WorldWideScience

Sample records for supporting lake victoria

  1. The diversity of benthic mollusks of Lake Victoria and Lake Burigi ...

    African Journals Online (AJOL)

    Molluscan diversity, abundance and distribution in sediments of Lake Victoria and its satellite lake, Lake Burigi, were investigated. The survey was carried out in January and February 2002 for Lake Victoria and in March and April 2002 for Lake Burigi. Ten genera were recorded from four zones of Lake Victoria while only ...

  2. Early warnings of hazardous thunderstorms over Lake Victoria

    Science.gov (United States)

    Thiery, Wim; Gudmundsson, Lukas; Bedka, Kristopher; Semazzi, Fredrick H. M.; Lhermitte, Stef; Willems, Patrick; van Lipzig, Nicole P. M.; Seneviratne, Sonia I.

    2017-07-01

    Weather extremes have harmful impacts on communities around Lake Victoria in East Africa. Every year, intense nighttime thunderstorms cause numerous boating accidents on the lake, resulting in thousands of deaths among fishermen. Operational storm warning systems are therefore crucial. Here we complement ongoing early warning efforts based on numerical weather prediction, by presenting a new satellite data-driven storm prediction system, the prototype Lake Victoria Intense storm Early Warning System (VIEWS). VIEWS derives predictability from the correlation between afternoon land storm activity and nighttime storm intensity on Lake Victoria, and relies on logistic regression techniques to forecast extreme thunderstorms from satellite observations. Evaluation of the statistical model reveals that predictive power is high and independent of the type of input dataset. We then optimise the configuration and show that false alarms also contain valuable information. Our results suggest that regression-based models that are motivated through process understanding have the potential to reduce the vulnerability of local fishing communities around Lake Victoria. The experimental prediction system is publicly available under the MIT licence at http://github.com/wthiery/VIEWS.

  3. Causes and effects of the Lake Victoria ecological revolution

    NARCIS (Netherlands)

    Goudswaard, Pleun Cornelis

    2006-01-01

    Nile perch was introduced in Lake Victoria in the 1950s and exploded in number during the 1980s. The process of colonization of the lake by this predatory fish is described and explained. The changes in a number of other fauna elements of Lake Victoria are described and explained. Not only Nile

  4. Has climate change disrupted stratification patterns in Lake Victoria ...

    African Journals Online (AJOL)

    Has climate change disrupted stratification patterns in Lake Victoria, East Africa? ... Climate change may threaten the fisheries of Lake Victoria by increasing density differentials in the water column, thereby strengthening stratification and increasing the ... Keywords: deoxygenation, fisheries, global warming, thermocline

  5. Adaptive responses to environmental changes in Lake Victoria cichlids

    NARCIS (Netherlands)

    Rijssel, Jacobus Cornelis van (Jacco)

    2014-01-01

    Lake Victoria cichlids show the fastest vertebrate adaptive radiation known which is why they function as a model organism to study evolution. In the past 40 years, Lake Victoria experienced severe environmental changes including the boom of the introduced, predatory Nile perch and eutrophication.

  6. Parameterization of the inherent optical properties of Murchison Bay, Lake Victoria

    Science.gov (United States)

    Okullo, Willy; Ssenyonga, Taddeo; Hamre, Børge; Frette, Øyvind; Sørensen, K.; Stamnes, Jakob J.; Steigen, Andreas; Stamnes, Knut

    2007-12-01

    Lake Victoria, Africa's largest freshwater lake, suffers greatly from negative changes in biomass of species of fish and also from severe eutrophication. The continuing deterioration of Lake Victoria's ecological functions has great long-term consequences for the ecosystem benefits it provides to the countries bordering its shores. However, knowledge about temporal and spatial variations of optical properties and how they relate to lake constituents is important for a number of reasons such as remote sensing, modeling of underwater light fields, and long-term monitoring of lake waters. Based on statistical analysis of data from optical measurements taken during half a year of weekly cruises in Murchison Bay, Lake Victoria, we present a three-component model for the absorption and a two-component model for the scattering of light in the UV and the visible regions of the solar spectrum along with tests of their ranges of validity. The three-component input to the model for absorption is the chlorophyll-a (Chl-a), total suspended materials concentrations, and yellow substance absorption, while the two-component input to the model for scattering is the Chl-a concentration and total suspended materials.

  7. Malaria vectors in Lake Victoria and adjacent habitats in western Kenya.

    Directory of Open Access Journals (Sweden)

    Noboru Minakawa

    Full Text Available The prevalence of malaria among the residents of the Lake Victoria basin remains high. The environment associated with the lake may maintain a high number of malaria vectors. Lake habitats including water hyacinths have been suspected to be the source of vectors. This study investigated whether malaria vectors breed in the lake habitats and adjacent backwater pools. Anopheline larvae were collected within the littoral zone of the lake and adjacent pools located along approximately 24.3 km of the lakeshore in western Kenya, and their breeding sites characterized. Three primary vector species, Anopheles arabiensis, Anopheles gambiae s.s. and Anopheles funestus s.s., and three potential vectors, were found in the lake habitats. Unexpectedly, An. arabiensis was the most dominant vector species in the lake sampling sites. Its habitats were uncovered or covered with short grass. A potential secondary malaria vector, Anopheles rivulorum, dominated the water hyacinths in the lake. Most breeding sites in the lake were limited to areas that were surrounded by tall emergent plants, including trees, and those not exposed to waves. Nearly half of adjacent habitats were lagoons that were separated from the lake by sand bars. Lagoons contained a variety of microhabitats. Anopheles arabiensis dominated open habitats, whereas An. funestus s.s. was found mainly in vegetated habitats in lagoons. The current study confirmed that several breeding sites are associated with Lake Victoria. Given that Lake Victoria is the second largest lake in the world, the lake related habitats must be extensive; therefore, making targeted vector control difficult. Further exploration is necessary to estimate the effects of lake associated habitats on malaria transmission so as to inform a rational decision-making process for vector control.

  8. Regional nitrogen budget of the Lake Victoria Basin, East Africa: syntheses, uncertainties and perspectives

    Science.gov (United States)

    Zhou, Minghua; Brandt, Patric; Pelster, David; Rufino, Mariana C.; Robinson, Timothy; Butterbach-Bahl, Klaus

    2014-10-01

    Using the net anthropogenic nitrogen input (NANI) approach we estimated the N budget for the Lake Victoria Basin in East Africa. The NANI of the basin ranged from 887 to 3008 kg N km-2 yr-1 (mean: 1827 kg N km-2 yr-1) for the period 1995-2000. The net nitrogen release at basin level is due primarily to livestock and human consumption of feed and foods, contributing between 69% and 85%. Atmospheric oxidized N deposition contributed approximately 14% to the NANI of the Lake Victoria Basin, while either synthetic N fertilizer imports or biological N fixations only contributed less than 6% to the regional NANI. Due to the low N imports of feed and food products (export to Lake Victoria accounted for 16%, which is much lower than for watersheds located in Europe and USA (25%). A significant reduction of the uncertainty of our N budget estimate for Lake Victoria Basin would be possible if better data on livestock systems and riverine N export were available. Our study indicates that at present soil N mining is the main source of nitrogen in the Lake Victoria Basin. Thus, sustainable N management requires increasing agricultural N inputs to guarantee food security and rehabilitation and protection of soils to minimize environmental costs. Moreover, to reduce N pollution of the lake, improving management of human and animal wastes needs to be carefully considered in future.

  9. Total mercury concentration in common fish species of Lake Victoria ...

    African Journals Online (AJOL)

    Total mercury (THg) concentration was analysed in muscles of common fish species of Lake Victoria in the eastern and southern parts of the lake using cold vapour Atomic Absorption Spectrophotometric technique. Mercury concentration in all fish species was generally lower than the WHO maximum allowable ...

  10. ('fingerponds\\') in the wetlands of Lake Victoria, Kenya

    African Journals Online (AJOL)

    The potential effect on ecosystem integrity of the use of natural wetlands for seasonal wetland fishponds ('fingerponds\\'), integrated with vegetable production for livelihood demands, was evaluated using experimental sites at Lake Victoria, Kenya. Soluble reactive phosphorous and total phosphorus, ammonium, nitrate and ...

  11. Levels of toxic metals in multisectoral samples from Winam Gulf of Lake Victoria.

    Science.gov (United States)

    Ongeri, D M K; Lalah, J O; Wandiga, S O; Schramm, K W; Michalke, B

    2009-01-01

    In this study, the distribution and sources of inputs of trace metals including Cd, Cu, Zn and Pb from various sources as well as Fe which is widely used in the construction industry, into Winam Gulf of Lake Victoria were investigated. The sampling sites were located up streams and down streams of four rivers (Sio, Nyamasaria, Nyando and Sondu-Miriu), in four beaches along the lake (Port Victoria, Kisumu Car Wash, Dunga and Hippo point beaches) and in three estates (Nyamasaria, Migosi and Nyawita) in Kisumu city, covering potential agrochemical and industrial sources and drinking water points, respectively. The concentrations (in microg/L) of trace metals analysed in the lake and river waters ranged from Car Wash area. The study confirmed that the concentrations of the metals accumulate downstream in the rivers both in water and sediment and these rivers are major sources of the heavy metal load into Winam Gulf of Lake Victoria.

  12. Satellite-Based Assessment of the spatial extent of Aquatic Vegetation in Lake Victoria

    Science.gov (United States)

    Clark, W.; Aligeti, N.; Jeyaprakash, T.; Martins, M.; Stodghill, J.; Winstanley, H.

    2011-12-01

    Lake Victoria in Africa is the second largest freshwater lake in the world and is known for its abundance of aquatic wildlife. In particular over 200 different fish species are caught and sold by local fisherman. The lake is a major contributor to the local economy as a corridor of transportation, source of drinking water, and source of hydropower. However, the invasion of aquatic vegetation such as water hyacinth in the lake has disrupted each of these markets. Aquatic vegetation now covers a substantial area of the coastline blocking waterways, disrupting hydropower, hindering the collection of drinking water and decreasing the profitability of fishing. The vegetation serves as a habitat for disease carrying mosquitoes as well as snakes and snails that spread the parasitic disease bilharzia. The current control measures of invasive aquatic vegetation rely on biological, chemical and mechanical control. The objective of this study was to utilize remote sensing to map aquatic vegetation within Lake Victoria from 2000 to 2011. MODIS, Landsat 4-5TM, and Landsat 7-ETM imagery was employed to perform change detections in vegetation and identify the extent of aquatic vegetation throughout the years. The efficiency of containment efforts were evaluated and ideal time for application of such efforts were suggested. A methodology for aquatic vegetation surveillance was created. The results of this project were presented as a workshop to the Lake Victoria Fisheries Organization, SERVIR, and other partner organizations. The workshop provided instruction into the use of NASA and other satellite derived products. Time series animations of the spatial extent of aquatic vegetation within the lake were created. By identifying seasons of decreased aquatic vegetation, ideal times to employ control efforts were identified. SERVIR will subsequently utilize the methodologies and mapping results of this study to develop operational aquatic vegetation surveillance for Lake Victoria.

  13. Lake Victoria's Water Budget and the Potential Effects of Climate ...

    African Journals Online (AJOL)

    This paper presents the Lake Victoria water budget for the period 1950-2004 and findings of a study on potential climate change impact on the lake's Hydrology through the 21st Century. The mass balance components are computed from measured and simulated data. A2 and B2 emission scenarios of the Special Report ...

  14. Water hyacinth hotspots in the Ugandan waters of Lake Victoria in ...

    African Journals Online (AJOL)

    Water hyacinth invaded Lake Victoria in the 1980s and, by 1998, had attained peak coverage of approximately 2 000 ha in the Ugandan waters of the lake. Control interventions, especially via biological means, significantly reduced the weed's coverage to non-nuisance levels (<10 ha) by 1999. Although resurgence was ...

  15. Mitigation of environmental problems in Lake Victoria, East Africa: causal chain and policy options analyses.

    Science.gov (United States)

    Odada, Eric O; Olago, Daniel O; Kulindwa, Kassim; Ntiba, Micheni; Wandiga, Shem

    2004-02-01

    Lake Victoria is an international waterbody that offers the riparian communities a large number of extremely important environmental services. Over the past three decades or so, the lake has come under increasing and considerable pressure from a variety of interlinked human activities such as overfishing, species introductions, industrial pollution, eutrophication, and sedimentation. In this paper we examine the root causes for overfishing and pollution in Lake Victoria and give possible policy options that can help remediate or mitigate the environmental degradation.

  16. Fishing Business Arrangements and Sustainability in Lake Victoria ...

    African Journals Online (AJOL)

    In this article an attempt is made to analyse the existing production relations between the owners of the vessels and the crewmembers and the concern for sustainability. Our results found that the existing sharing system in Lake Victoria poses a big challenge in as far as sustainability is concerned. Some of the system such ...

  17. Distribution of Nile perch Lates niloticus in southern Lake Victoria is ...

    African Journals Online (AJOL)

    Although Nile perch Lates niloticus is assumed to be sensitive to low oxygen concentrations, it was found in deep water in Lake Victoria, where oxygen depletion is common during the rainy season. Since factors determining Nile perch distribution are not well understood its spatial distribution in the Mwanza Gulf of Lake ...

  18. A review of mercury in Lake Victoria, East Africa: implications for human and ecosystem health.

    Science.gov (United States)

    Campbell, Linda; Dixon, D G; Hecky, R E

    2003-01-01

    Lake Victoria, East Africa, has been the site of many recent studies measuring mercury (Hg) concentrations in water, fish, sediment, soil, and humans. Most of these studies were motivated by concerns about Hg contamination from processing of gold ore on the southern shores. Total Hg (THg) concentrations in fish were usually below permissible World Health Organization (WHO) concentrations and international marketing limits and do not threaten the lucrative export industry. Nile perch 3-10 kg and most >10 kg had THg concentrations above the WHO threshold concentrations for at-risk groups (200 ng/g). Elevated THg concentrations in large Nile perch are not of major concern because Nile perch are rarely consumed by the people living on Lake Victoria and very large Nile perch are becoming increasingly rare in catches. Water THg concentrations were below Canadian drinking water guidelines but were elevated relative to those in the northern Great Lakes. Sediment and soil THg concentrations were within inter-national guidelines and are comparable to those in northern latitudes but are lower than those in the Amazon basin. Biomass burning and soil erosion are estimated to be the major sources of THg for the lake and probably constitute a larger source of THg than gold mining in Tanzania.THg concentrations in urine and hair from human volunteers indicate that while gold miners and frequent skin-bleaching cream users are at risk of inorganic mercury poisoning, the rest of the population, including fishermen, is not. Human exposure assessments demonstrated that fish consumption and soil geophagy constitute major sources of THg for humans, but the total estimated daily intake of THg was below the Health Canada tolerable daily intake (TDI) limits. The use of beauty creams containing high inorganic Hg concentrations, however, caused the estimated THg exposure to exceed the TDI. The high THg content in the hair of regular cream users supports this assessment. The nutritional

  19. Transactional sex in the fishing communities along Lake Victoria ...

    African Journals Online (AJOL)

    The study describes the nature, context and implications of a unique form of transactional sexual relationships in the fishing communities along Lake Victoria in Kisumu County, Kenya. We conducted 12 focus group discussions and 17 key informant interviews among fishermen, fishmongers and fish transporters in Kisumu.

  20. A Bottom-Up Understanding of Illegal, Unreported, and Unregulated Fishing in Lake Victoria

    Directory of Open Access Journals (Sweden)

    Joseph Luomba

    2016-10-01

    Full Text Available Illegal, unreported, and unregulated (IUU fishing is a major concern in fisheries management around the world. Several measures have been taken to address the problem. In Lake Victoria, the alleviation of IUU fishing is implemented through the Regional Plan of Action (RPOA-IUU, which restricts use of certain fishing gear, as well as prohibits fishing in closed areas and during closed seasons. Despite the long-term efforts to monitor and control what goes on in the fisheries, IUU fishing has persisted in Lake Victoria. Inspired by interactive governance theory, this paper argues that the persistence of IUU fishing could be due to different images that stakeholders have about the situation, rather than the lack of management competency. Through structured interviews with 150 fisheries stakeholders on Ijinga Island in the southeastern part of Lake Victoria, Tanzania, using paired comparison questionnaires, the study elicits stakeholders’ perspective about the severity of different locally-pertinent fishing-related activities. The results show that while fisheries stakeholder groups agree on their judgments about certain fishing gears, some differences are also apparent. For instance, fisheries managers and scientists do not always agree with fishing people about what activities cause the most damage to fisheries resources and ecosystem. Further, they tend to consider some IUU fishing-related activities less damaging than some non-IUU fishing. Such disparity creates governability challenges, pointing to the need to revisit relevant regulatory measures and to make them consistent with the knowledge and judgments of all stakeholders. Based on these findings, we discuss governing interventions that may contribute to addressing IUU fishing in Lake Victoria and elsewhere.

  1. Energy and Environment in the Lake Victoria basin.

    OpenAIRE

    Arungu-Olende, S.

    2006-01-01

    The local and national economies of Lake Victoria basin communities are heavily dependent on energy that fuels agriculture, industry, commerce, transportation and other economic activities; and powers our houses, offices, hospitals and buildings. Energy is therefore key to facilitating the development income generating opportunities, improving living standards, reducing poverty, and ensuring the protection of the environment. The development and use of various forms of renewable and non-renew...

  2. LAKE VICTORIA AND THE COMMON PROPERTY DEBATE: IS THE TRAGEDY OF THE COMMONS A THREAT TO ITS FUTURE?

    Directory of Open Access Journals (Sweden)

    Erick Ochieng OGELLO

    2013-12-01

    Full Text Available Lake Victoria is the largest among the African Great Lakes in East African region that are believed to have both dynamic and fragile aquatic ecosystems. Within two decades, the lake has experienced extensive resource exploitation leading to constrained productivity and drastic decline of native biodiversity. Intensive non-selective fishing, catchment vegetation degradation, industrial and agricultural pollution, the introduction of exotic species and uneven patchwork of governmental laws are some of the reasons for the current ecological woes facing Lake Victoria. This paper intends to stimulate recognition of Lake Victoria and its catchment as a lived Com­mons, to be shared, protected, managed and enjoyed by all who live around it. The paper compares the original biodiversity status of the lake with the current status and discusses the role of unlimited access as a function of the loss of the Lake’s biological wealth. The Lake’s water resource base, fishery, wetlands and other aquatic resources have been exhaustively discussed. In this review, we uphold the Hardin’s school of thought that freedom of the commoners causes resource overuse leading to poverty. Therefore, limiting freedom could be essential. However, there is need for provision of alternative means of survival since people with no choices would continue over-exploiting ecosystems even under limited access. The Lake Victoria basin commons should be protected by strict legal and clear political frame­work based on public trust doctrine, reinforced in law that the Lake is vital for the survival of people, plants and animals living on or near it and therefore must be protected for the common good. The political jurisdictions should consider governing the Lake basin as one integrated watershed. It is our fervent hope that bordering communities will secure grass root movements to protect and nurture Lake Victoria and its environs for the benefit of the present and future

  3. Nutritional composition and shelflife of the lake victoria nile perch ...

    African Journals Online (AJOL)

    Nile perch, the most important commercial fish species from the Lake Victoria fishery, contributes about 67% of Kenya's total annual fish export earnings. Despite the Nile perch being an important foreign exchange earner, little information is available on its nutritional composition and shelf life on ice, information that is ...

  4. B chromosomes have a functional effect on female sex determination in Lake Victoria cichlid fishes.

    Directory of Open Access Journals (Sweden)

    Kohta Yoshida

    2011-08-01

    Full Text Available The endemic cichlid fishes in Lake Victoria are a model system for speciation through adaptive radiation. Although the evolution of the sex-determination system may also play a role in speciation, little is known about the sex-determination system of Lake Victoria cichlids. To understand the evolution of the sex-determination system in these fish, we performed cytogenetic analysis in 11 cichlid species from Lake Victoria. B chromosomes, which are present in addition to standard chromosomes, were found at a high prevalence rate (85% in these cichlids. In one species, B chromosomes were female-specific. Cross-breeding using females with and without the B chromosomes demonstrated that the presence of the B chromosomes leads to a female-biased sex ratio in this species. Although B chromosomes were believed to be selfish genetic elements with little effect on phenotype and to lack protein-coding genes, the present study provides evidence that B chromosomes have a functional effect on female sex determination. FISH analysis using a BAC clone containing B chromosome DNA suggested that the B chromosomes are derived from sex chromosomes. Determination of the nucleotide sequences of this clone (104.5 kb revealed the presence of several protein-coding genes in the B chromosome, suggesting that B chromosomes have the potential to contain functional genes. Because some sex chromosomes in amphibians and arthropods are thought to be derived from B chromosomes, the B chromosomes in Lake Victoria cichlids may represent an evolutionary transition toward the generation of sex chromosomes.

  5. Existence versus extinction : Human-hippo conflicts in Lake Victoria Area, Kenya

    NARCIS (Netherlands)

    Post, A.W.C.H.M.

    2017-01-01

    This PhD dissertation examines the role of different organisations and affected communities in human-wildlife governance, with a focus on human-hippo conflicts in Lake Victoria Area, Kenya. The hippo population in this area is under pressure due to human activities that impact on the wetland

  6. Nile perch fish processing waste along Lake Victoria in East Africa ...

    African Journals Online (AJOL)

    Nile perch fish processing waste along Lake Victoria in East Africa: Auditing and characterization. ... African Journal of Environmental Science and Technology ... If you would like more information about how to print, save, and work with PDFs, Highwire Press provides a helpful Frequently Asked Questions about PDFs.

  7. Reconstruction of Late Pleistocene Paleoenvironments using bulk geochemistry of paleosols from the Lake Victoria Region

    Science.gov (United States)

    Beverly, Emily J.; Peppe, Daniel J.; Driese, Steven G.; Blegen, Nick; Faith, J. Tyler; Tryon, Christian A.; Stinchcomb, Gary E.

    2017-11-01

    The impact of changing environments on the evolution and dispersal of Homo sapiens is highly debated, but few data are available from equatorial Africa. Lake Victoria is the largest freshwater lake in the tropics and is currently a biogeographic barrier between the eastern and western branches of the East African Rift. The lake has previously desiccated at 17 ka and again at 15 ka, but little is known from this region prior to the Last Glacial Maximum. The Pleistocene terrestrial deposits on the northeast coast of Lake Victoria (94 to 36 ka) are ideal for paleoenvironmental reconstructions where volcaniclastic deposits (tuffs), fluvial deposits, tufa, and paleosols are exposed, which can be used to reconstruct Critical Zones (CZ) of the past (paleo-CZs). The paleo-CZ is a holistic concept that reconstructs the entire landscape using geologic records of the atmosphere, hydrosphere, lithosphere, biosphere, and pedosphere (the focus of this study). New paleosol-based mean annual precipitation (MAP) proxies from Karungu, Rusinga Island, and Mfangano Island indicate an average MAP of 750108 mm yr-1 (CALMAG), 800182 mm yr-1 (CIA-K), and 1010228 mm yr-1 (PPM1.0) with no statistical difference throughout the 11 m thick sequence. This corresponds to between 54 and 72% of modern precipitation. Tephras bracketing these paleosols have been correlated across seven sites, and sample a regional paleo-CZ across a 55 km transect along the eastern shoreline of the modern lake. Given the sensitivity of Lake Victoria to precipitation, it is likely that the lake was significantly smaller than modern between 94 ka and 36 ka. This would have removed a major barrier for the movement of fauna (including early modern humans) and provided a dispersal corridor across the equator and between the rifts. It is also consistent with the associated fossil faunal assemblage indicative of semi-arid grasslands. During the Late Pleistocene, the combined geologic and paleontological evidence suggests a

  8. Reconstruction of Late Pleistocene Paleoenvironments Using Bulk Geochemistry of Paleosols from the Lake Victoria Region

    Directory of Open Access Journals (Sweden)

    Emily J. Beverly

    2017-11-01

    Full Text Available The impact of changing environments on the evolution and dispersal of Homo sapiens is highly debated, but few data are available from equatorial Africa. Lake Victoria is the largest freshwater lake in the tropics and is currently a biogeographic barrier between the eastern and western branches of the East African Rift. The lake has previously desiccated at ~17 ka and again at ~15 ka, but little is known from this region prior to the Last Glacial Maximum. The Pleistocene terrestrial deposits on the northeast coast of Lake Victoria (94–36 ka are ideal for paleoenvironmental reconstructions where volcaniclastic deposits (tuffs, fluvial deposits, tufa, and paleosols are exposed, which can be used to reconstruct Critical Zones (CZ of the past (paleo-CZs. The paleo-CZ is a holistic concept that reconstructs the entire landscape using geologic records of the atmosphere, hydrosphere, lithosphere, biosphere, and pedosphere (the focus of this study. New paleosol-based mean annual precipitation (MAP proxies from Karungu, Rusinga Island, and Mfangano Island indicate an average MAP of 750 ± 108 mm year−1 (CALMAG, 800 ± 182 mm year−1 (CIA-K, and 1,010 ± 228 mm year−1 (PPM1.0 with no statistical difference throughout the 11 m thick sequence. This corresponds to between 54 and 72% of modern precipitation. Tephras bracketing these paleosols have been correlated across seven sites, and sample a regional paleo-CZ across a ~55 km transect along the eastern shoreline of the modern lake. Given the sensitivity of Lake Victoria to precipitation, it is likely that the lake was significantly smaller than modern between 94 and 36 ka. This would have removed a major barrier for the movement of fauna (including early modern humans and provided a dispersal corridor across the equator and between the rifts. It is also consistent with the associated fossil faunal assemblage indicative of semi-arid grasslands. During the Late Pleistocene, the combined geologic and

  9. Dietary shifts in Brycinus sadleri (Pisces : Characidae) from southern Lake Victoria

    NARCIS (Netherlands)

    Wanink, J.H.; Joordens, J.C.A.

    2007-01-01

    We studied the diet of Brycinus sadleri in Lake Victoria after extensive environmental changes during the 1980s. To check for diet expansion following these changes, as observed in some other fish species, we compared our results with data from the 1950s. Stomach contents were analysed in relation

  10. Nile perch fish processing waste along Lake Victoria in East Africa ...

    African Journals Online (AJOL)

    In East Africa, Nile perch fish processing into chilled fish fillet for export along Lake Victoria generate large proportions of both solid and liquid wastes. However, no thorough auditing and characterization of the waste has been done that would guide potential value addition through bioconversions and waste management.

  11. Eutrophication, Nile perch and food-web interactions in south-east Lake Victoria

    NARCIS (Netherlands)

    Cornelissen, I.J.M.

    2015-01-01

    The increasing eutrophication, the introduction of Nile perch (Lates niloticus) and the increasing fishing pressure has changed Lake Victoria tremendously the last century. Since the 1960s, eutrophication increased primary production, enabling an increase in fish production. However,

  12. Diel vertical migration of major fish-species in Lake Victoria, East Africa

    NARCIS (Netherlands)

    Goudswaard, P.C.; Wanink, J.H.; Witte, F.; Katunzi, E.F.B.; Berger, M.R.; Postma, D.J.

    2004-01-01

    Understanding of migration patterns is essential in the interpretation of hydro-acoustic stock assessment data of partly demersal partly pelagic fish stocks. In this paper we provide this kind of information for some species that were common in the Mwanza Gulf of Lake Victoria in the 1980s, before

  13. Diel vertical migration of major fish-species in Lake Victoria, East Africa.

    NARCIS (Netherlands)

    Goudswaard, KPC; Wanink, JH; Witte, F; Katunzi, EFB; Berger, MR; Postma, DJ

    2004-01-01

    Understanding of migration patterns is essential in the interpretation of hydro-acoustic stock assessment data of partly demersal partly pelagic fish stocks. In this paper we provide this kind of information for some species that were common in the Mwanza Gulf of Lake Victoria in the 1980s, before

  14. Collapse and reorganization of a food web of Mwanza Gulf, Lake Victoria

    NARCIS (Netherlands)

    Downing, A.S.; Van Nes, E.H.; Janse, J.H.; Witte, F.; Cornelissen, I.J.M.; Scheffer, M.; Mooij, W.M.

    2012-01-01

    Lake Victoria (in East Africa) is the world's second largest fresh-water system. Over the past century the ecosystem has undergone drastic changes. Some 30 years after the introduction of Nile perch and tilapia in the 1950s, the highly diverse community of native haplochromines collapsed, leaving a

  15. Conserved Receptor-Binding Domains of Lake Victoria Marburgvirus and Zaire Ebolavirus Bind a Shared Receptor

    National Research Council Canada - National Science Library

    Kuhn, Jens H; Radoshitzky, Sheli R; Guth, Alexander C; Warfield, Kelly L; Li, Wenhui; Vincent, Martin J; Towner, Jonathan S; Nichol, Stuart T; Bavari, Sina; Choe, Hyeryun

    2006-01-01

    .... Both fragments specifically inhibited replication of infectious Zaire ebolavirus, as well as entry of retroviruses pseudotyped with either Lake Victoria marburgvirus or Zaire ebolavirus GP(sub 1,2...

  16. Lake Victoria wetlands and the ecology of the Nile tilapia, Oreochromis niloticus Linne

    NARCIS (Netherlands)

    Balirwa, J.S.

