in sea basin south of the island. (orig.)

  10. Possible role of anti-SSA/Ro antibodies in the pathogenesis of pulmonary hypertension

    Directory of Open Access Journals (Sweden)

    Kelsey Guerreso


    Conclusion: It is known that pulmonary hypertension has association with autoimmune diseases, however no clear markers yet exist. Anti-SSA/Ro antibodies have been rarely described in cases of pulmonary disease, and less so in pulmonary hypertension. This case describes a unique association between isolated pulmonary hypertension and anti-SSA/Ro antibody, thereby illustrating the need to investigate this autoantibody and others in the pathogenesis of autoimmune pulmonary hypertension.

  11. Application of stereological methods to estimate post-mortem brain surface area using 3T MRI

    DEFF Research Database (Denmark)

    Furlong, Carolyn; García-Fiñana, Marta; Puddephat, Michael


    The Cavalieri and Vertical Sections methods of design based stereology were applied in combination with 3 tesla (i.e. 3T) Magnetic Resonance Imaging (MRI) to estimate cortical and subcortical volume, area of the pial surface, area of the grey-white matter boundary, and thickness of the cerebral...

  12. GillespieSSA: Implementing the Gillespie Stochastic Simulation Algorithm in R

    Directory of Open Access Journals (Sweden)

    Mario Pineda-Krch


    Full Text Available The deterministic dynamics of populations in continuous time are traditionally described using coupled, first-order ordinary differential equations. While this approach is accurate for large systems, it is often inadequate for small systems where key species may be present in small numbers or where key reactions occur at a low rate. The Gillespie stochastic simulation algorithm (SSA is a procedure for generating time-evolution trajectories of finite populations in continuous time and has become the standard algorithm for these types of stochastic models. This article presents a simple-to-use and flexible framework for implementing the SSA using the high-level statistical computing language R and the package GillespieSSA. Using three ecological models as examples (logistic growth, Rosenzweig-MacArthur predator-prey model, and Kermack-McKendrick SIRS metapopulation model, this paper shows how a deterministic model can be formulated as a finite-population stochastic model within the framework of SSA theory and how it can be implemented in R. Simulations of the stochastic models are performed using four different SSA Monte Carlo methods: one exact method (Gillespie's direct method; and three approximate methods (explicit, binomial, and optimized tau-leap methods. Comparison of simulation results confirms that while the time-evolution trajectories obtained from the different SSA methods are indistinguishable, the approximate methods are up to four orders of magnitude faster than the exact methods.

  13. Cortical surface area and cortical thickness in the precuneus of adult humans. (United States)

    Bruner, E; Román, F J; de la Cuétara, J M; Martin-Loeches, M; Colom, R


    The precuneus has received considerable attention in the last decade, because of its cognitive functions, its role as a central node of the brain networks, and its involvement in neurodegenerative processes. Paleoneurological studies suggested that form changes in the deep parietal areas represent a major character associated with the origin of the modern human brain morphology. A recent neuroanatomical survey based on shape analysis suggests that the proportions of the precuneus are also a determinant source of overall brain geometrical differences among adult individuals, influencing the brain spatial organization. Here, we evaluate the variation of cortical thickness and cortical surface area of the precuneus in a sample of adult humans, and their relation with geometry and cognition. Precuneal thickness and surface area are not correlated. There is a marked individual variation. The right precuneus is thinner and larger than the left one, but there are relevant fluctuating asymmetries, with only a modest correlation between the hemispheres. Males have a thicker cortex but differences in cortical area are not significant between sexes. The surface area of the precuneus shows a positive allometry with the brain surface area, although the correlation is modest. The dilation/contraction of the precuneus, described as a major factor of variability within adult humans, is associated with absolute increase/decrease of its surface, but not with variation in thickness. Precuneal thickness, precuneal surface area and precuneal morphology are not correlated with psychological factors such as intelligence, working memory, attention control, and processing speed, stressing further possible roles of this area in supporting default mode functions. Beyond gross morphology, the processes underlying the large phenotypic variation of the precuneus must be further investigated through specific cellular analyses, aimed at considering differences in cellular size, density

  14. Preparation, Surface and Pore Structure of High Surface Area Activated Carbon Fibers from Bamboo by Steam Activation

    Directory of Open Access Journals (Sweden)

    Xiaojun Ma


    Full Text Available High surface area activated carbon fibers (ACF have been prepared from bamboo by steam activation after liquefaction and curing. The influences of activation temperature on the microstructure, surface area and porosity were investigated. The results showed that ACF from bamboo at 850 °C have the maximum iodine and methylene blue adsorption values. Aside from the graphitic carbon, phenolic and carbonyl groups were the predominant functions on the surface of activated carbon fiber from bamboo. The prepared ACF from bamboo were found to be mainly type I of isotherm, but the mesoporosity presented an increasing trend after 700 °C. The surface area and micropore volume of samples, which were determined by application of the Brunauer-Emmett-Teller (BET and t-plot methods, were as high as 2024 m2/g and 0.569 cm3/g, respectively. It was also found that the higher activation temperature produced the more ordered microcrystalline structure of ACF from bamboo.

  15. Long-term evaluation of the needle surface wax condition of Pinus sylvestris around different industries in Lithuania

    International Nuclear Information System (INIS)

    Kupcinskiene, Eugenija; Huttunen, Satu


    The aim of our study was to evaluate the annual dynamics of needle surface wax erosion and wettability in Scots pines exposed to a gradient of industrial pollutants emitted from the main factories of Lithuania: a nitrogen fertilizer factory, an oil refinery and a cement factory. Decreased emissions (in the case of the oil refinery and the cement factory) were reflected in the increased structural surface area (SSA, i.e. area covered by tubular waxes) on the needles. The nearly constant amount of emissions from the nitrogen fertilizer factory within the 1994-2000 period corresponded to negligible annual differences in SSA. Annual changes in the hydrophobicity of needles on the investigated transects were small. Despite the decreased pollution within the 7-year period, industrial emissions are still causing significantly accelerated wax erosion and increased wettability in needles sampled from the stands most heavily affected by pollutants. - Tubular wax on the pine needle surface reflects changes/differences in industrial emissions

  16. Radiative surface temperatures of the burned and unburned areas in a tallgrass prairie

    International Nuclear Information System (INIS)

    Asrar, G.; Harris, T.R.; Lapitan, R.L.; Cooper, D.I.


    This study was conducted in a natural tallgrass prairie area in the Flint Hills of Kansas. Our objective was to evaluate the surface radiative temperatures of burned and unburned treatments of the grassland as a means of delineating the areas covered by each treatment. Burning is used to remove the senescent vegetation resulting from the previous year's growth. Surface temperatures were obtained in situ and by an airborne scanner. Burned and unburned grass canopies had distinctly different diurnal surface radiative temperatures. Measurements of surface energy balance components revealed a difference in partitioning of the available energy between the two canopies, which resulted in the difference in their measured surface temperatures. The magnitude of this difference is dependent on the time of measurements and topographic conditions. (author)

  17. Planar spatial correlations, anisotropy, and specific surface area of stationary random porous media

    International Nuclear Information System (INIS)

    Berryman, J.G.


    An earlier result of the author showed that an anisotropic spatial correlation function of a random porous medium could be used to compute the specific surface area when it is stationary as well as anisotropic by first performing a three-dimensional radial average and then taking the first derivative with respect to lag at the origin. This result generalized the earlier result for isotropic porous media of Debye et al. [J. Appl. Phys. 28, 679 (1957)]. The present article provides more detailed information about the use of spatial correlation functions for anisotropic porous media and in particular shows that, for stationary anisotropic media, the specific surface area can be related to the derivative of the two-dimensional radial average of the correlation function measured from cross sections taken through the anisotropic medium. The main concept is first illustrated using a simple pedagogical example for an anisotropic distribution of spherical voids. Then, a general derivation of formulas relating the derivative of the planar correlation functions to surface integrals is presented. When the surface normal is uniformly distributed (as is the case for any distribution of spherical voids), our formulas can be used to relate a specific surface area to easily measurable quantities from any single cross section. When the surface normal is not distributed uniformly (as would be the case for an oriented distribution of ellipsoidal voids), our results show how to obtain valid estimates of specific surface area by averaging measurements on three orthogonal cross sections. One important general observation for porous media is that the surface area from nearly flat cracks may be underestimated from measurements on orthogonal cross sections if any of the cross sections happen to lie in the plane of the cracks. This result is illustrated by taking the very small aspect ratio (penny-shaped crack) limit of an oblate spheroid, but holds for other types of flat surfaces as well

  18. Effect of surface area of substrates aiming the optimization of carbon nanotube production from ferrocene

    International Nuclear Information System (INIS)

    Osorio, A.G.; Bergmann, C.P.


    Highlights: ► An optimized synthesis of CNTs by ferrocene is proposed. ► The surface area of substrates influences the nucleation of CNTs. ► The higher the surface area of substrates the lower the temperature of synthesis. ► Chemical composition of substrates has no influence on the growth of CNTs. - Abstract: Ferrocene is widely used for the synthesis of carbon nanotubes due to its ability to act as catalyst and precursor of the synthesis. This paper proposes an optimization of the synthesis of carbon nanotubes from ferrocene, using a substrate with high surface area for their nucleation. Four different surface areas of silica powder were tested: 0.5, 50, 200 and 300 m 2 /g. Raman spectroscopy and microscopy were used to characterize the product obtained and X-ray diffraction and thermal analysis were also performed to evaluate the phases of the material. It was observed that the silica powder with the highest surface area allowed the synthesis of carbon nanotubes to occur at a lower temperature (600 °C), whereas substrates with a surface area lower than 50 m 2 /g will only form carbon nanotubes at temperatures higher than 750 °C. In order to evaluate the influence of chemical composition of the substrate, three different ceramic powders were analyzed: alumina, silica and zirconia. carbon black and previously synthesized carbon nanotubes were also used as substrate for the synthesis and the results showed that the chemical composition of the substrate does not play a relevant role in the synthesis of carbon nanotubes, only the surface area showed an influence.

  19. Estimating surface fluxes over the north Tibetan Plateau area with ASTER imagery

    Directory of Open Access Journals (Sweden)

    Weiqiang Ma


    Full Text Available Surface fluxes are important boundary conditions for climatological modeling and Asian monsoon system. The recent availability of high-resolution, multi-band imagery from the ASTER (Advanced Space-borne Thermal Emission and Reflection radiometer sensor has enabled us to estimate surface fluxes to bridge the gap between local scale flux measurements using micrometeorological instruments and regional scale land-atmosphere exchanges of water and heat fluxes that are fundamental for the understanding of the water cycle in the Asian monsoon system. A parameterization method based on ASTER data and field observations has been proposed and tested for deriving surface albedo, surface temperature, Normalized Difference Vegetation Index (NDVI, Modified Soil Adjusted Vegetation Index (MSAVI, vegetation coverage, Leaf Area Index (LAI, net radiation flux, soil heat flux, sensible heat flux and latent heat flux over heterogeneous land surface in this paper. As a case study, the methodology was applied to the experimental area of the Coordinated Enhanced Observing Period (CEOP Asia-Australia Monsoon Project (CAMP on the Tibetan Plateau (CAMP/Tibet, located at the north Tibetan Plateau. The ASTER data of 24 July 2001, 29 November 2001 and 12 March 2002 was used in this paper for the case of summer, winter and spring. To validate the proposed methodology, the ground-measured surface variables (surface albedo and surface temperature and land surface heat fluxes (net radiation flux, soil heat flux, sensible heat flux and latent heat flux were compared to the ASTER derived values. The results show that the derived surface variables and land surface heat fluxes in three different months over the study area are in good accordance with the land surface status. Also, the estimated land surface variables and land surface heat fluxes are in good accordance with ground measurements, and all their absolute percentage difference (APD is less than 10% in the validation sites

  20. Technology of surface wastewater purification, including high-rise construction areas (United States)

    Tsyba, Anna; Skolubovich, Yury


    Despite on the improvements in the quality of high-rise construction areas and industrial wastewater treatment, the pollution of water bodies continues to increase. This is due to the organized and unorganized surface untreated sewage entry into the reservoirs. The qualitative analysis of some cities' surface sewage composition is carried out in the work. Based on the published literature review, the characteristic contamination present in surface wastewater was identified. The paper proposes a new technology for the treatment of surface sewage and presents the results of preliminary studies.

  1. High-resolution surface analysis for extended-range downscaling with limited-area atmospheric models (United States)

    Separovic, Leo; Husain, Syed Zahid; Yu, Wei; Fernig, David


    High-resolution limited-area model (LAM) simulations are frequently employed to downscale coarse-resolution objective analyses over a specified area of the globe using high-resolution computational grids. When LAMs are integrated over extended time frames, from months to years, they are prone to deviations in land surface variables that can be harmful to the quality of the simulated near-surface fields. Nudging of the prognostic surface fields toward a reference-gridded data set is therefore devised in order to prevent the atmospheric model from diverging from the expected values. This paper presents a method to generate high-resolution analyses of land-surface variables, such as surface canopy temperature, soil moisture, and snow conditions, to be used for the relaxation of lower boundary conditions in extended-range LAM simulations. The proposed method is based on performing offline simulations with an external surface model, forced with the near-surface meteorological fields derived from short-range forecast, operational analyses, and observed temperatures and humidity. Results show that the outputs of the surface model obtained in the present study have potential to improve the near-surface atmospheric fields in extended-range LAM integrations.


    Directory of Open Access Journals (Sweden)

    R. Hu


    Full Text Available Impervious surface area and vegetation coverage are important biophysical indicators of urban surface features which can be derived from medium-resolution images. However, remote sensing data obtained by a single sensor are easily affected by many factors such as weather conditions, and the spatial and temporal resolution can not meet the needs for soil erosion estimation. Therefore, the integrated multi-source remote sensing data are needed to carry out high spatio-temporal resolution vegetation coverage estimation. Two spatial and temporal vegetation coverage data and impervious data were obtained from MODIS and Landsat 8 remote sensing images. Based on the Enhanced Spatial and Temporal Adaptive Reflectance Fusion Model (ESTARFM, the vegetation coverage data of two scales were fused and the data of vegetation coverage fusion (ESTARFM FVC and impervious layer with high spatiotemporal resolution (30 m, 8 day were obtained. On this basis, the spatial variability of the seepage-free surface and the vegetation cover landscape in the study area was measured by means of statistics and spatial autocorrelation analysis. The results showed that: 1 ESTARFM FVC and impermeable surface have higher accuracy and can characterize the characteristics of the biophysical components covered by the earth's surface; 2 The average impervious surface proportion and the spatial configuration of each area are different, which are affected by natural conditions and urbanization. In the urban area of Xi'an, which has typical characteristics of spontaneous urbanization, landscapes are fragmented and have less spatial dependence.

  3. Vegetation Coverage and Impervious Surface Area Estimated Based on the Estarfm Model and Remote Sensing Monitoring (United States)

    Hu, Rongming; Wang, Shu; Guo, Jiao; Guo, Liankun


    Impervious surface area and vegetation coverage are important biophysical indicators of urban surface features which can be derived from medium-resolution images. However, remote sensing data obtained by a single sensor are easily affected by many factors such as weather conditions, and the spatial and temporal resolution can not meet the needs for soil erosion estimation. Therefore, the integrated multi-source remote sensing data are needed to carry out high spatio-temporal resolution vegetation coverage estimation. Two spatial and temporal vegetation coverage data and impervious data were obtained from MODIS and Landsat 8 remote sensing images. Based on the Enhanced Spatial and Temporal Adaptive Reflectance Fusion Model (ESTARFM), the vegetation coverage data of two scales were fused and the data of vegetation coverage fusion (ESTARFM FVC) and impervious layer with high spatiotemporal resolution (30 m, 8 day) were obtained. On this basis, the spatial variability of the seepage-free surface and the vegetation cover landscape in the study area was measured by means of statistics and spatial autocorrelation analysis. The results showed that: 1) ESTARFM FVC and impermeable surface have higher accuracy and can characterize the characteristics of the biophysical components covered by the earth's surface; 2) The average impervious surface proportion and the spatial configuration of each area are different, which are affected by natural conditions and urbanization. In the urban area of Xi'an, which has typical characteristics of spontaneous urbanization, landscapes are fragmented and have less spatial dependence.

  4. Preparation of MgO with High Surface Area, and Modification of Its Pore Characteristics

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Moon Hee; Park, Dong Gon [Sookmyung Women' s University, Seoul (Korea, Republic of)


    Thermal decomposition of hydrated surface layer of Mg(OH){sub 2} at 500 .deg. C in vacuum turned non-porous MgO into porous one with high surface area of around 270 m{sup 2}/g. Most of its surface area, 74 %, was from micropores, and rest of it was from mesopores in wedge-shaped slits, exhibiting bimodal size distribution centered around 30 and 90 A. Rehydration followed by subsequent dehydration at 300 .deg. C in dynamic vacuum further raised the surface area to 340 m{sup 2}/g. Fraction of microporous surface area was increased to 93%, and the shape of the mesopores was modified into parallel slits with a specific dimension of 32 A. Application of Fe{sub 2}O{sub 3} over MgO via iron complex formation did not alter the pore characteristics of MgO core, except slightly increased pore dimension. Over the course of the modification, Fe{sub 2}O{sub 3} stayed on the surface possibly via spill-over reaction.

  5. Optimized preparation for large surface area activated carbon from date (Phoenix dactylifera L.) stone biomass

    International Nuclear Information System (INIS)

    Danish, Mohammed; Hashim, Rokiah; Ibrahim, M.N. Mohamad; Sulaiman, Othman


    The preparation of activated carbon from date stone treated with phosphoric acid was optimized using rotatable central composite design of response surface methodology (RSM). The chemical activating agent concentration and temperature of activation plays a crucial role in preparation of large surface area activated carbons. The optimized activated carbon was characterized using thermogravimetric analysis, field emission scanning electron microscopy, energy dispersive X-ray spectroscopy, powder X-ray diffraction, and Fourier transform infrared spectroscopy. The results showed that the larger surface area of activated carbon from date stone can be achieved under optimum activating agent (phosphoric acid) concentration, 50.0% (8.674 mol L −1 ) and activation temperature, 900 °C. The Brunauer–Emmett–Teller (BET) surface area of optimized activated carbon was found to be 1225 m 2  g −1 , and thermogravimetric analysis revealed that 55.2% mass of optimized activated carbon was found thermally stable till 900 °C. The leading chemical functional groups found in the date stone activated carbon were aliphatic carboxylic acid salt ν(C=O) 1561.22 cm −1 and 1384.52 cm −1 , aliphatic hydrocarbons ν(C–H) 2922.99 cm −1 (C–H sym./asym. stretch frequency), aliphatic phosphates ν(P–O–C) 1054.09 cm −1 , and secondary aliphatic alcohols ν(O–H) 3419.81 cm −1 and 1159.83 cm −1 . - Highlights: • RSM optimization was done for the production of large surface area activated carbon. • Two independent variables with two responses were selected for optimization. • Characterization was done for surface area, morphology and chemical constituents. • Optimized date stone activated carbon achieved surface area 1225 m 2  g −1

  6. Evaluating polymer degradation with complex mixtures using a simplified surface area method. (United States)

    Steele, Kandace M; Pelham, Todd; Phalen, Robert N


    Chemical-resistant gloves, designed to protect workers from chemical hazards, are made from a variety of polymer materials such as plastic, rubber, and synthetic rubber. One material does not provide protection against all chemicals, thus proper polymer selection is critical. Standardized testing, such as chemical degradation tests, are used to aid in the selection process. The current methods of degradation ratings based on changes in weight or tensile properties can be expensive and data often do not exist for complex chemical mixtures. There are hundreds of thousands of chemical products on the market that do not have chemical resistance data for polymer selection. The method described in this study provides an inexpensive alternative to gravimetric analysis. This method uses surface area change to evaluate degradation of a polymer material. Degradation tests for 5 polymer types against 50 complex mixtures were conducted using both gravimetric and surface area methods. The percent change data were compared between the two methods. The resulting regression line was y = 0.48x + 0.019, in units of percent, and the Pearson correlation coefficient was r = 0.9537 (p ≤ 0.05), which indicated a strong correlation between percent weight change and percent surface area change. On average, the percent change for surface area was about half that of the weight change. Using this information, an equivalent rating system was developed for determining the chemical degradation of polymer gloves using surface area.

  7. Study of measurement methods of ultrafine aerosols surface-area for characterizing occupational exposure

    International Nuclear Information System (INIS)

    Bau, S.


    This work aims at improving knowledge on ultrafine aerosols surface-area measurement. Indeed, the development of nano-technologies may lead to occupational exposure to airborne nano-structured particles, which involves a new prevention issue. There is currently no consensus concerning what parameter (mass, surface-area, number) should be measured. However, surface-area could be a relevant metric, since it leads to a satisfying correlation with biological effects when nano-structured particles are inhaled. Hence, an original theoretical work was performed to position the parameter of surface-area in relation to other aerosol characteristics. To investigate measurement techniques of nano-structured aerosols surface-area, the experimental facility CAIMAN (Characterization of Instruments for the Measurement of Aerosols of Nano-particles) was designed and built. Within CAIMAN, it is possible to produce nano-structured aerosols with varying and controlled properties (size, concentration, chemical nature, morphology, state-of-charge), stable and reproducible in time. The generated aerosols were used to experimentally characterize the response of the instruments in study (NSAM and AeroTrak 9000 TSI, LQ1-DC Matter Engineering). The response functions measured with monodisperse aerosols show a good agreement with the corresponding theoretical curves in a large size range, from 15 to 520 nm. Furthermore, hypotheses have been formulated to explain the reasonable biases observed when measuring poly-disperse aerosols. (author)

  8. A longitudinal study: changes in cortical thickness and surface area during pubertal maturation.

    Directory of Open Access Journals (Sweden)

    Megan M Herting

    Full Text Available Sex hormones have been shown to contribute to the organization and function of the brain during puberty and adolescence. Moreover, it has been suggested that distinct hormone changes in girls versus boys may contribute to the emergence of sex differences in internalizing and externalizing behavior during adolescence. In the current longitudinal study, the influence of within-subject changes in puberty (physical and hormonal on cortical thickness and surface area was examined across a 2-year span, while controlling for age. Greater increases in Tanner Stage predicted less superior frontal thinning and decreases in precuneus surface area in both sexes. Significant Tanner Stage and sex interactions were also seen, with less right superior temporal thinning in girls but not boys, as well as greater decreases in the right bank of the superior temporal sulcus surface area in boys compared to girls. In addition, within-subject changes in testosterone over the 2-year follow-up period were found to relate to decreases in middle superior frontal surface area in boys, but increases in surface area in girls. Lastly, larger increases in estradiol in girls predicted greater middle temporal lobe thinning. These results show that within-subject physical and hormonal markers of puberty relate to region and sex-specific changes in cortical development across adolescence.

  9. A longitudinal study: changes in cortical thickness and surface area during pubertal maturation. (United States)

    Herting, Megan M; Gautam, Prapti; Spielberg, Jeffrey M; Dahl, Ronald E; Sowell, Elizabeth R


    Sex hormones have been shown to contribute to the organization and function of the brain during puberty and adolescence. Moreover, it has been suggested that distinct hormone changes in girls versus boys may contribute to the emergence of sex differences in internalizing and externalizing behavior during adolescence. In the current longitudinal study, the influence of within-subject changes in puberty (physical and hormonal) on cortical thickness and surface area was examined across a 2-year span, while controlling for age. Greater increases in Tanner Stage predicted less superior frontal thinning and decreases in precuneus surface area in both sexes. Significant Tanner Stage and sex interactions were also seen, with less right superior temporal thinning in girls but not boys, as well as greater decreases in the right bank of the superior temporal sulcus surface area in boys compared to girls. In addition, within-subject changes in testosterone over the 2-year follow-up period were found to relate to decreases in middle superior frontal surface area in boys, but increases in surface area in girls. Lastly, larger increases in estradiol in girls predicted greater middle temporal lobe thinning. These results show that within-subject physical and hormonal markers of puberty relate to region and sex-specific changes in cortical development across adolescence.

  10. Large area smoothing of surfaces by ion bombardment: fundamentals and applications

    International Nuclear Information System (INIS)

    Frost, F; Fechner, R; Ziberi, B; Voellner, J; Flamm, D; Schindler, A


    Ion beam erosion can be used as a process for achieving surface smoothing at microscopic length scales and for the preparation of ultrasmooth surfaces, as an alternative to nanostructuring of various surfaces via self-organization. This requires that in the evolution of the surface topography different relaxation mechanisms dominate over the roughening, and smoothing of initially rough surfaces can occur. This contribution focuses on the basic mechanisms as well as potential applications of surface smoothing using low energy ion beams. In the first part, the fundamentals for the smoothing of III/V semiconductors, Si and quartz glass surfaces using low energy ion beams (ion energy: ≤2000 eV) are reviewed using examples. The topography evolution of these surfaces with respect to different process parameters (ion energy, ion incidence angle, erosion time, sample rotation) has been investigated. On the basis of the time evolution of different roughness parameters, the relevant surface relaxation mechanisms responsible for surface smoothing are discussed. In this context, physical constraints as regards the effectiveness of surface smoothing by direct ion bombardment will also be addressed and furthermore ion beam assisted smoothing techniques are introduced. In the second application-orientated part, recent technological developments related to ion beam assisted smoothing of optically relevant surfaces are summarized. It will be demonstrated that smoothing by direct ion bombardment in combination with the use of sacrificial smoothing layers and the utilization of appropriate broad beam ion sources enables the polishing of various technologically important surfaces down to 0.1 nm root mean square roughness level, showing great promise for large area surface processing. Specific examples are given for ion beam smoothing of different optical surfaces, especially for substrates used for advanced optical applications (e.g., in x-ray optics and components for extreme

  11. Relationship among land surface temperature and LUCC, NDVI in typical karst area. (United States)

    Deng, Yuanhong; Wang, Shijie; Bai, Xiaoyong; Tian, Yichao; Wu, Luhua; Xiao, Jianyong; Chen, Fei; Qian, Qinghuan


    Land surface temperature (LST) can reflect the land surface water-heat exchange process comprehensively, which is considerably significant to the study of environmental change. However, research about LST in karst mountain areas with complex topography is scarce. Therefore, we retrieved the LST in a karst mountain area from Landsat 8 data and explored its relationships with LUCC and NDVI. The results showed that LST of the study area was noticeably affected by altitude and underlying surface type. In summer, abnormal high-temperature zones were observed in the study area, perhaps due to karst rocky desertification. LSTs among different land use types significantly differed with the highest in construction land and the lowest in woodland. The spatial distributions of NDVI and LST exhibited opposite patterns. Under the spatial combination of different land use types, the LST-NDVI feature space showed an obtuse-angled triangle shape and showed a negative linear correlation after removing water body data. In summary, the LST can be retrieved well by the atmospheric correction model from Landsat 8 data. Moreover, the LST of the karst mountain area is controlled by altitude, underlying surface type and aspect. This study provides a reference for land use planning, ecological environment restoration in karst areas.

  12. Surface Area of Patellar Facets: Inferential Statistics in the Iraqi Population

    Directory of Open Access Journals (Sweden)

    Ahmed Al-Imam


    Full Text Available Background. The patella is the largest sesamoid bone in the body; its three-dimensional complexity necessitates biomechanical perfection. Numerous pathologies occur at the patellofemoral unit which may end in degenerative changes. This study aims to test the presence of statistical correlation between the surface areas of patellar facets and other patellar morphometric parameters. Materials and Methods. Forty dry human patellae were studied. The morphometry of each patella was measured using a digital Vernier Caliper, electronic balance, and image analyses software known as ImageJ. The patellar facetal surface area was correlated with patellar weight, height, width, and thickness. Results. Inferential statistics proved the existence of linear correlation of total facetal surface area and patellar weight, height, width, and thickness. The correlation was strongest for surface area versus patellar weight. The lateral facetal area was found persistently larger than the medial facetal area, the p value was found to be <0.001 (one-tailed t-test for right patellae, and another significant p value of < 0.001 (one-tailed t-test was found for left patellae. Conclusion. These data are vital for the restoration of the normal biomechanics of the patellofemoral unit; these are to be consulted during knee surgeries and implant designs and can be of an indispensable anthropometric, interethnic, and biometric value.

  13. Fire-induced albedo change and surface radiative forcing in sub-Saharan Africa savanna ecosystems: Implications for the energy balance (United States)

    Dintwe, Kebonye; Okin, Gregory S.; Xue, Yongkang


    Surface albedo is a critical parameter that controls surface energy balance. In dryland ecosystems, fires play a significant role in decreasing surface albedo, resulting in positive radiative forcing. Here we investigate the long-term effect of fire on surface albedo. We devised a method to calculate short-, medium-, and long-term effect of fire-induced radiative forcing and their relative effects on energy balance. We used Moderate Resolution Imaging Spectroradiometer (MODIS) data in our analysis, covering different vegetation classes in sub-Saharan Africa (SSA). Our analysis indicated that mean short-term fire-induced albedo change in SSA was -0.022, -0.035, and -0.041 for savannas, shrubland, and grasslands, respectively. At regional scale, mean fire-induced albedo change in savannas was -0.018 and -0.024 for northern sub-Saharan of Africa and the southern hemisphere Africa, respectively. The short-term mean fire-induced radiative forcing in burned areas in sub-Saharan Africa (SSA) was 5.41 W m-2, which contributed continental and global radiative forcings of 0.25 and 0.058 W m-2, respectively. The impact of fire in surface albedo has long-lasting effects that varies with vegetation type. The long-term energetic effects of fire-induced albedo change and associated radiative forcing were, on average, more than 19 times greater across SSA than the short-term effects, suggesting that fires exerted far more radiative forcing than previously thought. Taking into account the actual duration of fire's effect on surface albedo, we conclude that the contribution of SSA fires, globally and throughout the year, is 0.12 W m-2. These findings provide crucial information on possible impact of fire on regional climate variability.

  14. Digital photography and transparency-based methods for measuring wound surface area. (United States)

    Bhedi, Amul; Saxena, Atul K; Gadani, Ravi; Patel, Ritesh


    To compare and determine a credible method of measurement of wound surface area by linear, transparency, and photographic methods for monitoring progress of wound healing accurately and ascertaining whether these methods are significantly different. From April 2005 to December 2006, 40 patients (30 men, 5 women, 5 children) admitted to the surgical ward of Shree Sayaji General Hospital, Baroda, had clean as well as infected wound following trauma, debridement, pressure sore, venous ulcer, and incision and drainage. Wound surface areas were measured by these three methods (linear, transparency, and photographic methods) simultaneously on alternate days. The linear method is statistically and significantly different from transparency and photographic methods (P value transparency and photographic methods (P value >0.05). Photographic and transparency methods provided measurements of wound surface area with equivalent result and there was no statistically significant difference between these two methods.

  15. Nanoporous Ni with High Surface Area for Potential Hydrogen Storage Application. (United States)

    Zhou, Xiaocao; Zhao, Haibo; Fu, Zhibing; Qu, Jing; Zhong, Minglong; Yang, Xi; Yi, Yong; Wang, Chaoyang


    Nanoporous metals with considerable specific surface areas and hierarchical pore structures exhibit promising applications in the field of hydrogen storage, electrocatalysis, and fuel cells. In this manuscript, a facile method is demonstrated for fabricating nanoporous Ni with a high surface area by using SiO₂ aerogel as a template, i.e., electroless plating of Ni into an SiO₂ aerogel template followed by removal of the template at moderate conditions. The effects of the prepared conditions, including the electroless plating time, temperature of the structure, and the magnetism of nanoporous Ni are investigated in detail. The resultant optimum nanoporous Ni with a special 3D flower-like structure exhibited a high specific surface area of about 120.5 m²/g. The special nanoporous Ni exhibited a promising prospect in the field of hydrogen storage, with a hydrogen capacity of 0.45 wt % on 4.5 MPa at room temperature.

  16. Modeled effects on permittivity measurements of water content in high surface area porous media

    International Nuclear Information System (INIS)

    Jones, S.B.; Or, Dani


    Time domain reflectometry (TDR) has become an important measurement technique for determination of porous media water content and electrical conductivity due to its accuracy, fast response and automation capability. Water content is inferred from the measured bulk dielectric constant based on travel time analysis along simple transmission lines. TDR measurements in low surface area porous media accurately describe water content using an empirical relationship. Measurement discrepancies arise from dominating influences such as bound water due to high surface area, extreme aspect ratio particles or atypical water phase configuration. Our objectives were to highlight primary factors affecting dielectric permittivity measurements for water content determination in porous mixtures, and demonstrate the influence of these factors on mixture permittivity as predicted by a three-phase dielectric mixture model. Modeled results considering water binding, higher porosity, constituent geometry or phase configuration suggest any of these effects individually are capable of causing permittivity reduction, though all likely contribute in high surface area porous media

  17. Development of a certified reference material for specific surface area of quartz sand

    Directory of Open Access Journals (Sweden)

    Egor P Sobina


    Full Text Available The paper presents results of conducting research on the development of a certified reference material (CRM for specific surface area of quartz sand, which is practically non-porous and therefore has low specific surface area value ~ 0.8 m2/g. The standard uncertainty due to RM inhomogeneity, the standard uncertainty due to RM instability, as well as the standard uncertainty due to characterization were estimated using the State Primary Standard GET 210‑2014 for Units of Specific Absorption of Gases, Specific Surface Area, Specific Volume, and Pore Size of Solid Substances and Materials. The metrological characteristics of the CRM were determined using a low-temperature gas adsorption method. Krypton was used as an adsorbate to increase measurement accuracy.

  18. High surface area V-Mo-N materials synthesized from amine intercalated foams

    International Nuclear Information System (INIS)

    Krawiec, Piotr; Narayan Panda, Rabi; Kockrick, Emanuel; Geiger, Dorin; Kaskel, Stefan


    Nanocrystalline ternary V-Mo nitrides were prepared via nitridation of amine intercalated oxide foams or bulk ternary oxides. Specific surface areas were in the range between 40 and 198 m 2 g -1 and strongly depended on the preparation method (foam or bulk oxide). Foamed precursors were favorable for vanadium rich materials, while for molybdenum rich samples bulk ternary oxides resulted in higher specific surface areas. The materials were characterized via nitrogen physisorption at 77 K, X-ray diffraction patterns, electron microscopy, and elemental analysis. - Graphical abstract: Nanocrystalline ternary V-Mo nitrides were prepared via nitridation of amine intercalated oxide foams or bulk ternary oxides. Foamed precursors were favorable for vanadium rich materials, while for molybdenum rich samples bulk ternary oxides resulted in higher specific surface areas

  19. Contribution to the study of techniques of measurement of interface surface area in bubble flows

    International Nuclear Information System (INIS)

    Veteau, Jean-Michel


    This research thesis addresses problems raised by the measurement of the interface area per volume unit in duct bubble flows. The author first reports a literature survey of existing methods (photographic, chemical and optical methods) which give access to the value of the parameter which is commonly named 'specific surface area'. He analyses under which conditions these methods lead to a rigorous determination of the SVIM (mean integral volume surface). The author highlights the theoretical contributions of models related to each of these methods which are indeed global methods as they allow the interface surface area to be directly obtained in a given volume of a two-phase mixture. Then, the author reports the development of an original technique based on the use of phase detecting local probes. In the next part, the author compares photographic and optical methods, on the one hand, and optical and local methods, on the other hand. Recommendations are made for the development of local methods [fr

  20. Infinitesimal-area 2D radiative analysis using parametric surface representation, through NURBS

    Energy Technology Data Exchange (ETDEWEB)

    Daun, K J; Hollands, K G.T.


    The use of form factors in the treatment of radiant enclosures requires that the radiosity and surface properties be treated as uniform over finite areas. This restriction can be relaxed by applying an infinitesimal-area analysis, where the radiant exchange is taken to be between infinitesimal areas, rather than finite areas. This paper presents a generic infinitesimal-area formulation that can be applied to two-dimensional enclosure problems. (Previous infinitesimal-area analyses have largely been restricted to specific, one-dimensional problems.) Specifically, the paper shows how the analytical expression for the kernel of the integral equation can be obtained without human intervention, once the enclosure surface has been defined parametrically. This can be accomplished by using a computer algebra package or by using NURBS algorithms, which are the industry standard for the geometrical representations used in CAD-CAM codes. Once the kernel has been obtained by this formalism, the 2D integral equation can be set up and solved numerically. The result is a single general-purpose infinitesimal-area analysis code that can proceed from surface specification to solution. The authors have implemented this 2D code and tested it on 1D problems, whose solutions have been given in the literature, obtaining agreement commensurate with the accuracy of the published solutions.

  1. Microbiology of the surface water samples in the high background radiation areas of Ramsar, Iran

    International Nuclear Information System (INIS)

    Motamedifar, Mohammad; Zamani, Khosrow; Sedigh, Hadi; Mortazavi, Seyed Mohammad Javad; Taeb, Shahram; Haghani, M.; Mortazavi, Seyed Ali Reza; Soofi, Amir


    Residents of high background radiation areas of Ramsar have lived in these areas for many generations and received radiation doses much higher than the dose limit recommended by ICRP for radiation workers. The radioactivity of the high background radiation areas of Ramsar is reported to be due to 226 Ra and its decay products, which have been brought to the surface by the waters of hot springs. Over the past years the department has focused on different aspects of the health effects of the elevated levels of natural radiation in Ramsar. This study was aimed to perform a preliminary investigation on the bioeffects of exposure to elevated levels of natural radiation on the microbiology of surface water samples. Water samples were collected from surface water streams in Talesh Mahalleh district, Ramsar as well as a nearby area with normal levels of background radiation. Only two strains of bacteria, that is, Providencia stuartii and Shimwellia blattae, could be isolated from the water samples collected from high background radiation areas, while seven strains (Escherichia coli, Enterobacter asburiae, Klebsiella pneumoniae, Shigella dysenteriae, Buttiauxella agerstis, Tatumella punctuata and Raoultella ornithinolytica) were isolated from the water samples collected from normal background radiation areas. All the bacteria isolated from water samples of high and normal background radiation areas were sensitive to ultraviolet radiation, heat, betadine, alcohol, and deconex. Although other investigators have reported that bacteria isolated from hot springs show radioresistance, the results reported here do not reveal any adaptive response. (author)

  2. Area-averaged surface fluxes and their time-space variability over the FIFE experimental domain (United States)

    Smith, E. A.; Hsu, A. Y.; Crosson, W. L.; Field, R. T.; Fritschen, L. J.; Gurney, R. J.; Kanemasu, E. T.; Kustas, W. P.; Nie, D.; Shuttleworth, W. J.


    The underlying mean and variance properties of surface net radiation, sensible-latent heat fluxes and soil heat flux are studied over the densely instrumented grassland region encompassing FIFE. Flux variability is discussed together with the problem of scaling up to area-averaged fluxes. Results are compared and contrasted for cloudy and clear situations and examined for the influence of surface-induced biophysical controls (burn and grazing treatments) and topographic controls (aspect ratios and slope factors).

  3. A Three-Dimensional Enormous Surface Area Aluminum Microneedle Array with Nanoporous Structure


    Chen, Po Chun; Hsieh, Sheng Jen; Chen, Chien Chon; Zou, Jun


    We proposed fabricating an aluminum microneedle array with a nanochannel structure on the surface by combining micromachining, electrolyte polishing, and anodization methods. The microneedle array provides a three-dimensional (3D) structure that possesses several hundred times more surface area than a traditional nanochannel template. Therefore, the microneedle array can potentially be used in many technology applications. This 3D microneedle array device can not only be used for painless inj...

  4. DMSA scan nomograms for renal length and area: Related to patient age and to body weight, height or surface area

    International Nuclear Information System (INIS)

    Hassan, I.M.; Que, L.; Rutland, M.D.