    1998-01-01

    An ecological study of wetlands was undertaken in northern Lake Victoria (East Africa) between 1993 and 1996 with a major aim of characterising shallow vegetation-dominated interface habitats, and evaluating their importance for fish, in particular, for the stocked and socio-economically

  17. Simulation of Lake Victoria Circulation Patterns Using the Regional Ocean Modeling System (ROMS.

    Directory of Open Access Journals (Sweden)

    Chrispine Nyamweya

    Full Text Available Lake Victoria provides important ecosystem services including transport, water for domestic and industrial uses and fisheries to about 33 million inhabitants in three East African countries. The lake plays an important role in modulating regional climate. Its thermodynamics and hydrodynamics are also influenced by prevailing climatic and weather conditions on diel, seasonal and annual scales. However, information on water temperature and circulation in the lake is limited in space and time. We use a Regional Oceanographic Model System (ROMS to simulate these processes from 1st January 2000 to 31st December 2014. The model is based on real bathymetry, river runoff and atmospheric forcing data using the bulk flux algorithm. Simulations show that the water column exhibits annual cycles of thermo-stratification (September-May and mixing (June-August. Surface water currents take different patterns ranging from a lake-wide northward flow to gyres that vary in size and number. An under flow exists that leads to the formation of upwelling and downwelling regions. Current velocities are highest at the center of the lake and on the western inshore waters indicating enhanced water circulation in those areas. However, there is little exchange of water between the major gulfs (especially Nyanza and the open lake, a factor that could be responsible for the different water quality reported in those regions. Findings of the present study enhance understanding of the physical processes (temperature and currents that have an effect on diel, seasonal, and annual variations in stratification, vertical mixing, inshore-offshore exchanges and fluxes of nutrients that ultimately influence the biotic distribution and trophic structure. For instance information on areas/timing of upwelling and vertical mixing obtained from this study will help predict locations/seasons of high primary production and ultimately fisheries productivity in Lake Victoria.

  18. Simulation of Lake Victoria Circulation Patterns Using the Regional Ocean Modeling System (ROMS).

    Science.gov (United States)

    Nyamweya, Chrispine; Desjardins, Christopher; Sigurdsson, Sven; Tomasson, Tumi; Taabu-Munyaho, Anthony; Sitoki, Lewis; Stefansson, Gunnar

    2016-01-01

    Lake Victoria provides important ecosystem services including transport, water for domestic and industrial uses and fisheries to about 33 million inhabitants in three East African countries. The lake plays an important role in modulating regional climate. Its thermodynamics and hydrodynamics are also influenced by prevailing climatic and weather conditions on diel, seasonal and annual scales. However, information on water temperature and circulation in the lake is limited in space and time. We use a Regional Oceanographic Model System (ROMS) to simulate these processes from 1st January 2000 to 31st December 2014. The model is based on real bathymetry, river runoff and atmospheric forcing data using the bulk flux algorithm. Simulations show that the water column exhibits annual cycles of thermo-stratification (September-May) and mixing (June-August). Surface water currents take different patterns ranging from a lake-wide northward flow to gyres that vary in size and number. An under flow exists that leads to the formation of upwelling and downwelling regions. Current velocities are highest at the center of the lake and on the western inshore waters indicating enhanced water circulation in those areas. However, there is little exchange of water between the major gulfs (especially Nyanza) and the open lake, a factor that could be responsible for the different water quality reported in those regions. Findings of the present study enhance understanding of the physical processes (temperature and currents) that have an effect on diel, seasonal, and annual variations in stratification, vertical mixing, inshore-offshore exchanges and fluxes of nutrients that ultimately influence the biotic distribution and trophic structure. For instance information on areas/timing of upwelling and vertical mixing obtained from this study will help predict locations/seasons of high primary production and ultimately fisheries productivity in Lake Victoria.

  19. Two new species of zooplanktivorous haplochromine cichlids from Lake Victoria, Tanzania

    Directory of Open Access Journals (Sweden)

    Marnix de Zeeuw

    2013-01-01

    Full Text Available Two new species of zooplanktivorous haplochromine cichlids from Lake Victoria, Tanzania, are described and illustrated. These species closely resemble each other. Their affinities to other zooplanktivorous haplochromines from Lake Victoria are discussed. Haplochromis argens sp. n., which featured under nicknames (mainly H. “argens” in more than 50 papers, was caught both in the Mwanza Gulf and the Emin Pasha Gulf, whereas H. goldschmidti sp. n. was only found in the Emin Pasha Gulf. Of the latter species only males are available, but it seems unlikely that it represents a case of male colour polymorphism as several presumably unrelated characters differ in sympatry between the two species, suggesting that there is no gene flow. Statistical analysis revealed that the overall difference between the two species is greater than that between the populations from the two locations. Body depth of the two species in sympatry in the Emin Pasha Gulf was more similar than that of H. goldschmidti sp. n. and the allopatric population of H. argens sp. n. from the Mwanza Gulf, which may indicate an overall environmental effect. However, several measurements related to the width of snout and mouth differed more between the populations of the two species in sympatry than between the allopatric populations. In contrast to a group of zooplanktivorous species that recovered successfully after environmental changes in the lake, H. argens sp. n. is among a group that became extremely rare and probably is in danger of extinction; the conservation status of H. goldschmidti sp. n. is currently unknown.

  20. A pharyngeal jaw evolutionary innovation facilitated extinction in Lake Victoria cichlids.

    Science.gov (United States)

    McGee, Matthew D; Borstein, Samuel R; Neches, Russell Y; Buescher, Heinz H; Seehausen, Ole; Wainwright, Peter C

    2015-11-27

    Evolutionary innovations, traits that give species access to previously unoccupied niches, may promote speciation and adaptive radiation. Here, we show that such innovations can also result in competitive inferiority and extinction. We present evidence that the modified pharyngeal jaws of cichlid fishes and several marine fish lineages, a classic example of evolutionary innovation, are not universally beneficial. A large-scale analysis of dietary evolution across marine fish lineages reveals that the innovation compromises access to energy-rich predator niches. We show that this competitive inferiority shaped the adaptive radiation of cichlids in Lake Tanganyika and played a pivotal and previously unrecognized role in the mass extinction of cichlid fishes in Lake Victoria after Nile perch invasion. Copyright © 2015, American Association for the Advancement of Science.

  1. Late holocene trends of phytoplankton productivity and anoxia as inferred from diatom and geochemical proxies in Lake Victoria, Eastern Africa

    Science.gov (United States)

    Andama, M.; Lejju, J. B.; Tolo, C. U.

    2013-11-01

    Lake Victoria ecosystem has undergone major ecological changes in the recent decades. Sedimentary diatom analysis and Fe / Mn determined by Energy Dispersive X-ray Fluorescence (EDXRF) have provided phytoplankton (diatom) productivity and the resultant anoxia (Fe / Mn) in Lake Victoria at Napoleon Gulf during the late Holocene (1778 cal yr BP (calibrated years before present) to 2008 AD) with radiocarbon dates determined using Accelerator Mass Spectrometry standard method. The results showed that increased total diatom counts in Napoleon Gulf during the late Holocene correspond with increased Fe / Mn ratio (anoxia) in some of the profiles and not in others and in most cases those that correspond correlate very well with increased eutrophication from nitrate input (Total Nitrogen, TN). Therefore slightly increased anoxia not related to increased diatom productivity was recorded in Lake Victoria at Napoleon Gulf from the period 1778 to 1135 cal yr BP. There was slightly increased diatom productivity at Napoleon Gulf from the period 857 to 758 cal yr BP but it did not increase anoxia in the lake. The period 415 cal yr BP to 2008 AD recorded increased anoxia at Napoleon Gulf related to high diatom productivity especially from 415 to 390 cal yr BP and 191 cal yr BP to 2008 AD.

  2. Biological Diversity and Resilience: Lessons from the Recovery of Cichlid Species in Lake Victoria

    Directory of Open Access Journals (Sweden)

    Alex O. Awiti

    2011-03-01

    Full Text Available A fundamental feature of the Anthropocene is the inexorable erosion of the self-repairing capacity or adaptive renewal of natural systems because of natural perturbation, exploitation, or management failure. The concept of resilience offers a systematic framework for understanding the dynamics and variables that govern response dynamics of ecosystems. Resilience of haplochromine cichlids is assessed using limnological and biodiversity changes in Lake Victoria, the world's second largest freshwater lake, over the last five decades. The review explores the resurgence of the haplochromine cichlids using Holling's adaptive renewal cycle and attempts to illustrate how resilience-based management approaches might learn from an inadvertent management experiment. The introduction in the 1980s of the Nile perch (Lates niloticus, a fecund and voracious predator of the endemic phytoplankton feeding haplochromine cichlids, anthropogenic eutrophication, and deep water hypoxia have combined in a synergistic way to increase the vulnerability of the lake ecosystem to perturbations that were hitherto absorbed. However, the upsurge in commercial Nile perch fishing appears to be enabling the resurgence of the haplochromine cichlids. The resurgence of haplochromine cichlids is characterized by phenotypic plasticity, ecological and life history traits and demonstrates the critical role of response diversity in the maintenance of systems resilience. Resilience of the haplochromine cichlids resides in the requisite functional response diversity and habitat diversity that provide the resources for renewal and regeneration. This paper concludes that management of Nile perch fisheries and control of nutrient loading into Lake Victoria could halt or reverse eutrophication, hence offer the best promise for a diverse, productive, and resilient social-ecological system.

  3. Composition and Genetic Diversity of Mosquitoes (Diptera: Culicidae) on Islands and Mainland Shores of Kenya’s Lakes Victoria and Baringo

    Science.gov (United States)

    Ajamma, Yvonne Ukamaka; Villinger, Jandouwe; Omondi, David; Salifu, Daisy; Onchuru, Thomas Ogao; Njoroge, Laban; Muigai, Anne W. T.; Masiga, Daniel K.

    2016-01-01

    The Lake Baringo and Lake Victoria regions of Kenya are associated with high seroprevalence of mosquito-transmitted arboviruses. However, molecular identification of potential mosquito vector species, including morphologically identified ones, remains scarce. To estimate the diversity, abundance, and distribution of mosquito vectors on the mainland shores and adjacent inhabited islands in these regions, we collected and morphologically identified adult and immature mosquitoes and obtained the corresponding sequence variation at cytochrome c oxidase 1 (COI) and internal transcribed spacer region 2 (ITS2) gene regions. A total of 63 species (including five subspecies) were collected from both study areas, 47 of which have previously been implicated as disease vectors. Fourteen species were found only on island sites, which are rarely included in mosquito diversity surveys. We collected more mosquitoes, yet with lower species composition, at Lake Baringo (40,229 mosquitoes, 32 species) than at Lake Victoria (22,393 mosquitoes, 54 species). Phylogenetic analysis of COI gene sequences revealed Culex perexiguus and Cx. tenagius that could not be distinguished morphologically. Most Culex species clustered into a heterogeneous clade with closely related sequences, while Culex pipiens clustered into two distinct COI and ITS2 clades. These data suggest limitations in current morphological identification keys. This is the first DNA barcode report of Kenyan mosquitoes. To improve mosquito species identification, morphological identifications should be supported by their molecular data, while diversity surveys should target both adults and immatures. The diversity of native mosquito disease vectors identified in this study impacts disease transmission risks to humans and livestock. PMID:27402888

  4. The Development of a Customization Framework for the WRF Model over the Lake Victoria Basin, Eastern Africa on Seasonal Timescales

    Directory of Open Access Journals (Sweden)

    R. Argent

    2015-01-01

    Full Text Available Lake Victoria, Africa, supports millions of people. To produce reliable climate projections, it is desirable to successfully model the rainfall over the lake accurately. An initial step is taken here with customization of the Weather, Research, and Forecast (WRF model. Of particular interest is an asymmetrical rainfall pattern across the lake basin, due to a diurnal land-lake breeze. The main aim is to present a customization framework for use over the lake. This framework is developed by conducting several series of model runs to investigate aspects of the customization. The runs are analyzed using Tropical Rainfall Measuring Mission rainfall data and Climatic Research Unit temperature data. The study shows that the choice of parameters and lake surface temperature initialization can significantly alter the results. Also, the optimal physics combinations for the climatology may not necessarily be suitable for all circumstances, such as extreme years. The study concludes that WRF is unable to reproduce the pattern across the lake. The temperature of the lake is too cold and this prevents the diurnal land-lake breeze reversal. Overall, this study highlights the importance of customizing a model to the region of research and presents a framework through which this may be achieved.

  5. Linking land use changes to surface water quality variability in Lake Victoria: some insights from remote sensing

    Science.gov (United States)

    Mugo, R. M.; Limaye, A. S.; Nyaga, J. W.; Farah, H.; Wahome, A.; Flores, A.

    2016-12-01

    The water quality of inland lakes is largely influenced by land use and land cover changes within the lake's catchment. In Africa, some of the major land use changes are driven by a number of factors, which include urbanization, intensification of agricultural practices, unsustainable farm management practices, deforestation, land fragmentation and degradation. Often, the impacts of these factors are observable on changes in the land cover, and eventually in the hydrological systems. When the natural vegetation cover is reduced or changed, the surface water flow patterns, water and nutrient retention capacities are also changed. This can lead to high nutrient inputs into lakes, leading to eutrophication, siltation and infestation of floating aquatic vegetation. To assess the relationship between land use and land cover changes in part of the Lake Victoria Basin, a series of land cover maps were derived from Landsat imagery. Changes in land cover were identified through change maps and statistics. Further, the surface water chlorophyll-a concentration and turbidity were derived from MODIS-Aqua data for Lake Victoria. Chlrophyll-a and turbidity are good proxy indicators of nutrient inputs and siltation respectively. The trends in chlorophyll-a and turbidity concentrations were analyzed and compared to the land cover changes over time. Certain land cover changes related to agriculture and urban development were clearly identifiable. While these changes might not be solely responsible for variability in chlrophyll-a and turbidity concentrations in the lake, they are potentially contributing factors to this problem. This work illustrates the importance of addressing watershed degradation while seeking to solve water quality related problems.

  6. Species-specific relationships between water transparency and male coloration within and between two closely related Lake Victoria cichlid species

    NARCIS (Netherlands)

    Castillo Cajas, Ruth F; Selz, Oliver M; Ripmeester, Erwin A P; Seehausen, Ole; Maan, Martine E

    2012-01-01

    Environmental variation in signalling conditions affects animal communication traits, with possible consequences for sexual selection and reproductive isolation. Using spectrophotometry, we studied how male coloration within and between populations of two closely related Lake Victoria cichlid

  7. Reconstruction of a semi-arid late Pleistocene paleocatena from the Lake Victoria region, Kenya

    Science.gov (United States)

    Beverly, Emily J.; Driese, Steven G.; Peppe, Daniel J.; Arellano, L. Nicole; Blegen, Nick; Faith, J. Tyler; Tryon, Christian A.

    2015-11-01

    The effect of changing environment on the evolution of Homo sapiens is heavily debated, but few data are available from equatorial Africa prior to the last glacial maximum. The Karungu deposits on the northeast coast of Lake Victoria are ideal for paleoenvironmental reconstructions and are best studied at the Kisaaka site near Karunga in Kenya (94 to > 33 ka) where paleosols, fluvial deposits, tufa, and volcaniclastic deposits (tuffs) are exposed over a 2 km transect. Three well-exposed and laterally continuous paleosols with intercalated tuffs allow for reconstruction of a succession of paleocatenas. The oldest paleosol is a smectitic paleo-Vertisol with saline and sodic properties. Higher in the section, the paleosols are tuffaceous paleo-Inceptisols with Alfisol-like soil characteristics (illuviated clay). Mean annual precipitation (MAP) proxies indicate little change through time, with an average of 764 ± 108 mm yr- 1 for Vertisols (CALMAG) and 813 ± 182 to 963 ± 182 mm yr- 1 for all paleosols (CIA-K). Field observations and MAP proxies suggest that Karungu was significantly drier than today, consistent with the associated faunal assemblage, and likely resulted in a significantly smaller Lake Victoria during the late Pleistocene. Rainfall reduction and associated grassland expansion may have facilitated human and faunal dispersals across equatorial East Africa.

  8. Modelling nitrogen transformation and removal in mara river basin wetlands upstream of lake Victoria

    Science.gov (United States)

    Mayo, Aloyce W.; Muraza, Marwa; Norbert, Joel

    2018-06-01

    Lake Victoria, the largest lake in Africa, is a resource of social-economic potential in East Africa. This lake receives water from numerous tributaries including Mara River, which contributes about 4.8% of the total Lake water inflow. Unfortunately, Mara River basin faces environmental problems because of intensive settlement, agriculture, overgrazing in the basin and mining activities, which has lead to water pollution in the river, soil erosion and degradation, decreased soil fertility, loss of vegetation cover, decreased water infiltration capacity and increased sedimentation. One of the pollutants carried by the river includes nitrogen, which has contributed to ecological degradation of the Lake Victoria. Therefore this research work was intended to determine the effectiveness of Mara River wetland for removal of nitrogen and to establish nitrogen removal mechanisms in the wetland. To predict nitrogen removal in the wetland, the dynamics of nitrogen transformation was studied using a conceptual numerical model that takes into account of various processes in the system using STELLA II version 9.0®2006 software. Samples of model input from water, plants and sediments were taken for 45 days and were analyzed for pH, temperature, and DO in situ and chemical parameters such as NH3-N, Org-N, NO2-N, and NO3-N were analyzed in the laboratory in accordance with Standard methods. For plants, the density, dominance, biomass productivity and TN were determined and for sediments TN was analyzed. Inflow into the wetland was determined using stage-discharge relationship and was found to be 734,400 m3/day and the average wetland volume was 1,113,500 m3. Data collected by this study were used for model calibration of nitrogen transformation in this wetland while data from another wetland were used for model validation. It was found that about 37.8% of total nitrogen was removed by the wetland system largely through sedimentation (26.6%), plant uptake (6.6%) and

  9. Pesticide residues in Nile tilapia (Oreochromis niloticus) and Nile perch (Lates niloticus) from Southern Lake Victoria, Tanzania

    International Nuclear Information System (INIS)

    Henry, L.; Kishimba, M.A.

    2006-01-01

    Nile tilapia (Oreochromis niloticus) and Nile perch (Lates niloticus) samples were collected from fish landing stations in nine riparian districts on the Tanzanian side of Lake Victoria and screened for residues of 64 organochlorine, organophosphorus, carbamate, and pyrethroid pesticides. The residue levels in the fish fillet were up to 0.003, 0.03 and 0.2 mg/kg fresh weight (0.7, 3.8 and 42 mg/kg lipid weight) of fenitrothion, DDT and endosulfan, respectively. Mean levels within sites were up to 0.002, 0.02 and 0.1 mg/kg fresh weight (0.5, 0.5 and 16 mg/kg lipid weight), respectively. The detection of higher levels of p,p'-DDT than the degradation products (p,p'-DDD and p,p'-DDE), and higher levels of endosulfan isomers (α and β) than the sulphate, in fish samples, implied recent exposure of fish to DDT and endosulfan, respectively. Generally, most of the fish samples had residue levels above the average method detection limits (MDLs), but were within the calculated ADI. - Fish from Lake Victoria had relatively low pesticide levels

  10. Integrating remote sensing approach with pollution monitoring tools for aquatic ecosystem risk assessment and management: a case study of Lake Victoria (Uganda).

    Science.gov (United States)

    Focardi, Silvia; Corsi, Ilaria; Mazzuoli, Stefania; Vignoli, Leonardo; Loiselle, Steven A; Focardi, Silvano

    2006-11-01

    Aquatic ecosystems around the world, lake, estuaries and coastal areas are increasingly impacted by anthropogenic pollutants through different sources such as agricultural, industrial and urban discharges, atmospheric deposition and terrestrial drainage. Lake Victoria is the second largest lake in the world and the largest tropical lake. Bordered by Tanzania, Uganda, and Kenya, it provides a livelihood for millions of Africans in the region. However, the lake is under threat from eutrophication, a huge decline in the number of native fish species caused by several factors including loss of biodiversity, over fishing and pollution has been recently documented. Increasing usage of pesticides and insecticides in the adjacent agricultural areas as well as mercury contamination from processing of gold ore on the southern shores are currently considered among the most emergent phenomena of chemical contamination in the lake. By the application of globally consistent and comprehensive geospatial data-sets based on remote sensing integrated with information on heavy metals accumulation and insecticides exposure in native and alien fish populations, the present study aims at assessing the environmental risk associated to the contamination of the Lake Victoria water body on fish health, land cover distribution, biodiversity and the agricultural area surrounding the lake. By the elaboration of Landsat 7 TM data of November 2002 and Landsat 7 TM 1986 we have calculated the agriculture area which borders the Lake Victoria bay, which is an upland plain. The resulting enhanced nutrient loading to the soil is subsequently transported to the lake by rain or as dry fall. The data has been inserted in a Geographical information System (ARCGIS) to be upgraded and consulted. Heavy metals in fish fillets showed concentrations rather low except for mercury being higher than others as already described in previous investigations. In the same tissue, cholinesterases activity (ChE) as an

  11. DNA barcoding of schistosome cercariae reveals a novel sub-lineage within Schistosoma rodhaini from Ngamba Island Chimpanzee Sanctuary, Lake Victoria.

    Science.gov (United States)

    Standley, C J; Stothard, J R

    2012-10-01

    While Schistosoma rodhaini is typically considered a parasite of small mammals and is very scantly distributed in the Lake Victoria basin, it is known to hybridize with the more widespread Schistosoma mansoni, the causative agent of intestinal schistosomiasis. As part of broader parasitological and malacological surveys for S. mansoni across Lake Victoria, schistosome cercariae were harvested from a field-caught Biomphalaria choanomphala taken on Ngamba Island Chimpanzee Sanctuary, Uganda. Upon DNA barcoding, these cercariae were found to be a mixture of both S. rodhaini and S. mansoni, with further phylogenetic analysis revealing a hitherto unknown sub-lineage within S. rodhaini. Despite repeated sampling for eggs and miracidia from both chimpanzees and staff on Ngamba Island Sanctuary, detection of S. rodhaini within local definitive hosts awaits additional efforts, which should be mindful of a potential host role of spotted-necked otters.

  12. Molecular records of climate variability and vegetation response since the Late Pleistocene in the Lake Victoria basin, East Africa

    NARCIS (Netherlands)

    Berke, M.A.; Johnson, T.C.; Werne, J.P.; Grice, K.; Schouten, S.; Sinninghe Damsté, J.S.

    2012-01-01

    New molecular proxies of temperature and hydrology are helping to constrain tropical climate change and elucidate possible forcing mechanisms during the Holocene. Here, we examine a similar to 14,000 year record of climate variability from Lake Victoria, East Africa, the world's second largest

  13. Pesticide residues in Nile tilapia (Oreochromis niloticus) and Nile perch (Lates niloticus) from Southern Lake Victoria, Tanzania

    Energy Technology Data Exchange (ETDEWEB)

    Henry, L. [Chemistry Department, University of Dar es Salaam. PO Box 35061, Dar es Salaam (Tanzania); Kishimba, M.A. [Chemistry Department, University of Dar es Salaam. PO Box 35061, Dar es Salaam (Tanzania)]. E-mail: kishimba@chem.udsm.ac.tz

    2006-03-15

    Nile tilapia (Oreochromis niloticus) and Nile perch (Lates niloticus) samples were collected from fish landing stations in nine riparian districts on the Tanzanian side of Lake Victoria and screened for residues of 64 organochlorine, organophosphorus, carbamate, and pyrethroid pesticides. The residue levels in the fish fillet were up to 0.003, 0.03 and 0.2 mg/kg fresh weight (0.7, 3.8 and 42 mg/kg lipid weight) of fenitrothion, DDT and endosulfan, respectively. Mean levels within sites were up to 0.002, 0.02 and 0.1 mg/kg fresh weight (0.5, 0.5 and 16 mg/kg lipid weight), respectively. The detection of higher levels of p,p'-DDT than the degradation products (p,p'-DDD and p,p'-DDE), and higher levels of endosulfan isomers ({alpha} and {beta}) than the sulphate, in fish samples, implied recent exposure of fish to DDT and endosulfan, respectively. Generally, most of the fish samples had residue levels above the average method detection limits (MDLs), but were within the calculated ADI. - Fish from Lake Victoria had relatively low pesticide levels.

  14. Tsetse fly (G. f. fuscipes distribution in the Lake Victoria basin of Uganda.

    Directory of Open Access Journals (Sweden)

    Mugenyi Albert

    2015-04-01

    Full Text Available Tsetse flies transmit trypanosomes, the causative agent of human and animal African trypanosomiasis. The tsetse vector is extensively distributed across sub-Saharan Africa. Trypanosomiasis maintenance is determined by the interrelationship of three elements: vertebrate host, parasite and the vector responsible for transmission. Mapping the distribution and abundance of tsetse flies assists in predicting trypanosomiasis distributions and developing rational strategies for disease and vector control. Given scarce resources to carry out regular full scale field tsetse surveys to up-date existing tsetse maps, there is a need to devise inexpensive means for regularly obtaining dependable area-wide tsetse data to guide control activities. In this study we used spatial epidemiological modelling techniques (logistic regression involving 5000 field-based tsetse-data (G. f. fuscipes points over an area of 40,000 km2, with satellite-derived environmental surrogates composed of precipitation, temperature, land cover, normalised difference vegetation index (NDVI and elevation at the sub-national level. We used these extensive tsetse data to analyse the relationships between presence of tsetse (G. f. fuscipes and environmental variables. The strength of the results was enhanced through the application of a spatial autologistic regression model (SARM. Using the SARM we showed that the probability of tsetse presence increased with proportion of forest cover and riverine vegetation. The key outputs are a predictive tsetse distribution map for the Lake Victoria basin of Uganda and an improved understanding of the association between tsetse presence and environmental variables. The predicted spatial distribution of tsetse in the Lake Victoria basin of Uganda will provide significant new information to assist with the spatial targeting of tsetse and trypanosomiasis control.

  15. Hydro-climatic trends and water resource management implications based on multi-scale data for the Lake Victoria region, Kenya

    International Nuclear Information System (INIS)

    Koutsouris, A J; Destouni, G; Jarsjoe, J; Lyon, S W

    2010-01-01

    Unreliable rainfall may be a main cause of poverty in rural areas, such as the Kisumu district by Lake Victoria in Kenya. Climate change may further increase the negative effects of rainfall uncertainty. These effects could be mitigated to some extent through improved and adaptive water resource management and planning, which relies on our interpretations and projections of the coupled hydro-climatic system behaviour and its development trends. In order to identify and quantify the main differences and consistencies among such hydro-climatic assessments, this study investigates trends and exemplifies their use for important water management decisions for the Lake Victoria drainage basin (LVDB), based on local scale data for the Orongo village in the Kisumu district, and regional scale data for the whole LVDB. Results show low correlation between locally and regionally observed hydro-climatic trends, and large differences, which in turn affects assessments of important water resource management parameters. However, both data scales converge in indicating that observed local and regional hydrological discharge trends are primarily driven by local and regional water use and land use changes.

  16. Genetic variation and demographic history of the Haplochromis laparogramma group of Lake Victoria-An analysis based on SINEs and mitochondrial DNA.

    Science.gov (United States)

    Mzighani, Semvua I; Nikaido, Masato; Takeda, Miyuki; Seehausen, Ole; Budeba, Yohana L; Ngatunga, Benjamin P; Katunzi, Egid F B; Aibara, Mitsuto; Mizoiri, Shinji; Sato, Tetsu; Tachida, Hidenori; Okada, Norihiro

    2010-01-15

    More than 500 endemic haplochromine cichlid species inhabit Lake Victoria. This striking species diversity is a classical example of recent explosive adaptive radiation thought to have happened within the last approximately 15,000 years. In this study, we examined the population structure and historical demography of 3 pelagic haplochromine cichlid species that resemble in morphology and have similar niche, Haplochromis (Yssichromis) laparogramma, Haplochromis (Y.) pyrrhocephalus, and Haplochromis (Y.) sp. "glaucocephalus". We investigated the sequences of the mitochondrial DNA control region and the insertion patterns of short interspersed elements (SINEs) of 759 individuals. We show that sympatric forms are genetically differentiated in 4 of 6 cases, but we also found apparent weakening of the genetic differentiation in areas with turbid water. We estimated the timings of population expansion and species divergence to coincide with the refilling of the lake at the Pleistocene/Holocene boundary. We also found that estimates can be altered significantly by the choice of the shape of the molecular clock. If we employ the nonlinear clock model of evolutionary rates in which the rates are higher towards the recent, the population expansion was dated at around the event of desiccation of the lake ca. 17,000 YBP. Thus, we succeeded in clarifying the species and population structure of closely related Lake Victoria cichlids and in showing the importance of applying appropriate clock calibrations in elucidating recent evolutionary events.

  17. Chemodenitrification in the cryoecosystem of Lake Vida, Victoria Valley, Antarctica.

    Science.gov (United States)

    Ostrom, N E; Gandhi, H; Trubl, G; Murray, A E

    2016-11-01

    Lake Vida, in the Victoria Valley of East Antarctica, is frozen, yet harbors liquid brine (~20% salt, >6 times seawater) intercalated in the ice below 16 m. The brine has been isolated from the surface for several thousand years. The brine conditions (permanently dark, -13.4 °C, lack of O 2 , and pH of 6.2) and geochemistry are highly unusual. For example, nitrous oxide (N 2 O) is present at a concentration among the highest reported for an aquatic environment. Only a minor 17 O anomaly was observed in N 2 O, indicating that this gas was predominantly formed in the lake. In contrast, the 17 O anomaly in nitrate (NO3-) in Lake Vida brine indicates that approximately half or more of the NO3- present is derived from atmospheric deposition. Lake Vida brine was incubated in the presence of 15 N-enriched substrates for 40 days. We did not detect microbial nitrification, dissimilatory reduction of NO3- to ammonium (NH4+), anaerobic ammonium oxidation, or denitrification of N 2 O under the conditions tested. In the presence of 15 N-enriched nitrite (NO2-), both N 2 and N 2 O exhibited substantial 15 N enrichments; however, isotopic enrichment declined with time, which is unexpected. Additions of 15 N-NO2- alone and in the presence of HgCl 2 and ZnCl 2 to aged brine at -13 °C resulted in linear increases in the δ 15 N of N 2 O with time. As HgCl 2 and ZnCl 2 are effective biocides, we interpret N 2 O production in the aged brine to be the result of chemodenitrification. With this understanding, we interpret our results from the field incubations as the result of chemodenitrification stimulated by the addition of 15 N-enriched NO2- and ZnCl 2 and determined rates of N 2 O and N 2 production of 4.11-41.18 and 0.55-1.75 nmol L -1  day -1 , respectively. If these rates are representative of natural production, the current concentration of N 2 O in Lake Vida could have been reached between 6 and 465 years. Thus, chemodenitrification alone is sufficient to explain the

  18. Community genetics reveal elevated levels of sympatric gene flow among morphologically similar but not among morphologically dissimilar species of Lake Victoria cichlid fish

    NARCIS (Netherlands)

    Konijnendijk, N.; Joyce, D.A.; Mrosso, H.D.J.; Egas, M.; Seehausen, O.

    2011-01-01

    We examined genetic structure among five species of Lake Victoria haplochromine cichlids in four island communities, using a full factorial sampling design that compared genetic differentiation between pairs of species and populations of varying morphological similarity and geographical proximity.

  19. The population structure of Glossina fuscipes fuscipes in the Lake Victoria basin in Uganda: implications for vector control

    OpenAIRE

    Hyseni, Chaz; Kato, Agapitus B; Okedi, Loyce M; Masembe, Charles; Ouma, Johnson O; Aksoy, Serap; Caccone, Adalgisa

    2012-01-01

    Abstract Background Glossina fuscipes fuscipes is the primary vector of trypanosomiasis in humans and livestock in Uganda. The Lake Victoria basin has been targeted for tsetse eradication using a rolling carpet initiative, from west to east, with four operational blocks (3 in Uganda and 1 in Kenya), under a Pan-African Tsetse and Trypanosomiasis Eradication Campaign (PATTEC). We screened tsetse flies from the three Ugandan PATTEC blocks for genetic diversity at 15 microsatellite loci from con...

  20. Impacts of population growth and economic development on water quality of a lake: case study of Lake Victoria Kenya water.

    Science.gov (United States)

    Juma, Dauglas Wafula; Wang, Hongtao; Li, Fengting

    2014-04-01

    Anthropogenic-induced water quality pollution is a major environmental problem in freshwater ecosystems today. As a result of this, eutrophication of lakes occurs. Population and economic development are key drivers of water resource pollution. To evaluate how growth in the riparian population and in the gross domestic product (GDP) with unplanned development affects the water quality of the lake, this paper evaluates Lake Victoria Kenyan waters basin. Waters quality data between 1990 and 2012 were analyzed along with reviews of published literature, papers, and reports. The nitrate-nitrogen (NO3-N), soluble phosphorus (PO4-P), chlorophyll a, and Secchi transparencies were evaluated as they are key water quality indicators. The NO3-N increased from 10 μg l(-1) in 1990 to 98 μg 1(-1) in 2008, while PO4-P increased from 4 μg l(-1) in 1990 to 57 μg l(-1) in 2008. The population and economic growth of Kenya are increasing with both having minimums in 1990 of 24.143 million people and 12.18 billion US dollars, to maximums in 2010 of 39.742 million people and 32.163 billion US dollars, respectively. A Secchi transparency is reducing with time, indicating an increasing pollution. This was confirmed by an increase in aquatic vegetation using an analysis of moderate resolution imaging spectroradiometer (MODIS) images of 2000 and 2012 of Kenyan waters. This study found that increasing population and GDP increases pollution discharge thus polluting lakes. One of major factors causing lake water pollution is the unplanned or poor waste management policy and service.

  1. Perceptions about interventions to control schistosomiasis among the Lake Victoria island communities of Koome, Uganda.

    Directory of Open Access Journals (Sweden)

    Richard E Sanya

    2017-10-01

    Full Text Available Praziquantel-based mass treatment is the main approach to controlling schistosomiasis mansoni in endemic areas. Interventions such as provision and use of safe water, minimising contact with infested water, disposal of stool in latrines and snail control provide key avenues to break the transmission cycle and can sustain the benefits of mass treatment in the long term. Efforts are also being made to develop a schistosomiasis vaccine which, if effective, might reduce the incidence of re-infection after treatment. However, any interventions deployed need to be acceptable to, and sustainable by, the target communities.In this qualitative study, we investigated the perceptions of six Lake Victoria island communities of Koome, Uganda, about interventions to control Schistosoma mansoni infection and their willingness to participate in Schistosoma vaccine trials. Thirty-two in-depth interviews, 12 key informant interviews and 10 focus group discussions were conducted. Data were analysed using a thematic content approach.Intestinal schistosomiasis was not regarded as a serious health problem because a mass treatment programme is in place. However, the communities lack safe water sources and latrines. Mass treatment with praziquantel, safe water supplies and use of toilets were deemed the most acceptable interventions by the participants. The communities are willing to participate in Schistosoma vaccine trials.Knowledge of a community's perception about interventions to control schistosomiasis can be valuable to policy makers and programme implementers intending to set up interventions co-managed by the community members. In this study, the views of the Lake Victoria island communities of Koome are presented. This study also provides data to guide further work on alternative interventions such as Schistosoma vaccine trials in these communities.

  2. Perceptions about interventions to control schistosomiasis among the Lake Victoria island communities of Koome, Uganda.

    Science.gov (United States)

    Sanya, Richard E; Tumwesige, Edward; Elliott, Alison M; Seeley, Janet

    2017-10-01

    Praziquantel-based mass treatment is the main approach to controlling schistosomiasis mansoni in endemic areas. Interventions such as provision and use of safe water, minimising contact with infested water, disposal of stool in latrines and snail control provide key avenues to break the transmission cycle and can sustain the benefits of mass treatment in the long term. Efforts are also being made to develop a schistosomiasis vaccine which, if effective, might reduce the incidence of re-infection after treatment. However, any interventions deployed need to be acceptable to, and sustainable by, the target communities. In this qualitative study, we investigated the perceptions of six Lake Victoria island communities of Koome, Uganda, about interventions to control Schistosoma mansoni infection and their willingness to participate in Schistosoma vaccine trials. Thirty-two in-depth interviews, 12 key informant interviews and 10 focus group discussions were conducted. Data were analysed using a thematic content approach. Intestinal schistosomiasis was not regarded as a serious health problem because a mass treatment programme is in place. However, the communities lack safe water sources and latrines. Mass treatment with praziquantel, safe water supplies and use of toilets were deemed the most acceptable interventions by the participants. The communities are willing to participate in Schistosoma vaccine trials. Knowledge of a community's perception about interventions to control schistosomiasis can be valuable to policy makers and programme implementers intending to set up interventions co-managed by the community members. In this study, the views of the Lake Victoria island communities of Koome are presented. This study also provides data to guide further work on alternative interventions such as Schistosoma vaccine trials in these communities.

  3. Balancing the people, profit and planet dimensions in international marketing channels : a study on coordinating mechanisms in the Nile perch channel from Lake Victoria

    NARCIS (Netherlands)

    Kambewa, E.

    2007-01-01

    Keywords: people, profit, planet, marketing channels, contracts, sustainability, quality,LakeVictoria, conjointanalysis

  4. The rise and fall of water hyacinth in Lake Victoria and the Kagera River basin, 1989-2001

    Science.gov (United States)

    Albright, Thomas P.; Moorhouse, T.G.; McNabb, T.J.

    2004-01-01

    Water hyacinth (Eichhornia crassipes (Mart.) Solms) is an invasive aquatic macrophyte associated with major negative economic and ecological impacts to the Lake Victoria region since the plant's establishment in Uganda in the 1980s. Reliable estimates of water hyacinth distribution and extent are required to gauge the severity of the problem through time, relate water hyacinth abundance to environmental factors, identify areas requiring management action, and assess the efficacy of management actions. To provide such estimates and demonstrate the utility of remote sensing for this application, we processed and analyzed remotely sensed imagery to determine the distribution and extent of water hyacinth. Maps were produced and coverage was quantified using a hybrid unsupervised image classification approach with manual editing for each of the riparian countries of Kenya, Tanzania, and Uganda, as well as for numerous gulfs and bays. A similar procedure was carried out for selected lakes in the Rwanda-Tanzania borderlands lakes region in the Kagera River basin. Results confirm the severity of the water hyacinth infestation, especially in the northern parts of the lake. A maximum lake-wide extent of at least 17,374 ha was attained in 1998. Following this, a combination of factors, including conditions associated with the 1997 to 1998 El Nin??o and biocontrol with water hyacinth weevils, appear to have contributed to a major decline in water hyacinth in the most affected parts of the lake. Some lakes in the Kagera basin, such as Lake Mihindi, Rwanda, were severely infested in the late 1990s, but the level of infestation in most of these decreased markedly by the early 2000s.

  5. Intestinal schistosomiasis among preschool children along the shores of Lake Victoria in Uganda

    DEFF Research Database (Denmark)

    Nalugwa, A.; Olsen, Annette; Tukahebwa, M. E.

    2015-01-01

    Schistosomiasis, a disease caused by Schistosoma trematode parasites, affects hundreds of millions of people and accounts for more than 40% of the global health burden due to neglected tropical diseases. In Uganda, intestinal schistosomiasis is endemic in 73 out of 112 districts and about 55......% of the population of 36 million individuals are at risk. There is scanty information on the status and burden of schistosomiasis in preschool children less than six years of age in Uganda. This study aimed to assess the status of Schistosoma mansoni infections in children aged 1-5 years in Uganda. S. mansoni...... prevalence and intensity of infection were examined in 3058 children from 5 districts along Lake Victoria shoreline, eastern Uganda. For each child one stool sample was collected on three consecutive days. The Kato-Katz technique was used to prepare stool smears on slides for microscopic examination. Short...

  6. Australian doctors and the visual arts. Part 4. Doctors as supporters of art galleries and artists in Victoria.

    Science.gov (United States)

    Hamilton, D G

    1986-07-07

    The contribution of doctors to the visual arts is being discussed in a series of six articles. Doctor-artists in New South Wales and Victoria, and doctors as collectors, donors, gallery supporters and writers in New South Wales, have been discussed in earlier articles. This, the fourth article, deals with doctors as supporters of art galleries and artists in Victoria.

  7. Molecular Detection of Tick-Borne Pathogen Diversities in Ticks from Livestock and Reptiles along the Shores and Adjacent Islands of Lake Victoria and Lake Baringo, Kenya

    Directory of Open Access Journals (Sweden)

    David Omondi

    2017-06-01

    Full Text Available Although diverse tick-borne pathogens (TBPs are endemic to East Africa, with recognized impact on human and livestock health, their diversity and specific interactions with tick and vertebrate host species remain poorly understood in the region. In particular, the role of reptiles in TBP epidemiology remains unknown, despite having been implicated with TBPs of livestock among exported tortoises and lizards. Understanding TBP ecologies, and the potential role of common reptiles, is critical for the development of targeted transmission control strategies for these neglected tropical disease agents. During the wet months (April–May; October–December of 2012–2013, we surveyed TBP diversity among 4,126 ticks parasitizing livestock and reptiles at homesteads along the shores and islands of Lake Baringo and Lake Victoria in Kenya, regions endemic to diverse neglected tick-borne diseases. After morphological identification of 13 distinct Rhipicephalus, Amblyomma, and Hyalomma tick species, ticks were pooled (≤8 individuals by species, host, sampling site, and collection date into 585 tick pools. By supplementing previously established molecular assays for TBP detection with high-resolution melting analysis of PCR products before sequencing, we identified high frequencies of potential disease agents of ehrlichiosis (12.48% Ehrlichia ruminantium, 9.06% Ehrlichia canis, anaplasmosis (6.32% Anaplasma ovis, 14.36% Anaplasma platys, and 3.08% Anaplasma bovis,, and rickettsiosis (6.15% Rickettsia africae, 2.22% Rickettsia aeschlimannii, 4.27% Rickettsia rhipicephali, and 4.95% Rickettsia spp., as well as Paracoccus sp. and apicomplexan hemoparasites (0.51% Theileria sp., 2.56% Hepatozoon fitzsimonsi, and 1.37% Babesia caballi among tick pools. Notably, we identified E. ruminantium in both Amblyomma and Rhipicephalus pools of ticks sampled from livestock in both study areas as well as in Amblyomma falsomarmoreum (66.7% and Amblyomma nuttalli (100

  8. Molecular Detection of Tick-Borne Pathogen Diversities in Ticks from Livestock and Reptiles along the Shores and Adjacent Islands of Lake Victoria and Lake Baringo, Kenya.

    Science.gov (United States)

    Omondi, David; Masiga, Daniel K; Fielding, Burtram C; Kariuki, Edward; Ajamma, Yvonne Ukamaka; Mwamuye, Micky M; Ouso, Daniel O; Villinger, Jandouwe

    2017-01-01

    Although diverse tick-borne pathogens (TBPs) are endemic to East Africa, with recognized impact on human and livestock health, their diversity and specific interactions with tick and vertebrate host species remain poorly understood in the region. In particular, the role of reptiles in TBP epidemiology remains unknown, despite having been implicated with TBPs of livestock among exported tortoises and lizards. Understanding TBP ecologies, and the potential role of common reptiles, is critical for the development of targeted transmission control strategies for these neglected tropical disease agents. During the wet months (April-May; October-December) of 2012-2013, we surveyed TBP diversity among 4,126 ticks parasitizing livestock and reptiles at homesteads along the shores and islands of Lake Baringo and Lake Victoria in Kenya, regions endemic to diverse neglected tick-borne diseases. After morphological identification of 13 distinct Rhipicephalus, Amblyomma , and Hyalomma tick species, ticks were pooled (≤8 individuals) by species, host, sampling site, and collection date into 585 tick pools. By supplementing previously established molecular assays for TBP detection with high-resolution melting analysis of PCR products before sequencing, we identified high frequencies of potential disease agents of ehrlichiosis (12.48% Ehrlichia ruminantium , 9.06% Ehrlichia canis ), anaplasmosis (6.32% Anaplasma ovis , 14.36% Anaplasma platys , and 3.08% Anaplasma bovis ,), and rickettsiosis (6.15% Rickettsia africae , 2.22% Rickettsia aeschlimannii , 4.27% Rickettsia rhipicephali , and 4.95% Rickettsia spp.), as well as Paracoccus sp. and apicomplexan hemoparasites (0.51% Theileria sp., 2.56% Hepatozoon fitzsimonsi , and 1.37% Babesia caballi ) among tick pools. Notably, we identified E. ruminantium in both Amblyomma and Rhipicephalus pools of ticks sampled from livestock in both study areas as well as in Amblyomma falsomarmoreum (66.7%) and Amblyomma nuttalli (100%) sampled

  9. Scenario-based water resources planning for utilities in the Lake Victoria region

    Science.gov (United States)

    Mehta, Vishal K.; Aslam, Omar; Dale, Larry; Miller, Norman; Purkey, David R.

    Urban areas in the Lake Victoria (LV) region are experiencing the highest growth rates in Africa. As efforts to meet increasing demand accelerate, integrated water resources management (IWRM) tools provide opportunities for utilities and other stakeholders to develop a planning framework comprehensive enough to include short term (e.g. landuse change), as well as longer term (e.g. climate change) scenarios. This paper presents IWRM models built using the Water Evaluation And Planning (WEAP) decision support system, for three towns in the LV region - Bukoba (Tanzania), Masaka (Uganda), and Kisii (Kenya). Each model was calibrated under current system performance based on site visits, utility reporting and interviews. Projected water supply, demand, revenues and costs were then evaluated against a combination of climate, demographic and infrastructure scenarios up to 2050. Our results show that water supply in all three towns is currently infrastructure limited; achieving existing design capacity could meet most projected demand until 2020s in Masaka beyond which new supply and conservation strategies would be needed. In Bukoba, reducing leakages would provide little performance improvement in the short-term, but doubling capacity would meet all demands until 2050. In Kisii, major infrastructure investment is urgently needed. In Masaka, streamflow simulations show that wetland sources could satisfy all demand until 2050, but at the cost of almost no water downstream of the intake. These models demonstrate the value of IWRM tools for developing water management plans that integrate hydroclimatology-driven supply to demand projections on a single platform.

  10. Microbial quality and safety of fresh and dried Rastrineobola argentea from Lake Victoria, Tanzania

    DEFF Research Database (Denmark)

    Baniga, Zebedayo; Dalsgaard, Anders; Mhongole, Ofred J

    2017-01-01

    the bacteriological quality of fresh and dried sardines from Lake Victoria. Sardine samples were randomly collected from main landing sites and retail markets in the city of Mwanza. Total viable counts (TVC) in fresh sardines were in the range of 5.18–7.90 log10 cfu/g while those dried on racks contained 3.......13–4.85 log10 cfu/g which were 0.75% of those dried on sand with 4.80–7.13 log10 cfu/g (p .../g and those dried on sand contained 1.18–3.32 log10 mpn/g, however, sardines dried on racks, did not contain any E. coli. Similar findings were found in the two types of dried sardines from the retail markets. Prevalence of Salmonella spp. in fresh R. argentea was 25% (n = 40), sand dried sardines at landing...

  11. Application of Satellite Observations to Manage Natural Disasters in the Lake Victoria Basin

    Science.gov (United States)

    Habib, Shahid; Policelli, F.; Irwin, D.; Korme, Tesfaye; Adler, Bob; Hong, Yang

    2010-01-01

    Lake Victoria, the second largest fresh water lake in the Eastern part of Africa is a vital natural resource for the economic well being and prosperity of over 30 million people located in riparian regions of Uganda, Kenya and Tanzania. It covers a large area of about 68,870 km2 and produces a GDP of about US $30 billion per year. The region is also very much prone to natural disasters such as severe floods during heavy precipitation periods in the Eastern part of Africa. In addition to floods, the precipitation also produces large infestations of mosquito larvae due to the standing water in many areas. This further causes multiple vector borne diseases such as Malaria, Rift Valley Fever and more. These problems are of serious concern and require active and aggressive surveillance and management to minimize the loss of human and animal lives and property damage. Satellite imagery and observations along with the in situ measurements provide a great tool to analyze and study this area and inform the policy makers to make calculated policy decisions which are more beneficial to the environment. Recently, NASA and USAID have joined forces with the Regional Center for Mapping of Resources for Development (RCMRD) located in Nairobi, Kenya to utilize multiple NASA sensors such as TRMM, SRTM and MODIS to develop flood potential maps for the Lake Victoria Basin. The idea is to generate a flood forecasts and "nowcasts" that can be sent to the disaster management organizations of Uganda, Kenya, and Tanzania. Post flood event satellite imagery is becoming a common tool to assess the areas inundated by flooding. However, this work is unique undertaking by utilizing land imaging and atmospheric satellites to build credible flood potential maps. At same time, we are also studying the potential occurrence and spread of Rift Valley Fever disease based on the short term climate records and precipitation data. These activities require multi-nation coordination and agreements and

  12. Characterization of V1R receptor (ora) genes in Lake Victoria cichlids.

    Science.gov (United States)

    Ota, Tomoki; Nikaido, Masato; Suzuki, Hikoyu; Hagino-Yamagishi, Kimiko; Okada, Norihiro

    2012-05-15

    Although olfaction could play a crucial role in underwater habitats by allowing fish to sense a variety of nonvolatile chemical signals, the importance of olfaction in species-rich cichlids is still controversial. In particular, examining whether cichlids rely on olfaction for reproduction is of primary interest to understand the mechanisms of speciation. In the present study, we explored the V1R (also known as ora) genes, which are believed to encode reproductive pheromone receptors in fish, in the genomes of Lake Victoria cichlids. By screening a bacterial artificial chromosome library, we identified all six intact V1R genes (V1R1 to V1R6) that have been reported in other teleost fish. Furthermore, RT-PCR and in situ hybridization analyses showed that all of the V1R genes were expressed in the olfactory epithelium, indicating that these receptors are functional in cichlids. These observations indicate that cichlids use V1R-mediated olfaction in some ways for their social behaviors. Copyright © 2012 Elsevier B.V. All rights reserved.

  13. Linking Land Use Changes to Surface Water Quality Variability in Lake Victoria: Some Insights From Remote Sensing (GC41B-1101)

    Science.gov (United States)

    Limaye, Ashutosh; Mugo, Robinson; Wanjohi, James; Farah, Hussein; Wahome, Anastasia; Flores, Africa; Irwin, Dan

    2016-01-01

    Various land use changes driven by urbanization, conversion of grasslands and woodlands into farmlands, intensification of agricultural practices, deforestation, land fragmentation and degradation are taking place in Africa. In Kenya, agriculture is the main driver of land use conversions. The impacts of these land use changes are observable in land cover maps, and eventually in the hydrological systems. Reduction or change of natural vegetation cover types increases the speed of surface runoff and reduces water and nutrient retention capacities. This can lead to high nutrient inputs into lakes, resulting in eutrophication, siltation and infestation of floating aquatic vegetation. To assess if changes in land use could be contributing to increased phytoplankton blooms and sediment loads into Lake Victoria, we analyzed land use land cover data from Landsat, as well as surface chlorophyll-a and total suspended matter from MODIS-Aqua sensor.

  14. Hydroclimatology of Lake Victoria region using hydrologic model and satellite remote sensing data

    Directory of Open Access Journals (Sweden)

    S. I. Khan

    2011-01-01

    Full Text Available Study of hydro-climatology at a range of temporal scales is important in understanding and ultimately mitigating the potential severe impacts of hydrological extreme events such as floods and droughts. Using daily in-situ data over the last two decades combined with the recently available multiple-years satellite remote sensing data, we analyzed and simulated, with a distributed hydrologic model, the hydro-climatology in Nzoia, one of the major contributing sub-basins of Lake Victoria in the East African highlands. The basin, with a semi arid climate, has no sustained base flow contribution to Lake Victoria. The short spell of high discharge showed that rain is the prime cause of floods in the basin. There is only a marginal increase in annual mean discharge over the last 21 years. The 2-, 5- and 10- year peak discharges, for the entire study period showed that more years since the mid 1990's have had high peak discharges despite having relatively less annual rain. The study also presents the hydrologic model calibration and validation results over the Nzoia basin. The spatiotemporal variability of the water cycle components were quantified using a hydrologic model, with in-situ and multi-satellite remote sensing datasets. The model is calibrated using daily observed discharge data for the period between 1985 and 1999, for which model performance is estimated with a Nash Sutcliffe Efficiency (NSCE of 0.87 and 0.23% bias. The model validation showed an error metrics with NSCE of 0.65 and 1.04% bias. Moreover, the hydrologic capability of satellite precipitation (TRMM-3B42 V6 is evaluated. In terms of reconstruction of the water cycle components the spatial distribution and time series of modeling results for precipitation and runoff showed considerable agreement with the monthly model runoff estimates and gauge observations. Runoff values responded to precipitation events that occurred across the catchment during the wet season from March to

  15. Gastropod diversity, distribution and abundance in habitats with and without anthropogenic disturbances in Lake Victoria, Kenya

    DEFF Research Database (Denmark)

    Lange, C. N.; Kristensen, Thomas K.; Madsen, Henry

    2013-01-01

    We investigated freshwater gastropod diversity, abundance and distribution in habitats with and without anthropogenic disturbance in two localities, Ndere in the Winam Gulf and Mbita Point, Lake Victoria, Kenya, from May 2002 to January 2004. A total of 133 984 gastropod specimens belonging to 15...... species were recorded, 14 from Mbita and 12 from Ndere. Two species, Ferrissia kavirondica and Cleopatra cridlandi, which were recorded only from undisturbed habitats, could be indicators of least disturbed habitats. Water chemistry did differ between fish landing sites and undisturbed habitats at some......, while other species may not tolerate these changes. In order to protect gastropod diversity and avoid dominance of intermediate hosts, such as B. choanomphala, a management plan for the use of these fish landing sites should be developed. This could include rules on how to dispose of fish remnants...

  16. Perception of Aquaculture Education to Support Further Growth of Aquaculture Industry in Victoria, Australia

    Science.gov (United States)

    Awal, Sadiqul; Christie, Andrew; Watson, Matthew; Hannadige, Asanka G. T.

    2012-01-01

    Purpose: The central aim of this study was to determine the perception of aquaculture educational provisions in the state of Victoria, and whether they are sufficient to ultimately support further growth of the industry. Design/methodology/approach: Questionnaires were formulated and distributed to participants in a variety of ways, including via…

  17. Do religion and religiosity have anything to do with alcohol consumption patterns? Evidence from two fish landing sites on Lake Victoria Uganda.

    Science.gov (United States)

    Tumwesigye, Nazarius M; Atuyambe, Lynn; Kibira, Simon P S; Wabwire-Mangen, Fred; Tushemerirwe, Florence; Wagner, Glenn J

    2013-09-01

    Fish landing sites have high levels of harmful use of alcohol. This paper examines the role of religion and religiosity on alcohol consumption at two fish landing sites on Lake Victoria in Uganda. Questionnaires were administered to randomly selected people at the sites. Dependent variables included alcohol consumption during the previous 30 days, whereas the key independent variables were religion and religiosity. Bivariate and multivariate analysis techniques were applied. People reporting low religiosity were five times more likely to have consumed alcohol (95% confidence interval: 2.45-10.04) compared with those reporting low/average religiosity. Religion and religiosity are potential channels for controlling alcohol use.

  18. Satellite lakes as reservoirs of fish species diversity

    OpenAIRE

    Nkalubo, W.; Wandera, S.B.; Namulemo, G.

    2010-01-01

    Satellite lakes and rivers in the Victoria and Kyoga basins provide a sanctuary for endangered native fish species. The structural heterogeneity of macrophyte covering these lakes has made it possible for most of the biodiversity to be kept intact. The Kyoga minor lakes have the highest fish species diversity especially of the haplochromines. Most fish communities of these satellite lakes are composed of native species.

  19. The Bands Culture in Victoria, Australia: Live Music Benefits Career Paths, Employment and Community

    Science.gov (United States)

    Watson, Amanda; Forrest, David

    2012-01-01

    This study explores the career paths, employment, business opportunities and community contributions made available through the provision and development of the contemporary performance bands' culture in the State of Victoria. It is framed with the support given to live music performers by Arts Victoria, Small Business Victoria and Music Victoria.…

  20. Phytoplankton productivity in newly dug fish ponds within Lake ...

    African Journals Online (AJOL)

    The declining Lake Victoria fisheries resource led to a growing recognition of aquaculture as a source of livelihood to riparian communities. Finger ponds speculated to naturally stock fish during flooding and retain them during dry seasons were introduced within the lake's wetlands. In order to develop a

  1. The patterns and trends of marketing and consumption of the fish of Lake Victoria (Kenya waters). Paper presented at FISA 95: Inaugural Congress of the Fisheries Society for Africa (FISA '95),UNEP Nairobi, Kenya, 31 July - 5th August, 1995.

    OpenAIRE

    Abila, R.

    1995-01-01

    Lake Victoria, producing over 90% of Kenya's fish, is the principle source of fish for domestic consumption and for export in the country. The three fish species of most economic importance are Lates niloticus, Rastrineobola argentea and Oreochromis species. These constitute 50%, 37% and 6% respectively of the lakes's tonnage. The structure and performance of the marketing system for each of these species differ, depending on certain market features. Among these are the marketing history and ...

  2. climate change and lake water resourcesin sub-saharan africa: case ...

    African Journals Online (AJOL)

    user

    STUDY OF LAKE CHAD AND LAKE VICTORIA ... contribution to agriculture and socio-economic development of the region were ... many developing countries, current levels in water use .... 2050 and will become increasingly urban by implication. ... 4.1 Justification of Selected Case Studies ..... Orstom, Paris France. 1996.

  3. DISSOLVED OXYGEN MODELLING USING ARTIFICIAL NEURAL NETWORK: A CASE OF RIVER NZOIA, LAKE VICTORIA BASIN, KENYA

    Directory of Open Access Journals (Sweden)

    Edwin Kimutai Kanda

    2016-11-01

    Full Text Available River Nzoia in Kenya, due to its role in transporting industrial and municipal wastes in addition to agricultural runoff to Lake Victoria, is vulnerable to pollution. Dissolved oxygen is one of the most important indicators of water pollution. Artificial neural network (ANN has gained popularity in water quality forecasting. This study aimed at assessing the ability of ANN to predict dissolved oxygen using four input variables of temperature, turbidity, pH and electrical conductivity. Multilayer perceptron network architecture was used in this study. The data consisted of 113 monthly values for the input variables and output variable from 2009–2013 which were split into training and testing datasets. The results obtained during training and testing were satisfactory with R2 varying from 0.79 to 0.94 and RMSE values ranging from 0.34 to 0.64 mg/l which imply that ANN can be used as a monitoring tool in the prediction of dissolved oxygen for River Nzoia considering the non-correlational relationship of the input and output variables. The dissolved oxygen values follow seasonal trend with low values during dry periods.

  4. Spartial and seasonal variations in concentrations of polycyclic aromatic hydrocarbons in water and sediment of Kisumu City bay of Winam Gulf, Lake Victoria-Kenya.

    Science.gov (United States)

    Kwach, Bowa O; Lalah, Joseph O; Shem, Wandiga O

    2009-11-01

    Seasonal and offshore concentration variations for selected sixteen priority pollutant polycyclic aromatic hydrocarbons (PAHs) in surface sediments and water of Car Wash and Kisat areas of Winam Gulf, Lake Victoria, have been investigated. PAHs concentrations in sediments and water range from 0.4 to 31.95 microg/g dry weight and 3.32 to 55.8 microg/L, respectively. Statistical analysis of the PAHs concentrations showed that the most contaminated samples are found during rainy season (April, 2006), 5 m offshore for sediments and 10 m offshore for water. Dry season (October, 2005) generally recorded lower concentrations. The variations showed significant difference (p < or = 0.05) with season and distance of sampling from the shore.

  5. HIV-1 transmission networks in high risk fishing communities on the shores of Lake Victoria in Uganda: A phylogenetic and epidemiological approach.