    Aim: To create nomograms for renal size as measured from DMSA renal studies, and to test the nomograms for their ability to separate normal from abnormal kidneys. Method: Renal length was measured from posterior oblique views and renal area from posterior views. Results from 253 patients with bilateral normal kidneys were used to create nomograms for renal size relative to patient age, body height, weight or body surface area (BSA). The nomograms enclosed 95% of the normal kidneys, thus indicating the range for 95% confidence limits, and hence the specificity. Each nomogram was then tested against 46 hypertrophied kidneys and 46 damaged kidneys. Results: The results from nomograms of renal length and renal area, compared to age, body height, body weight and BSA are presented. For each nomogram, the range is presented as a fraction of the mean value, and the number of abnormal kidneys (hypertrophied or damaged) outside the normal range is presented as a percentage (indicating the sensitivity). Conclusion: Renal Area was no better than renal length for detecting abnormal kidneys. Patient age was the least useful method of normalisation. BSA normalisation produced the best results most frequently (narrower ranges and highest detection of abnormal kidneys)

  5. Heavy metal contamination in surface runoff sediments of the urban area of Vilnius, Lithuania

    Directory of Open Access Journals (Sweden)

    Gytautas Ignatavičius


    Full Text Available Surface runoff from urbanized territories carries a wide range of pollutants. Sediments in untreated runoff from direct discharge stormwater systems significantly contribute to urban waterway pollution. In this study, heavy metal (Pb, Zn, Cu, Cr, Ba, As and Fe contamination in surface runoff sediments of the urban area of the city of Vilnius was investigated. The surface runoff sediment samples were collected from seven dischargers with the highest volume rate of water flow and concentrations of suspended solids. The geospatial analysis of the distribution of heavy metals shows that there are several active pollution sources supplying the dischargers with contaminated sediments. Most of these areas are located in the central part of the city and in old town with intense traffic. Principal components analysis and t-test results clearly depicted the significantly different chemical compositions of winter and autumn surface sediment samples. The sampling approach and assessment of results provide a useful tool to examine the contamination that is generated in urban areas, distinguish pollution sources and give a better understanding of the importance of permeable surfaces and green areas.

  6. Whole object surface area and volume of partial-view 3D models

    International Nuclear Information System (INIS)

    Mulukutla, Gopal K; Proussevitch, Alexander A; Genareau, Kimberly D; Durant, Adam J


    Micro-scale 3D models, important components of many studies in science and engineering, are often used to determine morphological characteristics such as shape, surface area and volume. The application of techniques such as stereoscopic scanning electron microscopy on whole objects often results in ‘partial-view’ models with a portion of object not within the field of view thus not captured in the 3D model. The nature and extent of the surface not captured is dependent on the complex interaction of imaging system attributes (e.g. working distance, viewing angle) with object size, shape and morphology. As a result, any simplistic assumptions in estimating whole object surface area or volume can lead to significant errors. In this study, we report on a novel technique to estimate the physical fraction of an object captured in a partial-view 3D model of an otherwise whole object. This allows a more accurate estimate of surface area and volume. Using 3D models, we demonstrate the robustness of this method and the accuracy of surface area and volume estimates relative to true values. (paper)

  7. Stereological estimation of surface area and barrier thickness of fish gills in vertical sections. (United States)

    Da Costa, Oscar T F; Pedretti, Ana Carolina E; Schmitz, Anke; Perry, Steven F; Fernandes, Marisa N


    Previous morphometric methods for estimation of the volume of components, surface area and thickness of the diffusion barrier in fish gills have taken advantage of the highly ordered structure of these organs for sampling and surface area estimations, whereas the thickness of the diffusion barrier has been measured orthogonally on perpendicularly sectioned material at subjectively selected sites. Although intuitively logical, these procedures do not have a demonstrated mathematical basis, do not involve random sampling and measurement techniques, and are not applicable to the gills of all fish. The present stereological methods apply the principles of surface area estimation in vertical uniform random sections to the gills of the Brazilian teleost Arapaima gigas. The tissue was taken from the entire gill apparatus of the right-hand or left-hand side (selected at random) of the fish by systematic random sampling and embedded in glycol methacrylate for light microscopy. Arches from the other side were embedded in Epoxy resin. Reference volume was estimated by the Cavalieri method in the same vertical sections that were used for surface density and volume density measurements. The harmonic mean barrier thickness of the water-blood diffusion barrier was calculated from measurements taken along randomly selected orientation lines that were sine-weighted relative to the vertical axis. The values thus obtained for the anatomical diffusion factor (surface area divided by barrier thickness) compare favourably with those obtained for other sluggish fish using existing methods.

  8. A process to enhance the specific surface area and capacitance of hydrothermally reduced graphene oxide

    KAUST Repository

    Alazmi, Amira


    The impact of post-synthesis processing in reduced graphene oxide materials for supercapacitor electrodes has been analyzed. A comparative study of vacuum, freeze and critical point drying was carried out for hydrothermally reduced graphene oxide demonstrating that the optimization of the specific surface area and preservation of the porous network are critical to maximize its supercapacitance performance. As described below, using a supercritical fluid as the drying medium, unprecedented values of the specific surface area (364 m2 g−1) and supercapacitance (441 F g−1) for this class of materials have been achieved.

  9. Volumes, Masses, and Surface Areas for Shippingport LWBR Spent Nuclear Fuel in a DOE SNF Canister

    International Nuclear Information System (INIS)

    J.W. Davis


    The purpose of this calculation is to estimate volumes, masses, and surface areas associated with (a) an empty Department of Energy (DOE) 18-inch diameter, 15-ft long spent nuclear fuel (SNF) canister, (b) an empty DOE 24-inch diameter, 15-ft long SNF canister, (c) Shippingport Light Water Breeder Reactor (LWBR) SNF, and (d) the internal basket structure for the 18-in. canister that has been designed specifically to accommodate Seed fuel from the Shippingport LWBR. Estimates of volumes, masses, and surface areas are needed as input to structural, thermal, geochemical, nuclear criticality, and radiation shielding calculations to ensure the viability of the proposed disposal configuration

  10. Dye-Sensitized Solar Cells Based on High Surface Area Nanocrystalline Zinc Oxide Spheres

    Directory of Open Access Journals (Sweden)

    Pavuluri Srinivasu


    Full Text Available High surface area nanocrystalline zinc oxide material is fabricated using mesoporous nanostructured carbon as a sacrificial template through combustion process. The resulting material is characterized by XRD, N2 adsorption, HR-SEM, and HR-TEM. The nitrogen adsorption measurement indicates that the materials possess BET specific surface area ca. 30 m2/g. Electron microscopy images prove that the zinc oxide spheres possess particle size in the range of 0.12 μm–0.17 μm. The nanocrystalline zinc oxide spheres show 1.0% of energy conversion efficiency for dye-sensitized solar cells.

  11. A process to enhance the specific surface area and capacitance of hydrothermally reduced graphene oxide

    KAUST Repository

    Alazmi, Amira; El Tall, Omar; Rasul, Shahid; Hedhili, Mohamed N.; Patole, Shashikant P.; Da Costa, Pedro M. F. J.


    The impact of post-synthesis processing in reduced graphene oxide materials for supercapacitor electrodes has been analyzed. A comparative study of vacuum, freeze and critical point drying was carried out for hydrothermally reduced graphene oxide demonstrating that the optimization of the specific surface area and preservation of the porous network are critical to maximize its supercapacitance performance. As described below, using a supercritical fluid as the drying medium, unprecedented values of the specific surface area (364 m2 g−1) and supercapacitance (441 F g−1) for this class of materials have been achieved.

  12. Description of surface systems. Preliminary site description Simpevarp sub area - Version 1.2

    Energy Technology Data Exchange (ETDEWEB)

    Lindborg, Tobias [ed.


    Swedish Nuclear Fuel and Waste Management Co is currently conducting site characterisation in the Simpevarp area. The area is divided into two subareas, the Simpevarp and the Laxemar subarea. The two subareas are surrounded by a common regional model area, the Simpevarp area. This report describes both the regional area and the subareas. This report is an interim version (model version 1.2) of the description of the surface systems at the Simpevarp area, and should be seen as a background report to the site description of the Simpevarp area, version 1.2, SKB-R--05-08. The basis for this description is quality-assured field data available in the SKB SICADA and GIS databases, together with generic data from the literature. The Surface system, here defined as everything above the bedrock, comprises a number of separate disciplines (e.g. hydrology, geology, topography, oceanography and ecology). Each discipline has developed descriptions and models for a number of properties that together represent the site description. The current methodology for developing the surface system description and the integration to ecosystem models is documented in a methodology strategy report SKB-R--03-06. The procedures and guidelines given in that report were followed in this report. Compared with version 1.1 of the surface system description SKB-R--04-25, this report presents considerable additional features, especially in the ecosystem description (Chapter 4) and in the description of the surface hydrology (Section 3.4). A first attempt has also been made to connect the flow of matter (carbon) between the different ecosystems into an overall ecosystem model at a landscape level. A summarised version of this report is also presented in SKB-R--05-08 together with geological-, hydrogeological-, transport properties-, thermal properties-, rock mechanics- and hydrogeochemical descriptions.

  13. Is the planum temporale surface area a marker of hemispheric or regional language lateralization? (United States)

    Tzourio-Mazoyer, Nathalie; Crivello, Fabrice; Mazoyer, Bernard


    We investigated the association between the left planum temporale (PT) surface area or asymmetry and the hemispheric or regional functional asymmetries during language production and perception tasks in 287 healthy adults (BIL&GIN) who were matched for sex and handedness. The measurements of the PT surface area were performed after manually delineating the region using brain magnetic resonance images (MRI) and considering the Heschl's gyrus (HG) duplication pattern; the measurements either included (PT tot ) or did not include (PT post ) the second gyrus. A region encompassing both the PT and HG (HGPT) was also studied. Regardless of the ROI measured, 80% of the sample had a positive left minus right PT asymmetry. We first tested whether the PT tot , PT post and HGPT surface areas in the left or right hemispheres or PT asymmetries differed in groups of individuals varying in language lateralization by assessing their hemispheric index during a sentence production minus word list production task. We then investigated the association between these different measures of the PT anatomy and the regional asymmetries measured during the task. Regardless of the anatomical definition used, we observed no correlations between the left surface areas or asymmetries and the hemispheric or regional functional asymmetries during the language production task. We then performed a similar analysis using the same sample measuring language functional lateralization during speech listening tasks (i.e., listening to sentences and lists of words). Although the hemispheric lateralization during speech listening was not correlated with the left PT tot , PT post or HGPT surface areas or the PT asymmetries, significant positive correlations were observed between the asymmetries in these regions and the regional functional asymmetries measured in areas adjacent to the end of the Sylvian fissure while participants listened to the word lists or sentences. The PT asymmetry thus appears to be

  14. Description of surface systems. Preliminary site description Simpevarp sub area - Version 1.2

    International Nuclear Information System (INIS)

    Lindborg, Tobias


    Swedish Nuclear Fuel and Waste Management Co is currently conducting site characterisation in the Simpevarp area. The area is divided into two subareas, the Simpevarp and the Laxemar subarea. The two subareas are surrounded by a common regional model area, the Simpevarp area. This report describes both the regional area and the subareas. This report is an interim version (model version 1.2) of the description of the surface systems at the Simpevarp area, and should be seen as a background report to the site description of the Simpevarp area, version 1.2, SKB-R--05-08. The basis for this description is quality-assured field data available in the SKB SICADA and GIS databases, together with generic data from the literature. The Surface system, here defined as everything above the bedrock, comprises a number of separate disciplines (e.g. hydrology, geology, topography, oceanography and ecology). Each discipline has developed descriptions and models for a number of properties that together represent the site description. The current methodology for developing the surface system description and the integration to ecosystem models is documented in a methodology strategy report SKB-R--03-06. The procedures and guidelines given in that report were followed in this report. Compared with version 1.1 of the surface system description SKB-R--04-25, this report presents considerable additional features, especially in the ecosystem description (Chapter 4) and in the description of the surface hydrology (Section 3.4). A first attempt has also been made to connect the flow of matter (carbon) between the different ecosystems into an overall ecosystem model at a landscape level. A summarised version of this report is also presented in SKB-R--05-08 together with geological-, hydrogeological-, transport properties-, thermal properties-, rock mechanics- and hydrogeochemical descriptions

  15. Roles of surface water areas for water and solute cycle in Hanoi city, Viet Nam (United States)

    Hayashi, Takeshi; Kuroda, Keisuke; Do Thuan, An; Tran Thi Viet, Nga; Takizawa, Satoshi


    Hanoi city, the capital of Viet Nam, has developed beside the Red river. Recent rapid urbanization of this city has reduced a large number of natural water areas such as lakes, ponds and canals not only in the central area but the suburban area. Contrary, the urbanization has increased artificial water areas such as pond for fish cultivation and landscaping. On the other hand, the urbanization has induced the inflow of waste water from households and various kinds of factories to these water areas because of delay of sewerage system development. Inflow of the waste water has induced eutrophication and pollution of these water areas. Also, there is a possibility of groundwater pollution by infiltration of polluted surface water. However, the role of these water areas for water cycle and solute transport is not clarified. Therefore, this study focuses on the interaction between surface water areas and groundwater in Hanoi city to evaluate appropriate land development and groundwater resource management. We are carrying out three approaches: a) understanding of geochemical characteristics of surface water and groundwater, b) monitoring of water levels of pond and groundwater, c) sampling of soil and pond sediment. Correlation between d18O and dD of precipitation (after GNIP), the Red River (after GNIR) and the water samples of this study showed that the groundwater is composed of precipitation, the Red River and surface water that has evaporation process. Contribution of the surface water with evaporation process was widely found in the study area. As for groundwater monitoring, the Holocene aquifers at two sites were in unconfined condition in dry season and the groundwater levels in the aquifer continued to increase through rainy season. The results of isotopic analysis and groundwater level monitoring showed that the surface water areas are one of the major groundwater sources. On the other hand, concentrations of dissolved Arsenic (filtered by 0.45um) in the pore

  16. High Surface Area of Porous Silicon Drives Desorption of Intact Molecules (United States)

    Northen, Trent R.; Woo, Hin-Koon; Northen, Michael T.; Nordström, Anders; Uritboonthail, Winnie; Turner, Kimberly L.; Siuzdak, Gary


    The surface structure of porous silicon used in desorption/ionization on porous silicon (DIOS) mass analysis is known to play a primary role in the desorption/ionization (D/I) process. In this study, mass spectrometry and scanning electron microscopy (SEM) are used to examine the correlation between intact ion generation with surface ablation, and surface morphology. The DIOS process is found to be highly laser energy dependent and correlates directly with the appearance of surface ions (Sin+ and OSiH+). A threshold laser energy for DIOS is observed (10 mJ/cm2), which supports that DIOS is driven by surface restructuring and is not a strictly thermal process. In addition, three DIOS regimes are observed which correspond to surface restructuring and melting. These results suggest that higher surface area silicon substrates may enhance DIOS performance. A recent example which fits into this mechanism is silicon nanowires surface which have a high surface energy and concomitantly requires lower laser energy for analyte desorpton. PMID:17881245

  17. Surface activity of lipid extract surfactant in relation to film area compression and collapse. (United States)

    Schürch, S; Schürch, D; Curstedt, T; Robertson, B


    The physical properties of modified porcine surfactant (Curosurf), isolated from minced lungs by extraction with chloroform-methanol and further purified by liquid-gel chromatography, were investigated with the captive bubble technique. Bubble size, and thus the surface tension of an insoluble film at the bubble surface, is altered by changing the pressure within the closed bubble chamber. The film surface tension and area are determined from the shape (height and diameter) of the bubble. Adsorption of fresh Curosurf is characterized by stepwise decreases in surface tension, which can easily be observed by sudden quick movements of the bubble apex. These "adsorption clicks" imply a cooperative movement of large collective units of molecules, approximately 10(14) (corresponding to approximately 120 ng of phospholipid) or approximately 10(18) molecules/m2, into the interface during adsorption. Films formed in this manner are already highly enriched in dipalmitoyl phosphatidylcholine, as seen by the extremely low compressibility, close to that of dipalmitoyl phosphatidylcholine. Near-zero minimum tensions are obtained, even at phospholipid concentrations as low as 50 micrograms/ml. During dynamic cycling (20-50 cycles/min), low minimum surface tensions, good film stability, low compressibility, and maximum surface tensions between 30 and 40 mN/m are possible only if the films are not overcompressed near zero surface tension; i.e., the overall film area compression should not substantially exceed 30%.

  18. Model-Atmosphere Spectra of Central Stars of Planetary Nebulae - Access via the Virtual Observatory Service TheoSSA (United States)

    Rauch, T.; Reindl, N.


    In the framework of the Virtual Observatory (VO), the German Astrophysical Virtual Observatory GAVO project provides easy access to theoretical spectral energy distributions (SEDs) within the registered GAVO service TheoSSA ( TheoSSA is based on the well established Tübingen NLTE Model-Atmosphere Package (TMAP) for hot, compact stars. This includes central stars of planetary nebulae. We show examples of TheoSSA in operation.

  19. Surface area and the seabed area, volume, depth, slope, and topographic variation for the world's seas, oceans, and countries. (United States)

    Costello, Mark John; Cheung, Alan; De Hauwere, Nathalie


    Depth and topography directly and indirectly influence most ocean environmental conditions, including light penetration and photosynthesis, sedimentation, current movements and stratification, and thus temperature and oxygen gradients. These parameters are thus likely to influence species distribution patterns and productivity in the oceans. They may be considered the foundation for any standardized classification of ocean ecosystems and important correlates of metrics of biodiversity (e.g., species richness and composition, fisheries). While statistics on ocean depth and topography are often quoted, how they were derived is rarely cited, and unless calculated using the same spatial resolution the resulting statistics will not be strictly comparable. We provide such statistics using the best available resolution (1-min) global bathymetry, and open source digital maps of the world's seas and oceans and countries' Exclusive Economic Zones, using a standardized methodology. We created a terrain map and calculated sea surface and seabed area, volume, and mean, standard deviation, maximum, and minimum, of both depth and slope. All the source data and our database are freely available online. We found that although the ocean is flat, and up to 71% of the area has a ocean volume exceeds 1.3 billion km(3) (or 1.3 sextillion liters), and sea surface and seabed areas over 354 million km(2). We propose the coefficient of variation of slope as an index of topographic heterogeneity. Future studies may improve on this database, for example by using a more detailed bathymetry, and in situ measured data. The database could be used to classify ocean features, such as abyssal plains, ridges, and slopes, and thus provide the basis for a standards based classification of ocean topography.

  20. Changing surface-atmosphere energy exchange and refreezing capacity of the lower accumulation area, West Greenland (United States)

    Charalampidis, C.; van As, D.; Box, J. E.; van den Broeke, M. R.; Colgan, W. T.; Doyle, S. H.; Hubbard, A. L.; MacFerrin, M.; Machguth, H.; Smeets, C. J. P. P.


    We present 5 years (2009-2013) of automatic weather station measurements from the lower accumulation area (1840 m a.s.l. - above sea level) of the Greenland ice sheet in the Kangerlussuaq region. Here, the summers of 2010 and 2012 were both exceptionally warm, but only 2012 resulted in a strongly negative surface mass budget (SMB) and surface meltwater run-off. The observed run-off was due to a large ice fraction in the upper 10 m of firn that prevented meltwater from percolating to available pore volume below. Analysis reveals an anomalously low 2012 summer-averaged albedo of 0.71 (typically ~ 0.78), as meltwater was present at the ice sheet surface. Consequently, during the 2012 melt season, the ice sheet surface absorbed 28 % (213 MJ m-2) more solar radiation than the average of all other years. A surface energy balance model is used to evaluate the seasonal and interannual variability of all surface energy fluxes. The model reproduces the observed melt rates as well as the SMB for each season. A sensitivity analysis reveals that 71 % of the additional solar radiation in 2012 was used for melt, corresponding to 36 % (0.64 m) of the 2012 surface lowering. The remaining 64 % (1.14 m) of surface lowering resulted from high atmospheric temperatures, up to a +2.6 °C daily average, indicating that 2012 would have been a negative SMB year at this site even without the melt-albedo feedback. Longer time series of SMB, regional temperature, and remotely sensed albedo (MODIS) show that 2012 was the first strongly negative SMB year, with the lowest albedo, at this elevation on record. The warm conditions of recent years have resulted in enhanced melt and reduction of the refreezing capacity in the lower accumulation area. If high temperatures continue, the current lower accumulation area will turn into a region with superimposed ice in coming years.

  1. Changes in thickness and surface area of the human cortex and their relationship with intelligence. (United States)

    Schnack, Hugo G; van Haren, Neeltje E M; Brouwer, Rachel M; Evans, Alan; Durston, Sarah; Boomsma, Dorret I; Kahn, René S; Hulshoff Pol, Hilleke E


    Changes in cortical thickness over time have been related to intelligence, but whether changes in cortical surface area are related to general cognitive functioning is unknown. We therefore examined the relationship between intelligence quotient (IQ) and changes in cortical thickness and surface over time in 504 healthy subjects. At 10 years of age, more intelligent children have a slightly thinner cortex than children with a lower IQ. This relationship becomes more pronounced with increasing age: with higher IQ, a faster thinning of the cortex is found over time. In the more intelligent young adults, this relationship reverses so that by the age of 42 a thicker cortex is associated with higher intelligence. In contrast, cortical surface is larger in more intelligent children at the age of 10. The cortical surface is still expanding, reaching its maximum area during adolescence. With higher IQ, cortical expansion is completed at a younger age; and once completed, surface area decreases at a higher rate. These findings suggest that intelligence may be more related to the magnitude and timing of changes in brain structure during development than to brain structure per se, and that the cortex is never completed but shows continuing intelligence-dependent development. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail:

  2. Surface runoff from urban areas. New aspects; Neue Aspekte in der Behandlung von Siedlungsabfluessen

    Energy Technology Data Exchange (ETDEWEB)

    Fuchs, Stephan [Karlsruher Institut fuer Technologie (KIT), Karlsruhe (Germany). Bereich Siedlungswasserwirtschaft und Wasserguetewirtschaft; Lambert, Benedikt [Bioplan Landeskulturgesellschaft, Sinsheim (Germany); Grotehusmann, Dieter [Ingenieurgesellschaft fuer Stadthydrologie, Hannover (Germany)


    The surface runoff from urban areas is one of the most important sources of pollutants emitted into surface waters. Suspended solids which act as a transport vehicle for many anthropogenic pollutants (e. g. heavy metals, PAH) are a key factor in this regard. The development of efficient measures of storm water runoff treatment thus requires a further differentiation of suspended solids in a fine (clay and silt) and coarse (sand and gravel) fraction. Both fractions show distinctly different characteristics in pollutant loading, transport and retention on urban surfaces and sewer systems. The primary aim of storm water runoff treatment is the reduction of the fine particles which are always highly loaded with anthropogenic pollutants. In contrast the coarse particles are almost unpolluted especially if they have a low organic share. The widespread sedimentation tanks with surface loadings between 10 and 2 m/h are very inefficient. A significant, save and lasting reduction of the emitted load of fine particles requires a considerable reduction of the surface loads. That can be achieved with the installation of lamellar settler or the utilization of the very large volumes of flood management tanks frequently present in urban areas. Filtration plants are highly efficient but there application in urban areas is limited due to their high space demands. (orig.)

  3. Ambient pressure dried tetrapropoxysilane-based silica aerogels with high specific surface area (United States)

    Parale, Vinayak G.; Han, Wooje; Jung, Hae-Noo-Ree; Lee, Kyu-Yeon; Park, Hyung-Ho


    In the present paper, we report the synthesis of tetrapropoxysilane (TPOS)-based silica aerogels with high surface area and large pore volume. The silica aerogels were prepared by a two-step sol-gel process followed by surface modification via a simple ambient pressure drying approach. In order to minimize drying shrinkage and obtain hydrophobic aerogels, the surface of the alcogels was modified using trichloromethylsilane as a silylating agent. The effect of the sol-gel compositional parameters on the polymerization of aerogels prepared by TPOS, one of the precursors belonging to the Si(OR)4 family, was reported for the first time. The oxalic acid and NH4OH concentrations were adjusted to achieve good-quality aerogels with high surface area, low density, and high transparency. Controlling the hydrolysis and condensation reactions of the TPOS precursor turned out to be the most important factor to determine the pore characteristics of the aerogel. Highly transparent aerogels with high specific surface area (938 m2/g) and low density (0.047 g/cm3) could be obtained using an optimized TPOS/MeOH molar ratio with appropriate concentrations of oxalic acid and NH4OH.

  4. Impact of microstructure evolution on the difference between geometric and reactive surface areas in natural chalk (United States)

    Yang, Y.; Bruns, S.; Stipp, S. L. S.; Sørensen, H. O.


    The coupling between flow and mineral dissolution drives the evolution of many natural and engineered flow systems. Pore surface changes as microstructure evolves but this transient behaviour has traditionally been difficult to model. We combined a reactor network model with experimental, greyscale tomography data to establish the morphological grounds for differences among geometric, reactive and apparent surface areas in dissolving chalk. This approach allowed us to study the effects of initial geometry and macroscopic flow rate independently. The simulations showed that geometric surface, which represents a form of local transport heterogeneity, increases in an imposed flow field, even when the porous structure is chemically homogeneous. Hence, the fluid-reaction coupling leads to solid channelisation, which further results in fluid focusing and an increase in geometric surface area. Fluid focusing decreases the area of reactive surface and the residence time of reactant, both contribute to the over-normalisation of reaction rate. In addition, the growing and merging of microchannels, near the fluid entrance, contribute to the macroscopic, fast initial dissolution rate of rocks.

  5. Quality of surface-water supplies in the Triangle area of North Carolina, water year 2008 (United States)

    Giorgino, M.J.; Rasmussen, R.B.; Pfeifle, C.A.


    Surface-water supplies are important sources of drinking water for residents in the Triangle area of North Carolina, which is located within the upper Cape Fear and Neuse River Basins. Since 1988, the U.S. Geological Survey and a consortium of governments have tracked water-quality conditions and trends in several of the area's water-supply lakes and streams. This report summarizes data collected through this cooperative effort, known as the Triangle Area Water Supply Monitoring Project, during October 2007 through September 2008. Major findings for this period include:

  6. Aggregate surface areas quantified through laser measurements for South African asphalt mixtures

    CSIR Research Space (South Africa)

    Anochie-Boateng, Joseph


    Full Text Available design. This paper introduces the use of a three-dimensional (3D) laser scanning method to directly measure the surface area of aggregates used in road pavements in South Africa. As an application of the laser-based measurements, the asphalt film...

  7. Uncovering surface area and micropores in almond shell biochars by rainwater wash (United States)

    Biochars have been considered for adsorption of contaminants in soil and water, as well as conditioning and improving soil quality. One important property of the biochar is surface area in the pores of the biochar. Biochars were created from almond shells from two almond varieties with different ash...

  8. Specific surface area behavior of a dissolving population of particles. Augmenting Mercer Dissolution Theory

    International Nuclear Information System (INIS)

    Scripsick, R.C.; Rothenberg, S.J.


    Specific surface area (Sp) measurements were made on two uranium oxide aerosol materials before and after in vitro dissolution studies were performed on the materials. The results of these Sp measurements were evaluated relative to predictions made from extending Mercer dissolution theory to describe the Sp behavior of a dissolving population of particles

  9. An empirical method for estimating surface area of aggregates in hot mix asphalt

    Directory of Open Access Journals (Sweden)

    R.P. Panda


    Full Text Available Bitumen requirement in hot mix asphalt (HMA is directly dependent on the surface area of the aggregates in the mix, which in turn has effect on the asphalt film thickness and the flow characteristics. The surface area of aggregate blend in HMA is calculated using the specific surface area factors assigned to percentage passing through some specific standard sieve sizes and the imaging techniques. The first process is less capital intensive, but purely manual and labour intensive and prone to human errors. Imaging techniques though eliminating the human errors, still have limited use due to capital intensiveness and requirement of well-established laboratories with qualified technicians. Most of the developing countries like India are shortage of well-equipped laboratories and qualified technicians. To overcome these difficulties, the present mathematical model has been developed to estimate the surface area of aggregate blend of HMA from physical properties of aggregates evaluated using simple laboratory equipment. This model has been validated compared with the existing established methods of calculations and can be used as one of the tools in different developing and under developed countries for proper design of HMA.

  10. Developing Open-Ended Questions for Surface Area and Volume of Beam (United States)

    Kurniawan, Henry; Putri, Ratu Ilma Indra; Hartono, Yusuf


    The purpose of this research was to show open-ended questions about surface area and beam volume which valid and practice, have potential effect. This research is research development which consists of two main phases: preliminary phase (preparation phase and problem design) and formative evaluation phase (evaluation and revision phases). The…

  11. Flow analysis of water-powder mixtures: Application to specific surface area and shape factor

    NARCIS (Netherlands)

    Hunger, M.; Brouwers, H.J.H.


    This paper addresses the characterization of powder materials with respect to their application in concrete. Given that powders provide by far highest percentage of specific surface area in a concrete mix, their packing behavior and water demand is of vital interest for the design of concrete. They

  12. Flow analysis of water-powder mixtures : Application to specific surface area and shape factor

    NARCIS (Netherlands)

    Hunger, M.; Brouwers, H.J.H.


    This paper addresses the characterization of powder materials with respect to their application in concrete. Given that powders provide by far highest percentage of specific surface area in a concrete mix, their packing behavior and water demand is of vital interest for the design of concrete. They

  13. Dose banding as an alternative to body surface area-based dosing of chemotherapeutic agents

    NARCIS (Netherlands)

    E. Chatelut (Etienne); M.L. White-Koning (M.); A.H.J. Mathijssen (Ron); F. Puisset (F.); S.D. Baker (Sharyn); A. Sparreboom (Alex)


    textabstractBackground: Dose banding is a recently suggested dosing method that uses predefined ranges (bands) of body surface area (BSA) to calculate each patients dose by using a single BSA-value per band. Thus, drugs with sufficient long-term stability can be prepared in advance. The main

  14. Amylolytic hydrolysis of native starch granules affected by granule surface area. (United States)

    Kim, J C; Kong, B W; Kim, M J; Lee, S H


    Initial stage of hydrolysis of native starch granules with various amylolytic enzymes, alpha-amylase from Bacillus subtilis, glucoamylase I (GA-I) and II (GA-II) from Aspergillus niger, and beta-amylase from sweet potato showed that the reaction was apparently affected by a specific surface area of the starch granules. The ratios of the reciprocal of initial velocity of each amylolytic hydrolysis for native potato and maize starch to that for rice with the amylolytic enzymes were nearly equivalent to the ratio of surface area per mass of the 2 starch granules to that of rice, that is, 6.94 and 2.25, respectively. Thus, the reciprocal of initial velocity of each enzymatic hydrolysis as expressed in a Lineweaver-Burk plot was a linear function of the reciprocal of surface area for each starch granule. As a result, it is concluded that amylolytic hydrolysis of native starch granules is governed by the specific surface area, not by the mass concentration, of each granule.

  15. High surface area carbon for bifunctional air electrodes applied in zinc-air batteries

    Energy Technology Data Exchange (ETDEWEB)

    Arai, H [on leave from NTT Laboratories (Japan); Mueller, S; Haas, O [Paul Scherrer Inst. (PSI), Villigen (Switzerland)


    Bifunctional air electrodes with high surface area carbon substrates showed low reduction overpotential, thus are promising for enhancing the energy efficiency and power capability of zinc-air batteries. The improved performance is attributed to lower overpotential due to diffusion of the reaction intermediate, namely the peroxide ion. (author) 1 fig., 2 refs.

  16. Characterization of pigment-leached antifouling coatings using BET surface area measurements and mercury porosimetry

    DEFF Research Database (Denmark)

    Kiil, Søren; Dam-Johansen, Kim


    of antifouling coating behaviour because the active binder surface area and porosity of the leached layer are substantially increased. A similar effect was not observed for a coating with a mixture of ZnO and TiO2 pigments. The two experimental methods are expected to be useful for practical analysis of leaching...

  17. Sensitivity analysis of the surface water- groundwater interaction for the sandy area of the Netherlands

    NARCIS (Netherlands)

    Gomez del Campo, E.; Jousma, G.; Massop, H.T.L.


    The "Sensitivity Analysis of the Surface Water- Groundwater Interaction for the Sandy Area of the Netherlands" was carried out in the framework of a bilateral research project in support of the implementation of a nationwide geohydrological information system (REGIS) in the Netherlands. This

  18. Preparation of MgO Catalytic Support in Shaped Mesoporous High Surface Area Form

    Czech Academy of Sciences Publication Activity Database

    Gulková, Daniela; Šolcová, Olga; Zdražil, Miroslav


    Roč. 76, 1-3 (2004), s. 137-149 ISSN 1387-1811 R&D Projects: GA AV ČR IAA4072306 Institutional research plan: CEZ:AV0Z4072921 Keywords : MgO support * sigh Surface area * texture Subject RIV: CC - Organic Chemistry Impact factor: 2.093, year: 2004

  19. Escaping the correction for body surface area when calculating glomerular filtration rate in children

    International Nuclear Information System (INIS)

    Piepsz, Amy; Tondeur, Marianne; Ham, Hamphrey


    51 Cr ethylene diamine tetraacetic acid ( 51 Cr EDTA) clearance is nowadays considered as an accurate and reproducible method for measuring glomerular filtration rate (GFR) in children. Normal values in function of age, corrected for body surface area, have been recently updated. However, much criticism has been expressed about the validity of body surface area correction. The aim of the present paper was to present the normal GFR values, not corrected for body surface area, with the associated percentile curves. For that purpose, the same patients as in the previous paper were selected, namely those with no recent urinary tract infection, having a normal left to right 99m Tc MAG3 uptake ratio and a normal kidney morphology on the early parenchymal images. A single blood sample method was used for 51 Cr EDTA clearance measurement. Clearance values, not corrected for body surface area, increased progressively up to the adolescence. The percentile curves were determined and allow, for a single patient, to estimate accurately the level of non-corrected clearance and the evolution with time, whatever the age. (orig.)

  20. Allometric relationships for surface area and dry mass of young Norway spruce aboveground organs

    Czech Academy of Sciences Publication Activity Database

    Pokorný, Radek; Tomášková, Ivana

    53 2007, č. 12 (2007), s. 548-554 ISSN 1212-4834 R&D Projects: GA MŽP(CZ) SP/2D1/93/07 Institutional research plan: CEZ:AV0Z60870520 Keywords : allometry * biomass, * Picea abies * sapwood * surface area Subject RIV: GK - Forestry

  1. Proportional Reasoning Ability and Concepts of Scale: Surface Area to Volume Relationships in Science (United States)

    Taylor, Amy; Jones, Gail


    The "National Science Education Standards" emphasise teaching unifying concepts and processes such as basic functions of living organisms, the living environment, and scale. Scale influences science processes and phenomena across the domains. One of the big ideas of scale is that of surface area to volume. This study explored whether or not there…

  2. Should blood flow during cardiopulmonary bypass be individualized more than to body surface area?

    DEFF Research Database (Denmark)

    Thomassen, Sisse Anette; Larsson, A; Andreasen, Jan Jesper

    Blood flow during cardiopulmonary bypass (CPB) is calculated on body surface area (BSA). Increasing comorbidity, age and weight of today's cardiac patients question this calculation as it may not reflect individual metabolic requirement. The hypothesis was that a measured cardiac index (CI) prior...

  3. Escaping the correction for body surface area when calculating glomerular filtration rate in children

    Energy Technology Data Exchange (ETDEWEB)

    Piepsz, Amy; Tondeur, Marianne [CHU St. Pierre, Department of Radioisotopes, Brussels (Belgium); Ham, Hamphrey [University Hospital Ghent, Department of Nuclear Medicine, Ghent (Belgium)


    {sup 51}Cr ethylene diamine tetraacetic acid ({sup 51}Cr EDTA) clearance is nowadays considered as an accurate and reproducible method for measuring glomerular filtration rate (GFR) in children. Normal values in function of age, corrected for body surface area, have been recently updated. However, much criticism has been expressed about the validity of body surface area correction. The aim of the present paper was to present the normal GFR values, not corrected for body surface area, with the associated percentile curves. For that purpose, the same patients as in the previous paper were selected, namely those with no recent urinary tract infection, having a normal left to right {sup 99m}Tc MAG3 uptake ratio and a normal kidney morphology on the early parenchymal images. A single blood sample method was used for {sup 51}Cr EDTA clearance measurement. Clearance values, not corrected for body surface area, increased progressively up to the adolescence. The percentile curves were determined and allow, for a single patient, to estimate accurately the level of non-corrected clearance and the evolution with time, whatever the age. (orig.)

  4. Area densitometry using rotating Scheimpflug photography for posterior capsule opacification and surface light scattering analyses. (United States)

    Minami, Keiichiro; Honbo, Masato; Mori, Yosai; Kataoka, Yasushi; Miyata, Kazunori


    To compare area densitometry analysis using rotating Scheimpflug photography in quantifications of posterior capsule opacification (PCO) and surface light scattering with previous anterior-segment analyzer measurement. Miyata Eye Hospital, Miyazaki, Japan. Prospective observational case series. Scheimpflug images of eyes with foldable intraocular lenses (IOLs) were obtained using rotating and fixed Scheimpflug photography. Area densitometry on the posterior and anterior surfaces was conducted for PCO and surface light scattering analyses, respectively, with an identical area size. Correlation between two measurements was analyzed using linear regression. The study included 105 eyes of 74 patients who received IOLs 1 to 18 years (mean, 4.9 ± 4.5 years) postoperatively. In the PCO analysis on the posterior IOL surface, there was a significant correlation between the two measurements (P photography exhibited saturation due to intensive scatterings. Area densitometry combined with a rotating Scheimpflug photography was exchangeable to previously established densitometry measurement, and allowed successive evaluation in longer-term observations. Copyright © 2015 ASCRS and ESCRS. Published by Elsevier Inc. All rights reserved.

  5. Surface area of lactose and lactose granulates on consolidation and compaction

    NARCIS (Netherlands)

    Riepma, Klaas Alouis


    This dissertation discusses the effect of short time storage at different conditions on the strength and the specific BET surface area of lactose tablets. In addition, some aspects are studied of the consolidation and compaction properties of crystalline lactose fractions in heterogeneous systems.

  6. Turbostratic boron nitride coated on high-surface area metal oxide templates

    DEFF Research Database (Denmark)

    Klitgaard, Søren Kegnæs; Egeblad, Kresten; Brorson, M.


    Boron nitride coatings on high-surface area MgAl2O4 and Al2O3 have been synthesized and characterized by transmission electron microscopy and by X-ray powder diffraction. The metal oxide templates were coated with boron nitride using a simple nitridation in a flow of ammonia starting from ammonium...

  7. Oscillations of centroid position and surface area of soccer teams in small-sided games

    NARCIS (Netherlands)

    Frencken, Wouter; Lemmink, Koen; Delleman, Nico; Visscher, Chris


    There is a need for a collective variable that captures the dynamics of team sports like soccer at match level. The centroid positions and surface areas of two soccer teams potentially describe the coordinated flow of attacking and defending in small-sided soccer games at team level. The aim of the

  8. Surface water and groundwater interaction in selected areas of Indus basin

    International Nuclear Information System (INIS)

    Akram, W.; Ahmad, M.; Tariq, J.A.; Latif, Z.; Malik, M.R.