    Directory of Open Access Journals (Sweden)

    Sylvia Kiwuwa-Muyingo

    Full Text Available Fishing communities around Lake Victoria in sub-Saharan Africa have been characterised as a population at high risk of HIV-infection.Using data from a cohort of HIV-positive individuals aged 13-49 years, enrolled from 5 fishing communities on Lake Victoria between 2009-2011, we sought to identify factors contributing to the epidemic and to understand the underlying structure of HIV transmission networks. Clinical and socio-demographic data were combined with HIV-1 phylogenetic analyses. HIV-1 gag-p24 and env-gp-41 sub-genomic fragments were amplified and sequenced from 283 HIV-1-infected participants. Phylogenetic clusters with ≥2 highly related sequences were defined as transmission clusters. Logistic regression models were used to determine factors associated with clustering.Altogether, 24% (n = 67/283 of HIV positive individuals with sequences fell within 34 phylogenetically distinct clusters in at least one gene region (either gag or env. Of these, 83% occurred either within households or within community; 8/34 (24% occurred within household partnerships, and 20/34 (59% within community. 7/12 couples (58% within households clustered together. Individuals in clusters with potential recent transmission (11/34 were more likely to be younger 71% (15/21 versus 46% (21/46 in un-clustered individuals and had recently become resident in the community 67% (14/21 vs 48% (22/46. Four of 11 (36% potential transmission clusters included incident-incident transmissions. Independently, clustering was less likely in HIV subtype D (adjusted Odds Ratio, aOR = 0.51 [95% CI 0.26-1.00] than A and more likely in those living with an HIV-infected individual in the household (aOR = 6.30 [95% CI 3.40-11.68].A large proportion of HIV sexual transmissions occur within house-holds and within communities even in this key mobile population. The findings suggest localized HIV transmissions and hence a potential benefit for the test and treat approach even at a community

  6. Time series analysis of satellite multi-sensors imagery to study the recursive abnormal grow of floating macrophyte in the lake victoria (central Africa)

    Science.gov (United States)

    Fusilli, Lorenzo; Cavalli, Rosa Maria; Laneve, Giovanni; Pignatti, Stefano; Santilli, Giancarlo; Santini, Federico

    2010-05-01

    Remote sensing allows multi-temporal mapping and monitoring of large water bodies. The importance of remote sensing for wetland and inland water inventory and monitoring at all scales was emphasized several times by the Ramsar Convention on Wetlands and from EU projects like SALMON and ROSALMA, e.g. by (Finlayson et al., 1999) and (Lowry and Finlayson, 2004). This paper aims at assessing the capability of time series of satellite imagery to provide information suitable for enhancing the understanding of the temporal cycles shown by the macrophytes growing in order to support the monitor and management of the lake Victoria water resources. The lake Victoria coastal areas are facing a number of challenges related to water resource management which include growing population, water scarcity, climate variability and water resource degradation, invasive species, water pollution. The proliferation of invasive plants and aquatic weeds, is of growing concern. In particular, let us recall some of the problems caused by the aquatic weeds growing: Ø interference with human activities such as fishing, and boating; Ø inhibition or interference with a balanced fish population; Ø fish killing due to removal of too much oxygen from the water; Ø production of quiet water areas that are ideal for mosquito breeding. In this context, an integrated use of medium/high resolution images from sensors like MODIS, ASTER, LANDSAT/TM and whenever available CHRIS offers the possibility of creating a congruent time series allowing the analysis of the floating vegetation dynamic on an extended temporal basis. Although MODIS imagery is acquired daily, cloudiness and other sources of noise can greatly reduce the effective temporal resolution, further its spatial resolution can results not always adequate to map the extension of floating plants. Therefore, the integrated use of sensors with different spatial resolution, were used to map across seasons the evolution of the phenomena. The

  7. Identifying Water Insecurity Hotspots in the Lake Victoria Basin of Eastern Africa

    Science.gov (United States)

    Pricope, N. G.; Shukla, S.; Linard, C.; Gaughan, A.

    2014-12-01

    The Lake Victoria Basin (LVB), one of Africa's most populated transboundary watersheds and home to more than 30 million inhabitants, is increasingly challenged by both water quality problems and water quantity shortages against a backdrop of climate variability and change; and other environmental challenges. As a result of pollution, droughts, more erratic rainfall, heightened demand for water for both consumption and agricultural needs as well as differences in water allocation among the riverine countries of Uganda, Tanzania, Kenya, Rwanda and Burundi, many parts of this region are already experiencing water scarcity on a recurrent basis. Furthermore, given projected annual population growth rates of 2.5 to 3.5% for the next 20 years, water shortages are likely to be exacerbated in the future. Analyzing historical changes in the water resources of this region is hence important to identify "hot spots" that might be most sensitive to future changes in climate and demography. In this presentation, we report the findings of a comprehensive analysis performed to (i) examine changes in water resources of LVB in recent decades and (ii) identify overlap between regions of significant changes in water resources with land cover changes and high population centers that are also projected to grow the fastest over the coming decades. We first utilize several satellite, stations and model(s) based climatic and hydrologic datasets to assess changes in water resources in this region. We then use a quality-controlled Moderate Resolution Imaging Spectroradiometer (MODIS) land cover product to identify areas of significant land cover changes. Simultaneously we use projections of gridded population density based on differential growth rates for rural and urban population to estimate fastest projected human population growth for 2030 and 2050 relative to 2010 data. Using the outcomes of these change analysis we identify water insecurity hotspots in the LVB.

  8. Stakeholder views of management and decision support tools to integrate climate change into Great Lakes Lake Whitefish management

    Science.gov (United States)

    Lynch, Abigail J.; Taylor, William W.; McCright, Aaron M.

    2016-01-01

    Decision support tools can aid decision making by systematically incorporating information, accounting for uncertainties, and facilitating evaluation between alternatives. Without user buy-in, however, decision support tools can fail to influence decision-making processes. We surveyed fishery researchers, managers, and fishers affiliated with the Lake Whitefish Coregonus clupeaformis fishery in the 1836 Treaty Waters of Lakes Huron, Michigan, and Superior to assess opinions of current and future management needs to identify barriers to, and opportunities for, developing a decision support tool based on Lake Whitefish recruitment projections with climate change. Approximately 64% of 39 respondents were satisfied with current management, and nearly 85% agreed that science was well integrated into management programs. Though decision support tools can facilitate science integration into management, respondents suggest that they face significant implementation barriers, including lack of political will to change management and perceived uncertainty in decision support outputs. Recommendations from this survey can inform development of decision support tools for fishery management in the Great Lakes and other regions.

  9. High concentrations of polycyclic aromatic hydrocarbons found in water and sediments of car wash and Kisat areas of Winam Gulf, Lake Victoria-Kenya.

    Science.gov (United States)

    Kwach, B O; Lalah, J O

    2009-11-01

    Mean concentrations of selected USEPA priority polycyclic aromatic hydrocarbons (PAHs) in surface sediments and water samples from Car Wash and Kisat areas of Winam Gulf, Lake Victoria in Kenya have been determined using GC-FID and GC-MS. Sampling was done during the rainy season in April 2006. The PAH concentrations in sediment and water ranged from 0.04 to 31.95 microg/g dry weight and 3.32 to 55.8 microg/L, respectively, depending upon the sampling location. The total concentration levels of PAHs in both the sediment and water phase in this study were found to be much higher compared with those reported from other regions worldwide, revealing significant PAH pollution of Car Wash and Kisat areas of Kisumu city bay as a consequent of anthropogenic activities as described in the text. The GC-detected PAHs were confirmed by GC-MS.

  10. Critical Comments on Brian Victoria's "Engaged Buddhism: Skeleton in the Closet?"

    Directory of Open Access Journals (Sweden)

    Koichi Miyata

    2015-02-01

    Full Text Available In "Engaged Buddhism: A Skeleton in the Closet?" (Vol. 2 Brian Daizen Victoria claims, among other things, that Tsunesaburo Makiguchi (1871-1944, founder of the Soka Kyoiku Gakkai (forebear of the Soka Gakkai and Soka Gakkai International, was an active supporter of the Japanese wars of aggression. In this response, Koichi Miyata argues that Victoria's claims rest on the highly selective use of quotes, and ignore key interpretative issues associated with Japanese imperial fascism and its underlying belief structures. Miyata discusses the significance of Makiguchi's arrest and imprisonment under a law specifically aimed at opponents of the war efforts, in his analysis of critical lapses in Victoria's article.

  11. VICTORIA PARK: A DEMOCTRATIC PUBLIC OPEN SPACE FOR INDONESIA DOMESTIC HELPERS (TKW

    Directory of Open Access Journals (Sweden)

    Parmonangan Manurung

    2016-01-01

    Full Text Available Victoria Park is the largest city park in Hong Kong. This city park is not only known in Hong Kong, but also very well known in Indonesia as a gathering place for Indonesia domestic helpers (TKW in Hong Kong. This research tried to find out some determinant factors that have been affected the public open spac of Victoria Park to be a gathering place for thousands of TKW in Sunday and holidays as their day off. In order to get the results of research, some methodological research had been conducted such as: observation (survey, mapping, interviews and literature studies. The results showed that Victoria Park has a number of factors capable of meeting the needs of domestic help-ers in Hong Kong, these factors consist of internal factors and external factors. Internally, the character and functions held Victoria Park became a very influential factor, while externally, the accessibility and support functions around Victoria Park also has a considerable influence.

  12. Mini-FLOTAC and Kato-Katz: helminth eggs watching on the shore of Lake Victoria.

    Science.gov (United States)

    Barda, Beatrice; Zepherine, Henry; Rinaldi, Laura; Cringoli, Giuseppe; Burioni, Roberto; Clementi, Massimo; Albonico, Marco

    2013-07-31

    One of the challenges for monitoring helminth control programmes based on preventive chemotherapy is the lack of a copro-parasitological gold-standard method that combines good sensitivity with quantitative performance, low cost, and easy-to-learn technique.The aim of our study was to evaluate and compare, the WHO recommended quantitative diagnostic technique (Kato-Katz) and the Mini-FLOTAC. Mini-FLOTAC is an innovative method based on floatation of helminths eggs with two different solutions (FS2 and FS7) using a close system (Fill-FLOTAC) with 5% fixative. Kato-Katz was performed following WHO recommendation. The study was carried out in a rural part of Tanzania, close to Lake Victoria, where the laboratory facilities are fairly scarce, and the basic technique used in the local laboratory (direct smear) was taken as reference standard. 201 children were screened for intestinal helminths and 91% of them were found to be positive. The agreement among the three techniques was calculated with k Cohen coefficient and was fairly good (k = 0.4), although the Mini-FLOTAC results were more sensitive for hookworm (98%) with FS2, and for S.mansoni (90%) with FS7 followed by Kato-Katz (91% and 60% respectively) and direct smear (30% and 10% respectively). A good agreement was found between Mini-FLOTAC and Kato-Katz (k = 0.81) with FS7 (k = 0.76) for hookworm diagnosis and a fairly good one for S.mansoni diagnosis (k = 0.5). For both infections we had a poor agreement between the two quantitative techniques and the direct smear (kMcMaster) and in different settings where other soil-transmitted helminths are also endemic.

  13. Changes in ice cover thickness and lake level of Lake Hoare, Antarctica - Implications for local climatic change

    Science.gov (United States)

    Wharton, Robert A., Jr.; Mckay, Christopher P.; Clow, Gary D.; Andersen, Dale T.; Simmons, George M., Jr.; Love, F. G.

    1992-01-01

    Results are reported from 10 years of ice-thickness measurements at perennially ice-covered Lake Hoare in southern Victoria Land, Antarctica. The ice cover of this lake had been thinning steadily at a rate exceeding 20 cm/yr during the last decade but seems to have recently stabilized at a thickness of 3.3 m. Data concerning lake level and degree-days above freezing are presented to show the relationship between peak summer temperatures and the volume of glacier-derived meltwater entering Lake Hoare each summer. From these latter data it is inferred that peak summer temperatures have been above 0 C for a progressively longer period of time each year since 1972. Possible explanations for the thinning of the lake ice are considered. The thickness of the ice cover is determined by the balance between freezing during the winter and ablation that occurs all year but maximizes in summer. It is suggested that the term most likely responsible for the change in the ice cover thickness at Lake Hoare is the extent of summer melting, consistent with the rising lake levels.

  14. Evidence for a Drought-driven (pre-industrial) Regime Shift in an Australian Shallow Lake

    Science.gov (United States)

    Mills, K.; Gell, P.; Doan, P.; Kershaw, P.; McKenzie, M.; Lewis, T.; Tyler, J. J.

    2015-12-01

    We present a 750-year record of ecosystem response to long-term drought history from Lake Colac, Victoria. Using multiple lines of evidence, we test the sensitivity and resilience of Lake Colac to independently reconstructed drought history. The sedimentary archive shows that Lake Colac appears to be sensitive to periods of drought. Following drought conditions c. CE 1390, the lake ecosystem indicates signs of recovery. A succession of droughts in the early 1500s initiates a change in the diatom flora, with freshwater species declining and replaced by saline tolerant species, though there is little interpretable change in aquatic palynomorphs. An inferred drought, around CE 1720 appears to precede a major switch in the lake's ecosystem. The lake became increasingly turbid and saline and there is a distinct switch from a macrophyte-dominated system to an algal-dominated system. The arrival of Europeans in Victoria (CE1840) appears to have little effect on the lake's ecosystem, but the terrestrial vegetation indicates regionally established changes including declines in native trees, especially Casuarina, and arrival and expansion of exotic shade or plantation trees Pinus and Cupressus as well as native and introduced weeds. As European impact in the catchment increases, nutrients appear to play a role in the modification of the lake's ecosystem. A long-term drying trend from c. CE 1975 is evident, culminating in the Millennium Drought, which suggests unprecedented conditions in the ecological history of the Lake.

  15. Dicty_cDB: Contig-U04401-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available , 3' end ... 46 1.6 1 ( DQ447660 ) Lake Victoria marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447659 ) Lake Victoria... marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447658 ) Lake Victoria marburgvirus - An...gola2005 strain An... 44 6.3 1 ( DQ447657 ) Lake Victoria marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447656 ) Lake Victoria... marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447655 ) Lake Victoria... marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447654 ) Lake Victoria marburgvirus -

  16. First evidence of microplastics in the African Great Lakes

    DEFF Research Database (Denmark)

    Biginagwa, Fares John; Mayoma, Bahati Sosthenes; Shashoua, Yvonne

    2016-01-01

    -FTIR) spectroscopy. A variety of polymer types were identified with likely sources being urban waste and consumer use. Although further research is required to fully assess the impact of plastic pollution in this region, our study is the first to report the presence of microplastics in Africa's Great Lakes...... on the southern shore of Lake Victoria. The gastrointestinal tracts of locally fished Nile perch (Lates niloticus) and Nile tilapia (Oreochromis niloticus) were examined for plastics. Plastics were confirmed in 20% of fish from each species by Attenuated Total Reflectance Fourier Transform Infrared (ATR...

  17. Devils Lake Climate, Weather, and Water Decision Support System

    Science.gov (United States)

    Horsfall, F. M.; Kluck, D. R.; Brewer, M.; Timofeyeva, M. M.; Symonds, J.; Dummer, S.; Frazier, M.; Shulski, M.; Akyuz, A.

    2010-12-01

    North Dakota’s Devils Lake area represents an example of a community struggling with a serious climate-related problem. The Devils Lake water level elevation has been rising since 1993 due to a prolonged wet period, and it is now approaching the spill stage into the Cheyenne River and ultimately into the Red River of the North. The impacts of the rising water have already caused significant disruption to the surrounding communities, and even greater impacts will be seen if the lake reaches the spill elevation. These impacts include flooding, water quality issues, impacts to agriculture and ecosystems, and impacts to local and regional economies. National Oceanic and Atmospheric Administration (NOAA), through the National Weather Service (NWS), the National Environmental Satellite, Data, and Information Service (NESDIS), and the Office of Oceanic and Atmospheric Research (OAR), provides the U.S. public with climate, water, and weather services, including meteorological, hydrological and climate data, warnings, and forecasts of weather and climate from near- to longer-term timescales. In support of the people of Devils Lake, the surrounding communities, the people of North Dakota, and the other Federal agencies with responsibilities in the area, NOAA launched the first ever climate-sensitive decision support web site (www.devilslake.noaa.gov) in July 2010. The website is providing integrated weather, water, and climate information for the area, and has links to information from other agencies, such as USGS, to help decision makers as they address this ongoing challenge. This paper will describe the website and other ongoing activities by NOAA in support of this community.

  18. Optimization of EDXRF for the study of heavy metal pollution of Lake ...

    African Journals Online (AJOL)

    The spectrometer was subsequently utilized to determine concentrations of heavy metals in water hyacinth (Eichhornia crassipes (Mart) Solms.) found growing along the shore of Lake Victoria. The optimal conditions and detection limits were determined experimentally by variation of the excitation parameters. The study ...

  19. Fatty Acid Composition and Levels of Selected Polyunsaturated Fatty Acids in Four Commercial Important Freshwater Fish Species from Lake Victoria, Tanzania

    Directory of Open Access Journals (Sweden)

    Agnes Robert

    2014-01-01

    Full Text Available Fatty acids (FAs particularly ω3 and ω6 polyunsaturated fatty acids (PUFAs play important role in human health. This study aimed to investigate the composition and levels of selected ω3 PUFAs in four commercial fish species, Nile perch (Lates niloticus, Nile tilapia (Oreochromis niloticus, Tilapia zillii, and dagaa (Rastrineobola argentea from Mwanza Gulf in Lake Victoria. The results indicated that 36 types of FAs with different saturation levels were detected. These FAs were dominated by docosahexaenoic (DHA, eicosapentaenoic (EPA, docosapentaenoic (DPA, and eicosatetraenoic acids. O. niloticus had the highest composition of FAs (34 compared to L. niloticus (27, T. zillii (26, and R. argentea (21. The levels of EPA differed significantly among the four commercial fish species (F=6.19,  P=0.001. The highest EPA levels were found in R. argentea followed by L. niloticus and O. niloticus and the lowest in T. zillii. The DPA levels showed no significant difference among the four fish species studied (F=0.652,  P=0.583. The study concluded that all four commercial species collected from Mwanza Gulf are good for human health, but R. argentea is the best for consumption because it contains higher levels of ω3 FAs, mainly EPA.

  20. Estimation of design floods in ungauged catchments using a regional index flood method. A case study of Lake Victoria Basin in Kenya

    Science.gov (United States)

    Nobert, Joel; Mugo, Margaret; Gadain, Hussein

    Reliable estimation of flood magnitudes corresponding to required return periods, vital for structural design purposes, is impacted by lack of hydrological data in the study area of Lake Victoria Basin in Kenya. Use of regional information, derived from data at gauged sites and regionalized for use at any location within a homogenous region, would improve the reliability of the design flood estimation. Therefore, the regional index flood method has been applied. Based on data from 14 gauged sites, a delineation of the basin into two homogenous regions was achieved using elevation variation (90-m DEM), spatial annual rainfall pattern and Principal Component Analysis of seasonal rainfall patterns (from 94 rainfall stations). At site annual maximum series were modelled using the Log normal (LN) (3P), Log Logistic Distribution (LLG), Generalized Extreme Value (GEV) and Log Pearson Type 3 (LP3) distributions. The parameters of the distributions were estimated using the method of probability weighted moments. Goodness of fit tests were applied and the GEV was identified as the most appropriate model for each site. Based on the GEV model, flood quantiles were estimated and regional frequency curves derived from the averaged at site growth curves. Using the least squares regression method, relationships were developed between the index flood, which is defined as the Mean Annual Flood (MAF) and catchment characteristics. The relationships indicated area, mean annual rainfall and altitude were the three significant variables that greatly influence the index flood. Thereafter, estimates of flood magnitudes in ungauged catchments within a homogenous region were estimated from the derived equations for index flood and quantiles from the regional curves. These estimates will improve flood risk estimation and to support water management and engineering decisions and actions.

  1. Fish as bioindicators in aquatic environmental pollution assessment: A case study in Lake Victoria wetlands, Uganda

    Science.gov (United States)

    Naigaga, I.; Kaiser, H.; Muller, W. J.; Ojok, L.; Mbabazi, D.; Magezi, G.; Muhumuza, E.

    Growing human population and industrialization have led to the pollution of most aquatic ecosystems and consequent deterioration in environmental water quality. Indicator organisms are needed to improve assessment programmes on the ecological impacts of anthropogenic activities on the aquatic environment. Fish have been widely documented as useful indicators of environmental water quality because of their differential sensitivity to pollution. This study investigated the environmental water quality of selected wetland ecosystems using fish as biological indicators. Fish community structure in relation to water quality was assessed in five wetlands along the shoreline of Lake Victoria from August 2006 to June 2008. Four urban wetlands were variedly impacted by anthropogenic activities while one rural wetland was less impacted, and served as a reference site. Fish species diversity, abundance and richness were assessed, and canonical correspondence analysis (CCA) was used to evaluate the relationship between the fish communities and environmental variables. Results revealed that urban effluent impacted negatively on water quality and consequently the fish community structure. A total of 29 fish species were recorded throughout the study with the lowest number of 15 species recorded in the most impacted site. Shannon diversity and Margalef species richness indices were highest at the references site and lowest at the most impacted site. Wetland haplochromis species dominated the reference site, while oreochromis species dominated the most impacted site. The inshore locations registered higher species diversity and low species richness than the offshore locations. Low dissolved oxygen, pH, secchi depth and high electrical conductivity, total phosphorous, and total nitrogen were strongly associated with the effluent-impacted sites and greatly influenced the fish community structure. This study recommends the use of fish as valuable biological indicators in aquatic

  2. Recent plant studies using Victoria 2.0

    International Nuclear Information System (INIS)

    Bixler, Nathan E.; Gasser, Ronald D.

    2000-01-01

    VICTORIA 2.0 is a mechanistic computer code designed to analyze fission product behavior within the reactor coolant system (RCS) during a severe nuclear reactor accident. It provides detailed predictions of the release of radioactive and nonradioactive materials from the reactor core and transport and deposition of these materials within the RCS and secondary circuits. These predictions account for the chemical and aerosol processes that affect radionuclide behavior. VICTORIA 2.0 was released in early 1999; a new version VICTORIA 2.1, is now under development. The largest improvements in VICTORIA 2.1 are connected with the thermochemical database, which is being revised and expanded following the recommendations of a peer review. Three risk-significant severe accident sequences have recently been investigated using the VICTORIA 2.0 code. The focus here is on how various chemistry options affect the predictions. Additionally, the VICTORIA predictions are compared with ones made using the MELCOR code. The three sequences are a station blackout in a GE BWR and steam generator tube rupture (SGTR) and pump-seal LOCA sequences in a 3-loop Westinghouse PWR. These sequences cover a range of system pressures, from fully depressurized to full system pressure. The chief results of this study are the fission product fractions that are retained in the core, RCS, secondary, and containment and the fractions that are released into the environment

  3. Parasitic infections on the shore of Lake Victoria (East Africa) detected by Mini-FLOTAC and standard techniques.

    Science.gov (United States)

    Barda, Beatrice; Ianniello, Davide; Zepheryne, Henry; Rinaldi, Laura; Cringoli, Giuseppe; Burioni, Roberto; Albonico, Marco

    2014-09-01

    Helminths and protozoa infections pose a great burden especially in developing countries, due to morbidity caused by both acute and chronic infection. The aim of our survey was to analyze the intestinal parasitic burden in communities from Mwanza region, Tanzania. Subjects (n=251) from four villages on the South of Lake Victoria have been analyzed for intestinal parasites with direct smear (DS), formol-ether concentration method (FECM) and the newly developed Mini-FLOTAC technique; urinary schistosomiasis was also assessed in a subsample (n=151); symptoms were registered and correlation between clinic and infections was calculated by chi-squared test and logistical regression. Out of the subjects screened for intestinal and for urinary parasites, 87% (218/251) were found positive for any infection, 69% (174/251) carried a helminthic and 67% (167/251) a protozoan infection, almost half of them had a double or triple infection. The most common helminths were hookworms, followed by Schistosoma mansoni and Schistosoma haematobium. Among protozoa, the most common was Entamoeba coli followed by Entamoeba histolytica/dispar and Giardia intestinalis. Mini-FLOTAC detected a number of helminth infections (61.7%) higher than FECM (38.6%) and DS (17.9%). Some positive associations with abdominal symptoms were found and previous treatment was negatively correlated with infection. Despite the limited size of the examined population the current study indicates a high prevalence of intestinal parasitic infection in Bukumbi area, Tanzania, and Mini-FLOTAC showed to be a promising diagnostic tool for helminth infections. This high parasitic burden calls for starting a regular deworming programme and other preventive interventions in schools and in the community. Copyright © 2014 Elsevier B.V. All rights reserved.

  4. Integration of altimetric lake levels and GRACE gravimetry over Africa: Inferences for terrestrial water storage change 2003-2011

    Science.gov (United States)

    Moore, P.; Williams, S. D. P.

    2014-12-01

    Terrestrial water storage (TWS) change for 2003-2011 is estimated over Africa from GRACE gravimetric data. The signatures from change in water of the major lakes are removed by utilizing kernel functions with lake heights recovered from retracked ENVISAT satellite altimetry. In addition, the contribution of gravimetric change due to soil moisture and biomass is removed from the total GRACE signal by utilizing the GLDAS land surface model. The residual TWS time series, namely groundwater and the surface waters in rivers, wetlands, and small lakes, are investigated for trends and the seasonal cycle using linear regression. Typically, such analyses assume that the data are temporally uncorrelated but this has been shown to lead to erroneous inferences in related studies concerning the linear rate and acceleration. In this study, we utilize autocorrelation and investigate the appropriate stochastic model. The results show the proper distribution of TWS change and identify the spatial distribution of significant rates and accelerations. The effect of surface water in the major lakes is shown to contribute significantly to the trend and seasonal variation in TWS in the lake basin. Lake Volta, a managed reservoir in Ghana, is seen to have a contribution to the linear trend that is a factor of three greater than that of Lake Victoria despite having a surface area one-eighth of that of Lake Victoria. Analysis also shows the confidence levels of the deterministic trend and acceleration identifying areas where the signatures are most likely due to a physical deterministic cause and not simply stochastic variations.

  5. Assessment of Wetland Hydrological Dynamics in a Modified Catchment Basin: Case of Lake Buninjon, Victoria, Australia.

    Science.gov (United States)

    Yihdego, Yohannes; Webb, John A

    2017-02-01

      The common method to estimate lake levels is the water balance equation, where water input and output result in lake storage and water level changes. However, all water balance components cannot always be quickly assessed, such as due to significant modification of the catchment area. A method that assesses general changes in lake level can be a useful tool in examining why lakes have different lake level variation patterns. Assessment of wetlands using the dynamics of the historical hydrological and hydrogeological data set can provide important insights into variations in wetland levels in different parts of the world. A case study from a saline landscape, Lake Buninjon, Australia, is presented. The aim of the present study was to determine how climate, river regime, and lake hydrological properties independently influence lake water levels and salinity, leaving the discrepancy, for the effect of the non-climatic/catchment modification in the past and the model shows that surface inflow is most sensitive variable. The method, together with the analysis and interpretation, might be of interest to wider community to assess its response to natural/anthropogenic stress and decision choices for its ecological, social, scientific value, and mitigation measures to safe guard the wetland biodiversity in a catchment basin.

  6. Perceptions of HIV and Safe Male Circumcision in High HIV Prevalence Fishing Communities on Lake Victoria, Uganda.

    Directory of Open Access Journals (Sweden)

    Paul E Nevin

    Full Text Available In 2010, the Uganda Ministry of Health introduced its Safe Male Circumcision (SMC strategy for HIV prevention with the goal of providing 4.2 million voluntary medical male circumcisions by 2015. Fishing communities, where HIV prevalence is approximately 3-5 times higher than the national average, have been identified as a key population needing targeted HIV prevention services by the National HIV Prevention Strategy. This study aimed to understand perceptions of HIV and identify potential barriers and facilitators to SMC in fishing communities along Lake Victoria.We conducted 8 focus group discussions, stratified by sex and age, with 67 purposefully sampled participants in 4 communities in Kalangala District, Uganda.There was universal knowledge of the availability of SMC services, but males reported high uptake in the community while females indicated that it is low. Improved hygiene, disease prevention, and improved sexual performance and desirability were reported facilitators. Barriers included a perceived increase in SMC recipients' physiological libido, post-surgical abstinence, lost income during convalescence, and lengthier recovery due to occupational hazards. Both males and females reported concerns about spousal fidelity during post-SMC abstinence. Reported misconceptions and community-held cultural beliefs include fear that foreskins are sold after their removal, the belief that a SMC recipient's first sexual partner after the procedure should not be his spouse, and the belief that vaginal fluids aid circumcision wound healing.Previous outreach efforts have effectively reached these remote communities, where availability and health benefits of SMC are widely understood. However, community-specific intervention strategies are needed to address the barriers identified in this study. We recommend the development of targeted counseling, outreach, and communication strategies to address barriers, misconceptions, and community-held beliefs

  7. Comparing insecticide-treated bed net use to Plasmodium falciparum infection among schoolchildren living near Lake Victoria, Kenya.

    Science.gov (United States)

    Okoyo, Collins; Mwandawiro, Charles; Kihara, Jimmy; Simiyu, Elses; Gitonga, Caroline W; Noor, Abdisalan M; Njenga, Sammy M; Snow, Robert W

    2015-12-22

    Under trial conditions insecticide-treated nets have been shown to provide significant clinical and mortality protection under a range of malaria transmission intensity conditions. There are, however, few operational impact data, notably in very intense transmission conditions. This study, reports on malaria infection among Kenyan schoolchildren living in areas of intense malaria transmission and their reported use of insecticide-treated bed nets. 5188 children in 54 schools were randomly sampled from seven counties surrounding Lake Victoria between May and June 2014. A questionnaire was administered to schoolchildren in classes 2-6 on the use of a long-lasting, insecticide-treated net (LLIN) the night before the survey and provided a single blood sample for a rapid diagnostic test for malaria infection. Analysis of the impact of insecticide-treated net use on malaria prevalence was undertaken using a multivariable, mixed effects, logistic regression at 95% confidence interval (CI), taking into account hierarchical nature of the data and results adjusted for school clusters. The overall prevalence of malaria infection was 48.7%, two-thirds (67.9%) of the children reported using LLIN, 91.3% of the children reported that their households own at least one LLIN and the household LLIN coverage was 2.5 persons per one LLIN. The prevalence of infection showed variation across the counties, with prevalence being highest in Busia (66.9%) and Homabay (51.8%) counties, and lowest in Migori County (29.6%). Generally, malaria parasite prevalence differed between age groups and gender with the highest prevalence occurring in children below 7 years (50.6%) and males (52.2%). Adjusting for county and school, there was a significant reduction in odds of malaria infection among the schoolchildren who reported LLIN use the previous night by 14 % (aOR 0.86, 95% CI 0.74-0.98, P provide protection against infection among school-aged children.

  8. Utilisation of Rep-PCR to track microbes in aerosols collected adjacent to their source, a saline lake in Victoria, Australia.

    Science.gov (United States)

    Munday, Chris I; O'Loingsigh, Tadhg; Tapper, Nigel J; De Deckker, Patrick; Allison, Gwen E

    2013-04-15

    Dust storms are a major source of aerosolized bacteria, especially in the drought conditions experienced in Australia in the decade to 2009. The major aims of this project were to identify the culturable bacteria in environmental samples and to genetically fingerprint all isolates using repetitive element PCR (Rep-PCR) to investigate the possibility of tracking isolates from their source into the atmosphere. Four field trips were conducted to a dry lake in western Victoria, Australia to sample aerosols and sediments. Aerosols were collected at heights up to 150 m using vacuum pumps with filters attached to a tethered helium balloon, while corresponding sediments were collected in sterile polypropylene tubes. Isolates were cultivated on Tryptic Soy Agar, R2 Agar and Marine Agar, and grown in dark conditions at ambient temperature. By sequencing the 16S rRNA gene of 270 isolates, fifteen different bacterial families were identified, with both the aerosols and sediments dominated by the Bacillaceae family. Four sets of Rep-PCR primers were tested, with the ERIC and (GTG)5 primers proving to be the most suitable for fingerprinting the cultured taxa. Rep-PCR revealed very high strain diversity in the samples collected, however some strains were still able to be tracked from sediments up to 150 m in height. This shows the potential of Rep-PCR, however very large reference databases would be required for the technique to be more useful. Copyright © 2013 Elsevier B.V. All rights reserved.

  9. Urbanization and mental health: psychiatric morbidity, suicide and violence in the State of Victoria.

    Science.gov (United States)

    Krupinski, J

    1979-06-01

    Australia is one of the most urbanized countries in the world with over 85% of the population living in metropolitan and other urban areas. More important, the change from a predominantly rural society to an urbanized society has occurred within the last 100 years. To assess the effects of urbanization on mental health, rates of admissions to psychiatric institutions, suicides and violent crime in Victoria have been analysed for the last hundred years. Data on admissions to psychiatric facilities in Victoria from metropolitan, other urban and rural areas, as well as results of community health surveys carried out in metropolitan and rural areas were compared to examine for evidence of urban-rural differences in psychiatric morbidity. The findings do not support the notion that the level of psychiatric and psychosocial disorders in Victoria are related to urbanization or to urban living.

  10. Monitoring of Heavy Metal Loading into the Wetlands South of Lake ...

    African Journals Online (AJOL)

    Wetlands impacted by gold mining activities in the South Lake Victoria basin show elevated heavy metal contents in soil and sediment, particularly Cu (13-415 mg/kg), Pb (24-94 mg/kg), Zn (9-80 mg/kg), Cr (19-77 mg/kg), Ni (12-37 mg/kg) and Hg (0.19-1.76 mg/kg), contrary to non-impacted wetlands, which contain ...

  11. victoria cross awards warrants concerning the victoria cross (1920)

    African Journals Online (AJOL)

    1. WARRANTS CONCERNING THE. VICTORIA CROSS (1920). In order to get a picture of the Royal Warrants promulgated from 1856 to 1920 in respect of the .... to confirmation by us. Eighthly. - It is ordained, where such an act shall not have been performed in the sight of a commanding officer as aforesaid, then the ...

  12. VICTORIA Class Submarine Human-in-the-Loop Experimentation Plan

    Science.gov (United States)

    2014-06-01

    1472G. VICTORIA Class Submarine Human-in-the-Loop Experimentation Plan and Preliminary Results © Her Majesty the Queen in Right of...19 th International Command and Control Research and Technology Symposium Title: VICTORIA Class Submarine Human-in-the-Loop...TYPE 3. DATES COVERED 00-00-2014 to 00-00-2014 4. TITLE AND SUBTITLE VICTORIA Class Submarine Human-in-the-Loop Experimentation Plan 5a. CONTRACT

  13. An Integrated Hydrological and Water Management Study of the Entire Nile River System - Lake Victoria to Nile Delta

    Science.gov (United States)

    Habib, Shahid; Zaitchik, Benjamin; Alo, Clement; Ozdogan, Mutlu; Anderson, Martha; Policelli, Fritz

    2011-01-01

    The Nile basin River system spans 3 million km(exp 2) distributed over ten nations. The eight upstream riparian nations, Ethiopia, Eretria, Uganda, Rwanda, Burundi, Congo, Tanzania and Kenya are the source of approximately 86% of the water inputs to the Nile, while the two downstream riparian countries Sudan and Egypt, presently rely on the river's flow for most of the their needs. Both climate and agriculture contribute to the complicated nature of Nile River management: precipitation in the headwaters regions of Ethiopia and Lake Victoria is variable on a seasonal and inter-annual basis, while demand for irrigation water in the arid downstream region is consistently high. The Nile is, perhaps, one of the most difficult trans-boundary water issue in the world, and this study would be the first initiative to combine NASA satellite observations with the hydrologic models study the overall water balance in a to comprehensive manner. The cornerstone application of NASA's Earth Science Research Results under this project are the NASA Land Data Assimilation System (LDAS) and the USDA Atmosphere-land Exchange Inverse (ALEXI) model. These two complementary research results are methodologically independent methods for using NASA observations to support water resource analysis in data poor regions. Where an LDAS uses multiple sources of satellite data to inform prognostic simulations of hydrological process, ALEXI diagnoses evapotranspiration and water stress on the basis of thermal infrared satellite imagery. Specifically, this work integrates NASA Land Data Assimilation systems into the water management decision support systems that member countries of the Nile Basin Initiative (NBI) and Regional Center for Mapping of Resources for Development (RCMRD, located in Nairobi, Kenya) use in water resource analysis, agricultural planning, and acute drought response to support sustainable development of Nile Basin water resources. The project is motivated by the recognition that

  14. AcEST: DK961333 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|Q1PDC9|VP35_MABVR Polymerase cofactor VP35 OS=Lake Victoria m... 32 3.9 sp|Q6UY68|VP35_MABVO Polymerase cofactor VP35 OS=Lake Vict...oria m... 32 3.9 sp|P35259|VP35_MABVM Polymerase cofactor VP35 OS=Lake Victoria m...... 32 3.9 sp|Q1PD52|VP35_MABVA Polymerase cofactor VP35 OS=Lake Victoria m... 32 3.9 sp|O54898|CAC1G_RAT Volt...dependent T-type calcium channel s... 32 5.1 sp|Q03039|VP35_MABVP Polymerase cofactor VP35 OS=Lake Victoria ...C9|VP35_MABVR Polymerase cofactor VP35 OS=Lake Victoria marburgvirus (strain Ravn-87) GN=VP35 PE=3 SV=1 Leng

  15. Exploratory studies into seasonal flow forecasting potential for large lakes

    Science.gov (United States)

    Sene, Kevin; Tych, Wlodek; Beven, Keith

    2018-01-01

    In seasonal flow forecasting applications, one factor which can help predictability is a significant hydrological response time between rainfall and flows. On account of storage influences, large lakes therefore provide a useful test case although, due to the spatial scales involved, there are a number of modelling challenges related to data availability and understanding the individual components in the water balance. Here some possible model structures are investigated using a range of stochastic regression and transfer function techniques with additional insights gained from simple analytical approximations. The methods were evaluated using records for two of the largest lakes in the world - Lake Malawi and Lake Victoria - with forecast skill demonstrated several months ahead using water balance models formulated in terms of net inflows. In both cases slight improvements were obtained for lead times up to 4-5 months from including climate indices in the data assimilation component. The paper concludes with a discussion of the relevance of the results to operational flow forecasting systems for other large lakes.

  16. AcEST: DK949817 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=Drosophila melanogast... 34 0.58 sp|P41326|VP30_MABVP Minor nucleoprotein VP30 OS=Lake Victoria... m... 33 0.99 sp|Q6UY65|VP30_MABVO Minor nucleoprotein VP30 OS=Lake Victoria m... 33 1.7 s... 32 3.8 sp|Q1PDC6|VP30_MABVR Minor nucleoprotein VP30 OS=Lake Victoria m... 31 4.... 3956 >sp|P41326|VP30_MABVP Minor nucleoprotein VP30 OS=Lake Victoria marburgvirus (strain Popp-67) GN=VP30 ... NHH R+ ++T Sbjct: 11 RNHQTASSIYHETQLPSKPHYTNHHPRARSMSST 44 >sp|Q6UY65|VP30_MABVO Minor nucleoprotein VP30 OS=Lake Victoria

  17. Increasing deaths involving oxycodone, Victoria, Australia, 2000-09.

    Science.gov (United States)

    Rintoul, Angela C; Dobbin, Malcolm D H; Drummer, Olaf H; Ozanne-Smith, Joan

    2011-08-01

    In light of an emerging epidemic identified in the United States and Canada, to identify trends in fatal drug toxicity involving oxycodone and the demographic characteristics and indicators of socioeconomic disadvantage of the deceased. Population-based observational study in Victoria, Australia. Decedents whose death was reported to the Victorian Coroner between 2000 and 2009 and where oxycodone was detected. Association between supply of oxycodone and deaths. Demographic characteristics of decedents. Rate ratios of the rural or metropolitan location and socioeconomic indicators of disadvantage of the deceased. Supply to Victoria has increased nine-fold from 7.5 mg per capita in 2000 to 67.5 mg per capita in 2009. Detection of oxycodone in deaths reported to the Victorian Coroner has increased from 4 (0.08/100,000 population) in 2000 to 97 (1.78/100,000 population) in 2009-a 21-fold increase in deaths. Of the 320 cases described, 53.8% (172) were the result of drug toxicity. Of these, 52.3% were unintentional and 19.8% intentional self-harm; the remaining 27.9% are either still under investigation by the coroner or intent is unknown. Drug toxicity deaths were overrepresented in both rural areas and areas indexed with high levels of disadvantage. The substantial increase in the number of deaths involving oxycodone is strongly and significantly associated with the increase in supply. Most drug toxicity deaths involving oxycodone were unintentional. This newly identified trend in fatalities in Victoria supports concerns that a pattern of increasing deaths involving oxycodone is emerging globally.

  18. A survey of ichthyofauna of Lake Kanyaboli and other small waterbodies in Kenya: alternative refugia for endangered fish species

    OpenAIRE

    Maithya, J.

    1998-01-01

    In 1988, the World Conservation Union (WCU) Red Book of Endangered Species listed hundreds of endemic fishes of Lake Victoria under a single heading - "ENDANGERED". Most of the endemic native food fishes are either endangered or extinct. However, a survey of the fauna of Lake Kanyaboli, revealed that a few remaining samples of these native fishes are actually thriving. These include several unidentified Haplochromis spp., Oreochromis esculentus and Oreochromis variabilis. As a resul...

  19. AcEST: BP913599 [AcEST

    Lifescience Database Archive (English)

    Full Text Available VGP_MABVO Envelope glycoprotein OS=Lake Victoria marburgvirus (strain Ozolin-75) ...s) Value sp|Q6UY66|VGP_MABVO Envelope glycoprotein OS=Lake Victoria marbu... 31 2...P_MABVO Envelope glycoprotein OS=Lake Victoria marburgvirus (strain Ozolin-75) GN

  20. Hemofilie onder die nasate van koningin Victoria

    Directory of Open Access Journals (Sweden)

    Francois P. Retief

    2013-03-01

    Full Text Available Hierdie studie bespreek die uitwerking van die sogenaamde Victoriaanse hemofilie op Europese koningshuise gedurende die negentiende en twintigste eeu. Hemofilie as molekulêre defek word verduidelik en die kliniese beeld van die siekte word aangedui. ’n Bespreking van toepaslike terapeutiese ingrepe volg. Dan word ’n historiese oorsig verskaf van die verspreiding van Victoriaanse hemofilie vanaf koningin Victoria (Britse monarg, 1837–1901 via sommige van haar dogters na ander lede van die Britse koningshuis en ook na die Duitse, Russiese en Spaanse koningshuise. Elf bevestigde gevalle van hemofilie onder lede van koningin Victoria se nageslag word vermeld, asook drie ander moontlike gevalle van die siekte. Die effek van hemofilie op die verloop van die geskiedenis word ook ondersoek.Haemophilia amongst the descendants of Queen Victoria. This study discusses the impact of ‘Victorian haemophilia’ on the royal houses of Europe during the 19th and 20th centuries. Haemophilia as a molecular defect is explained and the clinical picture of the condition is indicated. Applicable therapeutic interventions also receive attention. Next, an historical review is provided of how ‘Victorian haemophilia’ spread from Queen Victoria (British monarch, 1837–1901 via some of her daughters to other members of the British royal family and also to the royal houses of Germany, Russia and Spain. Eleven confirmed cases of haemophilia amongst the descendants of Queen Victoria are mentioned, as well as three other possible cases. The effect of haemophilia on the course of history is also investigated.

  1. Levels and patterns of persistent organic pollutants (POPs) in tilapia (Oreochromis sp.) from four different lakes in Tanzania: geographical differences and implications for human health.

    Science.gov (United States)

    Polder, A; Müller, M B; Lyche, J L; Mdegela, R H; Nonga, H E; Mabiki, F P; Mbise, T J; Skaare, J U; Sandvik, M; Skjerve, E; Lie, E

    2014-08-01

    In Tanzania fish is one of the most important protein sources for the rapidly increasing population. Wild fish is threatened by overfishing and pollution from agriculture, industries, mining, household effluents and vector control. To monitor possible implications for public health, the geographical differences of the occurrence and levels of persistent organic pollutants (POPs) in tilapia fish (Oreochromis sp.) from four different Tanzanian lakes were investigated in 2011. Concentrations of organochlorine pesticides (OCPs), polychlorinated biphenyls (PCBs), polybrominated diphenyls (PBDEs) and hexabromocyclododecane (HBCDD) were determined in pooled samples of tilapia muscle from Lake (L) Victoria, L. Tanganyika, L. Nyasa (also called L. Malawi) and L. Babati in Tanzania in 2011. Levels of Σ-DDTs (274 ng/g lipid weight (lw)) and sum of 7 indicator PCBs (Σ-7PCBs) (17 ng/g lw) were significantly higher in tilapia from L. Tanganyika compared to the other lakes. The highest levels of Σ-endosulfan (94 ng/g lw) were detected in tilapia from L. Victoria. Toxaphenes were detected in low levels in fish from L. Tanganyika and L. Babati. Results revealed a geographic difference in the use of DDT and endosulfan between L. Victoria and L. Tanganyika. Low ratios of DDE/DDT in tilapia from L. Tanganyika indicated an on-going use of DDT in the area. Median levels of ΣBDEs, including BDE-209, were highest in L. Victoria (19.4 ng/g lw) and BDE-209 was present in 68% of the samples from this lake. The presence of BDE-209 indicates increasing influence of imported products from heavy industrialized countries. The measured POP levels in the studied tilapia were all below MRLs of EU or were lower than recommended levels, and thus the fish is considered as safe for human consumption. They may, however, pose a risk to the fish species and threaten biodiversity. Copyright © 2014 Elsevier B.V. All rights reserved.

  2. Estimating the recreational value of Pakistan's largest freshwater lake to support sustainable tourism management using a travel cost model

    NARCIS (Netherlands)

    Mangan, T.; Brouwer, R.; Lohano, H.; Nagraj, G.M.

    2013-01-01

    Keenjhar Lake, Pakistan's largest freshwater lake and an important Ramsar site, provides habitat for internationally important water birds. Annually, 385,000 people visit the lake. The lake is threatened by a variety of causes, including industrial and agricultural pollution. To support its

  3. How many species of cichlid fishes are there in African lakes?

    Science.gov (United States)

    Turner, G F; Seehausen, O; Knight, M E; Allender, C J; Robinson, R L

    2001-03-01

    The endemic cichlid fishes of Lakes Malawi, Tanganyika and Victoria are textbook examples of explosive speciation and adaptive radiation, and their study promises to yield important insights into these processes. Accurate estimates of species richness of lineages in these lakes, and elsewhere, will be a necessary prerequisite for a thorough comparative analysis of the intrinsic and extrinsic factors influencing rates of diversification. This review presents recent findings on the discoveries of new species and species flocks and critically appraises the relevant evidence on species richness from recent studies of polymorphism and assortative mating, generally using behavioural and molecular methods. Within the haplochromines, the most species-rich lineage, there are few reported cases of postzygotic isolation, and these are generally among allopatric taxa that are likely to have diverged a relatively long time in the past. However, many taxa, including many which occur sympatrically and do not interbreed in nature, produce viable, fertile hybrids. Prezygotic barriers are more important, and persist in laboratory conditions in which environmental factors have been controlled, indicating the primary importance of direct mate preferences. Studies to date indicate that estimates of alpha (within-site) diversity appear to be robust. Although within-species colour polymorphisms are common, these have been taken into account in previous estimates of species richness. However, overall estimates of species richness in Lakes Malawi and Victoria are heavily dependent on the assignation of species status to allopatric populations differing in male colour. Appropriate methods for testing the specific status of allopatric cichlid taxa are reviewed and preliminary results presented.

  4. Integrated prevalence mapping of schistosomiasis, soil-transmitted helminthiasis and malaria in lakeside and island communities in Lake Victoria, Uganda

    Science.gov (United States)

    2011-01-01

    Background It is widely advocated that integrated strategies for the control of neglected tropical diseases (NTDs) are cost-effective in comparison to vertical disease-specific programmes. A prerequisite for implementation of control interventions is the availability of baseline data of prevalence, including the population at risk and disease overlap. Despite extensive literature on the distribution of schistosomiasis on the mainland in Uganda, there has been a knowledge gap for the prevalence of co-infections with malaria, particularly for island communities in Lake Victoria. In this study, nine lakeshore and island districts were surveyed for the prevalence of NTDs and malaria, as well as educational and health infrastructure. Results A total of 203 communities were surveyed, including over 5000 school-age children. Varying levels of existing health infrastructure were observed between districts, with only Jinja District regularly treating people for NTDs. Community medicine distributors (CMD) were identified and trained in drug delivery to strengthen capacity. Prevalence levels of intestinal schistosomiasis and soil-transmitted helminthiasis were assessed via Kato-Katz thick smears of stool and malaria prevalence determined by microscopy of fingerprick blood samples. Prevalence levels were 40.8%, 26.04% and 46.4%, respectively, while the prevalence of co-infection by Schistosoma mansoni and Plasmodium spp. was 23.5%. Socio-economic status was strongly associated as a risk factor for positive infection status with one or more of these diseases. Conclusions These results emphasise the challenges of providing wide-scale coverage of health infrastructure and drug distribution in remote lakeshore communities. The data further indicate that co-infections with malaria and NTDs are common, implying that integrated interventions for NTDs and malaria are likely to maximize cost-effectiveness and sustainability of disease control efforts. PMID:22166365

  5. Integrated prevalence mapping of schistosomiasis, soil-transmitted helminthiasis and malaria in lakeside and island communities in Lake Victoria, Uganda.

    Science.gov (United States)

    Kabatereine, Narcis B; Standley, Claire J; Sousa-Figueiredo, Jose C; Fleming, Fiona M; Stothard, J Russell; Talisuna, Ambrose; Fenwick, Alan

    2011-12-13

    It is widely advocated that integrated strategies for the control of neglected tropical diseases (NTDs) are cost-effective in comparison to vertical disease-specific programmes. A prerequisite for implementation of control interventions is the availability of baseline data of prevalence, including the population at risk and disease overlap. Despite extensive literature on the distribution of schistosomiasis on the mainland in Uganda, there has been a knowledge gap for the prevalence of co-infections with malaria, particularly for island communities in Lake Victoria. In this study, nine lakeshore and island districts were surveyed for the prevalence of NTDs and malaria, as well as educational and health infrastructure. A total of 203 communities were surveyed, including over 5000 school-age children. Varying levels of existing health infrastructure were observed between districts, with only Jinja District regularly treating people for NTDs. Community medicine distributors (CMD) were identified and trained in drug delivery to strengthen capacity. Prevalence levels of intestinal schistosomiasis and soil-transmitted helminthiasis were assessed via Kato-Katz thick smears of stool and malaria prevalence determined by microscopy of fingerprick blood samples. Prevalence levels were 40.8%, 26.04% and 46.4%, respectively, while the prevalence of co-infection by Schistosoma mansoni and Plasmodium spp. was 23.5%. Socio-economic status was strongly associated as a risk factor for positive infection status with one or more of these diseases. These results emphasise the challenges of providing wide-scale coverage of health infrastructure and drug distribution in remote lakeshore communities. The data further indicate that co-infections with malaria and NTDs are common, implying that integrated interventions for NTDs and malaria are likely to maximize cost-effectiveness and sustainability of disease control efforts.

  6. Retention efficiencies of halogenated and non-halogenated hydrocarbons in selected wetland ecosystem in Lake Victoria Basin

    Directory of Open Access Journals (Sweden)

    Shadrack Mule

    2015-06-01

    Full Text Available The determination of retention efficiencies of halogenated and non-halogenated hydrocarbon in selected wetland ecosystems in Lake Victoria basin was carried out. Qualitative and quantitative determination of the presence of residual hydrocarbons in Kigwal/Kimondi, Nyando and Nzoia wetland ecosystems using Gas Chromatography - Mass Spectrometer (GC-MS instrument indicated the presence of residual organochlorines, organophosphorus, carbamates and synthetic pyrethroid hydrocarbons in water, sediment and plant materials. In order to compare the retention efficiencies of the wetlands, the wetland ecosystems were divided into three different sections, namely: inlet, mid and outlet. Calculations of mass balances of residual halogenated and non-halogenated hydrocarbons at the respective sections was done taking into account the partition of the studied compounds in samples of water, sediments and papyrus reed plant materials and analyzed using validated Gas Chromatography - Mass Spectrometer (GC-MS method. From the analysis, several residual hydrocarbons namely: bendiocarb, benzene hexachloride (BHC, carbaryl, cypermethrin, decis, deltamethrin, diazinon, dieldrin, DDT, DDD, DDE, malathion, propoxur, sumithion, 5-phenylrhodanine, 1,3,5-trichlorobenzene, 1-(2-phenoxybenzylhydrazine were detected and quantified. The levels of the selected residual hydrocarbons in water samples were used to calculate the retention efficiencies of a specific hydrocarbon and the values recorded. Generally, River Nyando wetland recorded mean percentage retention efficiencies of 76 and 94% for dry and rainy seasons respectively; Kigwal/Kimondi wetland had seasonal mean percentage retention efficiencies of 63 to 78%. River Nzoia also had calculated seasonal mean percentage retention efficiencies of between 56 to 88%. Dry season had lower mean percentages retention efficiencies as compared to rainy season in the three wetlands of interest during the period of study. The study

  7. Victoria Law School Ten Years On—A Time to Pause and Reflect

    OpenAIRE

    Andrew Clarke

    2013-01-01

    On 4 November 2010, a large and distinguished audience assembled at the Queen Street Campus of Victoria University to celebrate the tenth anniversary of the founding of Victoria Law School. This Foreword records the diverse achievements of Victoria Law School over the past decade.

  8. Victoria Law School Ten Years On—A Time to Pause and Reflect

    Directory of Open Access Journals (Sweden)

    Andrew Clarke

    2013-11-01

    Full Text Available On 4 November 2010, a large and distinguished audience assembled at the Queen Street Campus of Victoria University to celebrate the tenth anniversary of the founding of Victoria Law School. This Foreword records the diverse achievements of Victoria Law School over the past decade.

  9. EDRF supports Takakia Lake public inquiry

    International Nuclear Information System (INIS)

    Katzsch, K.

    1999-01-01

    The Queen Charlotte Power Corporation (QCPC) has applied for a water licence to drain Takakia Lake in British Columbia's Queen Charlotte Islands. Their plan is to build a tunnel into the side of the lake and draw water from it to supplement their power generating capabilities at their Moresby Lake hydro generating station. The BC Ministry of Environment, Lands and Parks called for a public inquiry into the application to address public concerns about the project. Through the Environmental Dispute Resolution Fund (EDRF), the North West Habitat Foundation (NWHF) was able to participate in this public inquiry which took place in June, 1999, and represent the environmental concerns of the community. Other participants included QCPC, BC Hydro, the Skidegate Band Council and the Haida Nation. One of the arguments raised was the lack of public disclosure and consultation, particularly regarding First Nations in the area. Takakia Lake area has been referred to as an ecological gem which hosts a unique ecosys tem and several rare plant species. The NWHF argued that the resulting draw-down of water from the lake would permanently damage the microclimate of the lake and would pose a major threat to the ecosystem. The Canadian Wildlife Service has also expressed concerns regarding the impacts on migratory birds. It was also noted that prior to their proposal, QCPC and BC Hydro did not fully consider the use of energy alternatives. As a result of this inquiry, QCPC has asked for more time to submit further documents regarding their proposal. In turn, the NWHF will be given a chance to respond to those materials and to submit their own additional information. 2 figs

  10. Pancam Peek into 'Victoria Crater' (Stereo)

    Science.gov (United States)

    2006-01-01

    [figure removed for brevity, see original site] Left-eye view of a stereo pair for PIA08776 [figure removed for brevity, see original site] Right-eye view of a stereo pair for PIA08776 A drive of about 60 meters (about 200 feet) on the 943rd Martian day, or sol, of Opportunity's exploration of Mars' Meridiani Planum region (Sept. 18, 2006) brought the NASA rover to within about 50 meters (about 160 feet) of the rim of 'Victoria Crater.' This crater has been the mission's long-term destination for the past 21 Earth months. Opportunity reached a location from which the cameras on top of the rover's mast could begin to see into the interior of Victoria. This stereo anaglyph was made from frames taken on sol 943 by the panoramic camera (Pancam) to offer a three-dimensional view when seen through red-blue glasses. It shows the upper portion of interior crater walls facing toward Opportunity from up to about 850 meters (half a mile) away. The amount of vertical relief visible at the top of the interior walls from this angle is about 15 meters (about 50 feet). The exposures were taken through a Pancam filter selecting wavelengths centered on 750 nanometers. Victoria Crater is about five times wider than 'Endurance Crater,' which Opportunity spent six months examining in 2004, and about 40 times wider than 'Eagle Crater,' where Opportunity first landed. The great lure of Victoria is the expectation that a thick stack of geological layers will be exposed in the crater walls, potentially several times the thickness that was previously studied at Endurance and therefore, potentially preserving several times the historical record.

  11. Funding Victoria's public hospitals: the casemix policy of 2000-2001.

    Science.gov (United States)

    McNair, Peter; Duckett, Stephen

    2002-01-01

    On 1 July 1993 Victoria became the first Australian state to use casemix information to set budgets for its public hospitals commencing with casemix funding for inpatient services. Victoria's casemix funding approach now embraces inpatient, outpatient and rehabilitation services.

  12. Focus on Form and Corrective Feedback Research at the University of Victoria, Canada

    Science.gov (United States)

    Chen, Sibo; Nassaji, Hossein

    2018-01-01

    The Department of Linguistics at University of Victoria (UVic) in Canada has a long-standing tradition of empirical approaches to the study of theoretical and applied linguistics. As part of the Faculty of Humanities, the department caters to students with a wide range of backgrounds and interests, and provides crucial language teaching support in…

  13. Regional groundwater-flow model of the Lake Michigan Basin in support of Great Lakes Basin water availability and use studies

    Science.gov (United States)

    Feinstein, D.T.; Hunt, R.J.; Reeves, H.W.

    2010-01-01

    A regional groundwater-flow model of the Lake Michigan Basin and surrounding areas has been developed in support of the Great Lakes Basin Pilot project under the U.S. Geological Survey's National Water Availability and Use Program. The transient 2-million-cell model incorporates multiple aquifers and pumping centers that create water-level drawdown that extends into deep saline waters. The 20-layer model simulates the exchange between a dense surface-water network and heterogeneous glacial deposits overlying stratified bedrock of the Wisconsin/Kankakee Arches and Michigan Basin in the Lower and Upper Peninsulas of Michigan; eastern Wisconsin; northern Indiana; and northeastern Illinois. The model is used to quantify changes in the groundwater system in response to pumping and variations in recharge from 1864 to 2005. Model results quantify the sources of water to major pumping centers, illustrate the dynamics of the groundwater system, and yield measures of water availability useful for water-resources management in the region. This report is a complete description of the methods and datasets used to develop the regional model, the underlying conceptual model, and model inputs, including specified values of material properties and the assignment of external and internal boundary conditions. The report also documents the application of the SEAWAT-2000 program for variable-density flow; it details the approach, advanced methods, and results associated with calibration through nonlinear regression using the PEST program; presents the water-level, drawdown, and groundwater flows for various geographic subregions and aquifer systems; and provides analyses of the effects of pumping from shallow and deep wells on sources of water to wells, the migration of groundwater divides, and direct and indirect groundwater discharge to Lake Michigan. The report considers the role of unconfined conditions at the regional scale as well as the influence of salinity on groundwater flow

  14. AcEST: DK961456 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 74EF isoform B OS... 32 4.1 sp|P35253|VGP_MABVM Envelope glycoprotein OS=Lake Victoria...S VT Sbjct: 62 SPVT 65 >sp|P35253|VGP_MABVM Envelope glycoprotein OS=Lake Victoria marburgvirus (strain Muso

  15. Victoria suudlus teeb maapoisist printsi, kuid mitte tulevase kuninga / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2010-01-01

    Printsess Victoria tulevasest abikaasast Daniel Westlingist, printsess Madelaine'i kihluse lõpetamisest, Bernadotte'ide dünastia asutajast Jean Bernadotte'ist. Monarhia toetajate vähenemisest Rootsis. Printsess Victoria ja Daniel Westlingi pulmatseremooniast 19. juunil

  16. Emergent Macrophytes Support Zooplankton in a Shallow Tropical Lake: A Basis for Wetland Conservation

    Science.gov (United States)

    Gebrehiwot, Mesfin; Kifle, Demeke; Triest, Ludwig

    2017-12-01

    Understanding the biodiversity value of littoral zones of lakes is a priority for aquatic biodiversity conservation. However, less emphasis has been given to the littoral part of tropical African lakes, with many of the previous researches focusing only on the open water side. The aim of the present study was, therefore, to investigate the impact of the littoral zone of a shallow freshwater tropical lake (Ziway, Ethiopia), dominated by two emergent macrophytes, on zooplankton community structure. We hypothesized that the wetland vegetation serves as a preferred microhabitat for zooplankton communities. A lake with substantial coverage of emergent macrophytes was monitored monthly from January to August, 2016. The monitoring included the measurements of physical, chemical, and biological parameters. Sampling sites were selected to represent areas of the macrophyte vegetation ( Typha latifolia and Phragmites australis) and the open water part of the lake. Sites with macrophyte vegetation were found to be the home of more dense and diverse zooplankton community. However, during the period of high vegetation loss, the density of crustacean zooplankton showed significant reduction within the patches of macrophytes. From biodiversity conservation perspective, it was concluded that the preservation of such small areas of macrophytes covering the littoral zone of lakes could be as important as protecting the whole lake. However, the rapid degradation of wetland vegetation by human activities is a real threat to the lake ecosystem. In the not-too-far future, it could displace and evict riparian vegetation and the biota it supports.