    Isotope hydrological investigations were carried out in Marala-Khanki Area of Punjab for elucidating various aspects of surface water and groundwater interaction. Groundwater samples were collected on seasonal basis (low and high river discharge periods) while surface water (Chenab River) samples were collected more frequently (weekly or monthly basis). Isotopic data suggested that there is no significant contribution of surface water to groundwater recharge in Marala-Khanki Area and rain is the prevailing source of groundwater recharge. The data further revealed that isotopic values of Tarbala lake are higher than those of main lake. Indus river meaning that there is significant contribution of base flow in this pocket. Isotopic data of Indus river showed an increase at Tunsa as compared to Chashma in flow period indicating the high contribution of base flow at this point in time. Stable isotopes were successfully used to quantify the base flow contribution. (author)

  9. Effect of high surface area activated carbon on thermal degradation of jet fuel

    Energy Technology Data Exchange (ETDEWEB)

    Gergova, K.; Eser, S.; Arumugam, R.; Schobert, H.H. [Pennsylvania State Univ., University Park, PA (United States)


    Different solid carbons added to jet fuel during thermal stressing cause substantial changes in pyrolytic degradation reactions. Activated carbons, especially high surface area activated carbons were found to be very effective in suppressing solid deposition on metal reactor walls during stressing at high temperatures (425 and 450{degrees}C). The high surface area activated carbon PX-21 prevented solid deposition on reactor walls even after 5h at 450{degrees}C. The differences seen in the liquid product composition when activated carbon is added indicated that the carbon surfaces affect the degradation reactions. Thermal stressing experiments were carried out on commercial petroleum-derived JPTS jet fuel. We also used n-octane and n-dodecane as model compounds in order to simplify the study of the chemical changes which take place upon activated carbon addition. In separate experiments, the presence of a hydrogen donor, decalin, together with PX-21 was also studied.

  10. A Three-Dimensional Enormous Surface Area Aluminum Microneedle Array with Nanoporous Structure

    Directory of Open Access Journals (Sweden)

    Po Chun Chen


    Full Text Available We proposed fabricating an aluminum microneedle array with a nanochannel structure on the surface by combining micromachining, electrolyte polishing, and anodization methods. The microneedle array provides a three-dimensional (3D structure that possesses several hundred times more surface area than a traditional nanochannel template. Therefore, the microneedle array can potentially be used in many technology applications. This 3D microneedle array device can not only be used for painless injection or extraction, but also for storage, highly sensitive detection, drug delivery, and microelectrodes. From the calculation we made, the microneedle array not only increases surface area, but also enlarges the capacity of the device. Therefore, the microneedle array can further be used on many detecting, storing, or drug delivering applications.

  11. A Three-Dimensional Enormous Surface Area Aluminum Microneedle Array with Nanoporous Structure

    International Nuclear Information System (INIS)

    Chen, P.Ch.; Zou, J.; Hsieh, Sh.J.; Chen, Ch.Ch.


    We proposed fabricating an aluminum micro needle array with a nano channel structure on the surface by combining micromachining, electrolyte polishing, and anodization methods. The micro needle array provides a three-dimensional (3D) structure that possesses several hundred times more surface area than a traditional nano channel template. Therefore, the micro needle array can potentially be used in many technology applications. This 3D micro needle array device can not only be used for painless injection or extraction, but also for storage, highly sensitive detection, drug delivery, and microelectrodes. From the calculation we made, the micro needle array not only increases surface area, but also enlarges the capacity of the device. Therefore, the micro needle array can further be used on many detecting, storing, or drug delivering applications.

  12. MELiSSA celebrates 25 years of research into life support

    International Nuclear Information System (INIS)


    MELiSSA (Micro-Ecological Life Support System Alternative) is a collaborative project with the European Space Agency ESA and various other scientific partners. The objective of MELiSSA is to develop a system that is able to provide manned space missions with food, drinking water and oxygen autonomously in space. Drinkable water and oxygen are currently being made in the international space station ISS by filtering waste water and by electrolysing water. However, such physiochemical technologies do not offer a solution for food. The MELiSSA project intends to reuse waste products, which include CO2, water, stools and urine from the astronauts, and even the perspiration moisture in the cabin and to transfer these into food through the use of micro-organisms.

  13. Investigation on large-area fabrication of vivid shark skin with superior surface functions (United States)

    Chen, Huawei; Zhang, Xin; Ma, Lingxi; Che, Da; Zhang, Deyuan; Sudarshan, T. S.


    Shark skin has attracted worldwide attention because of its superior drag reduction, antifouling performance induced from its unique surface morphology. Although the vivid shark skin has been fabricated by a bio-replicated micro-imprinting approach in previous studies and superior drag reduction effect has been validated in water tunnel, continuous large-area fabrication is still an obstacle to wide apply. In this paper, one novel bio-replication coating technology is proposed for large-area transfer of shark skin based on rapid UV curable paint. Apart from design of coating system, bio-replication accuracy of surface morphology was validated about 97% by comparison between shark skin template and coating surface morphology. Finally, the drag reduction and anti-fouling function of coating surface were tested in water tunnel and open algae pond respectively. Drag reduction rate of coating surface was validated about 12% higher and anti-fouling was proved to about hundred times ameliorate, all of which are more excellent than simple 2D riblet surface.

  14. Study of LiFePO{sub 4} cathode materials coated with high surface area carbon

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Cheng-Zhang; Fey, George Ting-Kuo [Department of Chemical and Materials Engineering, National Central University, Chung-Li 32054 (China); Kao, Hsien-Ming [Department of Chemistry, National Central University, Chung-Li 32054 (China)


    LiFePO{sub 4} is a potential cathode material for 4 V lithium-ion batteries. Carbon-coated lithium iron phosphates were prepared using a high surface area carbon to react precursors through a solid-state process, during which LiFePO{sub 4} particles were embedded in amorphous carbon. The carbonaceous materials were synthesized by the pyrolysis of peanut shells under argon, where they were carbonized in a two-step process that occurred between 573 and 873 K. The shells were also treated with a proprietary porogenic agent with the goal of altering the pore structure and surface area of the pyrolysis products. The electrochemical properties of the as-prepared LiFePO{sub 4}/C composite cathode materials were systematically characterized by X-ray diffraction, scanning electron microscope, element mapping, energy dispersive spectroscopy, Raman spectroscopy, and total organic carbon (TOC) analysis. In LiFePO{sub 4}/C composites, the carbon not only increases rate capability, but also stabilizes capacity. In fact, the capacity of the composites increased with the specific surface area of carbon. The best result was observed with a composite made of 8.0 wt.% with a specific surface area of 2099 m{sup 2} g{sup -1}. When high surface area carbon was used as a carbon source to produce LiFePO{sub 4}, overall conductivity increased from 10{sup -8} to 10{sup -4} S cm{sup -1}, because the inhibition of particle growth during the final sintering process led to greater specific capacity, improved cycling properties and better rate capability compared to a pure olivine LiFePO{sub 4} material. (author)

  15. Comparison of deposited surface area of airborne ultrafine particles generated from two welding processes. (United States)

    Gomes, J F; Albuquerque, P C; Miranda, Rosa M; Santos, Telmo G; Vieira, M T


    This article describes work performed on the assessment of the levels of airborne ultrafine particles emitted in two welding processes metal-active gas (MAG) of carbon steel and friction-stir welding (FSW) of aluminium in terms of deposited area in alveolar tract of the lung using a nanoparticle surface area monitor analyser. The obtained results showed the dependence from process parameters on emitted ultrafine particles and clearly demonstrated the presence of ultrafine particles, when compared with background levels. The obtained results showed that the process that results on the lower levels of alveolar-deposited surface area is FSW, unlike MAG. Nevertheless, all the tested processes resulted in important doses of ultrafine particles that are to be deposited in the human lung of exposed workers.

  16. Location of unaccessible implant surface areas during debridement in simulated peri-implantitis therapy. (United States)

    Steiger-Ronay, Valerie; Merlini, Andrea; Wiedemeier, Daniel B; Schmidlin, Patrick R; Attin, Thomas; Sahrmann, Philipp


    An in vitro model for peri-implantitis treatment was used to identify areas that are clinically difficult to clean by analyzing the pattern of residual stain after debridement with commonly employed instruments. Original data from two previous publications, which simulated surgical (SA) and non-surgical (NSA) implant debridement on two different implant systems respectively, were reanalyzed regarding the localization pattern of residual stains after instrumentation. Two blinded examiners evaluated standardized photographs of 360 initially ink-stained dental implants, which were cleaned at variable defect angulations (30, 60, or 90°), using different instrument types (Gracey curette, ultrasonic scaler or air powder abrasive device) and treatment approaches (SA or NSA). Predefined implant surface areas were graded for residual stain using scores ranging from one (stain-covered) to six (clean). Score differences between respective implant areas were tested for significance by pairwise comparisons using Wilcoxon-rank-sum-tests with a significance level α = 5%. Best scores were found at the machined surface areas (SA: 5.58 ± 0.43, NSA: 4.76 ± 1.09), followed by the tips of the threads (SA: 4.29 ± 0.44, NSA: 4.43 ± 0.61), and areas between threads (SA: 3.79 ± 0.89, NSA: 2.42 ± 1.11). Apically facing threads were most difficult to clean (SA: 1.70 ± 0.92, NSA: 2.42 ± 1.11). Here, air powder abrasives provided the best results. Machined surfaces at the implant shoulder were well accessible and showed least amounts of residual stain. Apically facing thread surfaces constituted the area with most residual stain regardless of treatment approach.

  17. Description of climate, surface hydrology, and near-surface hydrogeology. Preliminary site description. Forsmark area - version 1.2

    International Nuclear Information System (INIS)

    Johansson, Per-Olof; Werner, Kent; Bosson, Emma; Berglund, Sten; Juston, John


    The present report is a background report describing the meteorological conditions and the modelling of surface hydrology and near-surface hydrogeology in support of the Forsmark version 1.2 SDM based on the data available in the Forsmark 1.2 ''data freeze'' (July 31, 2004). The area covered in the conceptual and descriptive modelling is characterised by a low relief and a small-scale topography. Almost the whole area is located below 20 m a s l (metres above sea level). The corrected mean annual precipitation is 600-650 mm and the mean annual evapotranspiration can be estimated to a little more than 400 mm, leaving approximately 200 mm x year-1 for runoff. Till is the dominating Quaternary deposit covering approximately 75% of the area. In most of the area, the till is sandy. Bedrock outcrops are frequent but cover only approximately 5% of the area. Direct groundwater recharge from precipitation is the dominant source of groundwater recharge. The small-scale topography implies that many local, shallow groundwater flow systems are formed in the Quaternary deposits, overlaying more large-scale flow systems associated with groundwater flows at greater depths. Groundwater level time series from wells in till and bedrock within the same areas show a considerably higher groundwater level in the till than in the bedrock. The sediment stratigraphy of lakes and wetlands is crucial for their function as discharge areas for groundwater. Comparisons between measured lake water levels and groundwater levels below and around lakes indicate that the lakes in some cases may act as sources of groundwater recharge. Specifically, observations from Lake Bolundsfjaerden and Lake Eckarfjaerden show that such conditions were at hand during the dry summer of 2003. However, whether the observed water level relations correspond to significant water fluxes depends also on the hydrogeological properties of the lake sediments and the underlying Quaternary deposits. ''Old'' water with high

  18. Do the Asian Drivers undermine the export-oriented industrialisation in SSA?


    Kaplinsky, Raphael; Morris, Mike


    An increase in outward orientation in general, and in export-oriented manufacturing in particular is widely indicated as a suitable developmental path for SSA. The logic for this is drawn both from the demonstration effect of China and the earlier generation of Asian NICs, and from theory. However, the entry of China (and to a lesser extent India) into the global economy as a significant exporter of manufactures poses severe problems for export-oriented growth in SSA. This can be seen from SS...

  19. Spectral Analysis within the Virtual Observatory: The GAVO Service TheoSSA (United States)

    Ringat, E.


    In the last decade, numerous Virtual Observatory organizations were established. One of these is the German Astrophysical Virtual Observatory (GAVO) that e.g. provides access to spectral energy distributions via the service TheoSSA. In a pilot phase, these are based on the Tübingen NLTE Model-Atmosphere Package (TMAP) and suitable for hot, compact stars. We demonstrate the power of TheoSSA in an application to the sdOB primary of AA Doradus by comparison with a “classical” spectral analysis.

  20. Surface area and volume determination of subgingival calculus using laser fluorescence. (United States)

    Shakibaie, Fardad; Walsh, Laurence J


    Visible red (655 nm) laser fluorescence (LF) devices are currently used for identifying deposits of subgingival calculus on the root surfaces of teeth during dental examination and treatment; however, it is not known how the fluorescence readings produced by commercially available LF systems correlate to the nature of the deposits. This laboratory study explored the correlation between LF digital readings and the surface area and volume of subgingival calculus deposits on teeth. A collection of 30 extracted human posterior teeth with various levels of subgingival deposits of calculus across 240 sites were used in a clinical simulation, with silicone impression material used to replicate periodontal soft tissues. The teeth were scored by two examiners by using three commercial LF systems (DIAGNOdent, DIAGNOdent Pen and KEY3). The silicone was removed, and the teeth were removed for photography at × 20 magnification under white or ultraviolet light. The surface area, thickness, and volume were calculated, and both linear least squares regression and nonlinear (Spearman's rank method) correlation coefficients were determined. Visible red LF digital readings showed better correlation to calculus volume than to surface area. Overall, the best performance was found for the KEY3 system (Spearman coefficient 0.59), compared to the Classic DIAGNOdent (0.56) and the DIAGNOdent Pen (0.49). These results indicate that while visible red LF systems vary somewhat in performance, their LF readings provide a useful estimation of the volume of subgingival calculus deposits present on teeth.

  1. Verification of surface source's characteristics using large-area 2π gas flow counter

    International Nuclear Information System (INIS)

    Abu Naser Waheed, M.M.; Mikami, S.; Kobayashi, H.; Noda, K.


    Power Reactor and Nuclear Fuel Development Corporation (PNC) has large-area 2π gas flow counter for the purpose of measuring activity of surface sources of alpha or beta ray emitter. Surface sources are used for the calibration of radiation measuring equipment for radiation control. Due to sequent use of sources, the surface of these sources are inclined to go in bad condition because of unwanted accidental incidents. For the better calibration achievement of radiation measuring instruments the rate of emission of these sources are to be checked periodically by the large-area 2π gas flow counter. In this paper described that eight U 3 O 8 surface sources were selected from many sources of PNC Tokai Works and activity of these sources was measured by the 2π gas flow counter. The results were compared with the values certified by Japan Radio Isotope Association (JRIA). It is evident from the result of comparison that the surface sources are in good condition, i.e., the sources are reliable to calibrate the radiation control instruments. (author)

  2. Cortical Thickness, Surface Area and Subcortical Volume Differentially Contribute to Cognitive Heterogeneity in Parkinson's Disease. (United States)

    Gerrits, Niels J H M; van Loenhoud, Anita C; van den Berg, Stan F; Berendse, Henk W; Foncke, Elisabeth M J; Klein, Martin; Stoffers, Diederick; van der Werf, Ysbrand D; van den Heuvel, Odile A


    Parkinson's disease (PD) is often associated with cognitive deficits, although their severity varies considerably between patients. Recently, we used voxel-based morphometry (VBM) to show that individual differences in gray matter (GM) volume relate to cognitive heterogeneity in PD. VBM does, however, not differentiate between cortical thickness (CTh) and surface area (SA), which might be independently affected in PD. We therefore re-analyzed our cohort using the surface-based method FreeSurfer, and investigated (i) CTh, SA, and (sub)cortical GM volume differences between 93 PD patients and 45 matched controls, and (ii) the relation between these structural measures and cognitive performance on six neuropsychological tasks within the PD group. We found cortical thinning in PD patients in the left pericalcarine gyrus, extending to cuneus, precuneus and lingual areas and left inferior parietal cortex, bilateral rostral middle frontal cortex, and right cuneus, and increased cortical surface area in the left pars triangularis. Within the PD group, we found negative correlations between (i) CTh of occipital areas and performance on a verbal memory task, (ii) SA and volume of the frontal cortex and visuospatial memory performance, and, (iii) volume of the right thalamus and scores on two verbal fluency tasks. Our primary findings illustrate that i) CTh and SA are differentially affected in PD, and ii) VBM and FreeSurfer yield non-overlapping results in an identical dataset. We argue that this discrepancy is due to technical differences and the subtlety of the PD-related structural changes.

  3. Nanotechnological Advances in Catalytic Thin Films for Green Large-Area Surfaces

    Directory of Open Access Journals (Sweden)

    Suzan Biran Ay


    Full Text Available Large-area catalytic thin films offer great potential for green technology applications in order to save energy, combat pollution, and reduce global warming. These films, either embedded with nanoparticles, shaped with nanostructuring techniques, hybridized with other systems, or functionalized with bionanotechnological methods, can include many different surface properties including photocatalytic, antifouling, abrasion resistant and mechanically resistive, self-cleaning, antibacterial, hydrophobic, and oleophobic features. Thus, surface functionalization with such advanced structuring methods is of significance to increase the performance and wide usage of large-area thin film coatings specifically for environmental remediation. In this review, we focus on methods to increase the efficiency of catalytic reactions in thin film and hence improve the performance in relevant applications while eliminating high cost with the purpose of widespread usage. However, we also include the most recent hybrid architectures, which have potential to make a transformational change in surface applications as soon as high quality and large area production techniques are available. Hence, we present and discuss research studies regarding both organic and inorganic methods that are used to structure thin films that have potential for large-area and eco-friendly coatings.

  4. The reliability of three psoriasis assessment tools: Psoriasis area and severity index, body surface area and physician global assessment. (United States)

    Bożek, Agnieszka; Reich, Adam


    A wide variety of psoriasis assessment tools have been proposed to evaluate the severity of psoriasis in clinical trials and daily practice. The most frequently used clinical instrument is the psoriasis area and severity index (PASI); however, none of the currently published severity scores used for psoriasis meets all the validation criteria required for an ideal score. The aim of this study was to compare and assess the reliability of 3 commonly used assessment instruments for psoriasis severity: the psoriasis area and severity index (PASI), body surface area (BSA) and physician global assessment (PGA). On the scoring day, 10 trained dermatologists evaluated 9 adult patients with plaque-type psoriasis using the PASI, BSA and PGA. All the subjects were assessed twice by each physician. Correlations between the assessments were analyzed using the Pearson correlation coefficient. Intra-class correlation coefficient (ICC) was calculated to analyze intra-rater reliability, and the coefficient of variation (CV) was used to assess inter-rater variability. Significant correlations were observed among the 3 scales in both assessments. In all 3 scales the ICCs were > 0.75, indicating high intra-rater reliability. The highest ICC was for the BSA (0.96) and the lowest one for the PGA (0.87). The CV for the PGA and PASI were 29.3 and 36.9, respectively, indicating moderate inter-rater variability. The CV for the BSA was 57.1, indicating high inter-rater variability. Comparing the PASI, PGA and BSA, it was shown that the PGA had the highest inter-rater reliability, whereas the BSA had the highest intra-rater reliability. The PASI showed intermediate values in terms of interand intra-rater reliability. None of the 3 assessment instruments showed a significant advantage over the other. A reliable assessment of psoriasis severity requires the use of several independent evaluations simultaneously.

  5. Effect of particle surface area on ice active site densities retrieved from droplet freezing spectra

    Directory of Open Access Journals (Sweden)

    H. Beydoun


    Full Text Available Heterogeneous ice nucleation remains one of the outstanding problems in cloud physics and atmospheric science. Experimental challenges in properly simulating particle-induced freezing processes under atmospherically relevant conditions have largely contributed to the absence of a well-established parameterization of immersion freezing properties. Here, we formulate an ice active, surface-site-based stochastic model of heterogeneous freezing with the unique feature of invoking a continuum assumption on the ice nucleating activity (contact angle of an aerosol particle's surface that requires no assumptions about the size or number of active sites. The result is a particle-specific property g that defines a distribution of local ice nucleation rates. Upon integration, this yields a full freezing probability function for an ice nucleating particle. Current cold plate droplet freezing measurements provide a valuable and inexpensive resource for studying the freezing properties of many atmospheric aerosol systems. We apply our g framework to explain the observed dependence of the freezing temperature of droplets in a cold plate on the concentration of the particle species investigated. Normalizing to the total particle mass or surface area present to derive the commonly used ice nuclei active surface (INAS density (ns often cannot account for the effects of particle concentration, yet concentration is typically varied to span a wider measurable freezing temperature range. A method based on determining what is denoted an ice nucleating species' specific critical surface area is presented and explains the concentration dependence as a result of increasing the variability in ice nucleating active sites between droplets. By applying this method to experimental droplet freezing data from four different systems, we demonstrate its ability to interpret immersion freezing temperature spectra of droplets containing variable particle concentrations. It is shown

  6. The triazine-based porous organic polymer: Novel synthetic strategy for high specific surface area

    International Nuclear Information System (INIS)

    Park, Jin Kuen


    A new type of microporous polymer has been successively synthesized via a simple polycondensation reaction with the 2,4-diaminotriazine moiety and dianhydride monomer. Diaminotriazine moieties in M1 especially can provide effective branching sites, resulting in high surface areas up to 1150 m"2 /g. In addition, the specific pore structure of the polyimide POP in its solid state can be modified by the surface activation method. Therefore, it can be expected that the resulting material will be a promising candidate for gas storage, and with this synthetic strategy, various type of derivatives will also be optimized

  7. The triazine-based porous organic polymer: Novel synthetic strategy for high specific surface area

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jin Kuen [Dept. of Chemistry, Hankuk University of Foreign Studies, Yongin (Korea, Republic of)


    A new type of microporous polymer has been successively synthesized via a simple polycondensation reaction with the 2,4-diaminotriazine moiety and dianhydride monomer. Diaminotriazine moieties in M1 especially can provide effective branching sites, resulting in high surface areas up to 1150 m{sup 2} /g. In addition, the specific pore structure of the polyimide POP in its solid state can be modified by the surface activation method. Therefore, it can be expected that the resulting material will be a promising candidate for gas storage, and with this synthetic strategy, various type of derivatives will also be optimized.

  8. Petroleum Hydrocarbon in Surface Sediment from Coastal Area of Putatan and Papar, Sabah

    International Nuclear Information System (INIS)

    Siti Aishah Mohd Ali; Rohana Tair; Yang, S.Z.; Masni Mohd Ali


    Total petroleum hydrocarbons (TPH) and percent total organic carbon (TOC) were investigated in surface sediments from coastal area of Papar and Putatan, Sabah. Samples were collected in five different stations in each area by using Ponar grab sampler. Samples were extracted with Soxhlet, concentrated and analyzed by using UV/ VIS spectrophotometer. The overall mean and range of TPH concentrations in the sediments from coastal area of Papar and Putatan were 1.95 (0.53-4.59 mg/ kg dw Miri crude oil equivalents) and 0.85 (0.26-1.64 mg/ kg dw Miri crude oil equivalents) respectively. Meanwhile, the TOC ranged from 0.81-2.32 % and 0.35-0.81 % respectively. Statistical analysis using Pearson correlation showed no significant differences between TPH and TOC (p<0.05) in both areas. (author)

  9. Impervious Surfaces Alter Soil Bacterial Communities in Urban Areas: A Case Study in Beijing, China

    Directory of Open Access Journals (Sweden)

    Yinhong Hu


    Full Text Available The rapid expansion of urbanization has caused land cover change, especially the increasing area of impervious surfaces. Such alterations have significant effects on the soil ecosystem by impeding the exchange of gasses, water, and materials between soil and the atmosphere. It is unclear whether impervious surfaces have any effects on soil bacterial diversity and community composition. In the present study, we conducted an investigation of bacterial communities across five typical land cover types, including impervious surfaces (concrete, permeable pavement (bricks with round holes, shrub coverage (Buxus megistophylla Levl., lawns (Festuca elata Keng ex E. Alexeev, and roadside trees (Sophora japonica Linn. in Beijing, to explore the response of bacteria to impervious surfaces. The soil bacterial communities were addressed by high-throughput sequencing of the bacterial 16S rRNA gene. We found that Proteobacteria, Actinobacteria, Acidobacteria, Bacteroidetes, Chloroflexi, and Firmicutes were the predominant phyla in urban soils. Soil from impervious surfaces presented a lower bacterial diversity, and differed greatly from other types of land cover. Soil bacterial diversity was predominantly affected by Zn, dissolved organic carbon (DOC, and soil moisture content (SMC. The composition of the bacterial community was similar under shrub coverage, roadside trees, and lawns, but different from beneath impervious surfaces and permeable pavement. Variance partitioning analysis showed that edaphic properties contributed to 12% of the bacterial community variation, heavy metal pollution explained 3.6% of the variation, and interaction between the two explained 33% of the variance. Together, our data indicate that impervious surfaces induced changes in bacterial community composition and decrease of bacterial diversity. Interactions between edaphic properties and heavy metals were here found to change the composition of the bacterial community and

  10. A program to compute the area of an irregular polygon on a spheroidal surface

    Digital Repository Service at National Institute of Oceanography (India)

    Sivakholundu, K.M.; Prabaharan, N.

    (MATLAB). Short Note824 lar shapes. The analytical integrations were carried out with the software package MATLAB on a SUN workstation. The comparisons were made to check: 1. The eC128ect of varying strip width for integration. 2. Variation of accuracy... this program can be used to calculate the area on the spheroidal surface for irregular shapes without losing accuracy. REFERENCES Bomford, G. (1977) Geodesy. Oxford University Press, 731 pp. Larkin, B. J. (1988) A FORTRAN 77 program to calcu- late areas...

  11. Surface and ground waters evaluation at Brazilian Multiproposed Reactor installation area

    International Nuclear Information System (INIS)

    Stellato, Thamiris B.; Silva, Tatiane B.S.C.da; Soares, Sabrina M.V.; Faustino, Mainara G.; Marques, Joyce R.; Oliveira, Cintia C. de; Monteiro, Lucilena R.; Pires, Maria A.F.; Cotrim, Marycel E.B.


    This study evaluates six surface and ground waters physicochemical characteristics on the area of the future Brazilian Multipurpose Reactor (RMB), at Iperó/SP. One of the main goals is to establish reference values for future operation monitoring programs, as well as for environmental permits and regulation. Considering analyzed parameters, all collection points presented values within CONAMA Resolution 396/08 and 357/05 regulation limits, showing similar characteristics among collection points.Only two points groundwater (RMB-005 and RMB-006) presented higher alkalinity, total dissolved solids and conductivity. The studied area was considered in good environmental conservation condition, as far as water quality is concerned. (author)

  12. Changing surface-atmosphere energy exchange and refreezing capacity of the lower accumulation area, West Greenland

    DEFF Research Database (Denmark)

    Charalampidis, C.; Van As, D.; Box, J. E.


    We present 5 years (2009-2013) of automatic weather station measurements from the lower accumulation area (1840 m a.s.l.-above sea level) of the Greenland ice sheet in the Kangerlussuaq region. Here, the summers of 2010 and 2012 were both exceptionally warm, but only 2012 resulted in a strongly...... negative surface mass budget (SMB) and surface meltwater run-off. The observed run-off was due to a large ice fraction in the upper 10 m of firn that prevented meltwater from percolating to available pore volume below. Analysis reveals an anomalously low 2012 summer-averaged albedo of 0.71 (typically ∼ 0.......78), as meltwater was present at the ice sheet surface. Consequently, during the 2012 melt season, the ice sheet surface absorbed 28 % (213 MJ m-2) more solar radiation than the average of all other years. A surface energy balance model is used to evaluate the seasonal and interannual variability of all surface...

  13. Measuring the specific surface area of natural and manmade glasses: effects of formation process, morphology, and particle size

    International Nuclear Information System (INIS)

    Papelis, Charalambos; Um, Wooyong; Russel, Charles E.; Chapman, Jenny B.


    The specific surface area of natural and manmade solid materials is a key parameter controlling important interfacial processes in natural environments and engineered systems, including dissolution reactions and sorption processes at solid-fluid interfaces. To improve our ability to quantify the release of trace elements trapped in natural glasses, the release of hazardous compounds trapped in manmade glasses, or the release of radionuclides from nuclear melt glass, we measured the specific surface area of natural and manmade glasses as a function of particle size, morphology, and composition. Volcanic ash, volcanic tuff, tektites, obsidian glass, and in situ vitrified rock were analyzed. Specific surface area estimates were obtained using krypton as gas adsorbent and the BET model. The range of surface areas measured exceeded three orders of magnitude. A tektite sample had the highest surface area (1.65 m2/g), while one of the samples of in situ vitrified rock had the lowest surf ace area (0.0016 m2/g). The specific surface area of the samples was a function of particle size, decreasing with increasing particle size. Different types of materials, however, showed variable dependence on particle size, and could be assigned to one of three distinct groups: (1) samples with low surface area dependence on particle size and surface areas approximately two orders of magnitude higher than the surface area of smooth spheres of equivalent size. The specific surface area of these materials was attributed mostly to internal porosity and surface roughness. (2) samples that showed a trend of decreasing surface area dependence on particle size as the particle size increased. The minimum specific surface area of these materials was between 0.1 and 0.01 m2/g and was also attributed to internal porosity and surface roughness. (3) samples whose surface area showed a monotonic decrease with increasing particle size, never reaching an ultimate surface area limit within the particle

  14. Specific surface area of overlapping spheres in the presence of obstructions. (United States)

    Jenkins, D R


    This study considers the random placement of uniform sized spheres, which may overlap, in the presence of another set of randomly placed (hard) spheres, which do not overlap. The overlapping spheres do not intersect the hard spheres. It is shown that the specific surface area of the collection of overlapping spheres is affected by the hard spheres, such that there is a minimum in the specific surface area as a function of the relative size of the two sets of spheres. The occurrence of the minimum is explained in terms of the break-up of pore connectivity. The configuration can be considered to be a simple model of the structure of a porous composite material. In particular, the overlapping particles represent voids while the hard particles represent fillers. Example materials are pervious concrete, metallurgical coke, ice cream, and polymer composites. We also show how the material properties of such composites are affected by the void structure.

  15. A method of surface area measurement of fuel materials by fission gas release at low temperature

    International Nuclear Information System (INIS)

    Kaimal, K.N.G.; Naik, M.C.; Paul, A.R.; Venkateswarlu, K.S.


    The present report deals with the development of a method for surface area measurement of nuclear fuel as well as fissile doped materials by fission gas release study at low temperature. The method is based on the evaluation of knock-out release rate of fission 133 Xe from irradiated fuel after sufficient cooling to decay the short lived activity. The report also describes the fabrication of an ampoule breaker unit for such study. Knock-out release rate of 133 Xe has been studied from UO 2 powders having varying surface area 'S' ranging from 270 cm 2 /gm to 4100 cm 2 /gm at two fissioning rates 10 12 f/cm 3 . sec. and 3.2x10 10 f/cm.sec. A relation between K and A has been established and discussed in this report. (author). 6 refs

  16. Phenomenological study of aerosol dry deposition in urban area: surface properties, turbulence and local meteorology influences

    International Nuclear Information System (INIS)

    Roupsard, P.


    Aerosol dry deposition is not much known for urban areas due to the lack of data. Knowledge on this phenomenon is necessary to understand pollutant fluxes in cities and to estimate inhabitant exposition to ionizing radiation of radioactive aerosols. A data providing could enable to enhance dry deposition models for these areas. An original experimental approach is performed to study submicron aerosol dry deposition on urban surfaces. Wind tunnel coupled to in situ experiments give results to study different physical phenomenon governing dry deposition. Dry deposition velocities are measured using aerosol tracers. These data are associated to turbulent and meteorological measured conditions. This database permits to classify the principal physical phenomenon for each experiment type. Finally, different phenomenon must be considered for chronic and acute exposition of urban surfaces to atmospheric particles. (author)

  17. 75 FR 62623 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Internal Revenue Service (IRS... (United States)


    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0015] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Internal Revenue Service (IRS))--Match Number 1016 AGENCY: Social Security... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching...

  18. 77 FR 33547 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Centers for Medicare and Medicaid... (United States)


    ...: Social Security Administration (SSA). ACTION: Notice of a new computer matching program that will expire... protections for such persons. The Privacy Act, as amended, regulates the use of computer matching by Federal... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0015] Privacy Act of 1974, as Amended...

  19. 77 FR 24757 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Labor (DOL))-Match... (United States)


    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0083] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1015 AGENCY: Social Security... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching...

  20. 77 FR 27108 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Child Support... (United States)


    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching... protections for such persons. The Privacy Act, as amended, regulates the use of computer matching by Federal... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0010] Privacy Act of 1974, as Amended...

  1. 20 CFR 411.597 - Will SSA periodically review the outcome payment system and the outcome-milestone payment system... (United States)


    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Will SSA periodically review the outcome payment system and the outcome-milestone payment system for possible modifications? 411.597 Section 411... Employment Network Payment Systems § 411.597 Will SSA periodically review the outcome payment system and the...

  2. Lupus systémique et atteinte rénale: Apport des anticorps anti-SSA ...

    African Journals Online (AJOL)

    -SSA dans 12 cas (40%).Cinq patients (62.5%) ayant une atteinte rénale avaient des anticorps anti DNA négatifs. Parmi ces patients avec atteinte rénale, 37.5% avaient des anticorps anti SSA sans anticorps anti DNA. La moitié des patients ...

  3. The relationship of the lipoprotein SsaB, manganese and superoxide dismutase in Streptococcus sanguinis virulence for endocarditis. (United States)

    Crump, Katie E; Bainbridge, Brian; Brusko, Sarah; Turner, Lauren S; Ge, Xiuchun; Stone, Victoria; Xu, Ping; Kitten, Todd


    Streptococcus sanguinis colonizes teeth and is an important cause of infective endocarditis. Our prior work showed that the lipoprotein SsaB is critical for S. sanguinis virulence for endocarditis and belongs to the LraI family of conserved metal transporters. In this study, we demonstrated that an ssaB mutant accumulates less manganese and iron than its parent. A mutant lacking the manganese-dependent superoxide dismutase, SodA, was significantly less virulent than wild-type in a rabbit model of endocarditis, but significantly more virulent than the ssaB mutant. Neither the ssaB nor the sodA mutation affected sensitivity to phagocytic killing or efficiency of heart valve colonization. Animal virulence results for all strains could be reproduced by growing bacteria in serum under physiological levels of O(2). SodA activity was reduced, but not eliminated in the ssaB mutant in serum and in rabbits. Growth of the ssaB mutant in serum was restored upon addition of Mn(2+) or removal of O(2). Antioxidant supplementation experiments suggested that superoxide and hydroxyl radicals were together responsible for the ssaB mutant's growth defect. We conclude that manganese accumulation mediated by the SsaB transport system imparts virulence by enabling cell growth in oxygen through SodA-dependent and independent mechanisms. © 2014 John Wiley & Sons Ltd.

  4. 76 FR 55690 - Submission for OMB Review; Comment Request; The SSA-NIH Collaboration To Improve the Disability... (United States)


    ...; Comment Request; The SSA-NIH Collaboration To Improve the Disability Determination Process: Validation of... Collection: Title: The SSA-NIH Collaboration to Improve the Disability Determination Process: Validation of IRT-CAT tools. Type of Information Collection Request: NEW. Need and Use of Information Collection...

  5. 76 FR 77238 - Submission for OMB Review; Comment Request; The SSA-NIH Collaboration to Improve the Disability... (United States)


    ... Collaboration to Improve the Disability Determination Process: Validation of IRT-CAT tools. Type of Information...; Comment Request; The SSA-NIH Collaboration to Improve the Disability Determination Process: Validation of... being developed to assist in the SSA disability determination process. The utilization of CAT technology...

  6. 76 FR 12398 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Bureau of the Public Debt (BPD... (United States)


    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0034] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Bureau of the Public Debt (BPD))--Match Number 1304 AGENCY: Social Security... as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...

  7. 75 FR 9012 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/U.S. Department of Health and... (United States)


    ... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503), amended... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0052] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ U.S. Department of Health and Human Services (HHS), Administration for...

  8. 77 FR 32709 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Homeland Security... (United States)


    ...; Computer Matching Program (SSA/ Department of Homeland Security (DHS))--Match Number 1010 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program that... amended by the Computer Matching and Privacy Protection Act of 1988, as amended, and the regulations and...

  9. 78 FR 12128 - Privacy Act of 1974; Computer Matching Program (SSA/Department of the Treasury, Internal Revenue... (United States)


    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0067] Privacy Act of 1974; Computer Matching... Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...

  10. 78 FR 12127 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of the Treasury... (United States)


    ... 1310 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0007] Privacy Act of 1974, as Amended...

  11. 75 FR 51154 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of the Treasury... (United States)


    ... 1310 AGENCY: Social Security Administration (SSA) ACTION: Notice of a renewal of an existing computer..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0035] Privacy Act of 1974, as Amended...

  12. 77 FR 6620 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/the States); Match 6000 and 6003 (United States)


    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0102] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ the States); Match 6000 and 6003 AGENCY: Social Security Administration..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...

  13. 77 FR 49849 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Child Support... (United States)


    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer-matching... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0021] Privacy Act of 1974, as Amended...

  14. 78 FR 51264 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of the Treasury... (United States)


    ... 1016 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0022] Privacy Act of 1974, as Amended...

  15. 75 FR 68396 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Labor (DOL))-Match... (United States)


    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0052] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1003 AGENCY: Social Security... as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...

  16. 78 FR 69926 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Centers for Medicare & Medicaid... (United States)


    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L 100-503), amended the... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0059] Privacy Act of 1974, as Amended...

  17. 75 FR 18251 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Internal Revenue Service (IRS... (United States)


    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0066] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Internal Revenue Service (IRS))--Match 1305 AGENCY: Social Security... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...

  18. 75 FR 7648 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Veterans Affairs... (United States)


    ... Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503), amended the Privacy... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0006] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Veterans Affairs/Veterans Benefits Administration (VA/ VBA...

  19. 78 FR 16564 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Personnel Management... (United States)


    ... 1021 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of existing computer... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0073] Privacy Act of 1974, as Amended...

  20. 75 FR 32833 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Personnel Management... (United States)


    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0077] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Office of Personnel Management (OPM))--Match 1307 AGENCY: Social Security... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...

  1. 75 FR 59780 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Railroad Retirement Board (RRB... (United States)


    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0040] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Railroad Retirement Board (RRB))--Match Number 1006 AGENCY: Social Security...: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L.) 100-503), amended the...

  2. 77 FR 24756 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Labor (DOL))-Match... (United States)


    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0084] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1003 AGENCY: Social Security... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988...

  3. 20 CFR 403.100 - When can an SSA employee testify or produce information or records in legal proceedings? (United States)


    ... information or records in legal proceedings? 403.100 Section 403.100 Employees' Benefits SOCIAL SECURITY ADMINISTRATION TESTIMONY BY EMPLOYEES AND THE PRODUCTION OF RECORDS AND INFORMATION IN LEGAL PROCEEDINGS § 403.100 When can an SSA employee testify or produce information or records in legal proceedings? An SSA...

  4. Uptake of acetone, ethanol and benzene to snow and ice: effects of surface area and temperature

    International Nuclear Information System (INIS)

    Abbatt, J P D; Bartels-Rausch, T; Ullerstam, M; Ye, T J


    The interactions of gas-phase acetone, ethanol and benzene with smooth ice films and artificial snow have been studied. In one technique, the snow is packed into a cylindrical column and inserted into a low-pressure flow reactor coupled to a chemical-ionization mass spectrometer for gas-phase analysis. At 214 and 228 K, it is found for acetone and ethanol that the adsorbed amounts per surface area match those for adsorption to thin films of ice formed by freezing liquid water, when the specific surface area of the snow (as determined from Kr adsorption at 77 K) and the geometric surface area of the ice films are used. This indicates that freezing thin films of water leads to surfaces that are smooth at the molecular level. Experiments performed to test the effect of film growth on ethanol uptake indicate that uptake is independent of ice growth rate, up to 2.4 μm min -1 . In addition, traditional Brunauer-Emmett-Teller (BET) experiments were performed with these gases on artificial snow from 238 to 266.5 K. A transition from a BET type I isotherm indicative of monolayer formation to a BET type II isotherm indicative of multilayer uptake is observed for acetone at T≥263 K and ethanol at T≥255 K, arising from solution formation on the ice. When multilayer formation does not occur, as was the case for benzene at T≤263 K and for acetone at T≤255 K, the saturated surface coverage increased with increasing temperature, consistent with the quasi-liquid layer affecting adsorption prior to full dissolution/multilayer formation.