  17. Coal Corporation of Victoria annual report 1986

    Energy Technology Data Exchange (ETDEWEB)

    1986-01-01

    Information is presented on operations, strategic planning, brown coal production and finance. Divisional reports are presented for the following divisions of the Coal Corporation of Victoria: marketing, technical marketing and special projects, research and development, and corporate services. The activities of the technical marketing and special projects division are discussed under the following headings: the coal for industry programme, the Brown Coal Liquefaction (Victoria) Pty. Ltd. project, dried brown coal activities, and resource development planning and policy activities. The corporation is currently conducting research into the following areas: ion exchange materials, activated carbons, and horticultural and agricultural applications of brown coal.

  18. Late-life depression and the death of Queen Victoria.

    Science.gov (United States)

    Abrams, Robert C

    2010-12-01

    The objective of this study was to evaluate relationships between the death of Queen Victoria and the depressive episode she experienced during the last year of her life. The last volume of Queen Victoria's personal Journal was reviewed from a geriatrician's perspective, tracing the onset and course of depressive symptoms from entries beginning on 17 August 1900 and ending on 13 January 1901, 9 days before her death. The Queen's own words are supplemented with observations from contemporaneous secondary sources. The antecedents of Queen Victoria's late-life depression, including multiple losses, disabilities, and chronic pain, taken together with the presentation of vegetative, affective, and late cognitive symptoms, suggested the presence of a distinctively geriatric major depressive disorder. The absence of any other medical condition to explain the clinical picture seemed probable but not certain. Although historians and biographers have long been aware of Queen Victoria's final depression, the emphasis has mostly been on her earlier and prolonged mourning for her husband Prince Albert. Re-examined now, the Queen's Journal suggests that a severe late-life depressive episode occurring approximately in her last 5 months contributed meaningfully to her death. Copyright © 2010 John Wiley & Sons, Ltd.

  19. Prokaryotic Abundance and Activity in Permafrost of the Northern Victoria Land and Upper Victoria Valley (Antarctica).

    Science.gov (United States)

    La Ferla, Rosabruna; Azzaro, Maurizio; Michaud, Luigi; Caruso, Gabriella; Lo Giudice, Angelina; Paranhos, Rodolfo; Cabral, Anderson S; Conte, Antonella; Cosenza, Alessandro; Maimone, Giovanna; Papale, Maria; Rappazzo, Alessandro Ciro; Guglielmin, Mauro

    2017-08-01

    Victoria Land permafrost harbours a potentially large pool of cold-affected microorganisms whose metabolic potential still remains underestimated. Three cores (BC-1, BC-2 and BC-3) drilled at different depths in Boulder Clay (Northern Victoria Land) and one sample (DY) collected from a core in the Dry Valleys (Upper Victoria Valley) were analysed to assess the prokaryotic abundance, viability, physiological profiles and potential metabolic rates. The cores drilled at Boulder Clay were a template of different ecological conditions (different temperature regime, ice content, exchanges with atmosphere and with liquid water) in the same small basin while the Dry Valleys site was very similar to BC-2 conditions but with a complete different geological history and ground ice type. Image analysis was adopted to determine cell abundance, size and shape as well as to quantify the potential viable and respiring cells by live/dead and 5-cyano-2,3-ditolyl-tetrazolium chloride staining, respectively. Subpopulation recognition by apparent nucleic acid contents was obtained by flow cytometry. Moreover, the physiological profiles at community level by Biolog-Ecoplate™ as well as the ectoenzymatic potential rates on proteinaceous (leucine-aminopeptidase) and glucidic (ß-glucosidase) organic matter and on organic phosphates (alkaline-phosphatase) by fluorogenic substrates were tested. The adopted methodological approach gave useful information regarding viability and metabolic performances of microbial community in permafrost. The occurrence of a multifaceted prokaryotic community in the Victoria Land permafrost and a large number of potentially viable and respiring cells (in the order of 10 4 -10 5 ) were recognised. Subpopulations with a different apparent DNA content within the different samples were observed. The physiological profiles stressed various potential metabolic pathways among the samples and intense utilisation rates of polymeric carbon compounds and carbohydrates

  20. Chemistry models in the Victoria code

    International Nuclear Information System (INIS)

    Grimley, A.J. III

    1988-01-01

    The VICTORIA Computer code consists of the fission product release and chemistry models for the MELPROG severe accident analysis code. The chemistry models in VICTORIA are used to treat multi-phase interactions in four separate physical regions: fuel grains, gap/open porosity/clad, coolant/aerosols, and structure surfaces. The physical and chemical environment of each region is very different from the others and different models are required for each. The common thread in the modelling is the use of a chemical equilibrium assumption. The validity of this assumption along with a description of the various physical constraints applicable to each region will be discussed. The models that result from the assumptions and constraints will be presented along with samples of calculations in each region

  1. 3D DIGITAL CADASTRE JOURNEY IN VICTORIA, AUSTRALIA

    Directory of Open Access Journals (Sweden)

    D. Shojaei

    2017-10-01

    Full Text Available Land development processes today have an increasing demand to access three-dimensional (3D spatial information. Complex land development may need to have a 3D model and require some functions which are only possible using 3D data. Accordingly, the Intergovernmental Committee on Surveying and Mapping (ICSM, as a national body in Australia provides leadership, coordination and standards for surveying, mapping and national datasets has developed the Cadastre 2034 strategy in 2014. This strategy has a vision to develop a cadastral system that enables people to readily and confidently identify the location and extent of all rights, restrictions and responsibilities related to land and real property. In 2014, the land authority in the state of Victoria, Australia, namely Land Use Victoria (LUV, has entered the challenging area of designing and implementing a 3D digital cadastre focused on providing more efficient and effective services to the land and property industry. LUV has been following the ICSM 2034 strategy which requires developing various policies, standards, infrastructures, and tools. Over the past three years, LUV has mainly focused on investigating the technical aspect of a 3D digital cadastre. This paper provides an overview of the 3D digital cadastre investigation progress in Victoria and discusses the challenges that the team faced during this journey. It also addresses the future path to develop an integrated 3D digital cadastre in Victoria.

  2. Victoria Land, Ross Sea, and Ross Ice Shelf, Antarctica

    Science.gov (United States)

    2002-01-01

    On December 19, 2001, MODIS acquired data that produced this image of Antarctica's Victoria Land, Ross Ice Shelf, and the Ross Sea. The coastline that runs up and down along the left side of the image denotes where Victoria Land (left) meets the Ross Ice Shelf (right). The Ross Ice Shelf is the world's largest floating body of ice, approximately the same size as France. Credit: Jacques Descloitres, MODIS Land Rapid Response Team, NASA/GSFC

  3. Spiraal : uus Victoria & Alberti muuseum Londonis

    Index Scriptorium Estoniae

    1998-01-01

    Daniel Libeskindi projekt Victoria & Alberti Muuseumi laiendamiseks on põhjustanud konservatiivsete londonlaste pahameele, kuid kutsunud esile ka hulgaliselt toetusavaldusi. Muuseumi uus osa (kokkuvarisemise piiril näiva ehitisena) peaks külastajaile avatama 2004. a.

  4. Lake Afdera: a threatened saline lake in Ethiopia | Getahun | SINET ...

    African Journals Online (AJOL)

    Lake Afdera is a saline lake located in the Afar region, Northern Ethiopia. Because of its inaccessibility it is one of the least studied lakes of the country. It supports life including three species of fish of which two are endemic. Recently, reports are coming out that this lake is used for salt extraction. This paper gives some ...

  5. Lake Michigan lake trout PCB model forecast post audit

    Science.gov (United States)

    Scenario forecasts for total PCBs in Lake Michigan (LM) lake trout were conducted using the linked LM2-Toxics and LM Food Chain models, supported by a suite of additional LM models. Efforts were conducted under the Lake Michigan Mass Balance Study and the post audit represents th...

  6. Informal waste harvesting in Victoria Falls town, Zimbabwe: Socio-economic benefits

    NARCIS (Netherlands)

    Masocha, M.

    2006-01-01

    Waste harvesting, which occurs mostly but not exclusively at open waste dumps in Zimbabwe, constitutes one of the most important survival options for the urban poor. This paper analyses and discusses socio-economic benefits of informal waste harvesters in Victoria Falls town. Victoria Falls town has

  7. Neutron activation analysis on sediments from Victoria Land, Antarctica. Multi-elemental characterization of potential atmospheric dust sources

    International Nuclear Information System (INIS)

    Baccolo, G.; Maggi, V.; Baroni, C.; Clemenza, M.; Motta, A.; Nastasi, M.; Previtali, E.; University of Milano-Bicocca, Milan; Delmonte, B.; Salvatore, M.C.

    2014-01-01

    The elemental composition of 40 samples of mineral sediments collected in Victoria Land, Antarctica, in correspondence of ice-free sites, is presented. Concentration of 36 elements was determined by instrumental neutron activation analysis, INAA. The selection of 6 standard reference materials and the development of a specific analytical procedure allowed to reduce measurements uncertainties and to verify the reproducibility of the results. The decision to analyze sediment samples from Victoria Land ice-free areas is related to recent investigations regarding mineral dust content in the TALos Dome ICE core (159deg11'E; 72deg49'S, East Antarctica, Victoria Land), in which a coarse local fraction of dust was recognized. The characterization of Antarctic potential source areas of atmospheric mineral dust is the first step to identify the active sources of dust for the Talos Dome area and to reconstruct the atmospheric pathways followed by air masses in this region during different climatic periods. Principal components analysis was used to identify elements and samples correlations; attention was paid specially to rare earth elements (REE) and incompatible/compatible elements (ICE) in respect to iron, which proved to be the most discriminating elemental groups. The analysis of REE and ICE concentration profiles supported evidences of chemical weathering in ice-free areas of Victoria Land, whereas cold and dry climate conditions of the Talos Dome area and in general of East Antarctica. (author)

  8. Requirements for VICTORIA Class Fire Control System: Contact Management Function

    Science.gov (United States)

    2014-07-01

    Requirements for VICTORIA Class Fire Control System Contact Management Function Tab Lamoureux CAE Integrated Enterprise Solutions...Contract Report DRDC-RDDC-2014-C190 July 2014 © Her Majesty the Queen in Right of Canada, as represented by the...i Abstract …….. The VICTORIA Class Submarines (VCS) are subject to a continuing program of technical upgrades. One such program is

  9. Stratigraphic architecture of bedrock reference section, Victoria Crater, Meridiani Planum, Mars

    Science.gov (United States)

    Edgar, Lauren A.; Grotzinger, John P.; Hayes, Alex G.; Rubin, David M.; Squyres, Steve W.; Bell, James F.; Herkenhoff, Ken E.

    2012-01-01

    The Mars Exploration Rover Opportunity has investigated bedrock outcrops exposed in several craters at Meridiani Planum, Mars, in an effort to better understand the role of surface processes in its geologic history. Opportunity has recently completed its observations of Victoria crater, which is 750 m in diameter and exposes cliffs up to ~15 m high. The plains surrounding Victoria crater are ~10 m higher in elevation than those surrounding the previously explored Endurance crater, indicating that the Victoria crater exposes a stratigraphically higher section than does the Endurance crater; however, Victoria strata overlap in elevation with the rocks exposed at the Erebus crater. Victoria crater has a well-developed geomorphic pattern of promontories and embayments that define the crater wall and that reveal thick bedsets (3–7m) of large-scale cross-bedding, interpreted as fossil eolian dunes. Opportunity was able to drive into the crater at Duck Bay, located on the western margin of Victoria crater. Data from the Microscopic Imager and Panoramic Camera reveal details about the structures, textures, and depositional and diagenetic events that influenced the Victoria bedrock. A lithostratigraphic subdivision of bedrock units was enabled by the presence of a light-toned band that lines much of the upper rim of the crater. In ascending order, three stratigraphic units are named Lyell, Smith, and Steno; Smith is the light-toned band. In the Reference Section exposed along the ingress path at Duck Bay, Smith is interpreted to represent a zone of diagenetic recrystallization; however, its upper contact also coincides with a primary erosional surface. Elsewhere in the crater the diagenetic band crosscuts the physical stratigraphy. Correlation with strata present at nearby promontory Cape Verde indicates that there is an erosional surface at the base of the cliff face that corresponds to the erosional contact below Steno. The erosional contact at the base of Cape Verde

  10. Factors associated with dropout in a long term observational cohort of fishing communities around lake Victoria, Uganda.

    Science.gov (United States)

    Abaasa, Andrew; Asiki, Gershim; Mpendo, Juliet; Levin, Jonathan; Seeley, Janet; Nielsen, Leslie; Ssetaala, Ali; Nanvubya, Annet; De Bont, Jan; Kaleebu, Pontiano; Kamali, Anatoli

    2015-12-24

    Fishing communities are potentially suitable for Human immunodeficiency virus (HIV) efficacy trials due to their high risk profile. However, high mobility and attrition could decrease statistical power to detect the impact of a given intervention. We report dropout and associated factors in a fisher-folk observational cohort in Uganda. Human immunodeficiency virus-uninfected high-risk volunteers aged 13-49 years living in five fishing communities around Lake Victoria were enrolled and followed every 6 months for 18 months at clinics located within each community. Volunteers from two of the five communities had their follow-up periods extended to 30 months and were invited to attend clinics 10-40 km (km) away from their communities. Human immunodeficiency virus counseling and testing was provided, and data on sexual behaviour collected at all study visits. Study completion was defined as completion of 18 or 30 months or visits up to the date of sero-conversion and dropout as missing one or more visits. Discrete time survival models were fitted to find factors independently associated with dropout. A total of 1000 volunteers (55% men) were enrolled. Of these, 91.9% completed 6 months, 85.2% completed 12 months and 76.0% completed 18 months of follow-up. In the two communities with additional follow-up, 76.9% completed 30 months. In total 299 (29.9%) volunteers missed at least one visit (dropped out). Dropout was independently associated with age (volunteers aged 13-24 being most likely to dropout), gender [men being more likely to dropout than women [adjusted hazard ratio (aHR) 1.4; 95% confidence interval (CI) 1.1-1.8)], time spent in the fishing community (those who stayed dropout), History of marijuana use (users being more likely to dropout than non-users [1.7; (1.2-2.5)], ethnicity (non-Baganda being more likely to dropout than Baganda [1.5; (1.2-1.9)], dropout varied between the five fishing communities, having a new sexual partner in the previous 3 months [1

  11. State Electricity Commission of Victoria. Annual report 1984-1985

    Energy Technology Data Exchange (ETDEWEB)

    1985-01-01

    The State Electricity Commission of Victoria is a body corporate first constituted under the Electricity Commissioner's Act 1918. It now operates under the State Electricity Commission Act 1958. It generates, transmits and distributes electricity throughout Victoria's 228,000 square kilometres and supplies directly to 1.424 million customers. In addition 277,800 customers are supplied by eleven municipal authorities which purchase electricity in bulk from the Commission. The Commission also has a regulatory responsibility to ensure the safe use of electricity. It employs 22,518 people. The installed capacity of generators in the Commission's system, plus Victoria's share of Snowy and Hume generation, totalled 6603 MW at 30 June 1985 and the main transmission system comprises 500 kV, 300 kV and 220 kV lines. Corporate objectives have been developed in seven broad areas: customers,employee, finance, ntural resources, environment, conservationand community. These areas of activity are detailed in this report.

  12. Lake on life support: Evaluating urban lake management measures by using a coupled 1D-modelling approach

    Science.gov (United States)

    Ladwig, Robert; Kirillin, Georgiy; Hinkelmann, Reinhard; Hupfer, Michael

    2017-04-01

    Urban surface water systems and especially lakes are heavily stressed and modified systems to comply with water management goals and expectations. In this study we focus on Lake Tegel in Berlin, Germany, as a representative of heavily modified urban lakes. In the 20th century, Lake Tegel received increased loadings of nutrients and leached heavy metals from an upstream sewage farm resulting in severe eutrophication problems. The construction of two upstream treatment plants caused a lowering of nutrient concentrations and a re-oligotrophication of the lake. Additionally, artificial aerators, to keep the hypolimnion oxic, and a lake pipeline, to bypass water for maintaining a minimum discharge, went into operation. Lake Tegel is still heavily used for drinking water extraction by bank filtration. These interacting management measures make the system vulnerable to changing climate conditions and pollutant loads. Past modelling studies have shown the complex hydrodynamics of the lake. Here, we are following a simplified approach by using a less computational time consuming vertical 1D-model to simulate the hydrodynamics and the ecological interactions of the system by coupling the General Lake Model to the Aquatic Ecodynamics Model Library 2. For calibration of the multidimensional parameter space we applied the Covariance Matrix Adaption-Evolution Strategy algorithm. The model is able to sufficiently replicate the vertical field temperature profiles of Lake Tegel as well as to simulate similar concentration ranges of phosphate, dissolved oxygen and nitrate. The calibrated model is used to run an uncertainty analysis by sampling the simulated data within the meaning of the Metropolis-Hastings algorithm. Finally, we are evaluating different scenarios: (1) changing air temperatures, precipitation and wind speed due to effects of climate change, (2) decreased discharges into the lake due to bypassing treated effluents into a near stream instead of Lake Tegel, and (3

  13. vVICTORIA Console Development: Design and Fabrication of VICTORIA Console Emulations

    Science.gov (United States)

    2011-07-01

    successful set-up and readiness to conduct experimentation on facets of new Combat System concept development including equipment capabilities, system...émulateurs, faits de bois, de plastiques et de métaux légers, ont été fabriqués selon les données matérielles et les spécifications des consoles actuelles...mise sur pied du laboratoire d’évaluation de la capacité vVictoria et assureront que celui-ci est prêt pour les essais de nouveaux concepts de système

  14. Reforming Victoria's primary health and community service sector: rural implications.

    Science.gov (United States)

    Alford, K

    2000-01-01

    In 1999 the Victorian primary care and community support system began a process of substantial reform, involving purchasing reforms and a contested selection process between providers in large catchment areas across the State. The Liberal Government's electoral defeat in September 1999 led to a review of these reforms. This paper questions the reforms from a rural perspective. They were based on a generic template that did not consider rural-urban differences in health needs or other differences including socio-economic status, and may have reinforced if not aggravated rural-urban differences in the quality of and access to primary health care in Victoria.

  15. A Wireless Sensor Network-Based Approach with Decision Support for Monitoring Lake Water Quality.

    Science.gov (United States)

    Huang, Xiaoci; Yi, Jianjun; Chen, Shaoli; Zhu, Xiaomin

    2015-11-19

    Online monitoring and water quality analysis of lakes are urgently needed. A feasible and effective approach is to use a Wireless Sensor Network (WSN). Lake water environments, like other real world environments, present many changing and unpredictable situations. To ensure flexibility in such an environment, the WSN node has to be prepared to deal with varying situations. This paper presents a WSN self-configuration approach for lake water quality monitoring. The approach is based on the integration of a semantic framework, where a reasoner can make decisions on the configuration of WSN services. We present a WSN ontology and the relevant water quality monitoring context information, which considers its suitability in a pervasive computing environment. We also propose a rule-based reasoning engine that is used to conduct decision support through reasoning techniques and context-awareness. To evaluate the approach, we conduct usability experiments and performance benchmarks.

  16. Similar levels of diversity and population Structure in superflock and ...

    African Journals Online (AJOL)

    superflock cichlid fishes from Lake Victoria, Africa. ... Tropical Freshwater Biology ... We use DNA microsatellite loci to estimate neutral genetic diversity and the level of gene flow among populations of two cichlid species from southern Lake Victoria, ...

  17. Lake Michigan lake trout PCB model forecast post audit (oral presentation)

    Science.gov (United States)

    Scenario forecasts for total PCBs in Lake Michigan (LM) lake trout were conducted using the linked LM2-Toxics and LM Food Chain models, supported by a suite of additional LM models. Efforts were conducted under the Lake Michigan Mass Balance Study and the post audit represents an...

  18. Mathematical Problems in Biology : Victoria Conference

    CERN Document Server

    1974-01-01

    A conference on "Some Mathematical Problems in Biology" was held at the University of Victoria, Victoria, B. C. , Canada, from May 7 - 10, 1973. The participants and invited speakers were mathematicians interested in problems of a biological nature, and scientists actively engaged in developing mathematical models in biological fields. One aim of the conference was to attempt to assess what the recent rapid growth of mathematical interaction with the biosciences has accomplished and may accomplish in the near future. The conference also aimed to expose the problems of communication bet~",een mathematicians and biological scientists, and in doing so to stimulate the interchange of ideas. It was recognised that the topic spans an enormous breadth, and little attempt was made to balance the very diverse areas. Widespread active interest was shown in the conference, and just over one hundred people registered. The varied departments and institutions across North America from which the participants came made it bo...

  19. Little evidence for morphological change in a resilient endemic species following the introduction of a novel predator.

    Science.gov (United States)

    Sharpe, D M T; Langerhans, R B; Low-Décarie, E; Chapman, L J

    2015-11-01

    Human activities, such as species introductions, are dramatically and rapidly altering natural ecological processes and often result in novel selection regimes. To date, we still have a limited understanding of the extent to which such anthropogenic selection may be driving contemporary phenotypic change in natural populations. Here, we test whether the introduction of the piscivorous Nile perch, Lates niloticus, into East Africa's Lake Victoria and nearby lakes coincided with morphological change in one resilient native prey species, the cyprinid fish Rastrineobola argentea. Drawing on prior ecomorphological research, we predicted that this novel predator would select for increased allocation to the caudal region in R. argentea to enhance burst-swimming performance and hence escape ability. To test this prediction, we compared body morphology of R. argentea across space (nine Ugandan lakes differing in Nile perch invasion history) and through time (before and after establishment of Nile perch in Lake Victoria). Spatial comparisons of contemporary populations only partially supported our predictions, with R. argentea from some invaded lakes having larger caudal regions and smaller heads compared to R. argentea from uninvaded lakes. There was no clear evidence of predator-associated change in body shape over time in Lake Victoria. We conclude that R. argentea have not responded to the presence of Nile perch with consistent morphological changes and that other factors are driving observed patterns of body shape variation in R. argentea. © 2015 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2015 European Society For Evolutionary Biology.

  20. No fixed place of birth: unplanned BBAs in Victoria, Australia.

    Science.gov (United States)

    McLelland, Gayle; McKenna, Lisa; Archer, Frank

    2013-02-01

    the primary objective-to present data on the incidence of unplanned births before arrival (BBAs) in Victoria between 1991 and 2008. The secondary objective-to provide an extensive literature review highlighting the issues surrounding an unplanned BBA. the incidence of BBAs in Victoria published in the relevant government reports. data were extracted from published government reports pertaining to perinatal statistics in Victoria-The Australian Institute of Health and Wellbeing and the Perinatal Data Collection Unit of Victoria. Data on place of birth for each year from both sources was identified and tabulated. Comparisons between the data sources were undertaken to provide a picture of the scope of out of hospital birth. the incidence and absolute numbers of unplanned birth before arrival (BBA) to hospital in Victoria, are low compared to the total births. However, this number is comparable to unplanned BBAs in other developed countries with similar health systems. The incidence of unplanned BBAs has slowly but steadily doubled since 1991-2008. The two data sources almost mirror each other except for 1999 when there was an unexplained difference in the reported incidence in unplanned BBAs. Maternal and neonatal outcomes are disproportionally much poorer after unplanned BBAs than either planned home births or in hospital births. Various maternal factors can increase the risk of an unplanned BBA. multiple approaches should be adopted to manage unplanned BBAs. Antenatal screening should be undertaken to identify the women most at risk. Strategies can be developed that will reduce poor neonatal and maternal outcomes, including education for women and their partners on immediate management of the newborn; ensuring paramedics have current knowledge on care during childbirth; and maternity and ambulance services should develop management plans for care of women having unplanned BBAs. Copyright © 2011 Elsevier Ltd. All rights reserved.

  1. State Electricity Commission of Victoria annual report 1983-1984

    Energy Technology Data Exchange (ETDEWEB)

    1984-01-01

    The State Electricity Commission of Victoria (SECV) generates, transmits and distributes electricity throughout Victoria's 228,000 square kilometres and supplies directly to 1.390 million customers. In addition, 278,500 customers are supplied by eleven municipal authorities which purchase electricity in bulk from the Commission. The Commission also has a responsibility to ensure the safe use of electricity. The Commission's mission statement is 'to provide cost effective energy and services and to act at all times in the best interests of the people of Victoria by being a responsible, adaptive, financially sound and efficient public utility'. The mission statement is the foundation for all activities and should provide the Commission with a sense of direction and unity of purpose. Corporate objectives have been developed in the following seven broad areas: customer, employee, finance, natural resources, environment, conservation and community. Each objective has been translated into a series of specific goals, the achievement of which will be monitored. Details relating to these areas of activity are detailed in this report.

  2. Comparison of mortality following hospitalisation for isolated head injury in England and Wales, and Victoria, Australia.

    Directory of Open Access Journals (Sweden)

    Belinda J Gabbe

    Full Text Available BACKGROUND: Traumatic brain injury (TBI remains a leading cause of death and disability. The National Institute for Health and Clinical Excellence (NICE guidelines recommend transfer of severe TBI cases to neurosurgical centres, irrespective of the need for neurosurgery. This observational study investigated the risk-adjusted mortality of isolated TBI admissions in England/Wales, and Victoria, Australia, and the impact of neurosurgical centre management on outcomes. METHODS: Isolated TBI admissions (>15 years, July 2005-June 2006 were extracted from the hospital discharge datasets for both jurisdictions. Severe isolated TBI (AIS severity >3 admissions were provided by the Trauma Audit and Research Network (TARN and Victorian State Trauma Registry (VSTR for England/Wales, and Victoria, respectively. Multivariable logistic regression was used to compare risk-adjusted mortality between jurisdictions. FINDINGS: Mortality was 12% (749/6256 in England/Wales and 9% (91/1048 in Victoria for isolated TBI admissions. Adjusted odds of death in England/Wales were higher compared to Victoria overall (OR 2.0, 95% CI: 1.6, 2.5, and for cases <65 years (OR 2.36, 95% CI: 1.51, 3.69. For severe TBI, mortality was 23% (133/575 for TARN and 20% (68/346 for VSTR, with 72% of TARN and 86% of VSTR cases managed at a neurosurgical centre. The adjusted mortality odds for severe TBI cases in TARN were higher compared to the VSTR (OR 1.45, 95% CI: 0.96, 2.19, but particularly for cases <65 years (OR 2.04, 95% CI: 1.07, 3.90. Neurosurgical centre management modified the effect overall (OR 1.12, 95% CI: 0.73, 1.74 and for cases <65 years (OR 1.53, 95% CI: 0.77, 3.03. CONCLUSION: The risk-adjusted odds of mortality for all isolated TBI admissions, and severe TBI cases, were higher in England/Wales when compared to Victoria. The lower percentage of cases managed at neurosurgical centres in England and Wales was an explanatory factor, supporting the changes made to the NICE

  3. AcEST: BP918808 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ge structural protein OS=Lake Victoria marb... 30 6.5 sp|P14745|CD44_PAPHA CD44 antigen OS=Papio hamadryas G...5262|L_MABVP Large structural protein OS=Lake Victoria marburgvirus (strain Popp-

  4. Las pinturas esquemáticas de la Cueva de Victoria (Rincón de la Victoria, Málaga : propuesta interpretativa del friso A

    Directory of Open Access Journals (Sweden)

    Rafael Maura Mijares

    2004-01-01

    Full Text Available Se recoge en este artículo nuestra reciente revisión del conjunto pictórico postpaleolítico de la cueva de la Victoria. A partir de una documentación exhaustiva de los motivos representados y del análisis de su iconografía se proponen hipótesis de carácter interpretativo.In this article we gather the recent revision of the postpalaeolithic pictorial collection in the cave of la Victoria. Starting from an exhaustive documentation of the motifs and the analysis of its iconography, we propose some interpretative hypothesis.

  5. Seabed surveys of Victoria harbour, Mahe, Seychelles

    Digital Repository Service at National Institute of Oceanography (India)

    Hashimi, N.H.; Wagle, B.G.

    The seabed surveys in the Victoria Harbour, Mahe, Seychelles shows that the prominent feature is the navigational channel aligned in the northeast-southwest direction with a width varying from 300 to 450m. The depth in the channel ranges from 14...

  6. Bentho-pelagic divergence of cichlid feeding architecture was prodigious and consistent during multiple adaptive radiations within African rift-lakes.