  5. n-Alkylamine-assisted preparation of a high surface area vanadyl phosphate/tetraethylorthosilicate nanocomposite

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, João Paulo L., E-mail: [Departamento de Química, Faculdade de Filosofia, Ciências e Letras de Ribeirão Preto, Universidade de São Paulo, Av. Bandeirantes 3900, Ribeirão Preto, SP 14040-901 (Brazil); Zampronio, Elaine C.; Oliveira, Herenilton P. [Departamento de Química, Faculdade de Filosofia, Ciências e Letras de Ribeirão Preto, Universidade de São Paulo, Av. Bandeirantes 3900, Ribeirão Preto, SP 14040-901 (Brazil)


    Graphical abstract: CuK{sub α} X-ray diffraction patterns of the VP, VPOc, VPOcT, VPOcT200 and VPOcT500. Highlights: ► TEOS and octylamine incorporation into the VP was achieved by expanding the lamellar. ► The specific surface area increased from 15 m{sup 2} g{sup −1} in VP to 237 m{sup 2} g{sup −1} in VPOcT. ► The VPOcT exhibited thermal resistance up to 200 °C in air. ► Upon thermal treatment up to 500 °C, the surface area increased to 838 m{sup 2} g{sup −1}. -- Abstract: We have developed a vanadyl phosphate/tetraethylorthosilicate (VPO/TEOS) nanocomposite comprised of silicate chains interleaved with VPO layers, prepared by using an n-alkylamines such as octylamine as the structure directing agent. The nanocomposites were synthesized by reacting amine-intercalated vanadyl phosphate with tetraethylorthosilicate via the soft chemistry approach. The synthetic procedure encompassed the exfoliation of the layered vanadyl phosphate as well as the reorganization of this exfoliated solid into a mesostructured lamellar phase with the same V–P–O connectivity as in the original matrix. TEOS incorporation into the vanadyl phosphate was achieved by expanding the lamellar structure with n-alkylamine (Δd = 13 Å with n-octylamine). The specific surface area increased from 15 m{sup 2} g{sup −1} in the vanadyl phosphate matrix to 237 m{sup 2} g{sup −1} in VPOcT, and the isotherm curves revealed the characteristic hysteresis of mesoporous materials. Upon thermal treatment up to 500 °C, the surface area increased to 837 m{sup 2} g{sup −1}, which is suitable for catalytic purposes.

  6. Sensitivity analysis of the surface water- groundwater interaction for the sandy area of the Netherlands


    Gomez del Campo, E.; Jousma, G.; Massop, H.T.L.


    The "Sensitivity Analysis of the Surface Water- Groundwater Interaction for the Sandy Area of the Netherlands" was carried out in the framework of a bilateral research project in support of the implementation of a nationwide geohydrological information system (REGIS) in the Netherlands. This project, conducted in cooperation between the TNO Institute for Applied Scientific Research (IGG-TNO) and !he Winand Staring Centre for Integrated Land, Soil and Water Research (SC-DLO), is aimed at defin...

  7. Target Surface Area Effects on Hot Electron Dynamics from High Intensity Laser-Plasma Interactions (United States)


    Science, University ofMichigan, AnnArbor,MI 48109-2099, USA E-mail: Keywords: laser- plasma ,mass-limited, fast electrons , sheath...New J. Phys. 18 (2016) 063020 doi:10.1088/1367-2630/18/6/063020 PAPER Target surface area effects on hot electron dynamics from high intensity laser... plasma interactions CZulick, ARaymond,AMcKelvey, VChvykov, AMaksimchuk, AGRThomas, LWillingale, VYanovsky andKKrushelnick Center forUltrafast Optical

  8. Synthesis of high-surface-area spinel-type MgAl2O4 nanoparticles ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 40; Issue 1. Synthesis of high-surface-area spinel-type MgAl 2 O 4 nanoparticles by [Al(sal) 2 (H 2 O) 2 ] 2 [Mg(dipic) 2 ] and [Mg(H 2 O) 6 ][Al(ox) 2 (H 2 O) 2 ] 2 ·5H 2 O: influence of inorganic precursor type. Volume 40 Issue 1 February 2017 pp 45-53 ...

  9. Fabrication of mesoporous and high specific surface area lanthanum carbide-carbon nanotube composites

    International Nuclear Information System (INIS)

    Biasetto, L.; Carturan, S.; Maggioni, G.; Zanonato, P.; Bernardo, P. Di; Colombo, P.; Andrighetto, A.; Prete, G.


    Mesoporous lanthanum carbide-carbon nanotube composites were produced by means of carbothermal reaction of lanthanum oxide, graphite and multi-walled carbon nanotube mixtures under high vacuum. Residual gas analysis revealed the higher reactivity of lanthanum oxide towards carbon nanotubes compared to graphite. After sintering, the composites revealed a specific surface area increasing with the amount of carbon nanotubes introduced. The meso-porosity of carbon nanotubes was maintained after thermal treatment.

  10. Surface area of lactose and lactose granulates on consolidation and compaction


    Riepma, Klaas Alouis


    This dissertation discusses the effect of short time storage at different conditions on the strength and the specific BET surface area of lactose tablets. In addition, some aspects are studied of the consolidation and compaction properties of crystalline lactose fractions in heterogeneous systems. The crystalline lactose types used are: a-lactose monohydrate, anhydrous a-lactose, crystalline B-lactose and roller dried B-lactose. ... Zie: Summary

  11. Surface area-dependence of gas-particle interactions influences pulmonary and neuroinflammatory outcomes


    Tyler, Christina R.; Zychowski, Katherine E.; Sanchez, Bethany N.; Rivero, Valeria; Lucas, Selita; Herbert, Guy; Liu, June; Irshad, Hammad; McDonald, Jacob D.; Bleske, Barry E.; Campen, Matthew J.


    Background Deleterious consequences of exposure to traffic emissions may derive from interactions between carbonaceous particulate matter (PM) and gaseous components in a manner that is dependent on the surface area or complexity of the particles. To determine the validity of this hypothesis, we examined pulmonary and neurological inflammatory outcomes in C57BL/6 and apolipoprotein E knockout (ApoE?/?) male mice after acute and chronic exposure to vehicle engine-derived particulate matter, ge...

  12. 77 FR 74913 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA... (United States)


    ...; Computer Matching Program (Social Security Administration (SSA)/Office of Personnel Management (OPM.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub... computer matching involving the Federal government could be performed and adding certain protections for...

  13. Description of climate, surface hydrology, and near-surface hydrogeology. Preliminary site description. Forsmark area - version 1.2

    Energy Technology Data Exchange (ETDEWEB)

    Johansson, Per-Olof [Artesia Grundvattenkonsult AB, Stockholm (Sweden); Werner, Kent [SWECO VIAK AB/Golder Associates AB, Stockholm (Sweden); Bosson, Emma; Berglund, Sten [Swedish Nuclear Fuel and Waste Management Co., Stockholm (Sweden); Juston, John [DBE Sweden, Uppsala (Sweden)


    The Swedish Nuclear Fuel and Waste Management Company (SKB) is conducting site investigations at two different locations, the Forsmark and Simpevarp areas, with the objective of siting a geological repository for spent nuclear fuel. The results from the investigations at the sites are used as a basic input to the development of Site Descriptive Models (SDM). The SDM shall summarise the current state of knowledge of the site, and provide parameters and models to be used in further analyses within Safety Assessment, Repository Design and Environmental Impact Assessment. The present report is a background report describing the meteorological conditions and the modelling of surface hydrology and near-surface hydrogeology in support of the Forsmark version 1.2 SDM based on the data available in the Forsmark 1.2 'data freeze' (July 31, 2004). The groundwater is very shallow, with groundwater levels within one meter below ground as an annual mean for almost all groundwater monitoring wells. Also, the annual groundwater level amplitude is less than 1.5 m for most wells. The shallow groundwater levels mean that there is a strong interaction between evapotranspiration, soil moisture and groundwater. In the modelling, surface water and near-surface groundwater divides are assumed to coincide. The small-scale topography implies that many local, shallow groundwater flow systems are formed in the Quaternary deposits, overlaying more large-scale flow systems associated with groundwater flows at greater depths. Groundwater level time series from wells in till and bedrock within the same areas show a considerably higher groundwater level in the till than in the bedrock. The observed differences in levels are not fully consistent with the good hydraulic contact between overburden and bedrock indicated by the hydraulic tests in the Quaternary deposits. However, the relatively lower groundwater levels in the bedrock may be caused by the horizontal to sub-horizontal highly

  14. [Distribution, surface and protected area of palm-swamps in Costa Rica and Nicaragua]. (United States)

    Serrano-Sandí, Juan; Bonilla-Murillo, Fabian; Sasa, Mahmood


    In Central America, palm swamps are known collectively as yolillales. These wetlands are usually dominated by the raffia palm Raphia taedigera, but also by the royal palm Manicaria saccifera and -in lower extensions- by the American oil palm Elaeis oleifera. The yolillales tend to be poor in woody species and are characteristic of regions with high rainfall and extensive hydroperiods, so they remain flooded most of the year. The dominance of large raffia palm leaves in the canopy, allow these environments to be distinguishable in aerial photographs, which consequently has helped to map them along most of their distribution. However, while maps depicting yolillales are available, the extent of their surface area, perimeter and connectivity remains poorly understood. This is particularly true for yolillales in Costa Rica and Nicaragua, countries that share a good proportion of palm dominated swaps in the Rio San Juan Basin. In addition, it is not known the actual area of these environments that is under any category of protection according to the conservation systems of both countries. As a first step to catalog yolillal wetlands in Costa Rica and Nicaragua, this paper evaluates cartographic maps to delineate yolillales in the region. A subsample of yolillales mapped in this study were visited and we geo-referenced them and evaluate the extent and condition of the swamp. A total of 110 883.2ha are classified as yolillales in Nicaragua, equivalent to 22% of wetland surface area recorded for that country (excluding the Cocibolca and Xolothn Lakes). In Costa Rica, 53 931.3ha are covered by these palm dominated swamps, which represent 16.24% of the total surface area covered by wetlands. About 47% of the area covered by yolillales in Nicaragua is under some category of protection, the largest extensions protected by Cerro Silva, Laguna Tale Sulumas and Indio Maiz Nature Reserves. In Costa Rica, 55.5% of the area covered by yolillal is located within protected areas

  15. Polyaniline nanofibers with a high specific surface area and an improved pore structure for supercapacitors (United States)

    Xu, Hailing; Li, Xingwei; Wang, Gengchao


    Polyaniline (PANI) with a high specific surface area and an improved pore structure (HSSA-PANI) has been prepared by using a facile method, treating PANI nanofibers with chloroform (CHCl3), and its structure, morphology and pore structure are investigated. The specific surface area and pore volume of HSSA-PANI are 817.3 m2 g-1 and 0.6 cm3 g-1, and those of PANI are 33.6 m2 g-1 and 0.2 cm3 g-1. As electrode materials, a large specific surface area and pore volume can provide high electroactive regions, accelerate the diffusion of ions, and mitigate the electrochemical degradation of active materials. Compared with PANI, the capacity retention rate of HSSA-PANI is 90% with a growth of current density from 5.0 to 30 A g-1, and that of PANI is 29%. At a current density of 30 A g-1, the specific capacitance of HSSA-PANI still reaches 278.3 F g-1, and that of PANI is 86.7 F g-1. At a current density of 5.0 A g-1, the capacitance retention of HSSA-PANI is 53.1% after 2000 cycles, and that of PANI electrode is only 28.1%.

  16. Effects of acid treatment on the clay palygorskite: XRD, surface area, morphological and chemical composition

    Energy Technology Data Exchange (ETDEWEB)

    Xavier, Katiane Cruz Magalhaes; Santos, Maria do Socorro Ferreira dos; Santos, Maria Rita Morais Chaves; Oliveira, Marilia Evelyn Rodrigues; Osajima, Josy Antevelli; Silva Filho, Edson Cavalcanti da [Universidade Federal do Piaui (UFPI), Teresina, PI (Brazil); Carvalho, Maria Wilma Nunes Cordeiro, E-mail: [Universidade Federal de Campina Grande (UFCG), PB (Brazil)


    The palygorskite is an aluminum-magnesium silicate that has a fibrous morphology. Their physicochemical characteristics are the result of high surface area, porosity and thermal resistance which make it an attractive adsorbent. Its adsorption capacity can be increased through chemical reactions and/or heat treatments. The objective of this work is to verify the effects of acid activation on the palygorskite, treated with HCl at 90 °C at concentrations of 2, 4 and 6 mol L{sup -1} in 2 and 4 hours, with clay/acid solution ratio 1 g 10 mL{sup -1} and characterized by techniques: XRF, XRD and surface area. A significant increase in specific surface area was observed in the sample treated with HCl at the concentration 6 mol L{sup -1}. The changes were more pronounced at stricter concentrations of acidity, with decreasing intensity of reflection of the clay indicated in the XRD. These changes were confirmed in the XRF with the leaching of some oxides and with increasing concentration of SiO{sub 2}. (author)

  17. Evaluation of The Surface Ozone Concentrations In Greater Cairo Area With Emphasis On Helwan, Egypt

    International Nuclear Information System (INIS)

    Ramadan, A.; Kandil, A.T.; Abd Elmaged, S.M.; Mubarak, I.


    Various biogenic and anthropogenic sources emit huge quantities of surface ozone. The main purpose of this study is to evaluate the surface ozone levels present at Helwan area in order to improve the knowledge and understanding troposphere processes. Surface Ozone has been measured at 2 sites at Helwan; these sites cover the most populated area in Helwan. Ozone concentration is continuously monitored by UV absorption photometry using the equipment O 3 41 M UV Photometric Ozone Analyzer. The daily maximum values of the ozone concentration in the greater Cairo area have approached but did not exceeded the critical levels during the year 2008. Higher ozone concentrations at Helwan are mainly due to the transport of ozone from regions further to the north of greater Cairo and to a lesser extent of ozone locally generated by photochemical smog process. The summer season has the largest diurnal variation, with the tendency of the daily ozone maxima occur in the late afternoon. The night time concentration of ozone was significantly higher at Helwan because there are no fast acting sinks, destroying ozone since the average night time concentration of ozone is maintained at 40 ppb at the site. No correlation between the diurnal total suspended particulate (TSP) matter and the diurnal cumulative ozone concentration was observed during the Khamasin period

  18. Detailed effects of particle size and surface area on 222Rn emanation of a phosphate rock. (United States)

    Haquin, Gustavo; Yungrais, Zohar; Ilzycer, Danielle; Zafrir, Hovav; Weisbrod, Noam


    The dependency of radon emanation on soil texture was investigated using the closed chamber method. Ground phosphate rock with a large specific surface area was analyzed, and the presence of inner pores, as well as a high degree of roughness and heterogeneity in the phosphate particles, was found. The average radon emanation of the dry phosphate was 0.145 ± 0.016. The emanation coefficient was highest (0.169 ± 0.019) for the smallest particles (210 μm). The reduction rate followed an inverse power law. As expected, a linear dependence between the emanation coefficient and the specific surface area was found, being lower than predicted for the large specific surface area. This was most likely due to an increase in the embedding effect of radon atoms in adjacent grains separated by micropores. Results indicate that knowledge of grain radium distribution is crucial to making accurate emanation predictions. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Surface area, crystal morphology and characterization of transition alumina powders from a new gibbsite precursor

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Vieira Coelho


    Full Text Available A new procedure was used to prepare a microcrystalline powder constituted by thin euhedral hexagonal gibbsite plates, 0.2 to 0.6 µm in diameter and 32 nm thick. The powder, fired between 200 and 1000 °C, produced chi and kappa transition aluminas. Alpha-alumina is formed from 1000 °C and recrystallized up to 1500 °C. At 1000 °C, kappa- and alpha-alumina coexisted, but kappa-alumina could only be characterized by SAED. The details of the internal organization of the transition alumina pseudomorphs were clearly observable in TEM due to the great thinness of the I-gibbsite plates. The specific surface area varied from pristine I-gibbsite (24.9 m².g-1 to chi- and kappa transition aluminas (25.4 m².g-1 at 1000 °C to alpha-alumina (4.0 m².g-1 at 1500 °C. The maximum value of specific surface area is 347 m².g-1 in chi-alumina powder at 300 °C, a difference from Bayer gibbsite, in which the chi-alumina highest surface area is 370 m².g-1 at 400 °C.

  20. Preparation of high surface area and high conductivity polyaniline nanoparticles using chemical oxidation polymerization technique (United States)

    Budi, S.; Yusmaniar; Juliana, A.; Cahyana, U.; Purwanto, A.; Imaduddin, A.; Handoko, E.


    In this work, polyaniline nanoparticles were synthesized using a chemical oxidation polymerization technique. The ammonium peroxydisulfate (APS)/aniline ratio, APS dropping time, and polymerization temperature were optimized to increase the surface area and conductivity of the polyaniline.The Fourier-transform infrared (FTIR) spectrum confirmed the formation of emeraldine salt polyaniline. X-ray diffraction (XRD) patterns indicated that amorphous and crystalline phases of the polyaniline were formed with crystallinity less than 40%. Scanning electron microscope (SEM) micrographs showed that the finest nanoparticles with uniform size distribution were obtained at the polymerization temperature of 0°C. A surface area analyzer (SAA) showed that the highest Brunauer-Emmett-Teller surface area (SBET ) of 42.14 m2/gwas obtained from an APS/aniline ratio of 0.75 with a dropping time of 0 s at a polymerization temperature of 0°C. A four-point probe measurement conducted at 75–300K indicated relatively high conductivity of the semiconductor characteristic of the polyaniline.

  1. Correlation of lung surface area to apoptosis and proliferation in human emphysema. (United States)

    Imai, K; Mercer, B A; Schulman, L L; Sonett, J R; D'Armiento, J M


    Pulmonary emphysema is associated with alterations in matrix proteins and protease activity. These alterations may be linked to programmed cell death by apoptosis, potentially influencing lung architecture and lung function. To evaluate apoptosis in emphysema, lung tissue was analysed from 10 emphysema patients and six individuals without emphysema (normal). Morphological analysis revealed alveolar cells in emphysematous lungs with convoluted nuclei characteristic of apoptosis. DNA fragmentation was detected using terminal deoxynucleotide transferase-mediated dUTP nick-end labelling (TUNEL) and gel electrophoresis. TUNEL revealed higher apoptosis in emphysematous than normal lungs. Markers of apoptosis, including active caspase-3, proteolytic fragment of poly (ADP-ribose) polymerase, Bax and Bad, were detected in emphysematous lungs. Linear regression showed that apoptosis was inversely correlated with surface area. Emphysematous lungs demonstrated lower surface areas and increased cell proliferation. There was no correlation between apoptosis and proliferation, suggesting that, although both events increase during emphysema, they are not in equilibrium, potentially contributing to reduced lung surface area. In summary, cell-based mechanisms associated with emphysematous parenchymal damage include increased apoptosis and cell proliferation. Apoptosis correlated with airspace enlargement, supporting epidemiological evidence of the progressive nature of emphysema. These data extend the understanding of cell dynamics and structural changes within the lung during emphysema pathogenesis.

  2. A novel high specific surface area conducting paper material composed of polypyrrole and Cladophora cellulose. (United States)

    Mihranyan, Albert; Nyholm, Leif; Bennett, Alfonso E Garcia; Strømme, Maria


    We present a novel conducting polypyrrole-based composite material, obtained by polymerization of pyrrole in the presence of iron(III) chloride on a cellulose substrate derived from the environmentally polluting Cladophora sp. algae. The material, which was doped with chloride ions, was molded into paper sheets and characterized using scanning and transmission electron microscopy, N 2 gas adsorption analysis, cyclic voltammetry, chronoamperometry and conductivity measurements at varying relative humidities. The specific surface area of the composite was found to be 57 m (2)/g and the fibrous structure of the Cladophora cellulose remained intact even after a 50 nm thick layer of polypyrrole had been coated on the cellulose fibers. The composite could be repeatedly used for electrochemically controlled extraction and desorption of chloride and an ion exchanging capacity of 370 C per g of composite was obtained as a result of the high surface area of the cellulose substrate. The influence of the oxidation and reduction potentials on the chloride ion exchange capacity and the nucleation of delocalized positive charges, forming conductive paths in the polypyrrole film, was also investigated. The creation of conductive paths during oxidation followed an effective medium rather than a percolative behavior, indicating that some conduction paths survive the polymer reduction steps. The present high surface area material should be well-suited for use in, e.g., electrochemically controlled ion exchange or separation devices, as well as sensors based on the fact that the material is compact, light, mechanically stable, and moldable into paper sheets.

  3. Mineral paragenesis on Mars: The roles of reactive surface area and diffusion. (United States)

    Fairén, Alberto G; Gil-Lozano, Carolina; Uceda, Esther R; Losa-Adams, Elisabeth; Davila, Alfonso F; Gago-Duport, Luis


    Geochemical models of secondary mineral precipitation on Mars generally assume semiopen systems (open to the atmosphere but closed at the water-sediment interface) and equilibrium conditions. However, in natural multicomponent systems, the reactive surface area of primary minerals controls the dissolution rate and affects the precipitation sequences of secondary phases, and simultaneously, the transport of dissolved species may occur through the atmosphere-water and water-sediment interfaces. Here we present a suite of geochemical models designed to analyze the formation of secondary minerals in basaltic sediments on Mars, evaluating the role of (i) reactive surface areas and (ii) the transport of ions through a basalt sediment column. We consider fully open conditions, both to the atmosphere and to the sediment, and a kinetic approach for mineral dissolution and precipitation. Our models consider a geochemical scenario constituted by a basin (i.e., a shallow lake) where supersaturation is generated by evaporation/cooling and the starting point is a solution in equilibrium with basaltic sediments. Our results show that cation removal by diffusion, along with the input of atmospheric volatiles and the influence of the reactive surface area of primary minerals, plays a central role in the evolution of the secondary mineral sequences formed. We conclude that precipitation of evaporites finds more restrictions in basaltic sediments of small grain size than in basaltic sediments of greater grain size.


    Directory of Open Access Journals (Sweden)

    Markus Kiderlen


    Full Text Available According to Crofton's formula, the surface area S(A of a sufficiently regular compact set A in Rd is proportional to the mean of all total projections pA (u on a linear hyperplane with normal u, uniformly averaged over all unit vectors u. In applications, pA (u is only measured in k directions and the mean is approximated by a finite weighted sum bS(A of the total projections in these directions. The choice of the weights depends on the selected quadrature rule. We define an associated zonotope Z (depending only on the projection directions and the quadrature rule, and show that the relative error bS (A/S (A is bounded from below by the inradius of Z and from above by the circumradius of Z. Applying a strengthened isoperimetric inequality due to Bonnesen, we show that the rectangular quadrature rule does not give the best possible error bounds for d =2. In addition, we derive asymptotic behavior of the error (with increasing k in the planar case. The paper concludes with applications to surface area estimation in design-based digital stereology where we show that the weights due to Bonnesen's inequality are better than the usual weights based on the rectangular rule and almost optimal in the sense that the relative error of the surface area estimator is very close to the minimal error.

  5. Dependence of the specific surface area of the nuclear fuel with the matrix oxidation

    International Nuclear Information System (INIS)

    Gomez, F.; Quinones, J.; Iglesias, E.; Rodriguez, N.


    This paper is focused on the study of the changes in the specific surface area measured using BET techniques. The objective is to obtain a relation between this parameter and the change in the matrix stoichiometry (i.e., oxidation increase). None of the actual models used for extrapolating the behaviour of the spent fuel matrix under repository conditions have included this dependence yet. In this work the specific surface area of different uranium oxide were measured using N 2 (g) and Kr(g). The starting material was UO 2+x (s) with a size powder distribution lower than 20 μm. The results included in this paper shown a strong dependence on specific surface area with the matrix stoichiometry, i.e., and increase of more than one order of magnitude (SUO 2 = 6 m 2 *g -1 and SU 3 O 8 = 16.07 m 2 *g -1 ). Furthermore, the particle size distribution measured as a function of the thermal treatment done shows changes on the powder size related to the changes observed in the uranium oxide stoichiometry. (authors)

  6. Surface water areas significantly impacted 2014 dengue outbreaks in Guangzhou, China

    Energy Technology Data Exchange (ETDEWEB)

    Tian, Huaiyu; Huang, Shanqian [State Key Laboratory of Remote Sensing Science, College of Global Change and Earth System Science, Beijing Normal University, Beijing (China); Zhou, Sen [Ministry of Education Key Laboratory for Earth System Modelling, Center for Earth System Science, Tsinghua University, Beijing (China); Department of Pediatrics, Harvard Medical School, Boston, MA (United States); Bi, Peng [Discipline of Public Health, University of Adelaide, Adelaide (Australia); Yang, Zhicong, E-mail: [Guangzhou Center for Disease Control and Prevention, Guangzhou (China); Li, Xiujun [School of Public Health, Shandong University, Jinan (China); Chen, Lifan [State Key Laboratory of Remote Sensing Science, College of Global Change and Earth System Science, Beijing Normal University, Beijing (China); Cazelles, Bernard [UMMISCO, UMI 209 IRD – UPMC, 93142 Bondy (France); Eco-Evolutionary Mathematic, IBENS UMR 8197, ENS, 75230 Paris Cedex 05 (France); Yang, Jing [State Key Laboratory of Remote Sensing Science, College of Global Change and Earth System Science, Beijing Normal University, Beijing (China); Luo, Lei; Jing, Qinlong [Guangzhou Center for Disease Control and Prevention, Guangzhou (China); Yuan, Wenping [State Key Laboratory of Earth Surface Processes and Resource Ecology, College of Global Change and Earth System Science, Beijing Normal University, Beijing (China); Pei, Yao; Sun, Zhe [Ministry of Education Key Laboratory for Earth System Modelling, Center for Earth System Science, Tsinghua University, Beijing (China); Yue, Tianxiang [State Key Laboratory of Resources and Environment Information System, Chinese Academy of Sciences, Beijing (China); Kwan, Mei-Po [Department of Geography and Geographic Information Science, University of Illinois at Urbana-Champaign, Champaign, IL 61820 (United States); and others


    Dengue transmission in urban areas is strongly influenced by a range of biological and environmental factors, yet the key drivers still need further exploration. To better understand mechanisms of environment–mosquito–urban dengue transmission, we propose an empirical model parameterized and cross-validated from a unique dataset including viral gene sequences, vector dynamics and human dengue cases in Guangzhou, China, together with a 36-year urban environmental change maps investigated by spatiotemporal satellite image fusion. The dengue epidemics in Guangzhou are highly episodic and were not associated with annual rainfall over time. Our results indicate that urban environmental changes, especially variations in surface area covered by water in urban areas, can substantially alter the virus population and dengue transmission. The recent severe dengue outbreaks in Guangzhou may be due to the surge in an artificial lake construction, which could increase infection force between vector (mainly Aedes albopictus) and host when urban water area significantly increased. Impacts of urban environmental change on dengue dynamics may not have been thoroughly investigated in the past studies and more work needs to be done to better understand the consequences of urbanization processes in our changing world. - Highlights: • Urban dengue outbreak is associated with water area in Guangzhou, 1978–2014. • Surface water area can alter population size of dengue virus in urban area. • Urban dengue outbreak is not associated with annual rainfall in Guangzhou. • Spatiotemporal satellite image fusion can investigate urban environmental change. • Urban environmental change could induce virus, vector, and dengue epidemic change.

  7. Surface water areas significantly impacted 2014 dengue outbreaks in Guangzhou, China

    International Nuclear Information System (INIS)

    Tian, Huaiyu; Huang, Shanqian; Zhou, Sen; Bi, Peng; Yang, Zhicong; Li, Xiujun; Chen, Lifan; Cazelles, Bernard; Yang, Jing; Luo, Lei; Jing, Qinlong; Yuan, Wenping; Pei, Yao; Sun, Zhe; Yue, Tianxiang; Kwan, Mei-Po


    Dengue transmission in urban areas is strongly influenced by a range of biological and environmental factors, yet the key drivers still need further exploration. To better understand mechanisms of environment–mosquito–urban dengue transmission, we propose an empirical model parameterized and cross-validated from a unique dataset including viral gene sequences, vector dynamics and human dengue cases in Guangzhou, China, together with a 36-year urban environmental change maps investigated by spatiotemporal satellite image fusion. The dengue epidemics in Guangzhou are highly episodic and were not associated with annual rainfall over time. Our results indicate that urban environmental changes, especially variations in surface area covered by water in urban areas, can substantially alter the virus population and dengue transmission. The recent severe dengue outbreaks in Guangzhou may be due to the surge in an artificial lake construction, which could increase infection force between vector (mainly Aedes albopictus) and host when urban water area significantly increased. Impacts of urban environmental change on dengue dynamics may not have been thoroughly investigated in the past studies and more work needs to be done to better understand the consequences of urbanization processes in our changing world. - Highlights: • Urban dengue outbreak is associated with water area in Guangzhou, 1978–2014. • Surface water area can alter population size of dengue virus in urban area. • Urban dengue outbreak is not associated with annual rainfall in Guangzhou. • Spatiotemporal satellite image fusion can investigate urban environmental change. • Urban environmental change could induce virus, vector, and dengue epidemic change.

  8. Spreading of 137 C in the Goiania urban area by resuspension and transport of surface soil

    International Nuclear Information System (INIS)

    Rio, Monica Pires do; Amaral, Eliana


    The resuspension of surface soil was considered the mechanism responsible by the spreading of 137 Cs after the Goiania accident, which affected an urban area of about 1 km 2 . Studies on the transport of 137 Cs associated to the surface soil were performed in a house located at 57 th Street, close to the main focus of contamination, from 05/89 to 07/00. Periodically, samples of surface soil and soil profile were collected at the house yards and street dust sampling at representative locations was performed in order to know the extension of the contamination in the city. The soil profile samples have shown the low mobility of 137 Cs in deep layers of the soil, although a slight long-term decrease of the 137 Cs activity concentration in the surface soil were observed. The 137 Cs activity concentration in the street dust samples also decrease with time, suggesting a natural dilution of the contamination in those samples; higher values were only found in few locations close to the foci of primary deposition and no additional spreading of the radionuclide is expected to occur from that area. Street dust sampling is a suitable method to assess the spreading of caesium in urban environment. (author)

  9. Monitoring of Surface Subsidence of the Mining Area Based on Sbas (United States)

    Zhu, Y.; Zhou, S.; Zang, D.; Lu, T.


    This paper has collected 7 scenes of L band PALSAR sensor radar data of a mine in FengCheng city, jiangxi province, using the Small-baseline Subset (SBAS) method to invert the surface subsidence of the mine. Baselines of interference less than 800m has been chosen to constitute short baseline differential interference atlas, using pixels whose average coherent coefficient was larger than or equal to 0.3 as like high coherent point target, using singular value decomposition (SVD) method to calculate deformation phase sequence based on these high coherent points, and the accumulation of settlements of study area of different period had been obtained, so as to reflect the ground surface settlement evolution of the settlement of the area. The results of the study has showed that: SBAS technology has overcome coherent problem of the traditionality D-InSAR technique, continuous deformation field of surface mining in time dimension of time could been obtained, characteristics of ground surface settlement of mining subsidence in different period has been displayed, so to improve the accuracy and reliability of the monitoring results.

  10. Potential effects of groundwater and surface water contamination in an urban area, Qus City, Upper Egypt (United States)

    Abdalla, Fathy; Khalil, Ramadan


    The potential effects of anthropogenic activities, in particular, unsafe sewage disposal practices, on shallow groundwater in an unconfined aquifer and on surface water were evaluated within an urban area by the use of hydrogeological, hydrochemical, and bacteriological analyses. Physicochemical and bacteriological data was obtained from forty-five sampling points based on33 groundwater samples from variable depths and 12 surface water samples. The pollution sources are related to raw sewage and wastewater discharges, agricultural runoff, and wastewater from the nearby Paper Factory. Out of the 33 groundwater samples studied, 17 had significant concentrations of NO3-, Cl- and SO42-, and high bacteria counts. Most of the water samples from the wells contained high Fe, Mn, Pb, Zn, Cd, and Cr. The majority of surface water samples presented high NO3- concentrations and high bacteria counts. A scatter plot of HCO3- versus Ca indicates that 58% of the surface water samples fall within the extreme contamination zone, while the others are within the mixing zone; whereas 94% of groundwater samples showed evidence of mixing between groundwater and wastewater. The bacteriological assessment showed that all measured surface and groundwater samples contained Escherichia coli and total coliform bacteria. A risk map delineated four classes of contamination, namely, those sampling points with high (39.3%), moderate (36.3%), low (13.3%), and very low (11.1%) levels of contamination. Most of the highest pollution points were in the middle part of the urban area, which suffers from unmanaged sewage and industrial effluents. Overall, the results demonstrate that surface and groundwater in Qus City are at high risk of contamination by wastewater since the water table is shallow and there is a lack of a formal sanitation network infrastructure. The product risk map is a useful tool for prioritizing zones that require immediate mitigation and monitoring.

  11. Evolution of the Contact Area with Normal Load for Rough Surfaces: from Atomic to Macroscopic Scales. (United States)

    Huang, Shiping


    The evolution of the contact area with normal load for rough surfaces has great fundamental and practical importance, ranging from earthquake dynamics to machine wear. This work bridges the gap between the atomic scale and the macroscopic scale for normal contact behavior. The real contact area, which is formed by a large ensemble of discrete contacts (clusters), is proven to be much smaller than the apparent surface area. The distribution of the discrete contact clusters and the interaction between them are key to revealing the mechanism of the contacting solids. To this end, Green's function molecular dynamics (GFMD) is used to study both how the contact cluster evolves from the atomic scale to the macroscopic scale and the interaction between clusters. It is found that the interaction between clusters has a strong effect on their formation. The formation and distribution of the contact clusters is far more complicated than that predicted by the asperity model. Ignorance of the interaction between them leads to overestimating the contacting force. In real contact, contacting clusters are smaller and more discrete due to the interaction between the asperities. Understanding the exact nature of the contact area with the normal load is essential to the following research on friction.

  12. Decadal changes of surface elevation over permafrost area estimated using reflected GPS signals (United States)

    Liu, Lin; Larson, Kristine M.


    Conventional benchmark-based survey and Global Positioning System (GPS) have been used to measure surface elevation changes over permafrost areas, usually once or a few times a year. Here we use reflected GPS signals to measure temporal changes of ground surface elevation due to dynamics of the active layer and near-surface permafrost. Applying the GPS interferometric reflectometry technique to the multipath signal-to-noise ratio data collected by a continuously operating GPS receiver mounted deep in permafrost in Barrow, Alaska, we can retrieve the vertical distance between the antenna and reflecting surface. Using this unique kind of observables, we obtain daily changes of surface elevation during July and August from 2004 to 2015. Our results show distinct temporal variations at three timescales: regular thaw settlement within each summer, strong interannual variability that is characterized by a sub-decadal subsidence trend followed by a brief uplift trend, and a secular subsidence trend of 0.26 ± 0.02 cm year-1 during 2004 and 2015. This method provides a new way to fully utilize data from continuously operating GPS sites in cold regions for studying dynamics of the frozen ground consistently and sustainably over a long time.

  13. Corrective Action Decision Document for Corrective Action Unit 417: Central Nevada Test Area Surface, Nevada

    International Nuclear Information System (INIS)


    This Corrective Action Decision Document (CADD) identifies and rationalizes the U.S. Department of Energy, Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 417: Central Nevada Test Area Surface, Nevada, under the Federal Facility Agreement and Consent Order. Located in Hot Creek Valley in Nye County, Nevada, and consisting of three separate land withdrawal areas (UC-1, UC-3, and UC-4), CAU 417 is comprised of 34 corrective action sites (CASs) including 2 underground storage tanks, 5 septic systems, 8 shaker pad/cuttings disposal areas, 1 decontamination facility pit, 1 burn area, 1 scrap/trash dump, 1 outlier area, 8 housekeeping sites, and 16 mud pits. Four field events were conducted between September 1996 and June 1998 to complete a corrective action investigation indicating that the only contaminant of concern was total petroleum hydrocarbon (TPH) which was found in 18 of the CASs. A total of 1,028 samples were analyzed. During this investigation, a statistical approach was used to determine which depth intervals or layers inside individual mud pits and shaker pad areas were above the State action levels for the TPH. Other related field sampling activities (i.e., expedited site characterization methods, surface geophysical surveys, direct-push geophysical surveys, direct-push soil sampling, and rotosonic drilling located septic leachfields) were conducted in this four-phase investigation; however, no further contaminants of concern (COCs) were identified. During and after the investigation activities, several of the sites which had surface debris but no COCs were cleaned up as housekeeping sites, two septic tanks were closed in place, and two underground storage tanks were removed. The focus of this CADD was to identify CAAs which would promote the prevention or mitigation of human exposure to surface and subsurface soils with contaminant

  14. Investigation on the growth of DAST crystals of large surface area for THz applications

    International Nuclear Information System (INIS)

    Vijay, R. Jerald; Melikechi, N.; Thomas, Tina; Gunaseelan, R.; Arockiaraj, M. Antony; Sagayaraj, P.


    Graphical abstract: It is evident from the photographs that the crystal tend to grow as a needle (Fig. 1a) in the lower concentration region (2–3 g/200 mL); whereas, in the high concentration region (5 g/200 mL) though there is a marked enlargement in the size of the crystal, the morphology of the resulting DAST crystal is slightly irregular (Fig. 1d) in nature. Among the four concentrations employed, best result was obtained with the DAST–methanol solution of concentration 4 g/200 mL; which resulted in the DAST crystal of large surface area (270 mm 2 ) with high transparency and nearly square shape (Fig. 1c) in a growth period of 20–25 days. Highlights: ► DAST crystals of different sizes are obtained for different concentrations. ► The main focus is to grow DAST crystals with large surface area. ► Structural, optical, thermal and mechanical properties are investigated. - Abstract: The growth of high quality 4-N,N-dimethylamino-4-N-methyl-stilbazoliumtosylate (DAST) crystal with large surface area is reported by adopting the slope nucleation coupled slow evaporation method (SNM-SE). The structure and composition of the crystal are studied by single crystal X-ray diffraction and CHN analyses. The linear optical properties are investigated by UV–vis absorption. The melting point and thermal behavior of DAST are investigated using differential scanning calorimetric (DSC) and thermogravimetric analyses (TGA). The Vickers microhardness number (VHN) and work hardening coefficient of the grown crystal have been determined. The surface features of the DAST crystal are analyzed by scanning electron microscopy (SEM) and it confirmed the presence of narrow line defects (NLDs) in the sample.

  15. A Mathematical Method to Calculate Tumor Contact Surface Area: An Effective Parameter to Predict Renal Function after Partial Nephrectomy. (United States)

    Hsieh, Po-Fan; Wang, Yu-De; Huang, Chi-Ping; Wu, Hsi-Chin; Yang, Che-Rei; Chen, Guang-Heng; Chang, Chao-Hsiang


    We proposed a mathematical formula to calculate contact surface area between a tumor and renal parenchyma. We examined the applicability of using contact surface area to predict renal function after partial nephrectomy. We performed this retrospective study in patients who underwent partial nephrectomy between January 2012 and December 2014. Based on abdominopelvic computerized tomography or magnetic resonance imaging, we calculated the contact surface area using the formula (2*π*radius*depth) developed by integral calculus. We then evaluated the correlation between contact surface area and perioperative parameters, and compared contact surface area and R.E.N.A.L. (Radius/Exophytic/endophytic/Nearness to collecting system/Anterior/Location) score in predicting a reduction in renal function. Overall 35, 26 and 45 patients underwent partial nephrectomy with open, laparoscopic and robotic approaches, respectively. Mean ± SD contact surface area was 30.7±26.1 cm(2) and median (IQR) R.E.N.A.L. score was 7 (2.25). Spearman correlation analysis showed that contact surface area was significantly associated with estimated blood loss (p=0.04), operative time (p=0.04) and percent change in estimated glomerular filtration rate (p contact surface area and R.E.N.A.L. score independently affected percent change in estimated glomerular filtration rate (p contact surface area was a better independent predictor of a greater than 10% change in estimated glomerular filtration rate compared to R.E.N.A.L. score (AUC 0.86 vs 0.69). Using this simple mathematical method, contact surface area was associated with surgical outcomes. Compared to R.E.N.A.L. score, contact surface area was a better predictor of functional change after partial nephrectomy. Copyright © 2016 American Urological Association Education and Research, Inc. Published by Elsevier Inc. All rights reserved.

  16. Interaction between surface water areas and groundwater in Hanoi city, Viet Nam (United States)

    Hayashi, T.; Kuroda, K.; Do Thuan, A.; Tran Thi Viet, N.; Takizawa, S.


    Hanoi is the capital of Viet Nam and the second largest city in this country (population: 6.45 million in 2009). Hanoi city has developed along the Red River and has many lakes, ponds and canals. However, recent rapid urbanization of this city has reduced number of natural water areas such as ponds and lakes by reclamation not only in the central area but the suburban area. Canals also have been reclaimed or cut into pieces. Contrary, number of artificial water areas such as fish cultivation pond has rapidly increased. On the other hand, various kind of waste water flows into these natural and artificial water areas and induces pollution and eutrophication. These waste waters also have possibility of pollution of groundwater that is one of major water resources in this city. In addition, groundwater in this area has high concentrations of Arsenic, Fe and NH4. Thus, groundwater use may causes re-circulation of Arsenic. However, studies on the interaction between surface water areas and groundwater and on the role of surface water areas for solute transport with water cycle are a few. Therefore, we focused on these points and took water samples of river, pond and groundwater from four communities in suburban areas: two communities are located near the Red River and other two are far from the River. Also, columnar sediment samples of these ponds were taken and pore water was abstracted. Major dissolved ions, metals and stable isotopes of oxygen and hydrogen of water samples were analyzed. As for water cycle, from the correlation between δ18O and δD, the Red River water (after GNIR) were distributed along the LMWL (δD=8.2δ18O+14.1, calculated from precipitation (after GNIP)). On the other hand, although the pond waters in rainy season were distributed along the LMWL, that in dry season were distributed along the local evaporation line (LEL, slope=5.6). The LEL crossed with the LMWL at around the point of weighted mean values of precipitation in rainy season and of

  17. Influence of surface features of hydroxyapatite on the adsorption of proteins relevant to bone regeneration. (United States)

    Fernández-Montes Moraleda, Belén; San Román, Julio; Rodríguez-Lorenzo, Luís M


    Protein-surface interaction may determine the success or failure of an implanted device. Not much attention have been paid to the specific surface parametes of hydroxyapatite (OHAp) that modulates and determines the formation and potential activity of the layer of proteins that is first formed when the material get in contact with the host tissue. the influence of specific surface area (SSA), crystallite size (CS) and particle size (PS) of OHAp on the adsorption of proteins relevant for bone regeneration is evaluated in this article. OHAp have been prepared by a wet chemical reaction of Ca(OH)2 with H3PO4. One set of reactions included poly acrylic acid in the reactant solution to modify the properties of the powder. Fibrinogen (Fg) Fraction I, type I: from Human plasma, (67% Protein), and Fibronectin (Fn) from Human plasma were selected to perform the adsorption experiments. The analysis of protein adsorption was carried out by UV/Vis spectrometry. A lower SSA and a different aspect ratio are obtained when the acrylic acid is included in the reaction badge. The deconvolution of the amide I band on the Raman spectra of free and adsorbed proteins reveals that the interaction apatite-protein happens through the carboxylate groups of the proteins. The combined analysis of CS, SSA and PS should be considered on the design of OHAp materials intended to interact with proteins. Copyright © 2013 Wiley Periodicals, Inc.

  18. Probing hot-electron effects in wide area plasmonic surfaces using X-ray photoelectron spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Ayas, Sencer; Cupallari, Andi; Dana, Aykutlu, E-mail: [UNAM Institute of Materials Science and Nanotechnology, Bilkent University, 06800 Ankara (Turkey)


    Plasmon enhanced hot carrier formation in metallic nanostructures increasingly attracts attention due to potential applications in photodetection, photocatalysis, and solar energy conversion. Here, hot-electron effects in nanoscale metal-insulator-metal (MIM) structures are investigated using a non-contact X-ray photoelectron spectroscopy based technique using continuous wave X-ray and laser excitations. The effects are observed through shifts of the binding energy of the top metal layer upon excitation with lasers of 445, 532, and 650 nm wavelength. The shifts are polarization dependent for plasmonic MIM grating structures fabricated by electron beam lithography. Wide area plasmonic MIM surfaces fabricated using a lithography free route by the dewetting of evaporated Ag on HfO{sub 2} exhibit polarization independent optical absorption and surface photovoltage. Using a simple model and making several assumptions about the magnitude of the photoemission current, the responsivity and external quantum efficiency of wide area plasmonic MIM surfaces are estimated as 500 nA/W and 11 × 10{sup −6} for 445 nm illumination.

  19. High surface area mesoporous activated carbon-alginate beads for efficient removal of methylene blue. (United States)

    Nasrullah, Asma; Bhat, A H; Naeem, Abdul; Isa, Mohamed Hasnain; Danish, Mohammed


    High surface area mesoporous activated carbon-alginate (AC-alginate) beads were successfully synthesized by entrapping activated carbon powder derived from Mangosteen fruit peel into calcium-alginate beads for methylene blue (MB) removal from aqueous solution. The structure and surface characteristics of AC-alginate beads were analyzed using Fourier transform infra-red (FTIR) spectroscopy, scanning electron microscopy (SEM) and surface area analysis (S BET ), while thermal properties were tested using thermogravimetric analysis (TGA). The effect of AC-alginate dose, pH of solution, contact time, initial concentration of MB solution and temperature on MB removal was elucidated. The results showed that the maximum adsorption capacity of 230mg/g was achieved for 100mg/L of MB solution at pH 9.5 and temperature 25°C. Furthermore, the adsorption of MB on AC-alginate beads followed well pseudo-second order equation and equilibrium adsorption data were better fitted by the Freundlich isotherm model. The findings reveal the feasibility of AC-alginate beads composite to be used as a potential and low cost adsorbent for removal of cationic dyes. Copyright © 2017 Elsevier B.V. All rights reserved.

  20. Influence of Alkali Treatment on the Surface Area of Aluminium Dross

    Directory of Open Access Journals (Sweden)

    N. S. Ahmad Zauzi


    Full Text Available Aluminium dross is an industrial waste from aluminium refining industry and classified as toxic substances. However, the disposal of dross as a waste is a burden to aluminium manufacturer industries due to its negative effects to the ecosystem, surface, and ground water. Therefore the purpose of this study is to evaluate the influence of sodium hydroxide (NaOH on the surface area and pore size of aluminium dross. There were 3 stages in the treatment activities, which were leaching, precipitation, and calcination process. The optimum result from this study was the surface area of aluminium dross increases from 10.1 m2/g up to 80.0 m2/g at 40°C, 1% NaOH, and 15-minute reaction time. Thus, aluminium dross has a potential to be converted into other useful material such as catalyst and absorbent. The benefit of this research is that the hazardous industrial waste can be turned into wealth to be used in other applications such as in catalytic activities and absorber in waste water treatment. Further investigation on the physicochemical of aluminium dross with different acid or alkali should be conducted to get deeper understanding on the aluminium dross as a catalyst-type material.

  1. A highly permeable and enhanced surface area carbon-cloth electrode for vanadium redox flow batteries (United States)

    Zhou, X. L.; Zhao, T. S.; Zeng, Y. K.; An, L.; Wei, L.


    In this work, a high-performance porous electrode, made of KOH-activated carbon-cloth, is developed for vanadium redox flow batteries (VRFBs). The macro-scale porous structure in the carbon cloth formed by weaving the carbon fibers in an ordered manner offers a low tortuosity (∼1.1) and a broad pore distribution from 5 μm to 100 μm, rendering the electrode a high hydraulic permeability and high effective ionic conductivity, which are beneficial for the electrolyte flow and ion transport through the porous electrode. The use of KOH activation method to create nano-scale pores on the carbon-fiber surfaces leads to a significant increase in the surface area for redox reactions from 2.39 m2 g-1 to 15.4 m2 g-1. The battery assembled with the present electrode delivers an energy efficiency of 80.1% and an electrolyte utilization of 74.6% at a current density of 400 mA cm-2, as opposed to an electrolyte utilization of 61.1% achieved by using a conventional carbon-paper electrode. Such a high performance is mainly attributed to the combination of the excellent mass/ion transport properties and the high surface area rendered by the present electrode. It is suggested that the KOH-activated carbon-cloth electrode is a promising candidate in redox flow batteries.

  2. Characteristics of surface O{sub 3} over Qinghai Lake area in Northeast Tibetan Plateau, China

    Energy Technology Data Exchange (ETDEWEB)

    Shen, Zhenxing, E-mail: [Department of Environmental Sciences and Engineering, Xi' an Jiaotong University, Xi' an (China); Key Lab of Aerosol, SKLLQG, Institute of Earth Environment, Chinese Academy of Sciences, Xi' an (China); Cao, Junji [Key Lab of Aerosol, SKLLQG, Institute of Earth Environment, Chinese Academy of Sciences, Xi' an (China); Zhang, Leiming [Air Quality Research Division, Environment Canada, Toronto (Canada); Zhao, Zhuzi [Key Lab of Aerosol, SKLLQG, Institute of Earth Environment, Chinese Academy of Sciences, Xi' an (China); Dong, Jungang [School of Architecture, Xi' an University of Architecture and Technology, Xi' an 710055 (China); Wang, Linqing [Department of Environmental Sciences and Engineering, Xi' an Jiaotong University, Xi' an (China); Wang, Qiyuan; Li, Guohui; Liu, Suixin [Key Lab of Aerosol, SKLLQG, Institute of Earth Environment, Chinese Academy of Sciences, Xi' an (China); Zhang, Qian [Department of Environmental Sciences and Engineering, Xi' an Jiaotong University, Xi' an (China)


    Surface O{sub 3} was monitored continuously during Aug. 12, 2010 to Jul. 21, 2011 at a high elevation site (3200 m above sea level) in Qinghai Lake area (36°58′37″N, 99°53′56″E) in Northeast Tibetan Plateau, China. Daily average O{sub 3} ranged from 21.8 ppbv to 65.3 ppbv with an annual average of 41.0 ppbv. Seasonal average of O{sub 3} followed a decreasing order of summer > autumn > spring > winter. Diurnal variations of O{sub 3} showed low concentrations during daytime and high concentrations during late night and early morning. An intensive campaign was also conducted during Aug. 13–31, 2010 to investigate correlations between meteorological or chemical conditions and O{sub 3}. It was found that O{sub 3} was poorly correlated with solar radiation due to the insufficient NO{sub x} in the ambient air, thus limiting O{sub 3} formation under strong solar radiation. In contrast, high O{sub 3} levels always coincided with strong winds, suggesting that stratospheric O{sub 3} and long range transport might be the main sources of O{sub 3} in this rural area. Back-trajectory analysis supported this hypothesis and further indicated the transport of air masses from northwest, northeast and southeast directions. - Highlights: • Surface O{sub 3} was measured in Qinghai Lake area in Northeast Tibetan Plateau, China. • The O{sub 3} chemical formation was under a strong NOx-limited in Qinghai Lake areas. • Stratospheric O{sub 3} and transport might be the main sources of O{sub 3} in this area.

  3. Characteristics of surface O3 over Qinghai Lake area in Northeast Tibetan Plateau, China

    International Nuclear Information System (INIS)

    Shen, Zhenxing; Cao, Junji; Zhang, Leiming; Zhao, Zhuzi; Dong, Jungang; Wang, Linqing; Wang, Qiyuan; Li, Guohui; Liu, Suixin; Zhang, Qian


    Surface O 3 was monitored continuously during Aug. 12, 2010 to Jul. 21, 2011 at a high elevation site (3200 m above sea level) in Qinghai Lake area (36°58′37″N, 99°53′56″E) in Northeast Tibetan Plateau, China. Daily average O 3 ranged from 21.8 ppbv to 65.3 ppbv with an annual average of 41.0 ppbv. Seasonal average of O 3 followed a decreasing order of summer > autumn > spring > winter. Diurnal variations of O 3 showed low concentrations during daytime and high concentrations during late night and early morning. An intensive campaign was also conducted during Aug. 13–31, 2010 to investigate correlations between meteorological or chemical conditions and O 3 . It was found that O 3 was poorly correlated with solar radiation due to the insufficient NO x in the ambient air, thus limiting O 3 formation under strong solar radiation. In contrast, high O 3 levels always coincided with strong winds, suggesting that stratospheric O 3 and long range transport might be the main sources of O 3 in this rural area. Back-trajectory analysis supported this hypothesis and further indicated the transport of air masses from northwest, northeast and southeast directions. - Highlights: • Surface O 3 was measured in Qinghai Lake area in Northeast Tibetan Plateau, China. • The O 3 chemical formation was under a strong NOx-limited in Qinghai Lake areas. • Stratospheric O 3 and transport might be the main sources of O 3 in this area

  4. Assessment of mercury erosion by surface water in Wanshan mercury mining area. (United States)

    Dai, ZhiHui; Feng, Xinbin; Zhang, Chao; Shang, Lihai; Qiu, Guangle


    Soil erosion is a main cause of land degradation, and in its accelerated form is also one of the most serious ecological environmental problems. Moreover, there are few studies on migration of mercury (Hg) induced by soil erosion in seriously Hg-polluted districts. This paper selected Wanshan Hg mining area, SW China as the study area. Revised universal soil loss equation (RUSLE) and Geographic information system (GIS) methods were applied to calculate soil and Hg erosion and to classify soil erosion intensity. Our results show that the soil erosion rate can reach up to 600,884tkm(-2)yr(-1). Surfaces associated with very slight and extremely severe erosion include 76.6% of the entire land in Wanshan. Furthermore, the cumulative erosion rates in the area impacted by extremely severe erosion make up 90.5% of the total. On an annual basis, Hg surface erosion load was predicted to be 505kgyr(-1) and the corresponding mean migration flux of Hg was estimated to be 3.02kgkm(-2)yr(-1). The erosion loads of Hg resulting from farmland and meadow soil were 175 and 319kgyr(-1) respectively, which were enhanced compared to other landscape types due to the fact that they are generally located in the steep zones associated with significant reclamation. Contributing to establish a mass balance of Hg in Wanshan Hg mining area, this study supplies a dependable scientific basis for controlling soil and water erosion in the local ecosystems. Land use change is the most effective way for reducing Hg erosion load in Wanshan mining area. Copyright © 2013 Elsevier Inc. All rights reserved.

  5. Fabrication of a Horizontal and a Vertical Large Surface Area Nanogap Electrochemical Sensor

    Directory of Open Access Journals (Sweden)

    Jules L. Hammond


    Full Text Available Nanogap sensors have a wide range of applications as they can provide accurate direct detection of biomolecules through impedimetric or amperometric signals. Signal response from nanogap sensors is dependent on both the electrode spacing and surface area. However, creating large surface area nanogap sensors presents several challenges during fabrication. We show two different approaches to achieve both horizontal and vertical coplanar nanogap geometries. In the first method we use electron-beam lithography (EBL to pattern an 11 mm long serpentine nanogap (215 nm between two electrodes. For the second method we use inductively-coupled plasma (ICP reactive ion etching (RIE to create a channel in a silicon substrate, optically pattern a buried 1.0 mm × 1.5 mm electrode before anodically bonding a second identical electrode, patterned on glass, directly above. The devices have a wide range of applicability in different sensing techniques with the large area nanogaps presenting advantages over other devices of the same family. As a case study we explore the detection of peptide nucleic acid (PNA−DNA binding events using dielectric spectroscopy with the horizontal coplanar device.

  6. Estimating Surface Area of Sponges and Marine Gorgonians as Indicators of Habitat Availability on Caribbean Coral Reefs (United States)

    Surface area and topographical complexity are fundamental attributes of shallow tropical coral reefs and can be used to estimate habitat for fish and invertebrates. This study presents empirical methods for estimating surface area provided by sponges and gorgonians in the Central...

  7. Atomic layer deposition of highly dispersed Pt nanoparticles on a high surface area electrode backbone for electrochemical promotion of catalysis

    NARCIS (Netherlands)

    Hajar, Y.; di Palma, V.; Kyriakou, V.; Verheijen, M. A.; Baranova, E. A.; Vernoux, P.; Kessels, W. M. M.; Creatore, M.; van de Sanden, M. C. M.; Tsampas, M. N.


    A novel catalyst design for electrochemical promotion of catalysis (EPOC) is proposed which overcomes the main bottlenecks that limit EPOC commercialization, i.e., the low dispersion and small surface area of metal catalysts. We have increased the surface area by using a porous composite electrode

  8. Brain surface anatomy in adults with autism: the relationship between surface area, cortical thickness, and autistic symptoms. (United States)

    Ecker, Christine; Ginestet, Cedric; Feng, Yue; Johnston, Patrick; Lombardo, Michael V; Lai, Meng-Chuan; Suckling, John; Palaniyappan, Lena; Daly, Eileen; Murphy, Clodagh M; Williams, Steven C; Bullmore, Edward T; Baron-Cohen, Simon; Brammer, Michael; Murphy, Declan G M


    Neuroimaging studies of brain anatomy in autism spectrum disorder (ASD) have mostly been based on measures of cortical volume (CV). However, CV is a product of 2 distinct parameters, cortical thickness (CT) and surface area (SA), that in turn have distinct genetic and developmental origins. To investigate regional differences in CV, SA, and CT as well as their relationship in a large and well-characterized sample of men with ASD and matched controls. Multicenter case-control design using quantitative magnetic resonance imaging. Medical Research Council UK Autism Imaging Multicentre Study. A total of 168 men, 84 diagnosed as having ASD and 84 controls who did not differ significantly in mean (SD) age (26 [7] years vs 28 [6] years, respectively) or full-scale IQ (110 [14] vs 114 [12], respectively). Between-group differences in CV, SA, and CT investigated using a spatially unbiased vertex-based approach; the degree of spatial overlap between the differences in CT and SA; and their relative contribution to differences in regional CV. Individuals with ASD differed from controls in all 3 parameters. These mainly consisted of significantly increased CT within frontal lobe regions and reduced SA in the orbitofrontal cortex and posterior cingulum. These differences in CT and SA were paralleled by commensurate differences in CV. The spatially distributed patterns for CT and SA were largely nonoverlapping and shared only about 3% of all significantly different locations on the cerebral surface. Individuals with ASD have significant differences in CV, but these may be underpinned by (separable) variations in its 2 components, CT and SA. This is of importance because both measures result from distinct developmental pathways that are likely modulated by different neurobiological mechanisms. This finding may provide novel targets for future studies into the etiology of the condition and a new way to fractionate the disorder.

  9. Body surface area determined by whole-body CT scanning: need for new formulae?

    DEFF Research Database (Denmark)

    Villa, Chiara; Primeau, Charlotte; Hesse, Ulrik


    Calculation of the estimated body surface area (BSA) by body height and weight has been a challenge in the past centuries due to lack of a well-documented gold standard. More recently, available techniques such as 3D laser surface scanning and CT scanning may be expected to quantify the BSA...... Mimics software, and BSA values were automatically extracted from the program. They were compared with nine predictive equations from the literature. Remarkably, close correlations (r > 0·90) were found between BSA values from CT scans and those from the predictive formulae. A mean BSA of the 54 cadavers...... equations, with the CT scan determination as gold standard. It is concluded that DuBois and DuBois' equation can be safely used in normal-weight male subjects with high accuracy, but it seems likely that BSA is underestimated in underweight subjects and overestimated in overweight individuals. Creation...

  10. Replication fidelity assessment of large area sub-μm structured polymer surfaces using scatterometry

    International Nuclear Information System (INIS)

    Calaon, M; Hansen, H N; Tosello, G; Madsen, M H; Weirich, J; Hansen, P E; Garnaes, J; Tang, P T


    The present study addresses one of the key challenges in the product quality control of transparent structured polymer substrates, the replication fidelity of sub-μm structures over a large area. Additionally the work contributes to the development of new techniques focused on in-line characterization of large nanostructured surfaces using scatterometry. In particular an approach to quantify the replication fidelity of high volume manufacturing processes such as polymer injection moulding is presented. Both periodic channels and semi-spherical structures were fabricated on nickel shims used for later injection moulding of Cyclic-olefin-copolymer (COC) substrate were the sub-μm features where ultimately transferred. The scatterometry system was validated using calibrated atomic force microscopy measurements and a model based on scalar diffraction theory employed to calculate the expected angular distribution of the reflected and the transmitted intensity for the nickel surfaces and structured COC and, respectively. (paper)

  11. Analysis and Application of River Surface Line in Hilly Area based on Hec-ras Model

    Directory of Open Access Journals (Sweden)

    Yang Congshan


    Full Text Available For example—Cixian Fuyang River Regulation Project. Due to the character that Fuyang River is located in hilly areas of Cixian, we use the Hex-ras software to calculate the status of the river water surface line for the goal of determining the final treatment plan. We maintain the present situation of the river channel design as principle, select the most appropriate pushed water level and roughnessas the basic, and we combine the classification calculation of crossing structures of backwater and the encryption calculation section to get the more accurate result. We compare the water level elevation and the calculation of cross strait, analyze the design parameters, calculate repeated the water line section, analyze the rationality of the design plan, and then finally determine the applicability of Hex-rac software in the large continuous variation of cross section of embankment of river river surface line.

  12. GC/MS analysis of pesticides in the Ferrara area (Italy) surface water: a chemometric study. (United States)

    Pasti, Luisa; Nava, Elisabetta; Morelli, Marco; Bignami, Silvia; Dondi, Francesco


    The development of a network to monitor surface waters is a critical element in the assessment, restoration and protection of water quality. In this study, concentrations of 42 pesticides--determined by GC-MS on samples from 11 points along the Ferrara area rivers--have been analyzed by chemometric tools. The data were collected over a three-year period (2002-2004). Principal component analysis of the detected pesticides was carried out in order to define the best spatial locations for the sampling points. The results obtained have been interpreted in view of agricultural land use. Time series data regarding pesticide contents in surface waters has been analyzed using the Autocorrelation function. This chemometric tool allows for seasonal trends and makes it possible to optimize sampling frequency in order to detect the effective maximum pesticide content.

  13. GC/MS Analysis of Pesticides in the Ferrara Area (Italy) Surface Water: A Chemometric Study

    International Nuclear Information System (INIS)

    Pasti, L.; Dondi, F.; Nava, E.; Morelli, M.; Bignami, S.


    The development of a network to monitor surface waters is a critical element in the assessment, restoration and protection of water quality. In this study, concentrations of 42 pesticides - determined by GC-MS on samples from 11 points along the Ferrara area rivers - have been analyzed by chemometric tools. The data were collected over a three-year period (2002-2004). Principal component analysis of the detected pesticides was carried out in order to define the best spatial locations for the sampling points. The results obtained have been interpreted in view of agricultural land use. Time series data regarding pesticide contents in surface waters has been analyzed using the Autocorrelation function. This chemometric tool allows for seasonal trends and makes it possible to optimize sampling frequency in order to detect the effective maximum pesticide content

  14. Can We Trust Real Time Measurements of Lung Deposited Surface Area Concentrations in Dust from Powder Nanomaterials?

    DEFF Research Database (Denmark)

    Levin, Marcus; Witschger, Olivier; Bau, Sebastien


    A comparison between various methods for real-time measurements of lung deposited surface area (LDSA) using spherical particles and powder dust with specific surface area ranging from 0.03 to 112 m2 g-1 was conducted. LDSA concentrations measured directly using Nanoparticle Surface Area Monitor...... gravimetrical filter measurements and specific surface areas. Measurement of LDSA showed very good correlation in measurements of spherical particles (R2 > 0.97, Ratio 1.0 to 1.04). High surface area nanomaterial powders showed a fairly reliable correlation between NSAM and Aerotrak (R2 0...... present. We conclude that there is currently insufficient reliability and comparability between methods in the measurement of LDSA concentrations. Further development is required to enable use of LDSA for reliable dose metric and regulatory enforcement of exposure....

  15. Understanding Large-scale Structure in the SSA22 Protocluster Region Using Cosmological Simulations (United States)

    Topping, Michael W.; Shapley, Alice E.; Steidel, Charles C.; Naoz, Smadar; Primack, Joel R.


    We investigate the nature and evolution of large-scale structure within the SSA22 protocluster region at z = 3.09 using cosmological simulations. A redshift histogram constructed from current spectroscopic observations of the SSA22 protocluster reveals two separate peaks at z = 3.065 (blue) and z = 3.095 (red). Based on these data, we report updated overdensity and mass calculations for the SSA22 protocluster. We find {δ }b,{gal}=4.8+/- 1.8 and {δ }r,{gal}=9.5+/- 2.0 for the blue and red peaks, respectively, and {δ }t,{gal}=7.6+/- 1.4 for the entire region. These overdensities correspond to masses of {M}b=(0.76+/- 0.17)× {10}15{h}-1 {M}ȯ , {M}r=(2.15+/- 0.32)× {10}15{h}-1 {M}ȯ , and {M}t=(3.19+/- 0.40)× {10}15{h}-1 {M}ȯ for the red, blue, and total peaks, respectively. We use the Small MultiDark Planck (SMDPL) simulation to identify comparably massive z∼ 3 protoclusters, and uncover the underlying structure and ultimate fate of the SSA22 protocluster. For this analysis, we construct mock redshift histograms for each simulated z∼ 3 protocluster, quantitatively comparing them with the observed SSA22 data. We find that the observed double-peaked structure in the SSA22 redshift histogram corresponds not to a single coalescing cluster, but rather the proximity of a ∼ {10}15{h}-1 {M}ȯ protocluster and at least one > {10}14{h}-1 {M}ȯ cluster progenitor. Such associations in the SMDPL simulation are easily understood within the framework of hierarchical clustering of dark matter halos. We finally find that the opportunity to observe such a phenomenon is incredibly rare, with an occurrence rate of 7.4{h}3 {{{Gpc}}}-3. Based on data obtained at the W.M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration, and was made possible by the generous financial support of the W.M. Keck Foundation.

  16. Improved capacity to evaluate changes in intestinal mucosal surface area using mathematical modeling. (United States)

    Greig, Chasen J; Cowles, Robert A


    Quantification of intestinal mucosal growth typically relies on morphometric parameters, commonly villus height, as a surrogate for presumed changes in mucosal surface area (MSA). We hypothesized that using mathematical modeling based on multiple unique measurements would improve discrimination of the effects of interventions on MSA compared to standard measures. To determine the ability of mathematical modeling to resolve differences in MSA, a mouse model with enhanced serotonin (5HT) signaling known to stimulate mucosal growth was used. 5-HT signaling is potentiated by targeting the serotonin reuptake transporter (SERT) molecule. Selective serotonin reuptake inhibitor-treated wild-type (WT-SSRI), SERT-knockout (SERTKO), and wild-type C57Bl/6 (WT) mice were used. Distal ileal sections were H&E-stained. Villus height (VH), width (VW), crypt width (CW), and bowel diameter were used to calculate surface area enlargement factor (SEF) and MSA. VH alone for SERTKO and SSRI was significantly increased compared to WT, without a difference between SERTKO and WT-SSRI. VW and CW were significantly decreased for both SERTKO and WT-SSRI compared to WT, and VW for WT-SSRI was also decreased compared to SERTKO. These changes increased SEF and MSA for SERTKO and WT-SSRI compared to WT. Additionally, SEF and MSA were significantly increased for WT-SSRI compared to SERTKO. Mathematical modeling provides a valuable tool for differentiating changes in intestinal MSA. This more comprehensive assessment of surface area does not appear to correlate linearly with standard morphometric measures and represents a more comprehensive method for discriminating between therapies aimed at increasing functional intestinal mucosa. © 2017 Wiley Periodicals, Inc.

  17. Synthesis of partially graphitic ordered mesoporous carbons with high surface areas

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Wenjun; Wan, Ying [Department of Chemistry, Key Laboratory of Resource Chemistry of Ministry of Education, Shanghai Normal University, Shanghai 200234 (China); Dou, Yuqian; Zhao, Dongyuan [Department of Chemistry, Shanghai Key Laboratory of Molecular Catalysis and Innovative Materials, Fudan University, Shanghai 200433 (China)


    Graphitic carbons with ordered mesostructure and high surface areas (of great interest in applications such as energy storage) have been synthesized by a direct triblock-copolymer-templating method. Pluronic F127 is used as a structure-directing agent, with a low-molecular-weight phenolic resol as a carbon source, ferric oxide as a catalyst, and silica as an additive. Inorganic oxides can be completely eliminated from the carbon. Small-angle XRD and N{sub 2} sorption analysis show that the resultant carbon materials possess an ordered 2D hexagonal mesostructure, uniform bimodal mesopores (about 1.5 and 6 nm), high surface area ({proportional_to}1300 m{sup 2}/g), and large pore volumes ({proportional_to}1.50 cm{sup 3}/g) after low-temperature pyrolysis (900 C). All surface areas come from mesopores. Wide-angle XRD patterns demonstrate that the presence of the ferric oxide catalyst and the silica additive lead to a marked enhancement of graphitic ordering in the framework. Raman spectra provide evidence of the increased content of graphitic sp{sup 2} carbon structures. Transmission electron microscopy images confirm that numerous domains in the ordered mesostructures are composed of characteristic graphitic carbon nanostructures. The evolution of the graphitic structure is dependent on the temperature and the concentrations of the silica additive, and ferric oxide catalyst. Electrochemical measurements performed on this graphitic mesoporous carbon when used as an electrode material for an electrochemical double layer capacitor shows rectangular-shaped cyclic voltammetry curves over a wide range of scan rates, even up to 200 mV/s, with a large capacitance of 155 F/g in KOH electrolyte. This method can be widely applied to the synthesis of graphitized carbon nanostructures. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  18. The Investigation of a Sinkhole Area in Germany by Near-Surface Active Seismic Tomography (United States)

    Tschache, S.; Becker, D.; Wadas, S. H.; Polom, U.; Krawczyk, C. M.


    In November 2010, a 30 m wide and 17 m deep sinkhole occurred in a residential area of Schmalkalden, Germany, which fortunately did not harm humans, but led to damage of buildings and property. Subsequent geoscientific investigations showed that the collapse was naturally caused by the subrosion of sulfates in a depth of about 80 m. In 2012, an early warning system was established including 3C borehole geophones deployed in 50 m depth around the backfilled sinkhole. During the acquisition of two shallow 2D shear wave seismic profiles, the signals generated by a micro-vibrator at the surface were additionally recorded by the four borehole geophones of the early warning system and a VSP probe in a fifth borehole. The travel time analysis of the direct arrivals enhanced the understanding of wave propagation in the area. Seismic velocity anomalies were detected and related to structural seismic images of the 2D profiles. Due to the promising first results, the experiment was further extended by distributing vibration points throughout the whole area around the sinkhole. This time, micro-vibrators for P- and S-wave generation were used. The signals were recorded by the borehole geophones and temporary installed seismometers at surface positions close to the boreholes. The travel times and signal attenuations are evaluated to detect potential instable zones. Furthermore, array analyses are performed. The first results reveal features in the active tomography datasets consistent with structures observed in the 2D seismic images. The advantages of the presented method are the low effort and good repeatability due to the permanently installed borehole geophones. It has the potential to determine P-wave and S-wave velocities in 3D. It supports the interpretation of established investigation methods as 2D surface seismics and VSP. In our further research we propose to evaluate the suitability of the method for the time lapse monitoring of changes in the seismic wave

  19. Selective Area Modification of Silicon Surface Wettability by Pulsed UV Laser Irradiation in Liquid Environment. (United States)

    Liu, Neng; Moumanis, Khalid; Dubowski, Jan J


    The wettability of silicon (Si) is one of the important parameters in the technology of surface functionalization of this material and fabrication of biosensing devices. We report on a protocol of using KrF and ArF lasers irradiating Si (001) samples immersed in a liquid environment with low number of pulses and operating at moderately low pulse fluences to induce Si wettability modification. Wafers immersed for up to 4 hr in a 0.01% H2O2/H2O solution did not show measurable change in their initial contact angle (CA) ~75°. However, the 500-pulse KrF and ArF lasers irradiation of such wafers in a microchamber filled with 0.01% H2O2/H2O solution at 250 and 65 mJ/cm(2), respectively, has decreased the CA to near 15°, indicating the formation of a superhydrophilic surface. The formation of OH-terminated Si (001), with no measurable change of the wafer's surface morphology, has been confirmed by X-ray photoelectron spectroscopy and atomic force microscopy measurements. The selective area irradiated samples were then immersed in a biotin-conjugated fluorescein-stained nanospheres solution for 2 hr, resulting in a successful immobilization of the nanospheres in the non-irradiated area. This illustrates the potential of the method for selective area biofunctionalization and fabrication of advanced Si-based biosensing architectures. We also describe a similar protocol of irradiation of wafers immersed in methanol (CH3OH) using ArF laser operating at pulse fluence of 65 mJ/cm(2) and in situ formation of a strongly hydrophobic surface of Si (001) with the CA of 103°. The XPS results indicate ArF laser induced formation of Si-(OCH3)x compounds responsible for the observed hydrophobicity. However, no such compounds were found by XPS on the Si surface irradiated by KrF laser in methanol, demonstrating the inability of the KrF laser to photodissociate methanol and create -OCH3 radicals.

  20. Estimation of surface area and pore volume of activated carbons by methylene blue and iodine numbers

    Directory of Open Access Journals (Sweden)

    Cleiton A. Nunes


    Full Text Available Data of methylene blue number and iodine number of activated carbons samples were calibrated against the respective surface area, micropore volume and total pore volume using multiple regression. The models obtained from the calibrations were used in predicting these physical properties of a test group of activated carbon samples produced from several raw materials. In all cases, the predicted values were in good agreement with the expected values. The method allows extracting more information from the methylene blue and iodine adsorption studies than normally obtained with this type of material.

  1. Size-Dependent Specific Surface Area of Nanoporous Film Assembled by Core-Shell Iron Nanoclusters

    Directory of Open Access Journals (Sweden)

    Jiji Antony


    Full Text Available Nanoporous films of core-shell iron nanoclusters have improved possibilities for remediation, chemical reactivity rate, and environmentally favorable reaction pathways. Conventional methods often have difficulties to yield stable monodispersed core-shell nanoparticles. We produced core-shell nanoclusters by a cluster source that utilizes combination of Fe target sputtering along with gas aggregations in an inert atmosphere at 7∘C. Sizes of core-shell iron-iron oxide nanoclusters are observed with transmission electron microscopy (TEM. The specific surface areas of the porous films obtained from Brunauer-Emmett-Teller (BET process are size-dependent and compared with the calculated data.

  2. Ocular surface area and human eye blink frequency during VDU work

    DEFF Research Database (Denmark)

    Nielsen, Pernille Kofoed; Søgaard, Karen; Skotte, Jørgen


    . The low BF during the active task was succeded by a burst with high BF after cessation of the active task, indicating a compensatory blinking process. This stresses that interchange of work tasks with different cognitive load is as important as the monitor position in the prevention of visual......The purpose of this study was to investigate how the ocular surface area (OSA) and the eye blink frequency (BF) are affected by a high versus a low-monitor position during visual display unit (VDU) work with varying cognitive demands. In a balanced randomized (2 x 2) design ten healthy subjects...

  3. Agriculture and brown coal surface mining. The example of the Rhenish brown coal mining area

    International Nuclear Information System (INIS)

    Heck, B.


    Extensive surface mining in the Rhenish brown coal exploitation area has led to marked changes to the environment and living conditions there. This applies particularly to agriculture, which now has to subsist with a competitor for land. The progressive sacrifice of farmland and widespread relocation compaigns are grossly interfering with the business of farming. Only in exceptional cases do farms move as part of the relocation of whole villages. New sites are often found in hamlets and group settlements. This happens in connection with farming of newly reclaimed land or recultivated land reorganised and returned in land consolidation campaigns. (orig.) [de

  4. Quantification of aluminium-27 NMR spectra of high-surface-area oxides

    International Nuclear Information System (INIS)

    Pearson, R.M.; Schramm, C.M.


    This paper discusses the quantitation of 27 Al NMR spectra. It is showns that the so called 'invisible' aluminium atoms seen by recent workers are completely consistent with known continuous wave NMR studies of the 27 Al NMR spectra of high surface area aluminium oxides. The use of pulsed NMR techniques further complicate the quantitative measurement of 27 Al NMR spectra, especially when high resolution NMR spectrometers are used for this purpose. Methods are described which allow both the estimation of aluminium not seen by continuous wave techniques and the amounts of the NMR spectra lost in pulsed work. (author). 24 refs.; 6 figs.; 1 tab

  5. A microbial-mineralization approach for syntheses of iron oxides with a high specific surface area. (United States)

    Yagita, Naoki; Oaki, Yuya; Imai, Hiroaki


    Of minerals and microbes: A microbial-mineralization-inspired approach was used to facilitate the syntheses of iron oxides with a high specific surface area, such as 253 m(2)g(-1) for maghemite (γ-Fe(2)O(3)) and 148 m(2)g(-1) for hematite (α-Fe(2)O(3)). These iron oxides can be applied to electrode material of lithium-ion batteries, adsorbents, and catalysts. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. Surface area and chemical reactivity characteristics of uranium metal corrosion products.

    Energy Technology Data Exchange (ETDEWEB)

    Totemeier, T. C.


    The results of an initial characterization of hydride-containing corrosion products from uranium metal Zero Power Physics Reactor (ZPPR) fuel plates are presented. Sorption analyses using the BET method with a Kr adsorbate were performed to measure the specific areas of corrosion product samples. The specific surface areas of the corrosion products varied from 0.66 to 1.01 m{sup 2}/g. The reactivity of the products in Ar-9%O{sub 2} and Ar-20%O{sub 2} were measured at temperatures between 35 C and 150 C using a thermo-gravimetric analyzer. Ignition of the products occurred at temperatures of 150 C and above. The oxidation rates below ignition were comparable to rates observed for uranium metal.

  7. Surface area and chemical reactivity characteristics of uranium metal corrosion products

    International Nuclear Information System (INIS)

    Totemeier, T. C.