    Directory of Open Access Journals (Sweden)

    W James Cooper

    2010-03-01

    Full Text Available How particular changes in functional morphology can repeatedly promote ecological diversification is an active area of evolutionary investigation. The African rift-lake cichlids offer a calibrated time series of the most dramatic adaptive radiations of vertebrate trophic morphology yet described, and the replicate nature of these events provides a unique opportunity to test whether common changes in functional morphology have repeatedly facilitated their ecological success.Specimens from 87 genera of cichlid fishes endemic to Lakes Tanganyka, Malawi and Victoria were dissected in order to examine the functional morphology of cichlid feeding. We quantified shape using geometric morphometrics and compared patterns of morphological diversity using a series of analytical tests. The primary axes of divergence were conserved among all three radiations, and the most prevalent changes involved the size of the preorbital region of the skull. Even the fishes from the youngest of these lakes (Victoria, which exhibit the lowest amount of skull shape disparity, have undergone extensive preorbital evolution relative to other craniofacial traits. Such changes have large effects on feeding biomechanics, and can promote expansion into a wide array of niches along a bentho-pelagic ecomorphological axis.Here we show that specific changes in trophic anatomy have evolved repeatedly in the African rift lakes, and our results suggest that simple morphological alterations that have large ecological consequences are likely to constitute critical components of adaptive radiations in functional morphology. Such shifts may precede more complex shape changes as lineages diversify into unoccupied niches. The data presented here, combined with observations of other fish lineages, suggest that the preorbital region represents an evolutionary module that can respond quickly to natural selection when fishes colonize new lakes. Characterizing the changes in cichlid trophic

  7. Great Lakes Literacy Principles

    Science.gov (United States)

    Fortner, Rosanne W.; Manzo, Lyndsey

    2011-03-01

    Lakes Superior, Huron, Michigan, Ontario, and Erie together form North America's Great Lakes, a region that contains 20% of the world's fresh surface water and is home to roughly one quarter of the U.S. population (Figure 1). Supporting a $4 billion sport fishing industry, plus $16 billion annually in boating, 1.5 million U.S. jobs, and $62 billion in annual wages directly, the Great Lakes form the backbone of a regional economy that is vital to the United States as a whole (see http://www.miseagrant.umich.edu/downloads/economy/11-708-Great-Lakes-Jobs.pdf). Yet the grandeur and importance of this freshwater resource are little understood, not only by people in the rest of the country but also by many in the region itself. To help address this lack of knowledge, the Centers for Ocean Sciences Education Excellence (COSEE) Great Lakes, supported by the U.S. National Science Foundation and the National Oceanic and Atmospheric Administration, developed literacy principles for the Great Lakes to serve as a guide for education of students and the public. These “Great Lakes Literacy Principles” represent an understanding of the Great Lakes' influences on society and society's influences on the Great Lakes.

  8. Excess unsupported sup(210)Pb in lake sediment from Rocky Mountain lakes

    International Nuclear Information System (INIS)

    Norton, S.A.; Hess, C.T.; Blake, G.M.; Morrison, M.L.; Baron, J.

    1985-01-01

    Sediment cores from four high-altitude (approximately 3200 m) lakes in Rocky Mountain National Park, Colorado, were dated by sup(210)Pb chronology. Background (supported) sup(210)Pb activities for the four cores range from 0.26 to 0.93 Beq/g dry weight, high for typical oligotrophic lakes. Integrated unsupported sup(210)Pb ranges from 0.81 (a typical value for most lakes) to 11.0 Beq/cmsup(2). The sup(210)Pb activity in the surface sediments ranges from 1.48 to 22.2 Beq/g dry weight. Sedimentation from Lake Louise, the most unusual of the four, has 22.2 Beq/g dry weight at the sediment surface, an integrated unsupported sup(210)Pb=11.0 Beq/cmsup(2), and supported sup(210)Pb=0.74 Beq/g dry weight. sup(226)Ra content of the sediment is insufficient to explain either the high unsupported sup(210)Pb or the sup(222)Rn content of the water column of Lake Louise, which averaged 96.2 Beq/L. We concluded that sup(222)Rn-rich groundwater entering the lake is the source of the high sup(222)Rn in the water column. This, in turn, is capable of supporting the unusually high sup(210)Pb flux to the sediment surface. Groundwater with high sup(222)Rn may control the sup(210)Pb budget of lakes where sediment cores have integrated unsupported sup(210)Pb greater than 2 Beq/cmsup(2)

  9. Dicty_cDB: Contig-U14564-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |pid:none) Pseudomonas fluorescens SBW25 c... 32 9.8 DQ447651_7( DQ447651 |pid:none) Lake Victoria marburgv...uschii clone CDS3047 al... 32 9.8 DQ447650_7( DQ447650 |pid:none) Lake Victoria marburgvirus - DRC19... 32 9

  10. The table grape 'Victoria' with a long shaped berry: a potential mutation with attractive characteristics for consumers.

    Science.gov (United States)

    Ferrara, Giuseppe; Gallotta, Alessandra; Pacucci, Carmela; Matarrese, Angela Maria Stella; Mazzeo, Andrea; Giancaspro, Angelica; Gadaleta, Agata; Piazzolla, Francesca; Colelli, Giancarlo

    2017-12-01

    Puglia is the most important region in Italy for table grape production. Since consumers look for new products, the number of table grape varieties has greatly increased in recent years. In a survey in the Puglia region, we identified several years ago a potential mutation of the cv. Victoria. We described this accession in comparison with the standard Victoria for some amphelographic traits. All the characteristics were very similar to the standard Victoria except for the berry shape, which was significantly more elongated. Moreover, the berry of the mutated Victoria showed higher firmness, lightness and chroma than the standard one, with a more intense yellow colour of the skin (appreciated by consumers). The molecular characterisation with 25 SSR markers showed that normal and mutant Victoria were genetically identical at all the analysed loci, thus suggesting that the two accessions could be considered as clones with the difference in berry shape probably due to a somatic mutation. This mutation of the cv. Victoria may have interesting perspective for the market since consumers are always attracted by different shape and colour of the fruits (consumers buy with eyes). This accession can be an alternative clone of the already known standard Victoria. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  11. A once in a generation upgrade to ICT systems used for public transport in Victoria; Umfassende Modernisierung. Neue ICT-Systeme fuer den SPNV in Victoria

    Energy Technology Data Exchange (ETDEWEB)

    Hammerton, Richard [Funkwerk Information Technologies York Ltd., York (United Kingdom)

    2010-07-01

    Funkwerk IT is supplying a state-of-the-art timetable and fleet planning and management system to the Australian State of Victoria. Through its agency, the Department of Transport, Victoria is undertaking a once in a generation upgrade to key ICT systems that are used for operational control of the metropolitan and regional rail networks. The new system requires a tight coupling of both planning and real-time management systems. Using its products TrainPlan, ResourcePlan and ResourceManager Funkwerk IT provides an ideal platform to cover these requirements. (orig.)

  12. Eesti NATO Ühing juurutab demokraatlikke väärtusi / Victoria Punga ; interv. Aive Antsov

    Index Scriptorium Estoniae

    Punga, Victoria, 1977-

    2007-01-01

    Eesti NATO Ühingu tegevjuht organisatsiooni eesmärkidest, projektidest, koostööst teiste riikidega ning kaitsepoliitika ja majanduse seostest. Lisa: Väljavõte Victoria CVst; Eesti kaitsepoliitika viis plussi Victoria meelest

  13. Simbi Nyaima: An Interplay of Nature and Mythology in the Lake Victoria Region; Planning and Management for Ecotourism Transformation in Kenya

    Directory of Open Access Journals (Sweden)

    Fredrick Argwenge Odede

    2014-01-01

    Full Text Available Many countries in the world exploit cultural heritage to reduce poverty, enhance livelihood and transform of the community and support local livelihood. This paper focuses of ecotourism transformation, namely, nature (Simbi as unique Crater Lake and the mythology associated with the lake depicting the curse of a village of a strange old woman by the name Simbi. These two constellations have been used to preserve the site and needs to be used in the planning, conservation and management of this unique heritage. Stakeholder participation should use the two concepts in planning and conservation. The study aimed at mapping the site, examining its cultural identity, assessing the values and potential of the site, identifying the challenges facing the site and developing appropriate strategies for ecotourism promotion. The study used ethnographic and phenomenological modes of data collection using purposive sampling method. The data was qualitatively analysed and yielded themes with respect to research objectives. The documented the location, nature and mythology of the site as planning, conservation and branding tools, established the level of community participation in its planning, conservation and branding, identified its potential and challenges for ecotourism promotion, and proposed appropriate strategies for planning management and conservation of Simbi Nyaima for upscaling ecotourism in the study area.

  14. A critical review of the development, current hotspots, and future directions of Lake Taihu research from the bibliometrics perspective.

    Science.gov (United States)

    Zhang, Yunlin; Yao, Xiaolong; Qin, Boqiang

    2016-07-01

    Lake Taihu, as the important drinking water source of the Yangtze River Delta urban agglomeration and the third largest freshwater lake in China, has experienced serious lake eutrophication and water quality deterioration in the past three decades. Growing scientific, political, and public attention has been given to the water quality of Lake Taihu. This study aimed to conduct a comparative quantitative and qualitative analysis of the development, current hotspots, and future directions of Lake Taihu research using a bibliometric analysis of eight well-studied lakes (Lake Taihu, Lake Baikal, Lake Biwa, Lake Erie, Lake Michigan, Lake Ontario, Lake Superior and Lake Victoria) around the world based on the Science Citation Index (SCI) database. A total of 1582 papers discussing Lake Taihu research were published in 322 journals in the past three decades. However, the first paper about Lake Taihu research was not found in the SCI database until 1989, and there were only zero, one, or two papers each year from 1989 to 1995. There had been rapid development in Lake Taihu research since 1996 and a sharp increase in papers since 2005. A keyword analysis showed that "sediment," "eutrophication", "Microcystis aeruginosa", "cyanobacterial blooms", and "remote sensing" were the most frequently used keywords of the study subject. Owing to its significant impact on aquatic ecosystems, a crucial emphasis has been placed on climate change recently. In addition, the future focuses of research directions, including (1) environmental effects of physical processes; (2) nutrient cycles and control and ecosystem responses; (3) cyanobacteria bloom monitoring, causes, forecast and management; (4) eutrophication and climate change interactions; and (5) ecosystem degradation mechanism and ecological practice of lake restoration, are presented based on the keyword analysis. Through multidisciplinary fields (physics, chemistry, and biology) cross and synthesis study of Lake Taihu, the

  15. Understanding virtual water flows: A multiregion input-output case study of Victoria

    Science.gov (United States)

    Lenzen, Manfred

    2009-09-01

    This article explains and interprets virtual water flows from the well-established perspective of input-output analysis. Using a case study of the Australian state of Victoria, it demonstrates that input-output analysis can enumerate virtual water flows without systematic and unknown truncation errors, an issue which has been largely absent from the virtual water literature. Whereas a simplified flow analysis from a producer perspective would portray Victoria as a net virtual water importer, enumerating the water embodiments across the full supply chain using input-output analysis shows Victoria as a significant net virtual water exporter. This study has succeeded in informing government policy in Australia, which is an encouraging sign that input-output analysis will be able to contribute much value to other national and international applications.

  16. Formula-Based Public School Funding System in Victoria: An Empirical Analysis of Equity

    Science.gov (United States)

    Bandaranayake, Bandara

    2013-01-01

    This article explores the formula-based school funding system in the state of Victoria, Australia, where state funds are directly allocated to schools based on a range of equity measures. The impact of Victoria' funding system for education in terms of alleviating inequality and disadvantage is contentious, to say the least. It is difficult to…

  17. Microbiology of Lonar Lake and other soda lakes

    Science.gov (United States)

    Paul Antony, Chakkiath; Kumaresan, Deepak; Hunger, Sindy; Drake, Harold L; Murrell, J Colin; Shouche, Yogesh S

    2013-01-01

    Soda lakes are saline and alkaline ecosystems that are believed to have existed throughout the geological record of Earth. They are widely distributed across the globe, but are highly abundant in terrestrial biomes such as deserts and steppes and in geologically interesting regions such as the East African Rift valley. The unusual geochemistry of these lakes supports the growth of an impressive array of microorganisms that are of ecological and economic importance. Haloalkaliphilic Bacteria and Archaea belonging to all major trophic groups have been described from many soda lakes, including lakes with exceptionally high levels of heavy metals. Lonar Lake is a soda lake that is centered at an unusual meteorite impact structure in the Deccan basalts in India and its key physicochemical and microbiological characteristics are highlighted in this article. The occurrence of diverse functional groups of microbes, such as methanogens, methanotrophs, phototrophs, denitrifiers, sulfur oxidizers, sulfate reducers and syntrophs in soda lakes, suggests that these habitats harbor complex microbial food webs that (a) interconnect various biological cycles via redox coupling and (b) impact on the production and consumption of greenhouse gases. Soda lake microorganisms harbor several biotechnologically relevant enzymes and biomolecules (for example, cellulases, amylases, ectoine) and there is the need to augment bioprospecting efforts in soda lake environments with new integrated approaches. Importantly, some saline and alkaline lake ecosystems around the world need to be protected from anthropogenic pressures that threaten their long-term existence. PMID:23178675

  18. Probabilistic Seismic Hazard Analysis of Victoria, British Columbia, Canada: Considering an Active Leech River Fault

    Science.gov (United States)

    Kukovica, J.; Molnar, S.; Ghofrani, H.

    2017-12-01

    The Leech River fault is situated on Vancouver Island near the city of Victoria, British Columbia, Canada. The 60km transpressional reverse fault zone runs east to west along the southern tip of Vancouver Island, dividing the lithologic units of Jurassic-Cretaceous Leech River Complex schists to the north and Eocene Metchosin Formation basalts to the south. This fault system poses a considerable hazard due to its proximity to Victoria and 3 major hydroelectric dams. The Canadian seismic hazard model for the 2015 National Building Code of Canada (NBCC) considered the fault system to be inactive. However, recent paleoseismic evidence suggests there to be at least 2 surface-rupturing events to have exceeded a moment magnitude (M) of 6.5 within the last 15,000 years (Morell et al. 2017). We perform a Probabilistic Seismic Hazard Analysis (PSHA) for the city of Victoria with consideration of the Leech River fault as an active source. A PSHA for Victoria which replicates the 2015 NBCC estimates is accomplished to calibrate our PSHA procedure. The same seismic source zones, magnitude recurrence parameters, and Ground Motion Prediction Equations (GMPEs) are used. We replicate the uniform hazard spectrum for a probability of exceedance of 2% in 50 years for a 500 km radial area around Victoria. An active Leech River fault zone is then added; known length and dip. We are determining magnitude recurrence parameters based on a Gutenberg-Richter relationship for the Leech River fault from various catalogues of the recorded seismicity (M 2-3) within the fault's vicinity and the proposed paleoseismic events. We seek to understand whether inclusion of an active Leech River fault source will significantly increase the probabilistic seismic hazard for Victoria. Morell et al. 2017. Quaternary rupture of a crustal fault beneath Victoria, British Columbia, Canada. GSA Today, 27, doi: 10.1130/GSATG291A.1

  19. Lake whitefish diet, condition, and energy density in Lake Champlain and the lower four Great Lakes following dreissenid invasions

    Science.gov (United States)

    Herbst, Seth J.; Marsden, J. Ellen; Lantry, Brian F.

    2013-01-01

    Lake Whitefish Coregonus clupeaformis support some of the most valuable commercial freshwater fisheries in North America. Recent growth and condition decreases in Lake Whitefish populations in the Great Lakes have been attributed to the invasion of the dreissenid mussels, zebra mussels Dreissena polymorpha and quagga mussels D. bugensis, and the subsequent collapse of the amphipod, Diporeia, a once-abundant high energy prey source. Since 1993, Lake Champlain has also experienced the invasion and proliferation of zebra mussels, but in contrast to the Great Lakes, Diporeia were not historically abundant. We compared the diet, condition, and energy density of Lake Whitefish from Lake Champlain after the dreissenid mussel invasion to values for those of Lake Whitefish from Lakes Michigan, Huron, Erie, and Ontario. Lake Whitefish were collected using gill nets and bottom trawls, and their diets were quantified seasonally. Condition was estimated using Fulton's condition factor (K) and by determining energy density. In contrast to Lake Whitefish from some of the Great Lakes, those from Lake Champlain Lake Whitefish did not show a dietary shift towards dreissenid mussels, but instead fed primarily on fish eggs in spring, Mysis diluviana in summer, and gastropods and sphaeriids in fall and winter. Along with these dietary differences, the condition and energy density of Lake Whitefish from Lake Champlain were high compared with those of Lake Whitefish from Lakes Michigan, Huron, and Ontario after the dreissenid invasion, and were similar to Lake Whitefish from Lake Erie; fish from Lakes Michigan, Huron, and Ontario consumed dreissenids, whereas fish from Lake Erie did not. Our comparisons of Lake Whitefish populations in Lake Champlain to those in the Great Lakes indicate that diet and condition of Lake Champlain Lake Whitefish were not negatively affected by the dreissenid mussel invasion.

  20. AcEST: DK947961 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ABVR Minor nucleoprotein VP30 OS=Lake Victoria m... 30 9.1 sp|A1AYS1|SELA_PARDP L...E 586 G H+ +G L +P M++ Sbjct: 498 GEVHHC-KGELARALPMMQQ 516 >sp|Q1PDC6|VP30_MABVR Minor nucleoprotein VP30 OS=Lake Victoria

  1. Mercury biomagnification in the food web of Lake Tanganyika (Tanzania, East Africa)

    Energy Technology Data Exchange (ETDEWEB)

    Campbell, L. [School of Environmental Studies and Department of Biology, Queen' s University, Kingston, Ontario, K7L-3N6 (Canada)], E-mail: linda.campbell@queensu.ca; Verburg, Piet [National Institute of Water and Atmospheric Research, PO Box 11-115, Hamilton 3251 (New Zealand); Dixon, D.G. [Department of Biology, University of Waterloo, 200 University Avenue, Waterloo (Canada); Hecky, R.E. [Large Lakes Observatory, University of Minnesota, Duluth, 10 University Drive 204 RLBDuluth, MN 55812-2496 (United States)

    2008-09-01

    Lake Tanganyika is a globally important lake with high endemic biodiversity. Millions of people in the lake basin depend on several fish species for consumption. Due to the importance of fish consumption as an exposure route of mercury to humans, we sampled Lake Tanganyika in 2000 to assess total mercury concentrations and biomagnification of total mercury through the food web. Stable nitrogen and carbon isotope analyses of food web structure indicate a complex food web with overlapping omnivory with some specialist fish species. Stable nitrogen isotope analyses further confirm that mercury is biomagnifying through the Tanganyika food web at rates similar to those seen in Lakes Malawi and Victoria, the other two African Great Lakes. Most collected fish species and all invertebrate species had mercury concentrations below 0.2 {mu}g Hg/g wet weight. However, several fish species, Ctenochromis horei (average 0.15 {mu}g/g ww), Neolamprologus boulengeri (0.2 {mu}g/g ww) , Bathybates spp.spp. (0.21 {mu}g/g ww), Mastacembelus cunningtoni (0.22 {mu}g/g ww) and Clarias theodorae (0.22 {mu}g/g ww) approached or slightly exceeded the World Health Organization (WHO)'s recommended guideline of 0.2 {mu}g Hg/g for vulnerable populations with high rates of fish consumption. Two individuals of the piscivorous fish species Lates microlepis (0.54, 0.78 {mu}g/g ww) and a Polypterus congicus (1.3 {mu}g/g ww) exceeded the international marketing limit value of 0.5 {mu}g/g ww. Because C. theodorae and L. microlepis are also important market fish species, there is a need to monitor mercury concentrations in internationally marketed fish from Lake Tanganikya to ensure that those fish do not present a risk to human consumers.

  2. Mercury biomagnification in the food web of Lake Tanganyika (Tanzania, East Africa)

    International Nuclear Information System (INIS)

    Campbell, L.; Verburg, Piet; Dixon, D.G.; Hecky, R.E.

    2008-01-01

    Lake Tanganyika is a globally important lake with high endemic biodiversity. Millions of people in the lake basin depend on several fish species for consumption. Due to the importance of fish consumption as an exposure route of mercury to humans, we sampled Lake Tanganyika in 2000 to assess total mercury concentrations and biomagnification of total mercury through the food web. Stable nitrogen and carbon isotope analyses of food web structure indicate a complex food web with overlapping omnivory with some specialist fish species. Stable nitrogen isotope analyses further confirm that mercury is biomagnifying through the Tanganyika food web at rates similar to those seen in Lakes Malawi and Victoria, the other two African Great Lakes. Most collected fish species and all invertebrate species had mercury concentrations below 0.2 μg Hg/g wet weight. However, several fish species, Ctenochromis horei (average 0.15 μg/g ww), Neolamprologus boulengeri (0.2 μg/g ww) , Bathybates spp.spp. (0.21 μg/g ww), Mastacembelus cunningtoni (0.22 μg/g ww) and Clarias theodorae (0.22 μg/g ww) approached or slightly exceeded the World Health Organization (WHO)'s recommended guideline of 0.2 μg Hg/g for vulnerable populations with high rates of fish consumption. Two individuals of the piscivorous fish species Lates microlepis (0.54, 0.78 μg/g ww) and a Polypterus congicus (1.3 μg/g ww) exceeded the international marketing limit value of 0.5 μg/g ww. Because C. theodorae and L. microlepis are also important market fish species, there is a need to monitor mercury concentrations in internationally marketed fish from Lake Tanganikya to ensure that those fish do not present a risk to human consumers

  3. Hospital capacity and management preparedness for pandemic influenza in Victoria.

    Science.gov (United States)

    Dewar, Ben; Barr, Ian; Robinson, Priscilla

    2014-04-01

    This study was designed to investigate acute hospital pandemic influenza preparedness in Victoria, Australia, particularly focussing on planning and management efforts. A prospective study was conducted by questionnaire and semi-structured interview of health managers across the Victorian hospital system from July to October 2011. Participants with responsibility for emergency management, planning and operations were selected from every hospital in Victoria with an emergency department to complete a questionnaire (response rate 22/43 = 51%). Each respondent was invited to participate in a phone-based semi-structured interview (response rate 11/22 = 50%). Rural/regional hospitals demonstrated higher levels of clinical (86%) and non-clinical (86%) staff contingency planning than metropolitan hospitals (60% and 40% respectively). Pandemic plans were not being sufficiently tested in exercises or drills, which is likely to undermine their effectiveness. All respondents reported hand hygiene and standard precautions programs in place, although only one-third (33%) of metropolitan respondents and no rural/regional respondents reported being able to meet patient needs with high levels of staff absenteeism. Almost half Victoria's healthcare workers were unvaccinated against influenza. Hospitals across Victoria demonstrated different levels of influenza pandemic preparedness and planning. If a more severe influenza pandemic than that of 2009 arose, Victorian hospitals would struggle with workforce and infrastructure problems, particularly in rural/regional areas. Staff absenteeism threatens to undermine hospital pandemic responses. Various strategies, including education and communication, should be included with in-service training to provide staff with confidence in their ability to work safely during a future pandemic. © 2014 The Authors. ANZJPH © 2014 Public Health Association of Australia.

  4. AcEST: BP921491 [AcEST

    Lifescience Database Archive (English)

    Full Text Available . 32 3.4 sp|Q1PDC4|L_MABVR Large structural protein OS=Lake Victoria marb... 30 9.8 >sp|Q56A10|ZN608_MOUSE Z...e structural protein OS=Lake Victoria marburgvirus (strain Ravn-87) GN=L PE=3 SV=1 Length = 2327 Score = 30.

  5. Youth suicide in Victoria: a retrospective study.

    Science.gov (United States)

    Krupinski, J; Tiller, J W; Burrows, G D; Hallenstein, H

    1994-02-07

    To determine the trends in youth suicide in Victoria and Australia as a whole, and their relation to youth unemployment. We used Australian Bureau of Statistics data to analyse suicide trends between 1907 and 1990 in young people aged 15-24 years and made an in-depth study of youth suicides between 1980 and 1990, for which computerised data are available. There has been a steady increase in youth suicide both in Victoria and Australia as a whole since 1960 in males but not females. There were significant differences in age, sex and area of residence in both the rate and the method of suicide. The increase in youth suicide was not associated with the rise in unemployment. Male (not female) suicide rates were higher in non-metropolitan areas and areas of high youth unemployment. The reasons for the increase in youth suicide remain obscure. There is a need for a prospective in-depth study to determine factors in the aetiology of youth suicide, with particular reference to possible areas for prevention.

  6. Thermoluminescence dates for the Lake Mungo aboriginal fireplaces and the implications for radiocarbon dating

    International Nuclear Information System (INIS)

    Bell, W.T.

    1991-01-01

    During the Quaternary period in Australia large areas of western New South Wales and northern Victoria were covered by hundreds of lakes, both large and small. Nearly all are dry today but some may still be recognized by the long low dunes that follow the eastern shorelines. Many traces of early human occupation have been found along the shorelines of nearly all the major lakes and some of the best exposures have occurred on the lunette along the eastern shore of Lake Mungo. This lunette, has suffered massive erosion in recent times and this has uncovered the sites of many ancient fireplaces. Charcoal from some of these fireplaces has been dated by Barbetti and Polach (1973) using the radiocarbon method and the ages place the lakeside dwellers at Mungo in an area of Australian prehistory around 30 000 years ago. The baked sediment from below the fireplaces appears to have been heated to a temperature in excess of 400 o C according to archaeomagnetic studies carried out by Barbetti (1973) and this indicated that the fireplaces might lend themselves to the technique of thermoluminescence (TL) dating. The results of the TL dating programme are described elsewhere. (author)

  7. Thermoluminescence dates for the Lake Mungo aboriginal fireplaces and the implications for radiocarbon dating

    Energy Technology Data Exchange (ETDEWEB)

    Bell, W T [Australian National Univ., Canberra (Australia)

    1991-02-01

    During the Quaternary period in Australia large areas of western New South Wales and northern Victoria were covered by hundreds of lakes, both large and small. Nearly all are dry today but some may still be recognized by the long low dunes that follow the eastern shorelines. Many traces of early human occupation have been found along the shorelines of nearly all the major lakes and some of the best exposures have occurred on the lunette along the eastern shore of Lake Mungo. This lunette, has suffered massive erosion in recent times and this has uncovered the sites of many ancient fireplaces. Charcoal from some of these fireplaces has been dated by Barbetti and Polach (1973) using the radiocarbon method and the ages place the lakeside dwellers at Mungo in an area of Australian prehistory around 30 000 years ago. The baked sediment from below the fireplaces appears to have been heated to a temperature in excess of 400{sup o}C according to archaeomagnetic studies carried out by Barbetti (1973) and this indicated that the fireplaces might lend themselves to the technique of thermoluminescence (TL) dating. The results of the TL dating programme are described elsewhere. (author).

  8. Victoria Stodden: Scholarly Communication in the Era of Big Data and Big Computation

    OpenAIRE

    Stodden, Victoria

    2015-01-01

    Victoria Stodden gave the keynote address for Open Access Week 2015. "Scholarly communication in the era of big data and big computation" was sponsored by the University Libraries, Computational Modeling and Data Analytics, the Department of Computer Science, the Department of Statistics, the Laboratory for Interdisciplinary Statistical Analysis (LISA), and the Virginia Bioinformatics Institute. Victoria Stodden is an associate professor in the Graduate School of Library and Information Scien...

  9. An Investigation of the Hydroclimate Variability of Eastern Africa

    Science.gov (United States)

    Smith, K. A.; Semazzi, F. H. M.

    2015-12-01

    The flow of the Victoria Nile, and the productivity of the dams along it, is determined by the level of Lake Victoria, which is primarily dictated by the rainfall and temperature variability over the Lake Victoria Basin. Notwithstanding the indisputable decline of water resources over the lake basin during the Long Rains of March - May, there is a strong indication based on IPCC climate projections that this trend, which has persisted for several decades, will reverse in the next few decades. This phenomenon has come to be known as the Eastern-Central African climate change paradox and could have profound implications on sustainable development for the next few decades in Lake Victoria Basin. The purpose of this study is to investigate the climate variability associated with the East African Climate Change Paradox for the recent decades. This research analyzes observations to understand the sources of variability and potential physical mechanisms related to the decline in precipitation over Eastern Africa. We then investigate the hydrological factors involved in the decline of Lake Victoria levels in the context of the decline in rainfall. While East Africa has been experiencing persistent decline of the Long Rains for multiple decades, this same decline is not seen in annual rainfall. The remaining seasons show an increase in rainfall which is compensating for the decline of the Long Rains. It is possible that the Long Rains season is shifting in such a way that the season starts earlier, in February, and ending sooner. The corresponding annual Lake Victoria levels modeled using observed rainfall do not decline in the recent decades, except when the Long Rains seasonal variability is considered without variability from other seasons. This shift could impact hydroelectric power planning on a monthly or seasonal time scale, and could potentially have a large impact on agriculture, since it would shift the growing season in the region.

  10. The NETLAKE Metadatabase – A tool to support automatic monitoring on lakes in Europe and beyond

    Czech Academy of Sciences Publication Activity Database

    Jennings, E.; de Eyto, E.; Laas, A.; Pierson, D. C.; Mircheva, G.; Naumoski, A.; Clarke, A.; Helay, M.; Šumberová, Kateřina; Langenhaun, D.

    2017-01-01

    Roč. 26, č. 4 (2017), s. 95-100 ISSN 1539-607X Grant - others:COST(XE) ES1201 Program:ES Institutional support: RVO:67985939 Keywords : sensor -based monitoring * data sharing * lakes and reservoirs Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Marine biology, freshwater biology, limnology

  11. Job-Sharing at the Greater Victoria Public Library.

    Science.gov (United States)

    Miller, Don

    1978-01-01

    Describes the problems associated with the management of part-time library employees and some solutions afforded by a job sharing arrangement in use at the Greater Victoria Public Library. This is a voluntary work arrangement, changing formerly full-time positions into multiple part-time positions. (JVP)

  12. Modeling Lake Storage Dynamics to support Arctic Boreal Vulnerability Experiment (ABoVE)

    Science.gov (United States)

    Vimal, S.; Lettenmaier, D. P.; Smith, L. C.; Smith, S.; Bowling, L. C.; Pavelsky, T.