    The results of an initial characterization of hydride-containing corrosion products from uranium metal Zero Power Physics Reactor (ZPPR) fuel plates are presented. Sorption analyses using the BET method with a Kr adsorbate were performed to measure the specific areas of corrosion product samples. The specific surface areas of the corrosion products varied from 0.66 to 1.01 m 2 /g. The reactivity of the products in Ar-9%O 2 and Ar-20%O 2 were measured at temperatures between 35 C and 150 C using a thermo-gravimetric analyzer. Ignition of the products occurred at temperatures of 150 C and above. The oxidation rates below ignition were comparable to rates observed for uranium metal

  8. Radioecological state of some surface water systems of contaminated areas of both Gomel and Mogilev Regions

    International Nuclear Information System (INIS)

    Datskevich, P. I.; Komissariv, F. D.; Khvale', O. D.; Basharina, L. P.; Lobach, I. L.


    The radioecological situation of different ecosystems of Belarus and their components has been analysed. Such components of the surface water ecosystems as water, suspensions, sediments and soils of water-collection areas were used for the investigation of the content of cesium 137 and strontium 90. The received data were given since 1990. The content of cesium 137 and strontium 90 in the components of water ecosystems was counted in the laboratory conditions by means of standard methods of beta radiometry, semiconductor gamma spectrometry and radiochemistry. The error of measurement of radioactivity was not higher than 25 and 35% for cesium 137 and strontium 90 accordingly. Water ecosystems were distinguished by the state of contamination of water-collection areas and hydrological parameters. These and some other reasons considered in the article influence on the character of cesium 137 and strontium 90 behaviour in water ecosystems

  9. High Surface Area Nanoporous Ti02 Coating for Effective Water Condensation. (United States)

    Kaynar, Mehmet; McGarity, Mark; Yassitepe, Emre; Shah, S.


    A water collection device utilizing nanoparticles has been researched, towards the possible goal of providing water in much needed areas on Earth. Titanium dioxide nanoparticles were spray coated on stainless steel substrates to measure their effect on atmospheric water condensation. A simple thermoelectric cooler, also called a Peltier device, was used to lower the temperature of the coated and uncoated stainless steel substrates to below the dew point temperature of the surrounding air. The thickness of the spray coating was varied to measure its effect on water condensation. This increase in surface area had a direct effect on the amount of water condensed. Compared with bare stainless steel, the TiO2 spray coated stainless steel had a considerably smaller contact angle of H20 droplets. In addition, the super-hydrophilic properties of TiO2 allowed water to flow more easily off the device. Supported by TUBITAK-BIDEB 2214-Abroad Research Scholarship program.

  10. Remote Ultra-low Light Imaging (RULLI) For Space Situational Awareness (SSA): Modeling And Simulation Results For Passive And Active SSA

    International Nuclear Information System (INIS)

    Thompson, David C.; Shirey, Robert L.; Roggemann, Michael C; Gudimetla, Rao


    Remote Ultra-Low Light Imaging detectors are photon limited detectors developed at Los Alamos National Laboratories. RULLI detectors provide a very high degree of temporal resolution for the arrival times of detected photoevents, but saturate at a photo-detection rate of about 10 6 photo-events per second. Rather than recording a conventional image, such as output by a charged coupled device (CCD) camera, the RULLI detector outputs a data stream consisting of the two-dimensional location, and time of arrival of each detected photo-electron. Hence, there is no need to select a specific exposure time to accumulate photo-events prior to the data collection with a RULLI detector this quantity can be optimized in post processing. RULLI detectors have lower peak quantum efficiency (from as low as 5% to perhaps as much as 40% with modern photocathode technology) than back-illuminated CCD's (80% or higher). As a result of these factors, and the associated analyses of signal and noise, we have found that RULLI detectors can play two key new roles in SSA: passive imaging of exceedingly dim objects, and three-dimensional imaging of objects illuminated with an appropriate pulsed laser. In this paper we describe the RULLI detection model, compare it to a conventional CCD detection model, and present analytic and simulation results to show the limits of performance of RULLI detectors used for SSA applications at AMOS field site

  11. Coherence of land surface layout as intangible environmental resource (Vooremaa landscape protection area, Estonia

    Directory of Open Access Journals (Sweden)

    Oleksandr Karasov


    Full Text Available Vooremaa Landscape Protection Area provides a specimen of native Estonian agricultural lands, alternating with picturesque moraine lakes. The overall visual environment within this area was basically changed by glacial agents and, hereafter, by cultural activities, such as crop farming. Topography consists of about 100 drumlins (some of them are cultivated, as well as depressions, filled with lakes and covered by forests and grasslands. A rich combination of the mentioned factors determined the study area selection. There was accepted, that the harmony, or pleasing organization of distinguishable units of visual environment (with no attention to their colours or textures, but regarding their geographical meaning only, depends on the system effect: the more complexity of the overall system exceeds the algebraic sum of the complexity of its components, the more its organization does. In this way, some developments of information theory could be applied to the analysis of visual environment (from top view, similarly to the analysis of the text (considering units of land relief, land cover, and land cover relief, or a land surface in total, as the symbols of some alphabet, and their diversity within the floating circle – as words, consisting of the symbols. Since mentioned notions of organization and harmony are frequently implied in the concept of landscape coherence, the latter term was used as a fixed and well-known one in the landscape and environmental aesthetics. Hartley’s formula was used to compute the coherence of the land surface layout and the respective regionalization within the study area and surroundings. The effectiveness of the proposed method for representation of visual harmony was non-rigorously verified with transect of Google Street View panoramic photo series, while everyone is welcomed to use the Google Street View to compare the presented results with his own conclusions. There was found, that the proposed index

  12. On the relationship between enamel band complexity and occlusal surface area in Equids (Mammalia, Perissodactyla

    Directory of Open Access Journals (Sweden)

    Nicholas A. Famoso


    Full Text Available Enamel patterns on the occlusal surfaces of equid teeth are asserted to have tribal-level differences. The most notable example compares the Equini and Hipparionini, where Equini have higher crowned teeth with less enamel-band complexity and less total occlusal enamel than Hipparionini. Whereas previous work has successfully quantified differences in enamel band shape by dividing the length of enamel band by the square root of the occlusal surface area (Occlusal Enamel Index, OEI, it was clear that OEI only partially removes the effect of body size. Because enamel band length scales allometrically, body size still has an influence on OEI, with larger individuals having relatively longer enamel bands than smaller individuals. Fractal dimensionality (D can be scaled to any level, so we have used it to quantify occlusal enamel complexity in a way that allows us to get at an accurate representation of the relationship between complexity and body size. To test the hypothesis of tribal-level complexity differences between Equini and Hipparionini, we digitally traced a sample of 98 teeth, one tooth per individual; 31 Hipparionini and 67 Equini. We restricted our sampling to the P3-M2 to reduce the effect of tooth position. After calculating the D of these teeth with the fractal box method which uses the number of boxes of various sizes to calculate the D of a line, we performed a t-test on the individual values of D for each specimen, comparing the means between the two tribes, and a phylogenetically informed generalized least squares regression (PGLS for each tribe with occlusal surface area as the independent variable and D as the dependent variable. The slopes of both PGLS analyses were compared using a t-test to determine if the same linear relationship existed between the two tribes. The t-test between tribes was significant (p < 0.0001, suggesting different D populations for each lineage. The PGLS for Hipparionini was a positive but not

  13. The use of large surface area for particle and power deposition

    International Nuclear Information System (INIS)

    Seigneur, A.; Guilhem, D.; Hogan, J.


    Since the parallel heat flux passing through the LCFS has increased dramatically with the size of machines one has to cope with very large particle and power fluxes on the limiters. Thus the size of the limiters has been increased by the use of inner bumper limiters (for example in JET, TFTR, TORE-SUPRA and JT60). The 'exponential-sine' model is widely used to estimate the heat flux (Q) to a wall for a plasma flux surface with incident angle θ. The model predict Q = q || (0) sinθ e -ρ/λ q + q(0) cosθ e -ρ/λ q , (where θ=0 o when the flux surface is exactly tangential to the limiting surface), ρ is the minor radius measured from the last closed flux surface (LCFS), λ q is the SOL decay length of the heat flux density and q(0) is the heat flux density at the last closed surface. If we approximate the heat flux as Q = q || (0) e -ρ/λ q sin(θ+α), with α ≡ tan -1 [q(0)/q || (0)], then α can be interpreted as an effective 'minimum angle of incidence'. Under conditions where the geometric angle θ has been made almost grazing (below 5 o ) the predictions of the simplest model (with α=0 o ) is not adequate to represent the observation made in TORE-SUPRA; a similar result is found in TFTR. Experimental observations of heat and particle deposition on the large area limiter on the inner wall of TORE-SUPRA are presented. These results have been analyzed with a Monte Carlo code (THOR) describing the diffusion of hydrogenic particles across the LCFS to the limiting objects in the Scrape Off Layer (SOL), and by impurity generation calculations using the full 'exponential-sine' model (α ≠ 0) used as input to an impurity (carbon) Monte Carlo code (BBQ). (author) 6 refs., 3 figs., 1 tab

  14. Spatio-Temporal Modelling of Dust Transport over Surface Mining Areas and Neighbouring Residential Zones

    Directory of Open Access Journals (Sweden)

    Eva Gulikova


    Full Text Available Projects focusing on spatio-temporal modelling of the living environment need to manage a wide range of terrain measurements, existing spatial data, time series, results of spatial analysis and inputs/outputs from numerical simulations. Thus, GISs are often used to manage data from remote sensors, to provide advanced spatial analysis and to integrate numerical models. In order to demonstrate the integration of spatial data, time series and methods in the framework of the GIS, we present a case study focused on the modelling of dust transport over a surface coal mining area, exploring spatial data from 3D laser scanners, GPS measurements, aerial images, time series of meteorological observations, inputs/outputs form numerical models and existing geographic resources. To achieve this, digital terrain models, layers including GPS thematic mapping, and scenes with simulation of wind flows are created to visualize and interpret coal dust transport over the mine area and a neighbouring residential zone. A temporary coal storage and sorting site, located near the residential zone, is one of the dominant sources of emissions. Using numerical simulations, the possible effects of wind flows are observed over the surface, modified by natural objects and man-made obstacles. The coal dust drifts with the wind in the direction of the residential zone and is partially deposited in this area. The simultaneous display of the digital map layers together with the location of the dominant emission source, wind flows and protected areas enables a risk assessment of the dust deposition in the area of interest to be performed. In order to obtain a more accurate simulation of wind flows over the temporary storage and sorting site, 3D laser scanning and GPS thematic mapping are used to create a more detailed digital terrain model. Thus, visualization of wind flows over the area of interest combined with 3D map layers enables the exploration of the processes of coal dust

  15. Impacts of urban land-surface forcing on ozone air quality in the Seoul metropolitan area

    Directory of Open Access Journals (Sweden)

    Y.-H. Ryu


    Full Text Available Modified local meteorology owing to heterogeneities in the urban–rural surface can affect urban air quality. In this study, the impacts of urban land-surface forcing on ozone air quality during a high ozone (O3 episode in the Seoul metropolitan area, South Korea, are investigated using a high-resolution chemical transport model (CMAQ. Under fair weather conditions, the temperature excess (urban heat island significantly modifies boundary layer characteristics/structures and local circulations. The modified boundary layer and local circulations result in an increase in O3 levels in the urban area of 16 ppb in the nighttime and 13 ppb in the daytime. Enhanced turbulence in the deep urban boundary layer dilutes pollutants such as NOx, and this contributes to the elevated O3 levels through the reduced O3 destruction by NO in the NOx-rich environment. The advection of O3 precursors over the mountains near Seoul by the prevailing valley-breeze circulation in the mid- to late morning results in the build-up of O3 over the mountains in conjunction with biogenic volatile organic compound (BVOC emissions there. As the prevailing local circulation in the afternoon changes to urban-breeze circulation, the O3-rich air masses over the mountains are advected over the urban area. The urban-breeze circulation exerts significant influences on not only the advection of O3 but also the chemical production of O3 under the circumstances in which both anthropogenic and biogenic (natural emissions play important roles in O3 formation. As the air masses that are characterized by low NOx and high BVOC levels and long OH chain length are advected over the urban area from the surroundings, the ozone production efficiency increases in the urban area. The relatively strong vertical mixing in the urban boundary layer embedded in the

  16. AFM-based tribological study of nanopatterned surfaces: the influence of contact area instabilities. (United States)

    Rota, A; Serpini, E; Gazzadi, G C; Valeri, S


    Although the importance of morphology on the tribological properties of surfaces has long been proved, an exhaustive understanding of nanopatterning effects is still lacking due to the difficulty in both fabricating 'really nano-' structures and detecting their tribological properties. In the present work we show how the probe-surface contact area can be a critical parameter due to its remarkable local variability, making a correct interpretation of the data very difficult in the case of extremely small nanofeatures. Regular arrays of parallel 1D straight nanoprotrusions were fabricated by means of a low-dose focused ion beam, taking advantage of the amorphization-related swelling effect. The tribological properties of the patterns were detected in the presence of air and in vacuum (dry ambient) by atomic force microscopy. We have introduced a novel procedure and data analysis to reduce the uncertainties related to contact instabilities. The real time estimation of the radius of curvature of the contacting asperity enables us to study the dependence of the tribological properties of the patterns from their geometrical characteristics. The effect of the patterns on both adhesion and the coefficient of friction strongly depends on the contact area, which is linked to the local radius of curvature of the probe. However, a detectable hydrophobic character induced on the hydrophilic native SiO2 has been observed as well. The results suggest a scenario for capillary formation on the patterns.

  17. High-Surface-Area Nitrogen-Doped Reduced Graphene Oxide for Electric Double-Layer Capacitors. (United States)

    Youn, Hee-Chang; Bak, Seong-Min; Kim, Myeong-Seong; Jaye, Cherno; Fischer, Daniel A; Lee, Chang-Wook; Yang, Xiao-Qing; Roh, Kwang Chul; Kim, Kwang-Bum


    A two-step method consisting of solid-state microwave irradiation and heat treatment under NH3 gas was used to prepare nitrogen-doped reduced graphene oxide (N-RGO) with a high specific surface area (1007 m(2)  g(-1) ), high electrical conductivity (1532 S m(-1) ), and low oxygen content (1.5 wt %) for electrical double-layer capacitor applications. The specific capacitance of N-RGO was 291 F g(-1) at a current density of 1 A g(-1) , and a capacitance of 261 F g(-1) was retained at 50 A g(-1) , which indicated a very good rate capability. N-RGO also showed excellent cycling stability and preserved 96 % of the initial specific capacitance after 100 000 cycles. Near-edge X-ray absorption fine-structure spectroscopy results provided evidenced for the recovery of π conjugation in the carbon networks with the removal of oxygenated groups and revealed chemical bonding of the nitrogen atoms in N-RGO. The good electrochemical performance of N-RGO is attributed to its high surface area, high electrical conductivity, and low oxygen content. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Bounds on area and charge for marginally trapped surfaces with a cosmological constant

    International Nuclear Information System (INIS)

    Simon, Walter


    We sharpen the known inequalities AΛ ≤ 4π(1 - g) (Hayward et al 1994 Phys. Rev. D 49 5080, Woolgar 1999 Class. Quantum Grav. 16 3005) and A ≤ 4πQ 2 (Dain et al 2012 Class. Quantum Grav. 29 035013) between the area A and the electric charge Q of a stable marginally outer-trapped surface (MOTS) of genus g in the presence of a cosmological constant Λ. In particular, instead of requiring stability we include the principal eigenvalue λ of the stability operator. For Λ* Λ+λ > 0, we obtain a lower and an upper bound for Λ*A in terms of Λ*Q 2 , as well as the upper bound Q≤1/(2√(Λ * )) for the charge, which reduces to Q≤1/(2√(Λ)) in the stable case λ ≥ 0. For Λ* < 0, there only remains a lower bound on A. In the spherically symmetric, static, stable case, one of our area inequalities is saturated iff the surface gravity vanishes. We also discuss implications of our inequalities for 'jumps' and mergers of charged MOTS. (fast track communication)

  19. Closure Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Nevada

    International Nuclear Information System (INIS)

    Campbell, K.B.


    This Closure Report provides the documentation for closure of the Central Nevada Test Area (CNTA) surface Corrective Action Unit (CAU) 417. The CNTA is located in Hot Creek Valley in Nye County, Nevada, approximately 22.5 kilometers (14 miles) west of U.S. State Highway 6 near the Moores Station historical site, and approximately 137 kilometers (85 miles) northeast of Tonopah, Nevada. The CNTA consists of three separate land withdrawal areas commonly referred to as UC-1, UC-3, and UC-4, all of which are accessible to the public. A nuclear device for Project Faultless was detonated approximately 975 meters (3,200 feet) below ground surface on January 19, 1968, in emplacement boring UC-1 (Department of Energy, Nevada Operation Office [DOE/NV], 1997). CAU 417 consists of 34 Corrective Action Sites (CASs). Site closure was completed using a Nevada Department of Environmental Protection (NDEP) approved Corrective Action Plan (CAP) (DOE/NV, 2000) which was based on the recommendations presented in the NDEP-approved Corrective Action Decision Document (DOE/NV, 1999). Closure of CAU 417 was completed in two phases. Phase I field activities were completed with NDEP concurrence during 1999 as outlined in the Phase I Work Plan, Appendix A of the CAP (DOE/NV, 2000), and as summarized in Section 2.1.2 of this document

  20. Nanosecond multi-pulse laser milling for certain area removal of metal coating on plastics surface (United States)

    Zhao, Kai; Jia, Zhenyuan; Ma, Jianwei; Liu, Wei; Wang, Ling


    Metal coating with functional pattern on engineering plastics surface plays an important role in industry applications; it can be obtained by adding or removing certain area of metal coating on engineering plastics surface. However, the manufacturing requirements are improved continuously and the plastic substrate presents three-dimensional (3D) structure-many of these parts cannot be fabricated by conventional processing methods, and a new manufacturing method is urgently needed. As the laser-processing technology has many advantages like high machining accuracy and constraints free substrate structure, the machining of the parts is studied through removing certain area of metal coating based on the nanosecond multi-pulse laser milling. To improve the edge quality of the functional pattern, generation mechanism and corresponding avoidance strategy of the processing defects are studied. Additionally, a prediction model for the laser ablation depth is proposed, which can effectively avoid the existence of residual metal coating and reduces the damage of substrate. With the optimal machining parameters, an equiangular spiral pattern on copper-clad polyimide (CCPI) is machined based on the laser milling at last. The experimental results indicate that the edge of the pattern is smooth and consistent, the substrate is flat and without damage. The achievements in this study could be applied in industrial production.

  1. AFM-based tribological study of nanopatterned surfaces: the influence of contact area instabilities

    International Nuclear Information System (INIS)

    Rota, A; Serpini, E; Gazzadi, G C; Valeri, S


    Although the importance of morphology on the tribological properties of surfaces has long been proved, an exhaustive understanding of nanopatterning effects is still lacking due to the difficulty in both fabricating ‘really nano-’ structures and detecting their tribological properties. In the present work we show how the probe–surface contact area can be a critical parameter due to its remarkable local variability, making a correct interpretation of the data very difficult in the case of extremely small nanofeatures. Regular arrays of parallel 1D straight nanoprotrusions were fabricated by means of a low-dose focused ion beam, taking advantage of the amorphization-related swelling effect. The tribological properties of the patterns were detected in the presence of air and in vacuum (dry ambient) by atomic force microscopy. We have introduced a novel procedure and data analysis to reduce the uncertainties related to contact instabilities. The real time estimation of the radius of curvature of the contacting asperity enables us to study the dependence of the tribological properties of the patterns from their geometrical characteristics. The effect of the patterns on both adhesion and the coefficient of friction strongly depends on the contact area, which is linked to the local radius of curvature of the probe. However, a detectable hydrophobic character induced on the hydrophilic native SiO 2 has been observed as well. The results suggest a scenario for capillary formation on the patterns. (paper)

  2. Popcorn-Derived Porous Carbon Flakes with an Ultrahigh Specific Surface Area for Superior Performance Supercapacitors. (United States)

    Hou, Jianhua; Jiang, Kun; Wei, Rui; Tahir, Muhammad; Wu, Xiaoge; Shen, Ming; Wang, Xiaozhi; Cao, Chuanbao


    Popcorn-derived porous carbon flakes have been successfully fabricated from the biomass of maize. Utilizing the "puffing effect", the nubby maize grain turned into materials with an interconnected honeycomb-like porous structure composed of carbon flakes. The following chemical activation method enabled the as-prepared products to possess optimized porous structures for electrochemical energy-storage devices, such as multilayer flake-like structures, ultrahigh specific surface area (S BET : 3301 m 2 g -1 ), and a high content of micropores (microporous surface area of 95%, especially the optimized sub-nanopores with the size of 0.69 nm) that can increase the specific capacitance. The as-obtained sample displayed excellent specific capacitance of 286 F g -1 at 90 A g -1 for supercapacitors. Moreover, the unique porous structure demonstrated an ideal way to improve the volumetric energy density performance. A high energy density of 103 Wh kg -1 or 53 Wh L -1 has been obtained in the case of ionic liquid electrolyte, which is the highest among reported biomass-derived carbon materials and will satisfy the urgent requirements of a primary power source for electric vehicles. This work may prove to be a fast, green, and large-scale synthesis route by using the large nubby granular materials to synthesize applicable porous carbons in energy-storage devices.

  3. Spherical Torus Plasma Interactions with Large-area Liquid Lithium Surfaces in CDX-U

    International Nuclear Information System (INIS)

    Kaita, R.; Majeski, R.; Boaz, M.; Efthimion, P.; Jones, B.; Hoffman, D.; Kugel, H.; Menard, J.; Munsat, T.; Post-Zwicker, A.; Soukhanovskii, V.; Spaleta, J.; Taylor, G.; Timberlake, J.; Woolley, R.; Zakharov, L.; Finkenthal, M.; Stutman, D.; Antar, G.; Doerner, R.; Luckhardt, S.; Maingi, R.; Maiorano, M.; Smith, S.


    The Current Drive Experiment-Upgrade (CDX-U) device at the Princeton Plasma Physics Laboratory (PPPL) is a spherical torus (ST) dedicated to the exploration of liquid lithium as a potential solution to reactor first-wall problems such as heat load and erosion, neutron damage and activation, and tritium inventory and breeding. Initial lithium limiter experiments were conducted with a toroidally-local liquid lithium rail limiter (L3) from the University of California at San Diego. Spectroscopic measurements showed a clear reduction of impurities in plasmas with the L3, compared to discharges with a boron carbide limiter. The evidence for a reduction in recycling was less apparent, however. This may be attributable to the relatively small area in contact with the plasma, and the presence of high-recycling surfaces elsewhere in the vacuum chamber. This conclusion was tested in subsequent experiments with a fully toroidal lithium limiter that was installed above the floor of the vacuum vessel. The new limiter covered over ten times the area of the L3 facing the plasma. Experiments with the toroidal lithium limiter have recently begun. This paper describes the conditioning required to prepare the lithium surface for plasma operations, and effect of the toroidal liquid lithium limiter on discharge performance

  4. Spherical Torus Plasma Interactions with Large-area Liquid Lithium Surfaces in CDX-U

    Energy Technology Data Exchange (ETDEWEB)

    R. Kaita; R. Majeski; M. Boaz; P. Efthimion; B. Jones; D. Hoffman; H. Kugel; J. Menard; T. Munsat; A. Post-Zwicker; V. Soukhanovskii; J. Spaleta; G. Taylor; J. Timberlake; R. Woolley; L. Zakharov; M. Finkenthal; D. Stutman; G. Antar; R. Doerner; S. Luckhardt; R. Maingi; M. Maiorano; S. Smith


    The Current Drive Experiment-Upgrade (CDX-U) device at the Princeton Plasma Physics Laboratory (PPPL) is a spherical torus (ST) dedicated to the exploration of liquid lithium as a potential solution to reactor first-wall problems such as heat load and erosion, neutron damage and activation, and tritium inventory and breeding. Initial lithium limiter experiments were conducted with a toroidally-local liquid lithium rail limiter (L3) from the University of California at San Diego. Spectroscopic measurements showed a clear reduction of impurities in plasmas with the L3, compared to discharges with a boron carbide limiter. The evidence for a reduction in recycling was less apparent, however. This may be attributable to the relatively small area in contact with the plasma, and the presence of high-recycling surfaces elsewhere in the vacuum chamber. This conclusion was tested in subsequent experiments with a fully toroidal lithium limiter that was installed above the floor of the vacuum vessel. The new limiter covered over ten times the area of the L3 facing the plasma. Experiments with the toroidal lithium limiter have recently begun. This paper describes the conditioning required to prepare the lithium surface for plasma operations, and effect of the toroidal liquid lithium limiter on discharge performance.

  5. Ultrahigh surface area carbon from carbonated beverages: Combining self-templating process and in situ activation

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Pengfei; Zhang, Zhiyong; Chen, Jihua; Dai, Sheng


    Ultrahigh surface area carbons (USACs, e.g., >2000 m2/g) are attracting tremendous attention due to their outstanding performance in energy-related applications. The state-of-art approaches to USACs involve templating or activation methods and all these techniques show certain drawbacks. In this work, a series of USACs with specific surface areas up to 3633 m2/g were prepared in two steps: hydrothermal carbonization (200 °C) of carbonated beverages (CBs) and further thermal treatment in nitrogen (600–1000 °C). The rich inner porosity is formed by a self-templated process during which acids and polyelectrolyte sodium salts in the beverage formulas make some contribution. This strategy covers various CBs such as Coca Cola®, Pepsi Cola®, Dr. Pepper®, and Fanta® and it enables an acceptable product yield (based on sugars), for example: 21 wt% for carbon (2940 m2/g) from Coca Cola®. Being potential electrode materials for supercapacitors, those carbon materials possessed a good specific capacitance (57.2–185.7 F g-1) even at a scan rate of 1000 mV s-1. Thus, a simple and efficient strategy to USACs has been presented.

  6. Surface area-burnoff correlation for the steam--graphite reaction

    International Nuclear Information System (INIS)

    Stark, W.A. Jr.; Malinauskas, A.P.


    The oxidation of core graphite by steam of air represents a problem area of significant concern in safety analyses for the high temperature gas cooled reactor (HTGR). Core and core-support graphite integrity and strength deteriorate with oxidation of the graphite, and oxidation furthermore could affect the rate of fission product release under upset conditions. Consequently, modeling of core response during steam or air ingress conditions requires an expression for the rate of graphite interaction with those impurities. The steam--graphite reaction in particular is a complex interaction of mass transport within the graphite with chemi-sorption and reaction on accessible surfaces; experimental results from graphite to graphite are highly variable, and the description of the reaction is not yet completely consistent. A simple etch pit model relating surface area to burnoff has been proposed and shown to provide reasonable correlation with experimental data obtained from steam oxidation studies of nuclear grade H-327 graphite. Unaccounted differences between theory and experiment arise at burnoffs exceeding 3 to 5 percent. The model, while not complete nor comprehensive, is consistent with experimental observations of graphite oxidation by O 2 (air), CO 2 , or H 2 O, and could have some utility in safety analysis

  7. Effects of Cable Sway, Electrode Surface Area, and Electrode Mass on Electroencephalography Signal Quality during Motion. (United States)

    Symeonidou, Evangelia-Regkina; Nordin, Andrew D; Hairston, W David; Ferris, Daniel P


    More neuroscience researchers are using scalp electroencephalography (EEG) to measure electrocortical dynamics during human locomotion and other types of movement. Motion artifacts corrupt the EEG and mask underlying neural signals of interest. The cause of motion artifacts in EEG is often attributed to electrode motion relative to the skin, but few studies have examined EEG signals under head motion. In the current study, we tested how motion artifacts are affected by the overall mass and surface area of commercially available electrodes, as well as how cable sway contributes to motion artifacts. To provide a ground-truth signal, we used a gelatin head phantom with embedded antennas broadcasting electrical signals, and recorded EEG with a commercially available electrode system. A robotic platform moved the phantom head through sinusoidal displacements at different frequencies (0-2 Hz). Results showed that a larger electrode surface area can have a small but significant effect on improving EEG signal quality during motion and that cable sway is a major contributor to motion artifacts. These results have implications in the development of future hardware for mobile brain imaging with EEG.

  8. Non-activated high surface area expanded graphite oxide for supercapacitors

    Energy Technology Data Exchange (ETDEWEB)

    Vermisoglou, E.C.; Giannakopoulou, T.; Romanos, G.E.; Boukos, N.; Giannouri, M. [Institute of Nanoscience and Nanotechnology “Demokritos”, 153 43 Ag. Paraskevi, Attikis (Greece); Lei, C.; Lekakou, C. [Division of Mechanical, Medical, and Aerospace Engineering, Faculty of Engineering and Physical Sciences, University of Surrey, Guildford GU2 7XH (United Kingdom); Trapalis, C., E-mail: [Institute of Nanoscience and Nanotechnology “Demokritos”, 153 43 Ag. Paraskevi, Attikis (Greece)


    Graphical abstract: - Highlights: • One-step exfoliation and reduction of graphite oxide via microwave irradiation. • Effect of pristine graphite (type, flake size) on the microwave expanded material. • Effect of pretreatment and oxidation cycles on the produced expanded material. • Expanded graphene materials with high BET surface areas (940 m{sup 2}/g–2490 m{sup 2}/g). • Non-activated graphene based materials suitable for supercapacitors. - Abstract: Microwave irradiation of graphite oxide constitutes a facile route toward production of reduced graphene oxide, since during this treatment both exfoliation and reduction of graphite oxide occurs. In this work, the effect of pristine graphite (type, size of flakes), pretreatment and oxidation cycles on the finally produced expanded material was examined. All the types of graphite that were tested afforded materials with high BET surface areas ranging from 940 m{sup 2}/g to 2490 m{sup 2}/g, without intervening an activation stage at elevated temperature. SEM and TEM images displayed exfoliated structures, where the flakes were significantly detached and curved. The quality of the reduced graphene oxide sheets was evidenced both by X-ray photoelectron spectroscopy and Raman spectroscopy. The electrode material capacitance was determined via electrochemical impedance spectroscopy and cyclic voltammetry. The materials with PEDOT binder had better performance (∼97 F/g) at low operation rates while those with PVDF binder performed better (∼20 F/g) at higher rates, opening up perspectives for their application in supercapacitors.

  9. Effect of lung injuries on [14C]urea permeability-surface area product in dogs

    International Nuclear Information System (INIS)

    Zelter, M.; Lipavsky, A.; Hoeffel, J.M.; Murray, J.F.


    To determine whether [ 14 C]urea permeability-surface area product (PS) is a reliable indicator of changes in permeability in various injuries and its relationship to indicator-dilution and gravimetric lung water contents, we studied six groups of anesthetized, paralyzed, and mechanically ventilated dogs (5 animals each). The groups consisted of control dogs, those injured by intravenous alloxan, oleic acid, or glass beads, and those exposed to acute hypoxia or increased left atrial pressure from volume loading (Pla). Interanimal variation of PS was large (3.0-15.0 ml/s), but successive hourly values in individual animals were stable for 2 h in experimental groups and for 4 h in controls. The PS increased after alloxan, elevated Pla, and 2 h of hypoxia; PS decreased after oleic acid and micremboli. The gravimetric lung water increased after alloxan, oleic acid, and microemboli, and indicator-dilution lung water increased only after alloxan. We conclude (1) that intersubject variability requires normalization to enable detection of significant deviation from base line, and (2) that decreased PS after oleic acid and microvascular injury occurred because vascular obstruction, which decreased surface area, masked probable coexisting increases in capillary permeability

  10. Influence of chemical agents on the surface area and porosity of active carbon hollow fibers

    Directory of Open Access Journals (Sweden)



    Full Text Available Active carbon hollow fibers were prepared from regenerated polysulfone hollow fibers by chemical activation using: disodium hydrogen phosphate 2-hydrate, disodium tetraborate 10-hydrate, hydrogen peroxide, and diammonium hydrogen phosphate. After chemical activation fibers were carbonized in an inert atmosphere. The specific surface area and porosity of obtained carbons were studied by nitrogen adsorption–desorption isotherms at 77 K, while the structures were examined with scanning electron microscopy and X-ray diffraction. The activation process increases these adsorption properties of fibers being more pronounced for active carbon fibers obtained with disodium tetraborate 10-hydrate and hydrogen peroxide as activator. The obtained active hollow carbons are microporous with different pore size distribution. Chemical activation with phosphates produces active carbon material with small surface area but with both mesopores and micropores. X-ray diffraction shows that besides turbostratic structure typical for carbon materials, there are some peaks which indicate some intermediate reaction products when sodium salts were used as activating agent. Based on data from the electrochemical measurements the activity and porosity of the active fibers depend strongly on the oxidizing agent applied.

  11. High sensitivity, high surface area Enzyme-linked Immunosorbent Assay (ELISA). (United States)

    Singh, Harpal; Morita, Takahiro; Suzuki, Yuma; Shimojima, Masayuki; Le Van, An; Sugamata, Masami; Yang, Ming


    Enzyme-linked immunosorbent assays (ELISA) are considered the gold standard in the demonstration of various immunological reactions with an application in the detection of infectious diseases such as during outbreaks or in patient care. This study aimed to produce an ELISA-based diagnostic with an increased sensitivity of detection compared to the standard 96-well method in the immunologic diagnosis of infectious diseases. A '3DStack' was developed using readily available, low cost fabrication technologies namely nanoimprinting and press stamping with an increased surface area of 4 to 6 times more compared to 96-well plates. This was achieved by stacking multiple nanoimprinted polymer sheets. The flow of analytes between the sheets was enhanced by rotating the 3DStack and confirmed by Finite-Element (FE) simulation. An Immunoglobulin G (IgG) ELISA for the detection of antibodies in human serum raised against Rubella virus was performed for validation. An improved sensitivity of up to 1.9 folds higher was observed using the 3DStack compared to the standard method. The increased surface area of the 3DStack developed using nanoimprinting and press stamping technologies, and the flow pattern between sheets generated by rotating the 3DStack were potential contributors to a more sensitive ELISA-based diagnostic device.

  12. Reduction Expansion Synthesis as Strategy to Control Nitrogen Doping Level and Surface Area in Graphene

    Directory of Open Access Journals (Sweden)

    Russell Canty


    Full Text Available Graphene sheets doped with nitrogen were produced by the reduction-expansion (RES method utilizing graphite oxide (GO and urea as precursor materials. The simultaneous graphene generation and nitrogen insertion reactions are based on the fact that urea decomposes upon heating to release reducing gases. The volatile byproducts perform two primary functions: (i promoting the reduction of the GO and (ii providing the nitrogen to be inserted in situ as the graphene structure is created. Samples with diverse urea/GO mass ratios were treated at 800 °C in inert atmosphere to generate graphene with diverse microstructural characteristics and levels of nitrogen doping. Scanning electron microscopy (SEM and transmission electron microscopy (TEM were used to study the microstructural features of the products. The effects of doping on the samples structure and surface area were studied by X-ray diffraction (XRD, Raman Spectroscopy, and Brunauer Emmet Teller (BET. The GO and urea decomposition-reduction process as well as nitrogen-doped graphene stability were studied by thermogravimetric analysis (TGA coupled with mass spectroscopy (MS analysis of the evolved gases. Results show that the proposed method offers a high level of control over the amount of nitrogen inserted in the graphene and may be used alternatively to control its surface area. To demonstrate the practical relevance of these findings, as-produced samples were used as electrodes in supercapacitor and battery devices and compared with conventional, thermally exfoliated graphene.

  13. Surface area changes of Himalayan ponds as a proxy of hydrological climate-driven fluctuations (United States)

    Salerno, Franco; Thakuri, Sudeep; Guyennon, Nicolas; Viviano, Gaetano; Tartari, Gianni


    The meteorological measurements at high-elevations of the Himalayan range are scarce due to the harsh conditions of these environments which limit the suitable maintenance of weather stations. As a consequence, the meager knowledge on how the climate is changed in the last decades at Himalayan high-elevations sets a serious limit upon the interpretation of relationships between causes and recent observed effects on the cryosphere. Although the glaciers masses reduction in Himalaya is currently sufficiently well described, how changes in climate drivers (precipitation and temperature) have influenced the melting and shrinkage processes are less clear. Consequently, the uncertainty related to the recent past amplifies when future forecasts are done, both for climate and impacts. In this context, a substantial body of research has already demonstrated the high sensitivity of lakes and ponds to climate. Some climate-related signals are highly visible and easily measurable in lakes. For example, climate-driven fluctuations in lake surface area have been observed in many remote sites. On interior Tibetan Plateau the lake growth since the late 1990s is mainly attributed to increased regional precipitation and weakened evaporation. Differently, other authors attribute at the observed increases of lake surfaces at the enhanced glacier melting. In our opinion these divergences found in literature are due to the type of glacial lakes considered in the study and in particular their relationship with glaciers. In general, in Himalaya three types of glacial lakes can be distinguished: (i) lakes that are not directly connected with glaciers, but that may have a glacier located in their basin (unconnected glacial lakes); (ii) supraglacial lakes, which develop on the surface of the glacier downstream; or (iii) proglacial lakes, which are moraine-dammed lakes that are in contact with the glacier front. Some of these lakes store large quantities of water and are susceptible to GLOFs

  14. Forward-looking Assimilation of MODIS-derived Snow Covered Area into a Land Surface Model (United States)

    Zaitchik, Benjamin F.; Rodell, Matthew


    Snow cover over land has a significant impact on the surface radiation budget, turbulent energy fluxes to the atmosphere, and local hydrological fluxes. For this reason, inaccuracies in the representation of snow covered area (SCA) within a land surface model (LSM) can lead to substantial errors in both offline and coupled simulations. Data assimilation algorithms have the potential to address this problem. However, the assimilation of SCA observations is complicated by an information deficit in the observation SCA indicates only the presence or absence of snow, and not snow volume and by the fact that assimilated SCA observations can introduce inconsistencies with atmospheric forcing data, leading to non-physical artifacts in the local water balance. In this paper we present a novel assimilation algorithm that introduces MODIS SCA observations to the Noah LSM in global, uncoupled simulations. The algorithm utilizes observations from up to 72 hours ahead of the model simulation in order to correct against emerging errors in the simulation of snow cover while preserving the local hydrologic balance. This is accomplished by using future snow observations to adjust air temperature and, when necessary, precipitation within the LSM. In global, offline integrations, this new assimilation algorithm provided improved simulation of SCA and snow water equivalent relative to open loop integrations and integrations that used an earlier SCA assimilation algorithm. These improvements, in turn, influenced the simulation of surface water and energy fluxes both during the snow season and, in some regions, on into the following spring.

  15. Measurements of Deposition, Lung Surface Area and Lung Fluid for Simulation of Inhaled Compounds. (United States)

    Fröhlich, Eleonore; Mercuri, Annalisa; Wu, Shengqian; Salar-Behzadi, Sharareh


    Modern strategies in drug development employ in silico techniques in the design of compounds as well as estimations of pharmacokinetics, pharmacodynamics and toxicity parameters. The quality of the results depends on software algorithm, data library and input data. Compared to simulations of absorption, distribution, metabolism, excretion, and toxicity of oral drug compounds, relatively few studies report predictions of pharmacokinetics and pharmacodynamics of inhaled substances. For calculation of the drug concentration at the absorption site, the pulmonary epithelium, physiological parameters such as lung surface and distribution volume (lung lining fluid) have to be known. These parameters can only be determined by invasive techniques and by postmortem studies. Very different values have been reported in the literature. This review addresses the state of software programs for simulation of orally inhaled substances and focuses on problems in the determination of particle deposition, lung surface and of lung lining fluid. The different surface areas for deposition and for drug absorption are difficult to include directly into the simulations. As drug levels are influenced by multiple parameters the role of single parameters in the simulations cannot be identified easily.

  16. Experimental Study on the Microstructure Evolution of Mixed Disposal Paste in Surface Subsidence Areas

    Directory of Open Access Journals (Sweden)

    Wei Sun


    Full Text Available The integrated disposal of surface subsidence pits and surface solid waste can be realized by backfilling a surface subsidence area with a paste made from the solid wastes of mines, such as tailings and waste rock. The microstructures of these wastes determine the macroscopic properties of a paste backfill. This paper presents an experimental study on the internal structure evolution of pasty fluid mixed with different waste rock concentrations (10%, 30%, and 50% and cement dosages (1% and 2% under damage. To this end, a real-time computed tomography (CT scan is conducted using medical CT and a small loading device. Results show that UCS (uniaxial compressive strength increases when the amount of cement increases. Given a constant amount of cement, UCS increases first and then decreases as waste rock content increases. UCS is maximized at 551 kPa when the waste rock content is 30%. The paste body is a typical medium used to investigate initial damage, which mainly consists of microholes, pores, and microcracks. The initial damages also exhibit a high degree of random inhomogeneity. After loading, cracks are initiated and expand gradually from the original damage location until the overall damages are generated. The mesostructure evolution model of the paste body is divided into six categories, and this mesostructure is reasonable when the waste rock content is 30%.

  17. Synthetic microfluidic paper: high surface area and high porosity polymer micropillar arrays. (United States)

    Hansson, Jonas; Yasuga, Hiroki; Haraldsson, Tommy; van der Wijngaart, Wouter


    We introduce Synthetic Microfluidic Paper, a novel porous material for microfluidic applications that consists of an OSTE polymer that is photostructured in a well-controlled geometry of slanted and interlocked micropillars. We demonstrate the distinct benefits of Synthetic Microfluidic Paper over other porous microfluidic materials, such as nitrocellulose, traditional paper and straight micropillar arrays: in contrast to straight micropillar arrays, the geometry of Synthetic Microfluidic Paper was miniaturized without suffering capillary collapse during manufacturing and fluidic operation, resulting in a six-fold increased internal surface area and a three-fold increased porous fraction. Compared to commercial nitrocellulose materials for capillary assays, Synthetic Microfluidic Paper shows a wider range of capillary pumping speed and four times lower device-to-device variation. Compared to the surfaces of the other porous microfluidic materials that are modified by adsorption, Synthetic Microfluidic Paper contains free thiol groups and has been shown to be suitable for covalent surface chemistry, demonstrated here for increasing the material hydrophilicity. These results illustrate the potential of Synthetic Microfluidic Paper as a porous microfluidic material with improved performance characteristics, especially for bioassay applications such as diagnostic tests.

  18. Diversity of Bacterial Communities of Fitness Center Surfaces in a U.S. Metropolitan Area

    Directory of Open Access Journals (Sweden)

    Nabanita Mukherjee


    Full Text Available Public fitness centers and exercise facilities have been implicated as possible sources for transmitting community-acquired bacterial infections. However, the overall diversity of the bacterial community residing on the surfaces in these indoor environments is still unknown. In this study, we investigated the overall bacterial ecology of selected fitness centers in a metropolitan area (Memphis, TN, USA utilizing culture-independent pyrosequencing of the 16S rRNA genes. Samples were collected from the skin-contact surfaces (e.g., exercise instruments, floor mats, handrails, etc. within fitness centers. Taxonomical composition revealed the abundance of Firmicutes phyla, followed by Proteobacter and Actinobacteria, with a total of 17 bacterial families and 25 bacterial genera. Most of these bacterial genera are of human and environmental origin (including, air, dust, soil, and water. Additionally, we found the presence of some pathogenic or potential pathogenic bacterial genera including Salmonella, Staphylococcus, Klebsiella, and Micrococcus. Staphylococcus was found to be the most prevalent genus. Presence of viable forms of these pathogens elevates risk of exposure of any susceptible individuals. Several factors (including personal hygiene, surface cleaning and disinfection schedules of the facilities may be the reasons for the rich bacterial diversity found in this study. The current finding underscores the need to increase public awareness on the importance of personal hygiene and sanitation for public gym users.

  19. Benchmarking sensitivity of biophysical processes to leaf area changes in land surface models (United States)

    Forzieri, Giovanni; Duveiller, Gregory; Georgievski, Goran; Li, Wei; Robestson, Eddy; Kautz, Markus; Lawrence, Peter; Ciais, Philippe; Pongratz, Julia; Sitch, Stephen; Wiltshire, Andy; Arneth, Almut; Cescatti, Alessandro


    Land surface models (LSM) are widely applied as supporting tools for policy-relevant assessment of climate change and its impact on terrestrial ecosystems, yet knowledge of their performance skills in representing the sensitivity of biophysical processes to changes in vegetation density is still limited. This is particularly relevant in light of the substantial impacts on regional climate associated with the changes in leaf area index (LAI) following the observed global greening. Benchmarking LSMs on the sensitivity of the simulated processes to vegetation density is essential to reduce their uncertainty and improve the representation of these effects. Here we present a novel benchmark system to assess model capacity in reproducing land surface-atmosphere energy exchanges modulated by vegetation density. Through a collaborative effort of different modeling groups, a consistent set of land surface energy fluxes and LAI dynamics has been generated from multiple LSMs, including JSBACH, JULES, ORCHIDEE, CLM4.5 and LPJ-GUESS. Relationships of interannual variations of modeled surface fluxes to LAI changes have been analyzed at global scale across different climatological gradients and compared with satellite-based products. A set of scoring metrics has been used to assess the overall model performances and a detailed analysis in the climate space has been provided to diagnose possible model errors associated to background conditions. Results have enabled us to identify model-specific strengths and deficiencies. An overall best performing model does not emerge from the analyses. However, the comparison with other models that work better under certain metrics and conditions indicates that improvements are expected to be potentially achievable. A general amplification of the biophysical processes mediated by vegetation is found across the different land surface schemes. Grasslands are characterized by an underestimated year-to-year variability of LAI in cold climates

  20. Error rate of automated calculation for wound surface area using a digital photography. (United States)

    Yang, S; Park, J; Lee, H; Lee, J B; Lee, B U; Oh, B H


    Although measuring would size using digital photography is a quick and simple method to evaluate the skin wound, the possible compatibility of it has not been fully validated. To investigate the error rate of our newly developed wound surface area calculation using digital photography. Using a smartphone and a digital single lens reflex (DSLR) camera, four photographs of various sized wounds (diameter: 0.5-3.5 cm) were taken from the facial skin model in company with color patches. The quantitative values of wound areas were automatically calculated. The relative error (RE) of this method with regard to wound sizes and types of camera was analyzed. RE of individual calculated area was from 0.0329% (DSLR, diameter 1.0 cm) to 23.7166% (smartphone, diameter 2.0 cm). In spite of the correction of lens curvature, smartphone has significantly higher error rate than DSLR camera (3.9431±2.9772 vs 8.1303±4.8236). However, in cases of wound diameter below than 3 cm, REs of average values of four photographs were below than 5%. In addition, there was no difference in the average value of wound area taken by smartphone and DSLR camera in those cases. For the follow-up of small skin defect (diameter: <3 cm), our newly developed automated wound area calculation method is able to be applied to the plenty of photographs, and the average values of them are a relatively useful index of wound healing with acceptable error rate. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  1. Surviving space flight: case study on MELiSSA's CIII nitrifying compartment (United States)

    Ilgrande, Chiara; Lasseur, Christophe; Mastroleo, Felice; Paille, Christel; Leys, Natalie; Morozova, Julia; Ilyin, Vyacheslav; Clauwaert, Peter; Christiaens, Marlies E. R.; Lindeboom, Ralph E. F.; Vlaeminck, Siegfried; Prat, Delphine; Arroyo, Jose M. C.; Conincx, Ilse; Van Hoey, Olivier; Roume, Hugo; Udert, Kai; Sas, Benedikt


    Space synthetic biology offers key opportunities for long-term space missions. Planets mining, terraformation, space medicine and Life Support technologies would all benefit from an integrative biological approach. However, space is a harsh environment for life: microgravity, temperature, UV and cosmic radiation can affect the health and functionality of microorganisms and plants, possibly preventing the optimal performance of the systems. The European Space Agency's Life Support System (MELiSSA) has been developed as a model for future long term Space missions and Space habitation. MELiSSA is a 5 compartment artificial ecosystem with microorganisms and higher, that aims at completely recycling gas, liquid and solid waste. In this study, the survival and functional activity after Lower Earth Orbit conditions of microbial nitrogen conversions, relevant for MELiSSA's CIII compartment, was tested. Synthetic communities containing Nitrosomonas europeae, Nitrosomonas ureae, Nitrobacter winogradskyi, Nitrospira moscoviensis and Cupriavidus pinatubonensis were exposed to the Lower Earth Orbit conditions of the International Space Station (ISS) for 7 days. Nitrosomonas europeae, Nitrobacter winogradskyi, Cupriavidus pinatubonensis, and three mixed communities (a urine nitrification sludge, a sludge containing aerobic ammonia oxidizing bacteria and anammox bacteria (OLAND), and an aquaculture sludge containing ammonia oxidizing archaea) were exposed to Lower Earth Orbit conditions for 44 days. Survival after both space flights was demonstrated because nitritation, nitratation, denitrification and anammox activity could be restored at a rate comparable to ground storage conditions. Our results validate the potential survival feasibility and suggest future space applications for N-related microorganisms.

  2. Sewage sludge ash (SSA in high performance concrete: characterization and application

    Directory of Open Access Journals (Sweden)

    C. M. A. Fontes

    Full Text Available ABSTRACT Sewage sludge originated from the process of treatment of wastewater has become an environmental issue for three main reasons: contains pathogens, heavy metals and organic compounds that are harmful to the environmental and human health; high volumes are daily generated; and shortage of landfill sites for proper disposal. This research deals with the viability study of sewage sludge utilization, after calcination process, as mineral admixture in the production of concrete. High-performance concretes were produced with replacement content of 5% and 10% by weight of Portland cement with sewage sludge ash (SSA. The influence of this ash was analyzed through physical and mechanical tests. Analysis showed that the mixtures containing SSA have lower values of compressive strength than the reference. The results of absorptivity, porosity and accelerated penetration of chloride ions, presents that mixtures containing ash showed reductions compared to the reference. This indicates that SSA provided refinement of the pore structure, which was confirmed by mercury intrusion porosimetry test.

  3. External Validation of Contact Surface Area as a Predictor of Postoperative Renal Function in Patients Undergoing Partial Nephrectomy. (United States)

    Haifler, Miki; Ristau, Benjamin T; Higgins, Andrew M; Smaldone, Marc C; Kutikov, Alexander; Zisman, Amnon; Uzzo, Robert G


    We sought to externally validate a mathematical formula for tumor contact surface area as a predictor of postoperative renal function in patients undergoing partial nephrectomy for renal cell carcinoma. We queried a prospectively maintained kidney cancer database for patients who underwent partial nephrectomy between 2014 and 2016. Contact surface area was calculated using data obtained from preoperative cross-sectional imaging. The correlation between contact surface area and perioperative variables was examined. The correlation between postoperative renal functional outcomes, contact surface area and the R.E.N.A.L. (radius, exophytic/endophytic properties, nearness of tumor to collecting system or sinus, anterior/posterior, location relative to polar lines and tumor touches main renal artery or vein) nephrometry score was also assessed. A total of 257 patients who underwent partial nephrectomy had sufficient data to enter the study. Median contact surface area was 14.5 cm 2 (IQR 6.2-36) and the median nephrometry score was 9 (IQR 7-10). Spearman correlation analysis showed that contact surface area correlated with estimated blood loss (r s = 0.42, p contact surface area and nephrometry score were independent predictors of the absolute change in the estimated glomerular filtration rate (each p contact surface area was a better predictor of a greater than 20% postoperative decline in the estimated glomerular filtration rate compared with the nephrometry score (AUC 0.94 vs 0.80). Contact surface area correlated with the change in postoperative renal function after partial nephrectomy. It can be used in conjunction with the nephrometry score to counsel patients about the risk of renal functional decline after partial nephrectomy. Copyright © 2018 American Urological Association Education and Research, Inc. Published by Elsevier Inc. All rights reserved.

  4. Woody vegetation and succession on the Fonde surface mine demonstration area, Bell County, Kentucky

    International Nuclear Information System (INIS)

    Wade, G.L.; Thompson, R.L.


    The long term impact of surface mining on vegetation and plant succession has always been of concern to environmentalists and residents of Appalachia. The Fonde Surface Mine Demonstration Area is a 7.3-ha, NE-NW-aspect contour coal mine at an elevation of 562 m. It was reclaimed in 1965 to show state-of-the-art surface mine reclamation techniques consistent with then-current law and regulations after coal mining in 1959 and 1963. The mine spoils were lightly graded to control erosion and crates a bench with water control and two sediment ponds. Soil pH ranged from 2.8 to 5.9. About 80 percent of the mine was planted with 18 tree and shrub species including plantations of mixed pine, mixed hardwoods, black locust, and shrubs for wildlife. In a complete floristic inventory conducted 25 years later, the authors found the woody flora consisted of 34 families, 53 genera, and 70 species including 7 exotics. This inventory of the Fonde mine shows that a diverse forest vegetation can be reestablished after extreme disturbances in Appalachia. Black locust, yellow poplar, and Virginia pine reproduction varied significantly among plantation types. Canopy tree species significantly affected ground layer cover, total species richness, number of tree seedling species, and total number of tree seedlings present. Mine soil type affected ground layer percent cover and total species richness. Pre-SMCRA (Surface Mining Control and Reclamation Act of 1977) reclaimed and inventoried mines can be used to evaluate biodiversity on post-SMCRA mines

  5. Woody vegetation and succession on the Fonde surface mine demonstration area, Bell County, Kentucky

    Energy Technology Data Exchange (ETDEWEB)

    Wade, G.L.; Thompson, R.L.


    The long term impact of surface mining on vegetation and plant succession has always been of concern to environmentalists and residents of Appalachia. The Fonde Surface Mine Demonstration Area is a 7.3-ha, NE-NW-aspect contour coal mine at an elevation of 562 m. It was reclaimed in 1965 to show state-of-the-art surface mine reclamation techniques consistent with then-current law and regulations after coal mining in 1959 and 1963. The mine spoils were lightly graded to control erosion and crates a bench with water control and two sediment ponds. Soil pH ranged from 2.8 to 5.9. About 80 percent of the mine was planted with 18 tree and shrub species including plantations of mixed pine, mixed hardwoods, black locust, and shrubs for wildlife. In a complete floristic inventory conducted 25 years later, the authors found the woody flora consisted of 34 families, 53 genera, and 70 species including 7 exotics. This inventory of the Fonde mine shows that a diverse forest vegetation can be reestablished after extreme disturbances in Appalachia. Black locust, yellow poplar, and Virginia pine reproduction varied significantly among plantation types. Canopy tree species significantly affected ground layer cover, total species richness, number of tree seedling species, and total number of tree seedlings present. Mine soil type affected ground layer percent cover and total species richness. Pre-SMCRA (Surface Mining Control and Reclamation Act of 1977) reclaimed and inventoried mines can be used to evaluate biodiversity on post-SMCRA mines.

  6. Cortical thickness and surface area correlates with cognitive dysfunction among first-episode psychosis patients. (United States)

    Haring, L; Müürsepp, A; Mõttus, R; Ilves, P; Koch, K; Uppin, K; Tarnovskaja, J; Maron, E; Zharkovsky, A; Vasar, E; Vasar, V


    In studies using magnetic resonance imaging (MRI), some have reported specific brain structure-function relationships among first-episode psychosis (FEP) patients, but findings are inconsistent. We aimed to localize the brain regions where cortical thickness (CTh) and surface area (cortical area; CA) relate to neurocognition, by performing an MRI on participants and measuring their neurocognitive performance using the Cambridge Neuropsychological Test Automated Battery (CANTAB), in order to investigate any significant differences between FEP patients and control subjects (CS). Exploration of potential correlations between specific cognitive functions and brain structure was performed using CANTAB computer-based neurocognitive testing and a vertex-by-vertex whole-brain MRI analysis of 63 FEP patients and 30 CS. Significant correlations were found between cortical parameters in the frontal, temporal, cingular and occipital brain regions and performance in set-shifting, working memory manipulation, strategy usage and sustained attention tests. These correlations were significantly dissimilar between FEP patients and CS. Significant correlations between CTh and CA with neurocognitive performance were localized in brain areas known to be involved in cognition. The results also suggested a disrupted structure-function relationship in FEP patients compared with CS.

  7. Multivariate Analyses of Heavy Metals in Surface Soil Around an Organized Industrial Area in Eskisehir, Turkey. (United States)

    Malkoc, S; Yazici, B


    A total of 50 surface industrial area soil in Eskisehir, Turkey were collected and the concentrations of As, Cr, Cd, Co, Cu, Ni, Pb, Zn, Fe and Mg, at 11.34, 95.8, 1.37, 15.28, 33.06, 143.65, 14.34, 78.79 mg/kg, 188.80% and 78.70%, respectively. The EF values for As, Cu, Pb and Zn at a number of sampling sites were found to be the highest among metals. Igeo-index results show that the study area is moderately polluted with respect to As, Cd, Ni. According to guideline values of Turkey Environmental Quality Standard for Soils, there is no problem for Pb, but the Cd values are fairly high. However, Cr, Cu, Ni and Zn values mostly exceed the limits. Cluster analyses suggested that soil the contaminator values are homogenous in those sub classes. The prevention and remediation of the heavy metal soil pollution should focus on these high-risk areas in the future.

  8. Assessing the influence of groundwater and land surface scheme in the modelling of land surface-atmosphere feedbacks over the FIFE area in Kansas, USA

    DEFF Research Database (Denmark)

    Larsen, Morten Andreas Dahl; Højmark Rasmussen, Søren; Drews, Martin


    The land surface-atmosphere interaction is described differently in large scale surface schemes of regional climate models and small scale spatially distributed hydrological models. In particular, the hydrological models include the influence of shallow groundwater on evapotranspiration during dry...... by HIRHAM simulated precipitation. The last two simulations include iv) a standard HIRHAM simulation, and v) a fully coupled HIRHAM-MIKE SHE simulation locally replacing the land surface scheme by MIKE SHE for the FIFE area, while HIRHAM in standard configuration is used for the remaining model area...

  9. SSA DISABILITY. SGA Levels Appear to Affect the Work Behavior of Relatively Few Beneficiaries, but More Data Needed

    National Research Council Canada - National Science Library

    Baucus, Max


    ... physical or mental impairment has earnings that exceed the Substantial Gainful Activity (SGA) level, which represents SSA's principal standard for determining whether a disabled individual is able to work...

  10. Long-term evolution of the surface environment of the Campine area, Northern Belgium

    International Nuclear Information System (INIS)

    Beerten, K.; De Craen, M.; Brassinnes, S.; Wouters, L.


    Document available in extended abstract form only. The Boom Clay in the Campine Basin is studied as the reference host formation for the geological disposal of radioactive waste. Near Mol, it is covered by approximately 200 m of sediment which protects the clay layer. Here, we will give a preliminary assessment of the long-term evolution of the surface environment in the Campine area for the next 1 Ma, with respect to geomorphological, pedological and hydrological processes. The current surface environment started to develop after the last major marine regression around 2 Ma ago. Then, the climatic and tectonic evolution caused significant changes in surficial geology, relief intensity, soils and hydrography. The palaeo-geographical evolution during the Quaternary is characterized by important stream divergences, relative uplift and erosion. Tectonic uplift of the Campine Plateau forced the river Meuse to incise into the substrate. To the west, erosional processes shaped the Nete and the Lower Scheldt basins as a result of combined uplift and gradual sea-level drop. The Campine Plateau being covered by coarse fluvial deposits from the Early and Middle Pleistocene, is largely protected from erosion. The same is true for the Campine Cuesta, that stands out as a result of the cohesive and erosion resistant Kempen Clay substrate. Burial graphs covering the last few million years from different locations in the Boom Clay sub-crop zone reflect processes of subsidence, uplift, sea level variations and climate change in relation to the erodibility of the substrate. Continuous burial during the Quaternary as a result of subsidence is observed near the Dutch border, and for the Roer Valley Graben. Burial graphs for the Campine Plateau do not show important erosional phases during the last several million years. This is due to the protecting cover of coarse fluvial deposits. The area that is now occupied by the Lower Scheldt and the Nete basin has experienced erosion during

  11. The East Asian Development Experience: Policy Lessons, Implications, and Recommendations for Sub-Saharan Africa (SSA) Global Competitiveness


    Ashford C. Chea


    The paper looks at the development experience of East Asia and draws lessons for Sub-Saharan Africa in building global competitiveness. It starts with a historical perspective of both regions’ developmental trajectories. This is followed by an analysis of the causes of East Asia’s superior economic performance and development and SSA underdevelopment. The article also draws policy lessons from East Asia development strategies for SSA global competitiveness. The paper ends with a presentation ...

  12. Data on the role of accessible surface area on osmolytes-induced protein stabilization

    Directory of Open Access Journals (Sweden)

    Safikur Rahman


    Full Text Available This paper describes data related to the research article “Testing the dependence of stabilizing effect of osmolytes on the fractional increase in the accessible surface area on thermal and chemical denaturations of proteins” [1]. Heat- and guanidinium chloride (GdmCl-induced denaturation of three disulfide free proteins (bovine cytochrome c (b-cyt-c, myoglobin (Mb and barstar in the presence of different concentrations of methylamines (sarcosine, glycine-betaine (GB and trimethylamine-N-oxide (TMAO was monitored by [ϴ]222, the mean residue ellipticity at 222 nm at pH 7.0. Methylamines belong to a class of osmolytes known to protect proteins from deleterious effect of urea. This paper includes comprehensive thermodynamic data obtained from the heat- and GdmCl-induced denaturations of barstar, b-cyt-c and Mb.

  13. FreeSASA: An open source C library for solvent accessible surface area calculations. (United States)

    Mitternacht, Simon


    Calculating solvent accessible surface areas (SASA) is a run-of-the-mill calculation in structural biology. Although there are many programs available for this calculation, there are no free-standing, open-source tools designed for easy tool-chain integration. FreeSASA is an open source C library for SASA calculations that provides both command-line and Python interfaces in addition to its C API. The library implements both Lee and Richards' and Shrake and Rupley's approximations, and is highly configurable to allow the user to control molecular parameters, accuracy and output granularity. It only depends on standard C libraries and should therefore be easy to compile and install on any platform. The library is well-documented, stable and efficient. The command-line interface can easily replace closed source legacy programs, with comparable or better accuracy and speed, and with some added functionality.

  14. Cross-cutting High Surface Area Graphene-based Frameworks with Controlled Pore Structure/Dopants

    Energy Technology Data Exchange (ETDEWEB)

    Gaillard, J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)


    The goal of this project is to enhance the performance of graphene-based materials by manufacturing specific 3D architectures. The materials have global applications regarding fuel cell catalysts, gas adsorbents, supercapacitor/battery electrodes, ion (e.g., actinide) capture, gas separation, oil adsorption, and catalysis. This research focuses on hydrogen storage for hydrogen fuel cell vehicles with a potential transformational impact on hydrogen adsorbents that exhibit high gravimetric and volumetric density, a clean energy application sought by the Department of Energy. The development of an adsorbent material would enable broad commercial opportunities in hydrogen-fueled vehicles, promote new advanced nanomanufacturing scale-up, and open other opportunities at Savannah River National Laboratory to utilize a high surface area material that is robust, chemically stable, and radiation resistant.

  15. Preparation and Characterization of Highly Spherical Silica-titania Aerogel Beads with High Surface Area

    Directory of Open Access Journals (Sweden)

    YU Yu-xi


    Full Text Available The silica-titania aerogel beads were synthesized through sol-gel reaction followed by supercritical drying, in which TEOS and TBT as co-precursors, EtOH as solvents, HAC and NH3·H2O as catalysts. The as-prepared aerogel beads were characterized by SEM,TEM,XRD,FT-IR,TG-DTA and nitrogen adsorption-desorption. The results indicate that the diameter distribution of beads are between 1-8mm, the average diameter of beads is 3.5mm. The aerogel beads have nanoporous network structure with high specific surface area of 914.5m2/g, and the TiO2 particles are distributed in the aerogel uniformly, which keep the anatase crystal under high temperature.

  16. Lithium inclusion in indium metal-organic frameworks showing increased surface area and hydrogen adsorption

    Directory of Open Access Journals (Sweden)

    Mathieu Bosch


    Full Text Available Investigation of counterion exchange in two anionic In-Metal-Organic Frameworks (In-MOFs showed that partial replacement of disordered ammonium cations was achieved through the pre-synthetic addition of LiOH to the reaction mixture. This resulted in a surface area increase of over 1600% in {Li [In(1,3 − BDC2]}n and enhancement of the H2 uptake of approximately 275% at 80 000 Pa at 77 K. This method resulted in frameworks with permanent lithium content after repeated solvent exchange as confirmed by inductively coupled plasma mass spectrometry. Lithium counterion replacement appears to increase porosity after activation through replacement of bulkier, softer counterions and demonstrates tuning of pore size and properties in MOFs.

  17. Determination of the Presence of Three Antimicrobials in Surface Water Collected from Urban and Rural Areas

    Directory of Open Access Journals (Sweden)

    Alberto Cepeda


    Full Text Available Due to the continuous release of antimicrobials into the environment, the aim of this study was to compare the frequency of detection of sulfamethazine, sulfamethoxypyridazine and trimethoprim in surface water collected from urban and rural areas in Northwestern Spain. A monitoring study was conducted with 314 river water samples analyzed by high-performance liquid chromatography coupled to tandem mass spectrometry. The results indicated that 37% of the samples contained residues of at least one of the investigated antimicrobials, and every sampling site yielded positive samples. At sites located near the discharge points of wastewater treatment plants and near the collection point of a drinking-water treatment plant, more than 6% of the samples were positive for the presence of antimicrobial residues.

  18. Surface Water Transport for the F/H Area Seepage Basins Groundwater Program

    International Nuclear Information System (INIS)

    Chen, Kuo-Fu.


    The contribution of the F- and H-Area Seepage Basins (FHSBs) tritium releases to the tritium concentration in the Savannah River are presented in this report. WASP5 was used to simulate surface water transport for tritium releases from the FHSBs. The WASP5 model was qualified with the 1993 tritium measurements at US Highway 301. The tritium concentrations in Fourmile Branch and the Savannah River were calculated for tritium releases from FHSBs. The calculated tritium concentrations above normal environmental background in the Savannah River, resulting from FHSBs releases, drop from 1.25 pCi/ml (<10% of EPA Drinking Water Guide) in 1995 to 0.0056 pCi/ml in 2045

  19. Environmental protection management by monitoring the surface water quality in Semenic area

    Directory of Open Access Journals (Sweden)



    Full Text Available Environment seems to have been the war against all. In fact recently most people polluted the environment and those few are cared for his cleaning. Today, the relationship evolvedas societies have changed in favour of ensuring environmental protection. With modern technology, performance, monitoring the environment becomes part of human activity ever more necessary, more possible and more efficient. The quality of the environment, its components: air, water, soil, plants, vegetable and animal products, is a condition "sine qua non" for the life of the modern man. The consequences of environmental pollution areso dangerous that modern man cannot afford considering them. Through this paper I will study the environmental quality by monitoring the surfaces waters from the Semenic- Gărâna area.

  20. Glass-surface area to solution-volume ratio and its implications to accelerated leach testing

    International Nuclear Information System (INIS)

    Pederson, L.R.; Buckwalter, C.Q.; McVay, G.L.; Riddle, B.L.


    The value of glass surface area to solution volume ratio (SA/V) can strongly influence the leaching rate of PNL 76-68 glass. The leaching rate is largely governed by silicon solubility constraints. Silicic acid in solution reduced the elemental release of all glass components. No components are leached to depths greater than that of silicon. The presence of the reaction layer had no measurable effect on the rate of leaching. Accelerated leach testing is possible since PNL 76-68 glass leaching is solubility-controlled (except at very low SA/V values). A series of glasses leached with SA/V x time = constant will yield identical elemental release

  1. Block-copolymer-assisted synthesis of hydroxyapatite nanoparticles with high surface area and uniform size

    Directory of Open Access Journals (Sweden)

    Yu-Tzu Huang, Masataka Imura, Yoshihiro Nemoto, Chao-Hung Cheng and Yusuke Yamauchi


    Full Text Available We report the synthesis of hydroxyapatite nanoparticles (HANPs by the coprecipitation method using calcium D-gluconate and potassium hydrogen phosphate as the sources of calcium and phosphate ions, respectively, and the triblock copolymer F127 as a stabilizer. The HANPs were characterized using scanning electron microscopy, x-ray diffraction, and nitrogen adsorption/desorption isotherms. Removal of F127 by solvent extraction or calcination alters the structure of HANPs. The solvent-extracted HANPs were single crystals with their lang001rang axis oriented along the rod axis of the HANP, whereas the calcined HANPs contained two crystal phases that resulted in a spherical morphology. The calcined HANPs had much higher surface area (127 m2 g−1 than the solvent-extracted HANPs (44 m2 g−1.

  2. Fabrication of high surface area graphene electrodes with high performance towards enzymatic oxygen reduction

    International Nuclear Information System (INIS)

    Di Bari, Chiara; Goñi-Urtiaga, Asier; Pita, Marcos; Shleev, Sergey; Toscano, Miguel D.; Sainz, Raquel; De Lacey, Antonio L.


    High surface area graphene electrodes were prepared by simultaneous electrodeposition and electroreduction of graphene oxide. The electrodeposition process was optimized in terms of pH and conductivity of the solution and the obtained graphene electrodes were characterized by X-ray photoelectron spectroscopy, Fourier transform infrared spectroscopy, scanning electron microscopy and electrochemical methods (cyclic voltammetry and impedance spectroscopy). Electrodeposited electrodes were further functionalized to carry out covalent immobilization of two oxygen-reducing multicopper oxidases: laccase and bilirubin oxidase. The enzymatic electrodes were tested as direct electron transfer based biocathodes and catalytic currents as high as 1 mA/cm 2 were obtained. Finally, the mechanism of the enzymatic oxygen reduction reaction was studied for both enzymes calculating the Tafel slopes and transfer coefficients.

  3. Macrostructure-dependent photocatalytic property of high-surface-area porous titania films

    Energy Technology Data Exchange (ETDEWEB)

    Kimura, T., E-mail: [Advanced Manufacturing Research Institute, National Institute of Advanced Industrial Science and Technology (AIST), Shimoshidami, Moriyama-ku, Nagoya 463-8560 (Japan)


    Porous titania films with different macrostructures were prepared with precise control of condensation degree and density of the oxide frameworks in the presence of spherical aggregates of polystyrene-block-poly(oxyethylene) (PS-b-PEO) diblock copolymer. Following detailed explanation of the formation mechanisms of three (reticular, spherical, and large spherical) macrostructures by the colloidal PS-b-PEO templating, structural variation of the titania frameworks during calcination were investigated by X-ray diffraction and X-ray photoelectron spectroscopy. Then, photocatalytic performance of the macroporous titania films was evaluated through simple degradation experiments of methylene blue under an UV irradiation. Consequently, absolute surface area of the film and crystallinity of the titania frameworks were important for understanding the photocatalytic performance, but the catalytic performance can be improved further by the macrostructural design that controls diffusivity of the targeted molecules inside the film and their accessibility to active sites.

  4. Macrostructure-dependent photocatalytic property of high-surface-area porous titania films

    Directory of Open Access Journals (Sweden)

    T. Kimura


    Full Text Available Porous titania films with different macrostructures were prepared with precise control of condensation degree and density of the oxide frameworks in the presence of spherical aggregates of polystyrene-block-poly(oxyethylene (PS-b-PEO diblock copolymer. Following detailed explanation of the formation mechanisms of three (reticular, spherical, and large spherical macrostructures by the colloidal PS-b-PEO templating, structural variation of the titania frameworks during calcination were investigated by X-ray diffraction and X-ray photoelectron spectroscopy. Then, photocatalytic performance of the macroporous titania films was evaluated through simple degradation experiments of methylene blue under an UV irradiation. Consequently, absolute surface area of the film and crystallinity of the titania frameworks were important for understanding the photocatalytic performance, but the catalytic performance can be improved further by the macrostructural design that controls diffusivity of the targeted molecules inside the film and their accessibility to active sites.

  5. Assessment of the dynamics of the radioactivity contents in surface waters in contaminated areas

    International Nuclear Information System (INIS)

    Komissarov, F.D.; Datskevich, P.I.; Golikov, Y.N.; Basharina, L.P.; Churack, T.N.; Khvaley, O.D.


    In the connection with Chernobyl APS accident, since 1988 a network of sites was established for radioecological monitoring of surface water systems, mainly, small rivers on all Belarus territory. Small rivers are the principal way of radionuclides run off in liquid and solid discharges during rains and high-floods and their re-distribution in landscapes. The components of water systems radio-monitoring were water and water suspensions, area water-collection, bottom deposits and biota. In the paper the data are cited of radioecological studies of water systems components. Their analysis is done and some conclusions made which may be used for the development of radioecological prognosis and for taking environmental measures

  6. Cross-cutting High Surface Area Graphene-based Frameworks with Controlled Pore Structure/Dopants

    International Nuclear Information System (INIS)

    Gaillard, J.


    The goal of this project is to enhance the performance of graphene-based materials by manufacturing specific 3D architectures. The materials have global applications regarding fuel cell catalysts, gas adsorbents, supercapacitor/battery electrodes, ion (e.g., actinide) capture, gas separation, oil adsorption, and catalysis. This research focuses on hydrogen storage for hydrogen fuel cell vehicles with a potential transformational impact on hydrogen adsorbents that exhibit high gravimetric and volumetric density, a clean energy application sought by the Department of Energy. The development of an adsorbent material would enable broad commercial opportunities in hydrogen-fueled vehicles, promote new advanced nanomanufacturing scale-up, and open other opportunities at Savannah River National Laboratory to utilize a high surface area material that is robust, chemically stable, and radiation resistant.

  7. Trajectories of cortical surface area and cortical volume maturation in normal brain development

    Directory of Open Access Journals (Sweden)

    Simon Ducharme


    Full Text Available This is a report of developmental trajectories of cortical surface area and cortical volume in the NIH MRI Study of Normal Brain Development. The quality-controlled sample included 384 individual typically-developing subjects with repeated scanning (1–3 per subject, total scans n=753 from 4.9 to 22.3 years of age. The best-fit model (cubic, quadratic, or first-order linear was identified at each vertex using mixed-effects models, with statistical correction for multiple comparisons using random field theory. Analyses were performed with and without controlling for total brain volume. These data are provided for reference and comparison with other databases. Further discussion and interpretation on cortical developmental trajectories can be found in the associated Ducharme et al.׳s article “Trajectories of cortical thickness maturation in normal brain development – the importance of quality control procedures” (Ducharme et al., 2015 [1].

  8. Aloe vera Derived Activated High-Surface-Area Carbon for Flexible and High-Energy Supercapacitors. (United States)

    Karnan, M; Subramani, K; Sudhan, N; Ilayaraja, N; Sathish, M


    Materials which possess high specific capacitance in device configuration with low cost are essential for viable application in supercapacitors. Herein, a flexible high-energy supercapacitor device was fabricated using porous activated high-surface-area carbon derived from aloe leaf (Aloe vera) as a precursor. The A. vera derived activated carbon showed mesoporous nature with high specific surface area of ∼1890 m 2 /g. A high specific capacitance of 410 and 306 F/g was achieved in three-electrode and symmetric two-electrode system configurations in aqueous electrolyte, respectively. The fabricated all-solid-state device showed a high specific capacitance of 244 F/g with an energy density of 8.6 Wh/kg. In an ionic liquid electrolyte, the fabricated device showed a high specific capacitance of 126 F/g and a wide potential window up to 3 V, which results in a high energy density of 40 Wh/kg. Furthermore, it was observed that the activation temperature has significant role in the electrochemical performance, as the activated sample at 700 °C showed best activity than the samples activated at 600 and 800 °C. The electron microscopic images (FE-SEM and HR-TEM) confirmed the formation of pores by the chemical activation. A fabricated supercapacitor device in ionic liquid with 3 V could power up a red LED for 30 min upon charging for 20s. Also, it is shown that the operation voltage and capacitance of flexible all-solid-state symmetric supercapacitors fabricated using aloe-derived activated carbon could be easily tuned by series and parallel combinations. The performance of fabricated supercapacitor devices using A. vera derived activated carbon in all-solid-state and ionic liquid indicates their viable applications in flexible devices and energy storage.

  9. Transport and retention of phosphorus in surface water in an urban slum area (United States)

    Nyenje, P. M.; Meijer, L. M. G.; Foppen, J. W.; Kulabako, R.; Uhlenbrook, S.


    The transport of excessive phosphorus (P) discharged from unsewered informal settlements (slums) due to poor on-site sanitation is largely unknown. Hence, we investigated the processes governing P transport in a 28 km2 slum-dominated catchment in Kampala, Uganda. During high runoff events and a period of base flow, we collected hourly water samples (over 24 h) from a primary channel draining the catchment and from a small size tertiary channel draining one of the contributing slum areas (0.5 km2). Samples were analyzed for orthophosphate (PO4-P), particulate P (PP), total P (TP) and selected hydro-chemical parameters. Channel bed and suspended sediments were collected to determine their sorption potential, geo-available metals and dominant P forms. We found that P inputs in the catchment originated mainly from domestic wastewater as evidenced by high concentrations of Cl (36-144 mg L-1), HCO3 and other cations in the channels. Most P discharged during low flow conditions was particulate implying that much of it was retained in bed sediments. Retained P was mostly bound to Ca and Fe/Al oxides. Hence, we inferred that mineral precipitation and adsorption to Ca-minerals were the dominant P retention processes. Bed sediments were P-saturated and showed a tendency to release P to discharging waters. P released was likely due to Ca-bound P because of the strong correlation between Ca and total P in sediments (r2 = 0.9). High flows exhibited a strong flush of PP and SS implying that part of P retained was frequently flushed out of the catchment by surface erosion and resuspension of bed sediment. Our findings suggest that P accumulated in the channel bed during low flows and then was slowly released into surface water. Hence, it will likely take some time, even with improved wastewater management practices, before P loads to downstream areas can be significantly reduced.

  10. Renal function maturation in children: is normalization to surface area valid?

    International Nuclear Information System (INIS)

    Rutland, M.D.; Hassan, I.M.; Que, L.


    Full text: Gamma camera DTPA renograms were analysed to measure renal function by the rate at which the kidneys took up tracer from the blood. This was expressed either directly as the fractional uptake rate (FUR), which is not related to body size, or it was converted to a camera-based GFR by the formula GFR blood volume x FUR, and this GFR was normalized to a body surface area of 1.73 m2. Most of the patients studied had one completely normal kidney, and one kidney with reflux but normal function and no large scars. The completely normal kidneys contributed, on average, 50% of the total renal function. The results were considered in age bands, to display the effect of age on renal function. The camera-GFR measurements showed the conventional results of poor renal function in early childhood, with a slow rise to near-adult values by the age of 2 years, and somewhat low values throughout childhood. The uptake values showed a different pattern, with renal function rising to adult equivalent values by the age of 4 months, and with children having better renal function than adults throughout most of their childhood. The standard deviations expressed as coefficients of variation (CV) were smaller for the FUR technique than the GFR (Wilcoxon rank test, P < 0.01). These results resemble recent published measurements of absolute DMSA uptake, which are also unrelated to body size and show early renal maturation. The results also suggest that the reason children have lower serum creatinine levels than adults is that they have better renal function. If this were confirmed, it would raise doubts about the usefulness of normalizing renal function to body surface area in children

  11. A finite area scheme for shallow granular flows on three-dimensional surfaces (United States)

    Rauter, Matthias


    Shallow granular flow models have become a popular tool for the estimation of natural hazards, such as landslides, debris flows and avalanches. The shallowness of the flow allows to reduce the three-dimensional governing equations to a quasi two-dimensional system. Three-dimensional flow fields are replaced by their depth-integrated two-dimensional counterparts, which yields a robust and fast method [1]. A solution for a simple shallow granular flow model, based on the so-called finite area method [3] is presented. The finite area method is an adaption of the finite volume method [4] to two-dimensional curved surfaces in three-dimensional space. This method handles the three dimensional basal topography in a simple way, making the model suitable for arbitrary (but mildly curved) topography, such as natural terrain. Furthermore, the implementation into the open source software OpenFOAM [4] is shown. OpenFOAM is a popular computational fluid dynamics application, designed so that the top-level code mimics the mathematical governing equations. This makes the code easy to read and extendable to more sophisticated models. Finally, some hints on how to get started with the code and how to extend the basic model will be given. I gratefully acknowledge the financial support by the OEAW project "beyond dense flow avalanches". Savage, S. B. & Hutter, K. 1989 The motion of a finite mass of granular material down a rough incline. Journal of Fluid Mechanics 199, 177-215. Ferziger, J. & Peric, M. 2002 Computational methods for fluid dynamics, 3rd edn. Springer. Tukovic, Z. & Jasak, H. 2012 A moving mesh finite volume interface tracking method for surface tension dominated interfacial fluid flow. Computers & fluids 55, 70-84. Weller, H. G., Tabor, G., Jasak, H. & Fureby, C. 1998 A tensorial approach to computational continuum mechanics using object-oriented techniques. Computers in physics 12(6), 620-631.

  12. Hydrogen-terminated mesoporous silicon monoliths with huge surface area as alternative Si-based visible light-active photocatalysts

    KAUST Repository

    Li, Ting; Li, Jun; Zhang, Qiang; Blazeby, Emma; Shang, Congxiao; Xu, Hualong; Zhang, Xixiang; Chao, Yimin


    Silicon-based nanostructures and their related composites have drawn tremendous research interest in solar energy storage and conversion. Mesoporous silicon with a huge surface area of 400-900 m2 g-1 developed by electrochemical etching exhibits

  13. Relationship between surface, free tropospheric and total column ozone in 2 contrasting areas in South-Africa

    CSIR Research Space (South Africa)

    Combrink, J


    Full Text Available Measurements of surface ozone in two contrasting areas of South Africa are compared with free tropospheric and Total Ozone Mapping Spectrometer (TOMS) total column ozone data. Cape Point is representative of a background monitoring station which...

  14. Surface-seismic imaging for nehrp soil profile classifications and earthquake hazards in urban areas (United States)

    Williams, R.A.; Stephenson, W.J.; Odum, J.K.


    We acquired high-resolution seismic-refraction data on the ground surface in selected areas of the San Fernando Valley (SFV) to help explain the earthquake damage patterns and the variation in ground motion caused by the 17 January 1994 magnitude 6.7 Northridge earthquake. We used these data to determine the compressional- and shear-wave velocities (Vp and Vs) at 20 aftershock recording sites to 30-m depth ( V??s30, and V??p30). Two other sites, located next to boreholes with downhole Vp and Vs data, show that we imaged very similar seismic-vefocity structures in the upper 40 m. Overall, high site response appears to be associated with tow Vs in the near surface, but there can be a wide rangepf site amplifications for a given NEHRP soil type. The data suggest that for the SFV, if the V??s30 is known, we can determine whether the earthquake ground motion will be amplified above a factor of 2 relative to a local rock site.

  15. Surface deformation analysis over Vrancea seismogenic area through radar and GPS geospatial data (United States)

    Zoran, Maria A.; Savastru, Roxana S.; Savastru, Dan M.; Serban, Florin S.; Teleaga, Delia M.; Mateciuc, Doru N.


    Time series analysis of GPS (Global Positioning Systems) and InSAR (Interferometric Synthetic Aperture Radar) data are important tools for Earth's surface deformation assessment, which can result from a wide range of geological phenomena like as earthquakes, landslides or ground water level changes. The aim of this paper was to identify several types of earthquake precursors that might be observed from geospatial data in Vrancea seismogenic region in Romania. Continuous GPS Romanian network stations and few field campaigns data recorded between 2005-2012 years revealed a displacement of about 5 or 6 millimeters per year in horizontal direction relative motion, and a few millimeters per year in vertical direction. In order to assess possible deformations due to earthquakes and respectively for possible slow deformations, have been used also time series Sentinel 1 satellite data available for Vrancea zone during October 2014 till October 2016 to generate two types of interferograms (short-term and medium- term). During investigated period were not recorded medium or strong earthquakes, so interferograms over test area revealed small displacements on vertical direction (subsidence or uplifts) of 5-10 millimeters per year. Based on GPS continuous network data and satellite Sentinel 1 results, different possible tectonic scenarios were developed. The localization of horizontal and vertical motions, fault slip, and surface deformation of the continental blocks provides new information, in support of different geodynamic models for Vrancea tectonic active region in Romania and Europe.

  16. Genesis and Development of Soils along Different Geomorphic Surfaces in Kouh Birk Area, Mehrestan City

    Directory of Open Access Journals (Sweden)

    Mohammad Akbar Bahoorzahi


    Full Text Available Introduction: The optimum and sustainable use of soil is only possible with correct and complete understanding of its properties. The objectives of the present research were to study 1 genesis and development of soils related to different geomorphic surfaces in Kouh Birk Area (Mehrestan City, 2 Soil classification according to Soil Taxonomy (2014 and WRB (2014 systems, and 3 physicochemical properties, clay mineralogy and micromorphology of soils. Materials and Methods: Mean annual rainfall and soil temperature in the selected location are 153.46 mm and 19.6 oC, respectively. From geological point of view, the studied area is a part of west and south west zones and Flysch zone of east Iran. Soil temperature and moisture regimes of this part are thermic and aridic, respectively. Eight representative pedons on different surfaces including rock pediment, mantled pediment, Alluvial fan and Upper terraces were selected, sampled, and described. Routine physicochemical analyses, clay mineralogy, and micromorphological observations performed on soil samples. Soil reaction, texture, electrical conductivity, calcium carbonate, and gypsum were identified. Four samples including Bt horizon of pedon 1, Bk1 horizon of pedon 4, By2 horizon of pedon 5 and Bk1 horizon of pedon 7 were selected for clay mineralogy investigations. Four slides including Mg saturated, Mg saturated treated with ethylene glycol, K saturated, and K saturated heated up to 550 oC were analyzed. A Brucker X-Ray diffractometer at 40 kV and 30 mA was used for XRD analyses. Undisturbed soil samples from Bt horizon of pedon 1, Bk2 horizon of pedon 2, Btn horizon of pedon 3, By2 horizon of pedon 5, Bk1 horizon of pedon 7, and By1 horizon of pedon 8 were selected for micromorphological observations. A vestapol resin with stearic acid and cobalt as hardener was used for soil impregnation. Bk-Pol petrographic microscope was used for micromorphology investigations. Results and Discussion: Due to

  17. Herbicide micropollutants in surface, ground and drinking waters within and near the area of Zagreb, Croatia. (United States)

    Fingler, Sanja; Mendaš, G; Dvoršćak, M; Stipičević, S; Vasilić, Ž; Drevenkar, V


    The frequency and mass concentrations of 13 herbicide micropollutants (triazines, phenylureas, chloroacetanilides and trifluralin) were investigated during 2014 in surface, ground and drinking waters in the area of the city of Zagreb and its suburbs. Herbicide compounds were accumulated from water by solid-phase extraction using either octadecylsilica or styrene-divinylbenzene sorbent cartridges and analysed either by high-performance liquid chromatography with UV-diode array detector or gas chromatography with mass spectrometric detection. Atrazine was the most frequently detected herbicide in drinking (84 % of samples) and ground (61 % of samples) waters in mass concentrations of 5 to 68 ng L -1 . It was followed by metolachlor and terbuthylazine, the former being detected in 54 % of drinking (up to 15 ng L -1 ) and 23 % of ground (up to 100 ng L -1 ) waters, and the latter in 45 % of drinking (up to 20 ng L -1 ) and 26 % of ground (up to 25 ng L -1 ) water samples. Acetochlor was the fourth most abundant herbicide in drinking waters, detected in 32 % of samples. Its mass concentrations of 107 to 117 ng L -1 in three tap water samples were the highest of all herbicides measured in the drinking waters. The most frequently (62 % of samples) and highly (up to 887 ng L -1 ) detected herbicide in surface waters was metolachlor, followed by terbuthylazine detected in 49 % of samples in mass concentrations of up to 690 ng L -1 , and atrazine detected in 30 % of samples in mass concentrations of up to 18 ng L -1 . The seasonal variations in herbicide concentrations in surface waters were observed for terbuthylazine, metolachlor, acetochlor, chlortoluron and isoproturon with the highest concentrations measured from April to August.

  18. Eddy formation and surface flow field in the Luzon Strait area during the summer of 2009 (United States)

    Liu, Ze; Hou, Yijun; Xie, Qiang


    The formation of mesoscale eddies and the structure of the surface flow field in the Luzon Strait area were examined using in-situ CTD data, Argo float data, and multi-satellite remote sensing data collected from May to August 2009. The results show that vigorous water exchange between Kuroshio water and South China Sea (SCS) water began to emerge over the 200 m water column throughout the strait. Based on an objective definition of surface currents, float A69 tracked an anti-cyclonic eddy southwest of Taiwan Island under a Lagrangian current measurement. The salinity inside the anti-cyclonic eddy was higher than in typical SCS water but lower than in Kuroshio mainstream water, indicating that this eddy was induced by Kuroshio frontal intrusion through the Luzon Strait and into the SCS. From hydrographic data, we propose that continuous horizontal diffusion with high-salinity characteristics in the subsurface layer could extend to 119°E or even further west. The high-temperature filament, large positive sea level anomaly and clockwise geostrophic current all confirmed the existence of this warm eddy in May and June. A strongly negative wind stress curl maintained the eddy until it died. The surface flow field during July and August was rather complicated. Float A83 described an east-west orientated shuttle run in the 20°N section that was not reported by previous studies. At the same time, float A80 indicated a Kuroshio bend into the north-central region of Luzon Strait but it did not cross 120.5°E. The water mass rejoining the Kuroshio mainstream from the southern tip of Taiwan Island was less saline, indicating an entrainment of water from SCS by the Kuroshio bend.

  19. Supercritical processing as a route to high internal surface areas and permanent microporosity in metal-organic framework materials. (United States)

    Nelson, Andrew P; Farha, Omar K; Mulfort, Karen L; Hupp, Joseph T


    Careful processing of four representative metal-organic framework (MOF) materials with liquid and supercritical carbon dioxide (ScD) leads to substantial, or in some cases spectacular (up to 1200%), increases in gas-accessible surface area. Maximization of surface area is key to the optimization of MOFs for many potential applications. Preliminary evidence points to inhibition of mesopore collapse, and therefore micropore accessibility, as the basis for the extraordinarily efficacious outcome of ScD-based activation.

  20. Hydrothermal Synthesis of Highly Water-dispersible Anatase Nanoparticles with Large Specific Surface Area and Their Adsorptive Properties


    Hu Xueting; Zhang Dongyun; Zhao Siqin; Asuha Sin


    Highly water-dispersible and very small TiO2 nanoparticles (~3 nm anatase) with large specific surface area have been synthesized by hydrolysis and hydrothermal reactions of titanium butoxide and used for the removal of three azo dyes (Congo red, orange II, and methyl orange) with different molecular structure from simulated wastewaters. The synthesized TiO2 nanoparticles are well dispersed in water with large specific surface area up to 417 m2 g−1. Adsorption experiments demonstrated that th...

  1. Thermal infrared imagery as a tool for analysing the variability of surface saturated areas at various temporal and spatial scales (United States)

    Glaser, Barbara; Antonelli, Marta; Pfister, Laurent; Klaus, Julian


    Surface saturated areas are important for the on- and offset of hydrological connectivity within the hillslope-riparian-stream continuum. This is reflected in concepts such as variable contributing areas or critical source areas. However, we still lack a standardized method for areal mapping of surface saturation and for observing its spatiotemporal variability. Proof-of-concept studies in recent years have shown the potential of thermal infrared (TIR) imagery to record surface saturation dynamics at various temporal and spatial scales. Thermal infrared imagery is thus a promising alternative to conventional approaches, such as the squishy boot method or the mapping of vegetation. In this study we use TIR images to investigate the variability of surface saturated areas at different temporal and spatial scales in the forested Weierbach catchment (0.45 km2) in western Luxembourg. We took TIR images of the riparian zone with a hand-held FLIR infrared camera at fortnightly intervals over 18 months at nine different locations distributed over the catchment. Not all of the acquired images were suitable for a derivation of the surface saturated areas, as various factors influence the usability of the TIR images (e.g. temperature contrasts, shadows, fog). Nonetheless, we obtained a large number of usable images that provided a good insight into the dynamic behaviour of surface saturated areas at different scales. The images revealed how diverse the evolution of surface saturated areas can be throughout the hydrologic year. For some locations with similar morphology or topography we identified diverging saturation dynamics, while other locations with different morphology / topography showed more similar behaviour. Moreover, we were able to assess the variability of the dynamics of expansion / contraction of saturated areas within the single locations, which can help to better understand the mechanisms behind surface saturation development.

  2. Polychlorinated biphenyls in surface soil in urban and background areas of Mongolia

    International Nuclear Information System (INIS)

    Mamontova, Elena A.; Mamontov, Alexander A.; Tarasova, Eugenia N.; Kuzmin, Mikhail I.; Ganchimeg, Darmaa; Khomutova, Marina Yu.; Gombosuren, Odontuya; Ganjuurjav, Erdenebayasgalan


    Polychlorinated biphenyls (PCBs) were measured in soil in some industrial towns (Ulaanbaatar, Suhbaatar, Erdenet, Darhan, Tsetserleg, Hovd, Ulaangom, Altay, Bayanhongor, Arvayheer, Saynshand, Choybalsan) and in background and rural areas of Mongolia. The average sum of all investigated PCB congeners in soil of Mongolia comes to 7.4 ng/g dry weight (DW) and varies from 0.53 ng/g DW till 114 ng/g DW. PCB levels in soil from towns are significantly higher than those in soil from background and rural areas. The PCB homological composition in soil sampled in highly-PCB-polluted sites is similar to the PCB homological pattern in Sovol and Aroclor 1254. Significant correlation between soil organic carbon and low chlorinated PCB both for towns and background sites was found. Significant differences in PCB means in soil in different natural zones were found. -- Highlights: •First study to measure PCBs in surface soil sampled throughout Mongolia. •The PCB patterns in polluted soil were similar to those in Sovol or Aroclor 1254. •Significant differences in PCB means in soil in different natural zones were found. -- Polychlorinated biphenyls were measured in soils throughout Mongolia

  3. Large area window on vacuum chamber surface for neutron scattering instruments

    International Nuclear Information System (INIS)

    Itoh, Shinichi; Yokoo, Tetsuya; Ueno, Kenji; Suzuki, Junichi; Teraoku, Takuji; Tsuchiya, Masao


    The feasibility of a large area window using a thin aluminum plate on the surface of the vacuum chamber for neutron scattering instruments at a pulsed neutron source was investigated. In the prototype investigation for a window with an area of 1m×1.4m and a thickness of 1 mm, the measured pressure dependence of the displacement agreed well with a calculation using a nonlinear strain–stress curve up to the plastic deformation region. In addition, we confirmed the repetition test up to 2000 pressurization-and-release cycles, which is sufficient for the lifetime of the vacuum chamber for neutron scattering instruments. Based on these investigations, an actual model of the window to be mounted on the vacuum chamber of the High Resolution Chopper Spectrometer (HRC) at J-PARC was designed. By using a calculated stress distribution on the window, the clamping structure capable of balancing the tension in the window was determined. In a model with a structure identical to the actual window, we confirmed the repetition test over more than 7000 pressurization-and-release cycles, which shows a lifetime long enough for the actual usage of the vacuum chamber on the HRC.

  4. Evaluation of light detector surface area for functional Near Infrared Spectroscopy. (United States)

    Wang, Lei; Ayaz, Hasan; Izzetoglu, Meltem; Onaral, Banu


    Functional Near Infrared Spectroscopy (fNIRS) is an emerging neuroimaging technique that utilizes near infrared light to detect cortical concentration changes of oxy-hemoglobin and deoxy-hemoglobin non-invasively. Using light sources and detectors over the scalp, multi-wavelength light intensities are recorded as time series and converted to concentration changes of hemoglobin via modified Beer-Lambert law. Here, we describe a potential source for systematic error in the calculation of hemoglobin changes and light intensity measurements. Previous system characterization and analysis studies looked into various fNIRS parameters such as type of light source, number and selection of wavelengths, distance between light source and detector. In this study, we have analyzed the contribution of light detector surface area to the overall outcome. Results from Monte Carlo based digital phantoms indicated that selection of detector area is a critical system parameter in minimizing the error in concentration calculations. The findings here can guide the design of future fNIRS sensors. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. Construction of the Geological Model around KURT area based on the surface investigations

    International Nuclear Information System (INIS)

    Park, Kyung Woo; Koh, Yong Kwon; Kim, Kyung Su; Choi, Jong Won


    To characterize the geological features in the study area for high-level radioactive waste disposal research, KAERI (Korea Atomic Energy Research Institute) has been performing several geological investigations such as geophysical surveys and borehole drillings since 1997. Especially, the KURT (KAERI Underground Research Tunnel) constructed to understand the deep geological environments in 2006. Recently, the deep boreholes, which have 500 m depth inside the left research module of the KURT and 1,000 m depth outside the KURT, were drilled to confirm and validate the results from a geological model. The objective of this research was to investigate hydrogeological conditions using a 3-D geological model around the KURT. The geological analysis from the surface and borehole investigations determined four important geological elements including subsurface weathered zone, low-angled fractures zone, fracture zones and bedrock for the geological model. In addition, the geometries of these elements were also calculated for the three-dimensional model. The results from 3-D geological model in this study will be beneficial to understand hydrogeological environment in the study area as an important part of high-level radioactive waste disposal technology.

  6. Representation of Glossy Material Surface in Ventral Superior Temporal Sulcal Area of Common Marmosets. (United States)

    Miyakawa, Naohisa; Banno, Taku; Abe, Hiroshi; Tani, Toshiki; Suzuki, Wataru; Ichinohe, Noritaka


    The common marmoset ( Callithrix jacchus ) is one of the smallest species of primates, with high visual recognition abilities that allow them to judge the identity and quality of food and objects in their environment. To address the cortical processing of visual information related to material surface features in marmosets, we presented a set of stimuli that have identical three-dimensional shapes (bone, torus or amorphous) but different material appearances (ceramic, glass, fur, leather, metal, stone, wood, or matte) to anesthetized marmoset, and recorded multiunit activities from an area ventral to the superior temporal sulcus (STS) using multi-shanked, and depth resolved multi-electrode array. Out of 143 visually responsive multiunits recorded from four animals, 29% had significant main effect only of the material, 3% only of the shape and 43% of both the material and the shape. Furthermore, we found neuronal cluster(s), in which most cells: (1) showed a significant main effect in material appearance; (2) the best stimulus was a glossy material (glass or metal); and (3) had reduced response to the pixel-shuffled version of the glossy material images. The location of the gloss-selective area was in agreement with previous macaque studies, showing activation in the ventral bank of STS. Our results suggest that perception of gloss is an important ability preserved across wide range of primate species.

  7. Description of surface systems. Preliminary site description. Forsmark area Version 1.2

    Energy Technology Data Exchange (ETDEWEB)

    Lindborg, Tobias [ed.


    Swedish Nuclear Fuel and Waste Management Co (SKB) started site investigations for a deep repository for spent nuclear fuel in 2002 at two different sites in Sweden, Forsmark and Oskarshamn. The investigations should provide necessary information for a license application aimed at starting underground exploration. For this reason, ecosystem data need to be interpreted and assessed into site descriptive models, which in turn are used for safety assessment studies and for environmental impact assessment. Descriptions of the surface system are also needed for further planning of the site investigations. This report describes the surface ecosystems of the Forsmark site (e.g. hydrology, Quaternary deposits, chemistry, vegetation, animals and the human land use). The ecosystem description is an integration of the site and its regional setting, covering the current state of the biosphere as well as the ongoing natural processes affecting the longterm development. Improving the descriptions is important during both the initial and the complete site investigation phase. Before starting of the initial phase in Forsmark, version 0 of the site descriptive model was developed. The results of the initial site investigation phase is compiled into a preliminary site description of Forsmark (version 1.2) in June 2005. This report provides the major input and background to the biosphere description, in the 1.2 version of the Forsmark site description. The basis for this interim version is quality-assured field data from the Forsmark sub area and regional area, available in the SKB SICADA, and GIS data bases as of July 31th 2004 as well as version 1.1 of the Site Descriptive Model. To achieve an ecosystem site description there is a need to develop discipline-specific models by interpreting and analysing primary data. The different discipline-specific models are then integrated into a system describing interactions and flows and stocks of matter between and within functional units in

  8. Description of surface systems. Preliminary site description. Forsmark area Version 1.2

    International Nuclear Information System (INIS)

    Lindborg, Tobias


    Swedish Nuclear Fuel and Waste Management Co (SKB) started site investigations for a deep repository for spent nuclear fuel in 2002 at two different sites in Sweden, Forsmark and Oskarshamn. The investigations should provide necessary information for a license application aimed at starting underground exploration. For this reason, ecosystem data need to be interpreted and assessed into site descriptive models, which in turn are used for safety assessment studies and for environmental impact assessment. Descriptions of the surface system are also needed for further planning of the site investigations. This report describes the surface ecosystems of the Forsmark site (e.g. hydrology, Quaternary deposits, chemistry, vegetation, animals and the human land use). The ecosystem description is an integration of the site and its regional setting, covering the current state of the biosphere as well as the ongoing natural processes affecting the longterm development. Improving the descriptions is important during both the initial and the complete site investigation phase. Before starting of the initial phase in Forsmark, version 0 of the site descriptive model was developed. The results of the initial site investigation phase is compiled into a preliminary site description of Forsmark (version 1.2) in June 2005. This report provides the major input and background to the biosphere description, in the 1.2 version of the Forsmark site description. The basis for this interim version is quality-assured field data from the Forsmark sub area and regional area, available in the SKB SICADA, and GIS data bases as of July 31th 2004 as well as version 1.1 of the Site Descriptive Model. To achieve an ecosystem site description there is a need to develop discipline-specific models by interpreting and analysing primary data. The different discipline-specific models are then integrated into a system describing interactions and flows and stocks of matter between and within functional units in

  9. Accessible reactive surface area and abiotic redox reactivity of iron oxyhydroxides in acidic brines (United States)

    Strehlau, Jennifer H.; Toner, Brandy M.; Arnold, William A.; Penn, R. Lee


    The reactivity of iron oxyhydroxide nanoparticles in low pH and high ionic strength solutions was quantified to assess abiotic contributions to oxidation-reduction chemistry in acidic brine environments, such as mine groundwater seepage, lakes in Western Australia, and acid mine drainage settings, which are of global interest for their environmental impacts and unique geomicrobiology. Factors expected to influence accessible and reactive surface area, including Fe(II) adsorption and aggregate size, were measured as a function of pH and CaCl2 concentration and related to the kinetics of redox reactions in aqueous suspensions of synthetic goethite (α-FeOOH), akaganeite (β-FeOOH), and ferrihydrite (Fe10O14(OH)2) nanoparticles. Aqueous conditions and iron oxyhydroxides were chosen based on characterization of natural iron-rich mine microbial mats located in Soudan Underground Mine State Park, Minnesota, USA. Quinone species were used as redox sensors because they are well-defined probes and are present in natural organic matter. Fe(II) adsorption to the iron oxyhydroxide mineral surfaces from aqueous solution was measurable only at pH values above 4 and either decreased or was not affected by CaCl2 concentration. Concentrations at or above 0.020 M CaCl2 in acetate buffer (pH 4.5) induced particle aggregation. Assessment of Fe(II) adsorption and particle aggregation in acidic brine suggested that accessible reactive surface area may be limited in acidic brines. This was supported by observations of decreasing benzoquinone reduction rate by adsorbed Fe(II) at high CaCl2 concentration. In contrast, the hydroquinone oxidation rate increased at high CaCl2 concentrations, which may be due to suppressed adsorption of Fe(II) generated by the reaction. Results suggest that iron geochemical cycling in acidic brine environments will be substantially different than for iron oxyhydroxides in low-saline waters with circumneutral pH. These findings have implications for acidic

  10. Albedo and land surface temperature shift in hydrocarbon seepage potential area, case study in Miri Sarawak Malaysia (United States)

    Suherman, A.; Rahman, M. Z. A.; Busu, I.


    The presence of hydrocarbon seepage is generally associated with rock or mineral alteration product exposures, and changes of soil properties which manifest with bare development and stress vegetation. This alters the surface thermodynamic properties, changes the energy balance related to the surface reflection, absorption and emission, and leads to shift in albedo and LST. Those phenomena may provide a guide for seepage detection which can be recognized inexpensively by remote sensing method. District of Miri is used for study area. Available topographic maps of Miri and LANDSAT ETM+ were used for boundary construction and determination albedo and LST. Three land use classification methods, namely fixed, supervised and NDVI base classifications were employed for this study. By the intensive land use classification and corresponding statistical comparison was found a clearly shift on albedo and land surface temperature between internal and external seepage potential area. The shift shows a regular pattern related to vegetation density or NDVI value. In the low vegetation density or low NDVI value, albedo of internal area turned to lower value than external area. Conversely in the high vegetation density or high NDVI value, albedo of internal area turned to higher value than external area. Land surface temperature of internal seepage potential was generally shifted to higher value than external area in all of land use classes. In dense vegetation area tend to shift the temperature more than poor vegetation area.

  11. Albedo and land surface temperature shift in hydrocarbon seepage potential area, case study in Miri Sarawak Malaysia

    International Nuclear Information System (INIS)

    Suherman, A; Rahman, M Z A; Busu, I


    The presence of hydrocarbon seepage is generally associated with rock or mineral alteration product exposures, and changes of soil properties which manifest with bare development and stress vegetation. This alters the surface thermodynamic properties, changes the energy balance related to the surface reflection, absorption and emission, and leads to shift in albedo and LST. Those phenomena may provide a guide for seepage detection which can be recognized inexpensively by remote sensing method. District of Miri is used for study area. Available topographic maps of Miri and LANDSAT ETM+ were used for boundary construction and determination albedo and LST. Three land use classification methods, namely fixed, supervised and NDVI base classifications were employed for this study. By the intensive land use classification and corresponding statistical comparison was found a clearly shift on albedo and land surface temperature between internal and external seepage potential area. The shift shows a regular pattern related to vegetation density or NDVI value. In the low vegetation density or low NDVI value, albedo of internal area turned to lower value than external area. Conversely in the high vegetation density or high NDVI value, albedo of internal area turned to higher value than external area. Land surface temperature of internal seepage potential was generally shifted to higher value than external area in all of land use classes. In dense vegetation area tend to shift the temperature more than poor vegetation area

  12. Relationship between surface area for adhesion and tensile bond strength--evaluation of a micro-tensile bond test. (United States)

    Sano, H; Shono, T; Sonoda, H; Takatsu, T; Ciucchi, B; Carvalho, R; Pashley, D H


    The purpose of this study was to test the null hypothesis that there is no relationship between the bonded surface area of dentin and the tensile strength of adhesive materials. The enamel was removed from the occlusal surface of extracted human third molars, and the entire flat surface was covered with resin composite bonded to the dentin to form a flat resin composite crown. Twenty-four hours later, the bonded specimens were sectioned parallel to the long axis of the tooth into 10-20 thin sections whose upper part was composed of resin composite with the lower half being dentin. These small sections were trimmed using a high speed diamond bur into an hourglass shape with the narrowest portion at the bonded interface. Surface area was varied by altering the specimen thickness and width. Tensile bond strength was measured using custom-made grips in a universal testing machine. Tensile bond strength was inversely related to bonded surface area. At surface areas below 0.4 mm2, the tensile bond strengths were about 55 MPa for Clearfil Liner Bond 2 (Kuraray Co., Ltd.), 38 MPa for Scotchbond MP (3M Dental Products), and 20 MPa for Vitremer (3M Dental Products). At these small surface areas all of the bond failures were adhesive in nature. This new method permits measurement of high bond strengths without cohesive failure of dentin. It also permits multiple measurements to be made within a single tooth.

  13. The Genetic Association Between Neocortical Volume and General Cognitive Ability Is Driven by Global Surface Area Rather Than Thickness. (United States)

    Vuoksimaa, Eero; Panizzon, Matthew S; Chen, Chi-Hua; Fiecas, Mark; Eyler, Lisa T; Fennema-Notestine, Christine; Hagler, Donald J; Fischl, Bruce; Franz, Carol E; Jak, Amy; Lyons, Michael J; Neale, Michael C; Rinker, Daniel A; Thompson, Wesley K; Tsuang, Ming T; Dale, Anders M; Kremen, William S


    Total gray matter volume is associated with general cognitive ability (GCA), an association mediated by genetic factors. It is expectable that total neocortical volume should be similarly associated with GCA. Neocortical volume is the product of thickness and surface area, but global thickness and surface area are unrelated phenotypically and genetically in humans. The nature of the genetic association between GCA and either of these 2 cortical dimensions has not been examined. Humans possess greater cognitive capacity than other species, and surface area increases appear to be the primary driver of the increased size of the human cortex. Thus, we expected neocortical surface area to be more strongly associated with cognition than thickness. Using multivariate genetic analysis in 515 middle-aged twins, we demonstrated that both the phenotypic and genetic associations between neocortical volume and GCA are driven primarily by surface area rather than thickness. Results were generally similar for each of 4 specific cognitive abilities that comprised the GCA measure. Our results suggest that emphasis on neocortical surface area, rather than thickness, could be more fruitful for elucidating neocortical-GCA associations and identifying specific genes underlying those associations. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail:

  14. Nanoparticles in natural systems I: The effective reactive surface area of the natural oxide fraction in field samples.

    NARCIS (Netherlands)

    Hiemstra, T.; Antelo, J.; Rahnemaie, R.; Riemsdijk, van W.H.


    Information on the particle size and reactive surface area of natural samples is essential for the application of surface complexation models (SCM) to predict bioavailability, toxicity, and transport of elements in the natural environment. In addition, this information will be of great help to

  15. Three-dimensional measurement of periodontal surface area for quantifying inflammatory burden. (United States)

    Park, Sa-Beom; An, So-Youn; Han, Won-Jeong; Park, Jong-Tae


    Measurement of the root surface area (RSA) is important in periodontal treatment and for the evaluation of periodontal disease as a risk factor for systemic disease. The aim of this study was to measure the RSA at 6 mm below the cementoenamel junction (CEJ) using the Mimics software (Materialise, Leuven, Belgium). We obtained cone-beam computed tomography (CBCT) data from 33 patients who had visited the Department of Oral and Maxillofacial Radiology of Dankook University Dental Hospital. The patients comprised 17 men and 16 women aged from 20 to 35 years, with a mean age of 24.4 years. Only morphologically intact teeth were included in our data. Because the third molars of the maxilla and mandible have a high deformation rate and were absent in some participants, they were not included in our research material. The CBCT data were reconstructed into 3-dimensional (3D) teeth models using the Mimics software, and the RSA at 6 mm below the CEJ was separated and measured using 3-Matic (Materialise). In total, 924 3D teeth models were created, and the area at 6 mm below the CEJ could be isolated in all the models. The area at 6 mm below the CEJ was measured in all teeth from the 33 patients and compared based on sex and position (maxilla vs. mandible). In this study, we demonstrated that it was feasible to generate 3D data and to evaluate RSA values using CBCT and the Mimics software. These results provide deeper insights into the relationship between periodontal inflammatory burden and systemic diseases.

  16. Effect of uncertainty in Digital Surface Models on the boundary of inundated areas (United States)

    Nalbantis, I.; Papageorgaki, I.; Sioras, P.; Ioannidis, Ch.


    The planning, design and operation of flood damage reduction works or non-structural measures require the construction of maps that indicate zones to be potentially inundated during floods. Referring to floods due to heavy rainfall, the common procedure for flood mapping consists of the following five computational steps: (1) Frequency analysis of extreme rainfall; (2) construction of design hyetographs for various return periods; (3) construction of the related direct runoff hydrographs; (4) routing of these hydrographs through the hydrographic network; (5) mapping of the inundated area that corresponds to the temporally maximum depth for each location in the flood plain. Steps 3 through 5 require the use of spatial information which can be easily obtained from a Digital Surface Model (DSM). The DSM contains grid-based elevations of the ground or overlying objects that influence the propagation of flood waves. In this work, the SCS-CN method is used in step 3 in combination with a synthetic Unit Hydrograph based on the SCS dimensionless Unit Hydrograph. In step 4, the full one-dimensional Saint Venant equations for non-uniform unsteady flow on fixed bed are used, which are numerically solved. The impact of uncertainty in the DSM on the inundated area boundary is investigated. For this the Monte Carlo simulation method is employed to produce a large number of erroneous DSMs through introducing errors in elevation with a standard deviation equal to σ. These DSMs are then used for delineating potentially flooded areas. The standard deviation of the distance (from the riverbed axis) of the boundary of these areas, herein denoted as σF, is used as the measure of the resulting uncertainty. The link between σ and σF is examined for a spectrum of large return periods (100 to 10000). A computer experiment was set up based on data from two drainage basins. The first basin is located in East Attica and is drained by a branch of the Erasinos Torrent named the South

  17. Human Effects and Soil Surface CO2 fluxes in Tropical Urban Green Areas, Singapore (United States)

    Ng, Bernard; Gandois, Laure; Kai, Fuu Ming; Chua, Amy; Cobb, Alex; Harvey, Charles; Hutyra, Lucy


    Urban green spaces are appreciated for their amenity value, with increasing interest in the ecosystem services they could provide (e.g. climate amelioration and increasingly as possible sites for carbon sequestration). In Singapore, turfgrass occupies approximately 20% of the total land area and is readily found on both planned and residual spaces. This project aims at understanding carbon fluxes in tropical urban green areas, including controls of soil environmental factors and the effect of urban management techniques. Given the large pool of potentially labile carbon, management regimes are recognised to have an influence on soil environmental factors (temperature and moisture), this would affect soil respiration and feedbacks to the greenhouse effect. A modified closed dynamic chamber method was employed to measure total soil respiration fluxes. In addition to soil respiration rates, environmental factors such as soil moisture and temperature, and ambient air temperature were monitored for the site in an attempt to evaluate their control on the observed fluxes. Measurements of soil-atmosphere CO2 exchanges are reported for four experimental plots within the Singtel-Kranji Radio Transmission Station (103o43'49E, 1o25'53N), an area dominated by Axonopus compressus. Different treatments such as the removal of turf, and application of clippings were effected as a means to determine the fluxes from the various components (respiration of soil and turf, and decomposition of clippings), and to explore the effects of human intervention on observed effluxes. The soil surface CO2 fluxes observed during the daylight hours ranges from 2.835 + 0.772 umol m-2 s-1 for the bare plot as compared to 6.654 + 1.134 umol m-2 s-1 for the turfed plot; this could be attributed to both autotrophic and heterotrophic respiration. Strong controls of both soil temperature and soil moisture are observed on measured soil fluxes. On the base soils, fluxes were positively correlated to soil

  18. Measuring stone surface area from a radiographic image is accurate and reproducible with the help of an imaging program. (United States)

    Kurien, Abraham; Ganpule, Arvind; Muthu, V; Sabnis, R B; Desai, Mahesh


    The surface area of the stone from a radiographic image is one of the more suitable parameters defining stone bulk. The widely accepted method of measuring stone surface area is to count the number of square millimeters enclosed within a tracing of the stone outline on graph paper. This method is time consuming and cumbersome with potential for human error, especially when multiple measurements are needed. The purpose of this study was to evaluate the accuracy, efficiency, and reproducibility of a commercially available imaging program, Adobe Photoshop 7.0 for the measurement of stone surface area. The instructions to calculate area using the software are simple and easy in a Windows-based format. The accuracy of the imaging software was estimated by measuring surface areas of shapes of known mathematical areas. The efficiency and reproducibility were then evaluated from radiographs of 20 persons with radiopaque upper-tract urinary stones. The surface areas of stone images were measured using both graph paper and imaging software. Measurements were repeated after 10 days to assess the reproducibility of the techniques. The time taken to measure the area by the two methods was also assessed separately. The accuracy of the imaging software was estimated to be 98.7%. The correlation coefficient between the two methods was R(2) = 0.97. The mean percentage variation using the imaging software was 0.68%, while it was 6.36% with the graph paper. The mean time taken to measure using the image analyzer and graph paper was 1.9 +/- 0.8 minutes and 4.5 +/- 1.08 minutes, respectively (P stone surface area from radiographs compared with manual measurements using graph paper.

  19. Modification of Surface Roughness and Area of FeCrAl Substrate for Catalytic Converter using Ultrasonic Treatment

    Directory of Open Access Journals (Sweden)

    Yanuandri Putrasari


    Full Text Available Surface roughness and area play important role especially in deposition and reaction of the catalyst in the catalytic converter substrate. The aim of this paper is to show the modification of surface roughness and area of FeCrAl substrate for catalytic converter using ultrasonic method. The method was conducted by agitating the FeCrAl in 10 minutes 35 kHz ultrasonic cleaning bath. The  surface roughness, morphology, and chemical components of FeCrAl catalytic converter substrate after ultrasonic treatment were analyzed using atomic force microscope (AFM and examined with scanning electron microscope (SEM in combination with energy dispersive X-ray spectroscopy (EDS. The ultrasonic treatment assisted with Al2O3 powders successfully increased the roughness and surface area of FeCrAl better than SiC powders. 

  20. Lung ventilation injures areas with discrete alveolar flooding, in a surface tension-dependent fashion. (United States)

    Wu, You; Kharge, Angana Banerjee; Perlman, Carrie E


    With proteinaceous-liquid flooding of discrete alveoli, a model of the edema pattern in the acute respiratory distress syndrome, lung inflation over expands aerated alveoli adjacent to flooded alveoli. Theoretical considerations suggest that the overexpansion may be proportional to surface tension, T. Yet recent evidence indicates proteinaceous edema liquid may not elevate T. Thus whether the overexpansion is injurious is not known. Here, working in the isolated, perfused rat lung, we quantify fluorescence movement from the vasculature to the alveolar liquid phase as a measure of overdistension injury to the alveolar-capillary barrier. We label the perfusate with fluorescence; micropuncture a surface alveolus and instill a controlled volume of nonfluorescent liquid to obtain a micropunctured-but-aerated region (control group) or a region with discrete alveolar flooding; image the region at a constant transpulmonary pressure of 5 cmH2O; apply five ventilation cycles with a positive end-expiratory pressure of 0-20 cmH2O and tidal volume of 6 or 12 ml/kg; return the lung to a constant transpulmonary pressure of 5 cmH2O; and image for an additional 10 min. In aerated areas, ventilation is not injurious. With discrete alveolar flooding, all ventilation protocols cause sustained injury. Greater positive end-expiratory pressure or tidal volume increases injury. Furthermore, we determine T and find injury increases with T. Inclusion of either plasma proteins or Survanta in the flooding liquid does not alter T or injury. Inclusion of 2.7-10% albumin and 1% Survanta together, however, lowers T and injury. Contrary to expectation, albumin inclusion in our model facilitates exogenous surfactant activity. Copyright © 2014 the American Physiological Society.