    2017-12-01

    The Arctic and Boreal Zone (ABZ) of Canada and Alaska includes vast areas of permafrost, lakes, and wetlands. Permafrost thawing in this area is expected to increase due to the projected rise of temperature caused by climate change. Over the long term, this may reduce overall surface water area, but in the near-term, the opposite is being observed, with rising paludification (lake/wetland expansion). One element of NASA's ABoVE field experiment is observations of lake and wetland extent and surface elevations using NASA's AirSWOT airborne interferometric radar, accompanied by a high-resolution camera. One use of the WSE retrievals will be to constrain model estimates of lake storage dynamics. Here, we compare predictions using the lake dynamics algorithm within the Variable Infiltration Capacity (VIC) land surface scheme. The VIC lake algorithm includes representation of sub-grid topography, where the depth and area of seasonally-flooded areas are modeled as a function of topographic wetness index, basin area, and slope. The topography data used is from a new global digital elevation model, MERIT-DEM. We initially set up VIC at sites with varying permafrost conditions (i.e., no permafrost, discontinuous, continuous) in Saskatoon and Yellowknife, Canada, and Toolik Lake, Alaska. We constrained the uncalibrated model with the WSE at the time of the first ABoVE flight, and quantified the model's ability to predict WSE and ΔWSE during the time of the second flight. Finally, we evaluated the sensitivity of the VIC-lakes model and compared the three permafrost conditions. Our results quantify the sensitivity of surface water to permafrost state across the target sites. Furthermore, our evaluation of the lake modeling framework contributes to the modeling and mapping framework for lake and reservoir storage change evaluation globally as part of the SWOT mission, planned for launch in 2021.

  13. Validation of New Crack Monitoring Technique for Victoria Class High-Pressure Air Bottles

    Science.gov (United States)

    2014-06-01

    Defence Research and Development Canada Recherche et développement pour la défense Canada Validation of new crack monitoring technique for Victoria ...Validation of new crack monitoring technique for Victoria class high-pressure air bottles Ian Thompson John R. MacKay Defence Research and Development...Canada Scientific Report DRDC-RDDC-2014-R81 June 2014 © Her Majesty the Queen in Right of Canada (Department of National Defence), 2014 © Sa Majesté

  14. Strong evidence for terrestrial support of zooplankton in small lakes based on stable isotopes of carbon, nitrogen, and hydrogen

    Science.gov (United States)

    Cole, J.J.; Carpenter, S.R.; Kitchell, J.; Pace, M.L.; Solomon, C.T.; Weidel, B.

    2011-01-01

    Cross-ecosystem subsidies to food webs can alter metabolic balances in the receiving (subsidized) system and free the food web, or particular consumers, from the energetic constraints of local primary production. Although cross-ecosystem subsidies between terrestrial and aquatic systems have been well recognized for benthic organisms in streams, rivers, and the littoral zones of lakes, terrestrial subsidies to pelagic consumers are more difficult to demonstrate and remain controversial. Here, we adopt a unique approach by using stable isotopes of H, C, and N to estimate terrestrial support to zooplankton in two contrasting lakes. Zooplankton (Holopedium, Daphnia, and Leptodiaptomus) are comprised of ???20-40% of organic material of terrestrial origin. These estimates are as high as, or higher than, prior measures obtained by experimentally manipulating the inorganic 13C content of these lakes to augment the small, natural contrast in 13C between terrestrial and algal photosynthesis. Our study gives credence to a growing literature, which we review here, suggesting that significant terrestrial support of pelagic crustaceans (zooplankton) is widespread.

  15. Assessment of the abnormal growth of floating macrophytes in Winam Gulf (Kenya) by using MODIS imagery time series

    Science.gov (United States)

    Fusilli, L.; Collins, M. O.; Laneve, G.; Palombo, A.; Pignatti, S.; Santini, F.

    2013-02-01

    The objective of this research study is to assess the capability of time-series of MODIS imagery to provide information suitable for enhancing the understanding of the temporal cycles shown by the abnormal growth of the floating macrophytes in order to support monitoring and management action of Lake Victoria water resources. The proliferation of invasive plants and aquatic weeds is of growing concern. Starting from 1989, Lake Victoria has been interested by the high infestation of water hyacinth with significant socio-economic impact on riparian populations. In this paper, we describe an approach based on the time-series of MODIS to derive the temporal behaviour, the abundance and distribution of the floating macrophytes in the Winam Gulf (Kenyan portion of the Lake Victoria) and its possible links to the concentrations of the main water constituencies. To this end, we consider the NDVI values computed from the MODIS imagery time-series from 2000 to 2009 to identify the floating macrophytes cover and an appropriate bio-optical model to retrieve, by means of an inverse procedure, the concentrations of chlorophyll a, coloured dissolved organic matter and total suspended solid. The maps of the floating vegetation based on the NDVI values allow us to assess the spatial and temporal dynamics of the weeds with high time resolution. A floating vegetation index (FVI) has been introduced for describing the weeds pollution level. The results of the analysis show a consistent temporal relation between the water constituent concentrations within the Winam Gulf and the FVI, especially in the proximity of the greatest proliferation of floating vegetation in the last 10 years that occurred between the second half of 2006 and the first half of 2007.The adopted approach will be useful to implement an automatic system for monitoring and predicting the floating macrophytes proliferation in Lake Victoria.

  16. Are the Lake Victoria fisheries threatened by exploitation or eutrophication? Towards an ecosystem-based approach to management

    NARCIS (Netherlands)

    Kolding, J.; Zwieten, van P.A.M.; Mkumbo, O.; Silsbe, G.; Hecky, R.

    2008-01-01

    Lake Victoria’s ecosystem has shown fundamental changes over its past recorded history in terms of nutrient loadings, productivity, faunal composition and fisheries. As yet, however, no attempt has been made to link the driving processes of eutrophication and fisheries to understand the feedback

  17. Knowledge, attitude, and practices on intestinal schistosomiasis among primary schoolchildren in the Lake Victoria basin, Rorya District, north-western Tanzania

    Directory of Open Access Journals (Sweden)

    David Z. Munisi

    2017-09-01

    Full Text Available Abstract Background Globally school-age children, adolescents and young adults bear the highest burden of schistosomiasis. When developing a specific intervention to improve community’s knowledge, attitudes, and practices (KAPs, existing KAPs must be taken into account. Therefore, this study was designed to determine schoolchildren’s KAPs on schistosomiasis in the study area. Methods A cross-sectional study was conducted in Busanga and Kibuyi villages involving 513 schoolchildren. A pre-tested questionnaire was used to collect socio-demographic data and to assess KAP on schistosomiasis among primary schoolchildren in the study area. Results Of the 488 interviewed children, 391 (80.12% reported to have heard of schistosomiasis, with the majority 289 (73.91% citing school as the source of this knowledge. Swimming in the lake, worms, witchcraft, and mosquitoes were mentioned to be the cause for intestinal schistosomiasis. Fishing in the lake, drinking unboiled lake water, walking bare footed, and shaking hands were reported to be practices that may lead to contracting schistosomiasis. Only 156 (39.90% of the study respondents reported to know the signs of intestinal schistosomiasis. Avoiding swimming in the lake, drinking unboiled water and eating unwashed fruits were mentioned as preventive measures. Nearly 85% (412 reported understanding that there was a disease known as schistosomiasis; additionally, 419 (85.86% considered schistosomiasis as a dangerous disease and 418 (85.66% believed that schistosomiasis was treatable. Fishermen and schoolchildren were reported to be groups most at risk of schistosomiasis infection. Visiting the lake (for swimming and other gatherings was a common practice among study participants 471 (96.52%.Nearly 93% (451 of participants mentioned using lake water for domestic chores, and, although 407 (84.61% reported to own a toilet at home, only 229 (55.31% reported to always use a toilet for sanitation purposes

  18. Phylogenetic relationships among East African haplochromine fish as revealed by short interspersed elements (SINEs).

    Science.gov (United States)

    Terai, Yohey; Takezaki, Naoko; Mayer, Werner E; Tichy, Herbert; Takahata, Naoyuki; Klein, Jan; Okada, Norihiro

    2004-01-01

    Genomic DNA libraries were prepared from two endemic species of Lake Victoria haplochromine (cichlid) fish and used to isolate and characterize a set of short interspersed elements (SINEs). The distribution and sequences of the SINEs were used to infer phylogenetic relationships among East African haplochromines. The SINE-based classification divides the fish into four groups, which, in order of their divergence from a stem lineage, are the endemic Lake Tanganyika flock (group 1); fish of the nonendemic, monotypic, widely distributed genus Astatoreochromis (group 2); the endemic Lake Malawi flock (group 3); and group 4, which contains fish from widely dispersed East African localities including Lakes Victoria, Edward, George, Albert, and Rukwa, as well as many rivers. The group 4 haplochromines are characterized by a subset of polymorphic SINEs, each of which is present in some individuals and absent in others of the same population at a given locality, the same morphologically defined species, and the same mtDNA-defined haplogroup. SINE-defined group 4 contains six of the seven previously described mtDNA haplogroups. One of the polymorphic SINEs appears to be fixed in the endemic Lake Victoria flock; four others display the presence-or-absence polymorphism within the species of this flock. These findings have implications for the origin of Lake Victoria cichlids and for their founding population sizes.

  19. Lake Cadagno

    DEFF Research Database (Denmark)

    Tonolla, Mauro; Storelli, Nicola; Danza, Francesco

    2017-01-01

    Lake Cadagno (26 ha) is a crenogenic meromictic lake located in the Swiss Alps at 1921 m asl with a maximum depth of 21 m. The presence of crystalline rocks and a dolomite vein rich in gypsum in the catchment area makes the lake a typical “sulphuretum ” dominated by coupled carbon and sulphur...... cycles. The chemocline lies at about 12 m depth, stabilized by density differences of salt-rich water supplied by sub-aquatic springs to the monimolimnion and of electrolyte-poor surface water feeding the mixolimnion. Steep sulphide and light gradients in the chemocline support the growth of a large...... in the chemocline. Small-celled PSB together with the sulfate-reducing bacterium Desulfocapsa thiozymogenes sp. form stable aggregates in the lake, which represent small microenvironments with an internal sulphur cycle. Eukaryotic primary producers in the anoxic zones are dominated by Cryptomonas phaseolus...

  20. Queen Victoria, her physicians, and her cataracts.

    Science.gov (United States)

    Ravin, J G

    1994-01-01

    Decreasing vision due to cataracts became a significant problem for Queen Victoria toward the end of the 19th century. Her personal physician, Sir James Reid, obtained consultations with two eminent British ophthalmologists, George Lawson and Edward Nettleship. The Queen was not satisfied, and requested an opinion from the German professor Hermann Pagenstecher. All the doctors agreed on the diagnosis, but the Queen never underwent surgery.

  1. L-Lake macroinvertebrate community

    International Nuclear Information System (INIS)

    Specht, W.L.

    1996-06-01

    To characterize the present benthic macroinvertebrate community of L-Lake, Regions 5 and 7 of the reservoir were sampled in September 1995 at the same locations sampled in 1988 and 1989 during the L-Lake monitoring program. The macroinvertebrate community of 1995 is compared to that of 1988 and 1989. The species composition of L-Lake's macroinvertebrate community has changed considerably since 1988-1989, due primarily to maturation of the reservoir ecosystem. L-Lake contains a reasonably diverse macroinvertebrate community that is capable of supporting higher trophic levels, including a diverse assemblage of fish species. The L-Lake macroinvertebrate community is similar to those of many other southeastern reservoirs, and there is no indication that the macroinvertebrate community is perturbed by chemical or physical stressors

  2. L-Lake macroinvertebrate community

    Energy Technology Data Exchange (ETDEWEB)

    Specht, W.L.

    1996-06-01

    To characterize the present benthic macroinvertebrate community of L-Lake, Regions 5 and 7 of the reservoir were sampled in September 1995 at the same locations sampled in 1988 and 1989 during the L-Lake monitoring program. The macroinvertebrate community of 1995 is compared to that of 1988 and 1989. The species composition of L-Lake`s macroinvertebrate community has changed considerably since 1988-1989, due primarily to maturation of the reservoir ecosystem. L-Lake contains a reasonably diverse macroinvertebrate community that is capable of supporting higher trophic levels, including a diverse assemblage of fish species. The L-Lake macroinvertebrate community is similar to those of many other southeastern reservoirs, and there is no indication that the macroinvertebrate community is perturbed by chemical or physical stressors.

  3. Is the organisation and structure of hospital postnatal care a barrier to quality care? Findings from a state-wide review in Victoria, Australia.

    Science.gov (United States)

    McLachlan, Helen L; Forster, Della A; Yelland, Jane; Rayner, Joanne; Lumley, Judith

    2008-09-01

    to describe the structure and organisation of hospital postnatal care in Victoria, Australia. postal survey sent to all public hospitals in Victoria (n=71) and key-informant interviews with midwives and medical practitioners (n=38). Victoria, Australia. providers of postnatal care in Victorian public hospitals. there is significant diversity across Victoria in the way postnatal units are structured and organised and in the way care is provided. There are differences in numerous practices, including maternal and neonatal observations and the length of time women spend in hospital after giving birth. Although the benefits of continuity of care are recognised by health care providers, continuity is difficult to provide in the postnatal period. Postnatal care is provided in busy, sometimes chaotic environments, with many barriers to providing effective care and few opportunities for women to rest and recover after childbirth. The findings in this study can, in part, be explained by the lack of evidence that has been available to guide early postnatal care. current structures such as standard postnatal documentation (clinical pathways) and fixed length of stay, may inhibit rather than support individualised care for women after childbirth. There is a need to move towards greater flexibility in providing of early postnatal care, including alternative models of service delivery; choice and flexibility in the length of stay after birth; a focus on the individual with far less emphasis on care being structured around organisational requirements; and building an evidence base to guide care.

  4. 78 FR 71493 - Special Local Regulation; Lake Havasu City Christmas Boat Parade of Lights; Colorado River; Lake...

    Science.gov (United States)

    2013-11-29

    ...-AA00 Special Local Regulation; Lake Havasu City Christmas Boat Parade of Lights; Colorado River; Lake... temporarily modifying the dates for the special local regulation in support of the Lake Havasu City Christmas Boat Parade of Lights on the Colorado River. This modification is necessary to reflect the actual dates...

  5. Refuge Lake Reclassification in 620 Minnesota Cisco Lakes under Future Climate Scenarios

    Directory of Open Access Journals (Sweden)

    Liping Jiang

    2017-09-01

    Full Text Available Cisco (Coregonus artedi is the most common coldwater stenothermal fish in Minnesota lakes. Water temperature (T and dissolved oxygen (DO in lakes are important controls of fish growth and reproduction and likely change with future climate warming. Built upon a previous study, this study uses a modified method to identify which of 620 cisco lakes in Minnesota can still support cisco populations under future climate and therefore be classified as cisco refuge lakes. The previous study used oxythermal stress parameter TDO3, the temperature at DO of 3 mg/L, simulated only from deep virtual lakes to classify 620 cisco lakes. Using four categories of virtual but representative cisco lakes in modified method, a one-dimensional water quality model MINLAKE2012 was used to simulate daily T and DO profiles in 82 virtual lakes under the past (1961–2008 and two future climate scenarios. A multiyear average of 31-day largest TDO3 over variable benchmark (VB periods, AvgATDO3VB, was calculated from simulated T and DO profiles using FishHabitat2013. Contour plots of AvgATDO3VB for four categories of virtual lakes were then developed to reclassify 620 cisco lakes into Tier 1 (AvgATDO3VB < 11 °C or Tier 2 refuge lakes, and Tier 3 non-refuge lakes (AvgATDO3VB > 17 °C. About 20% of 620 cisco lakes are projected to be refuge lakes under future climate scenarios, which is a more accurate projection (improving the prediction accuracy by ~6.5% from the previous study since AvgATDO3VB was found to vary by lake categories.

  6. Analyses of CsI aerosol deposition tests in WIND project with ART and VICTORIA codes

    International Nuclear Information System (INIS)

    Yuchi, Y.; Shibazaki, H.; Kudo, T.

    2000-01-01

    Deposition behavior of cesium iodide (CsI) was analyzed with ART and VICTORIA-92 codes for a test of the aerosol re-vaporization test series performed in WIND project at JAERI. In the test analyzed, CsI aerosol was injected into piping of test section where metaboric acid (HBO 2 ) was placed in advance on the floor area. It was confirmed in the present analysis that similar results on the CsI deposition were obtained between ART and VICTORIA when influences of chemical interactions were negligibly small. The analysis with VICTORIA agreed satisfactorily with the test results in analytical cases that cesium metaborate (CsBO 2 ) was injected into the test section instead of CsI to simulate the pre-existence of HBO 2 effect. (author)

  7. Great Lakes

    Science.gov (United States)

    Edsall, Thomas A.; Mac, Michael J.; Opler, Paul A.; Puckett Haecker, Catherine E.; Doran, Peter D.

    1998-01-01

    population.The wild plants and animals and the natural systems that support them in the Great Lakes region are valuable resources of considerable local, regional, and national interest. They are also, in part, transboundary resources that we share with our Canadian neighbors to the north. The way these resources are changing over time is inadequately known and is a cause for concern for resource users and for those charged with managing and protecting these unique and valuable resources. This chapter describes the wild plants and animals and the systems that support them in the Great Lakes region; addresses their condition; and points out the gaps in our knowledge about them that, if filled, would aid in their conservation and appropriate use.

  8. 78 FR 48318 - Approval and Promulgation of Air Quality Implementation Plans; Texas; Victoria County, 1997 8...

    Science.gov (United States)

    2013-08-08

    ... pollution. Inclusion of Victoria County in 30 TAC Chapter 115 volatile organic compounds (VOC) rules for the... vessels, and marine vessels would be required to vent to a control device until the VOC concentration of... Victoria County in 30 TAC Chapter 114 rule for Texas Low Emission Diesel (TxLED) compliant marine diesel...

  9. Isotopic character of Cambro-Ordovician plutonism, southern Victoria Land

    International Nuclear Information System (INIS)

    Cox, S.C.; Parkinson, D.L.; Allibone, A.H.; Cooper, A.F.

    2000-01-01

    Previous mapping of granitoid rocks in the Dry Valleys area of southern Victoria Land, Antarctica, identified the calc-alkaline (DV1a), adakitic (DV1b), and monzonitic (DV2) suites. A fourth older suite comprising alkaline gabbro, syenite, and A-type granite occurs in the Mt Dromedary area c. 80 km to the south. U-Pb zircon dating of Bonney Pluton, the largest calc-alkaline DV1a intrusion, indicates emplacement of this regional-scale body at 505 +/- 2 Ma. Pb-loss and inherited zircon were common to Bonney Pluton analyses of this study. U-Pb dating of monazite from Valhalla Pluton, a principal DV1b suite adakitic intrusion, indicates emplacement at 488 +/- 2 Ma. The Bonney Pluton age constrains the peak of calc-alkaline plutonism at 505 Ma and the Valhalla Pluton age records the major pulse of adakitic plutonism that is inferred to mark the final stages of subduction c. 490 Ma along this section of the East Antarctic margin. Nd and Sr isotope data for the calc-alkaline DV1a suite and adakitic DV1b suite define distinct ranges for each suite, supporting their subdivision on the basis of field relationships, petrography, and whole-rock geochemistry. Calc-alkaline DV1a suite granite magmas have eNd(T) = -4.2 to -6.1 and Sri = 0.7071-0.7079, whereas the adakitic DV1b suite rocks have a wider range of eNd(T) = -1.9 to -7.2 and Sri = 0.7065-0.7097. The isotopic data suggest a significant mantle component and subordinate crustal component in the source region of both suites. Time-dependent variations in the isotopic ratios of DV1a and DV1b suites imply a progressive increase in the proportion of more radiogenic material in the source region of the granitoid rocks, either mantle- or crust-derived material. Larger adakitic DV1b plutons are more 'evolved' than equivalent, smaller plutons of the same DV1b suite. Vanda Dikes and monzonitic DV2 suite intrusions are characterised by particularly low Sri = 0.7044-0.7067 and near-constant eNd(T) = -4.8 to -5.3, which indicate a

  10. Sir James Reid and the Death of Queen Victoria: An Early Model for End-of-Life Care.

    Science.gov (United States)

    Abrams, Robert C

    2015-12-01

    An appraisal of the last ten days of Queen Victoria's life, viewed primarily from the perspective of her personal physician, Sir James Reid, is presented. Sir James' clinical encounters with his patient and the Royal Family are examined to reveal his strategic and medical thinking and gauge his level of success in basic palliative aims. It was found that the lack of effective medical interventions, tensions within the Royal Family, the importance of his post to Sir James' professional career, and the political ramifications unavoidably connected with the illness of a head of state, all presented challenges to Reid's efforts to ease the physical and emotional pain of Queen Victoria's dying. Key features of Sir James' approach included reliance on physician-patient and physician-family relationships, emphasis on emotional support for the patient, and the careful selection of interventions for the family. In the first years of the 20th century, an era when the contemporary concepts of palliative care, hospice, and family dynamics did not exist, Sir James' management of the Queen's final illness suggested an early model for end-of-life care. By the end of Queen Victoria's life, Sir James was seen to have preserved his patient's comfort and dignity, at the same time advancing family and societal acceptance of the death of this matriarchal figure. © The Author 2014. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  11. Playa Lakes

    Data.gov (United States)

    Kansas Data Access and Support Center — This digital dataset provides information about the spatial distribution of soil units associated with playa lakes. Specific soil types have been designated by the...

  12. Complete mitochondrial DNA sequences of the Victoria tilapia (Oreochromis variabilis) and Redbelly Tilapia (Tilapia zilli): genome characterization and phylogeny analysis.

    Science.gov (United States)

    Kinaro, Zachary Omambia; Xue, Liangyi; Volatiana, Josies Ancella

    2016-07-01

    The Cichlid fishes have played an important role in evolutionary biology, population studies and aquaculture industry with East African species representing a model suited for studying adaptive radiation and speciation for cichlid genome projects in which closely related genomes are fast emerging presenting questions on phenotype-genotype relations. The complete mitochondrial genomes presented here are for two closely related but eco-morphologically distinct Lake Victoria basin cichlids, Oreochromis variabilis, an endangered native species and Tilapia zilli, an invasive species, both of which are important economic fishes in local areas. The complete mitochondrial genomes determined for O. variabilis and T. zilli are 16 626 and 16,619 bp, respectively. Both the mitogenomes contain 13 protein-coding genes, 22 tRNAs, 2 rRNAs and a non-coding control region, which are typical of vertebrate mitogenomes. Phylogenetic analyses of the two species revealed that though both lie within family Cichlidae, they are remotely related.

  13. Long-Term Variability of Satellite Lake Surface Water Temperatures in the Great Lakes

    Science.gov (United States)

    Gierach, M. M.; Matsumoto, K.; Holt, B.; McKinney, P. J.; Tokos, K.

    2014-12-01

    The Great Lakes are the largest group of freshwater lakes on Earth that approximately 37 million people depend upon for fresh drinking water, food, flood and drought mitigation, and natural resources that support industry, jobs, shipping and tourism. Recent reports have stated (e.g., the National Climate Assessment) that climate change can impact and exacerbate a range of risks to the Great Lakes, including changes in the range and distribution of certain fish species, increased invasive species and harmful algal blooms, declining beach health, and lengthened commercial navigation season. In this study, we will examine the impact of climate change on the Laurentian Great Lakes through investigation of long-term lake surface water temperatures (LSWT). We will use the ATSR Reprocessing for Climate: Lake Surface Water Temperature & Ice Cover (ARC-Lake) product over the period 1995-2012 to investigate individual and interlake variability. Specifically, we will quantify the seasonal amplitude of LSWTs, the first and last appearances of the 4°C isotherm (i.e., an important identifier of the seasonal evolution of the lakes denoting winter and summer stratification), and interpret these quantities in the context of global interannual climate variability such as ENSO.

  14. Analysis of an Organisation: A University of the Third Age (U3A), Mornington, Victoria

    Science.gov (United States)

    Small, Michael

    2017-01-01

    The purpose of this paper is two fold: to look at Mornington U3A in organisational terms and then look at U3AM as a loosely coupled system. One outcome of the study would be to undertake further analyses of U3As in Victoria to determine the levels of bureaucracy under which each operates. Questions to be asked: are U3As in Victoria operating as…

  15. The heliothermic lake: a direct method of collecting and storing solar energy

    Science.gov (United States)

    Kirkland, Douglas W.; Bradbury, J. Platt; Dean, Walter E.

    1980-01-01

    Heliothermic lakes contain a sun-heated layer of warm, saline water beneath a surface layer of cooler, less saline water. The two layers are separated by a chemocline, a stratum in which salinity increases progressively with depth. The chemocline, the position of which varies from lake to lake, functions as a heat trap. Most sunlight that penetrates this stratum is transformed into heat, which cannot escape by radiation because water is opaque to infrared light, and which cannot escape by convection because the specific gravity of the dense water below the chemocline is not significantly decreased by the increasing temperature. Heat can escape only by conduction through the chemocline, and water or brine is a very poor conductor. As a result, the temperature within and commonly below the chemocline rises. Under ideal conditions of a clear solution, high isolation, and a suitable salinity distribution, the temperature of the chemocline will increase to the boiling point. The lower part of the chemocline in a shallow (0.8-m) manmade heliothermic lake at Sedom, Israel, for example, reached a temperature of 96°C (205°F) in spite of a brine with poor light transmissibility.About 30 natural heliothermic lakes have been reported. The best known, Lake Ursului, occurs in Transylvania, Romania (latitude, 46°35'N). During four consecutive summers, 1899 to 1902, this lake had temperatures of 60-70°C (140-158°F) at a depth of 1-2 m. Heliothermic conditions have persisted in this lake for at least 28 and probably for more than 77 years. The most unusual, Lake Vanda, Victoria Land, Antarctica (latitude, 77°35'S), has a temperature of 26°C near the base of the chemocline at a depth of 61 despite a mean atmospheric temperature of -20°C. Sunlight penetrates into the chemocline through 5 m of remarkably clear ice.Maintenance of the chemocline is the chief problem preventing commercial use of manmade heliothermic lakes for the collection and storage of solar energy. The most

  16. VICTORIA: A mechanistic model of radionuclide behavior in the reactor coolant system under severe accident conditions

    International Nuclear Information System (INIS)

    Heams, T.J.; Williams, D.A.; Johns, N.A.; Mason, A.; Bixler, N.E.; Grimley, A.J.; Wheatley, C.J.; Dickson, L.W.; Osborn-Lee, I.; Domagala, P.; Zawadzki, S.; Rest, J.; Alexander, C.A.; Lee, R.Y.

    1992-12-01

    The VICTORIA model of radionuclide behavior in the reactor coolant system (RCS) of a light water reactor during a severe accident is described. It has been developed by the USNRC to define the radionuclide phenomena and processes that must be considered in systems-level models used for integrated analyses of severe accident source terms. The VICTORIA code, based upon this model, predicts fission product release from the fuel, chemical reactions involving fission products, vapor and aerosol behavior, and fission product decay heating. Also included is a detailed description of how the model is implemented in VICTORIA, the numerical algorithms used, and the correlations and thermochemical data necessary for determining a solution. A description of the code structure, input and output, and a sample problem are provided

  17. Limnology of Botos Lake, a tropical crater lake in Costa Rica.

    Science.gov (United States)

    Umaña, G

    2001-12-01

    Botos Lake, located at the Poas Volcano complex (Costa Rica) was sampled eight times from 1994 to 1996 for physicochemical conditions of the water column and phytoplanktonic community composition. Depth was measured at fixed intervals in several transects across the lake to determine its main morphometric characteristics. The lake has an outlet to the north. It is located 2580 m above sea level and is shallow, with a mean depth of 1.8 m and a relative depth of 2.42 (surface area 10.33 ha, estimated volume 47.3 hm3). The lake showed an isothermal water column in all occasions, but it heats and cools completely according to weather fluctuations. Water transparency reached the bottom on most occasions (> 9 m). The results support the idea that the lake is polymictic and oligotrophic. The lake has at least 23 species of planktonic algae, but it was always dominated by dinoflagellates, especially Peridinium inconspicuum. The shore line is populated by a sparse population of Isoetes sp. and Eleocharis sp. mainly in the northern shore where the bottom has a gentle slope and the forest does not reach the shore.

  18. Aboriginal Students in Victoria. ACER Research Monograph No. 3.

    Science.gov (United States)

    de Lemos, Marion M.

    An estimated 80%-90% of all Aboriginal students enrolled in the primary and secondary schools of Victoria, Australia, were tested and surveyed to determine their numbers, distribution, attendance, achievement, attitudes, and school leaving patterns. Most of the 1244 Aboriginals surveyed attended state schools and 75% were schooled in rural areas.…

  19. Investigation of a steam generator tube rupture sequence using VICTORIA

    International Nuclear Information System (INIS)

    Bixler, N.E.; Erickson, C.M.; Schaperow, J.H.

    1995-01-01

    VICTORIA-92 is a mechanistic computer code for analyzing fission product behavior within the reactor coolant system (RCS) during a severe reactor accident. It provides detailed predictions of the release of radionuclides and nonradioactive materials from the core and transport of these materials within the RCS. The modeling accounts for the chemical and aerosol processes that affect radionuclide behavior. Coupling of detailed chemistry and aerosol packages is a unique feature of VICTORIA; it allows exploration of phenomena involving deposition, revaporization, and re-entrainment that cannot be resolved with other codes. The purpose of this work is to determine the attenuation of fission products in the RCS and on the secondary side of the steam generator in an accident initiated by a steam generator tube rupture (SGTR). As a class, bypass sequences have been identified in NUREG-1150 as being risk dominant for the Surry and Sequoyah pressurized water reactor (PWR) plants

  20. A Baseline Air Quality Assessment Onboard a Victoria Class Submarine: HMCS Windsor

    National Research Council Canada - National Science Library

    Severs, Y. D

    2006-01-01

    .... This trial thus represents a baseline habitability evaluation of Canada's Victoria class submarines to confirm compliance with the current maximum permissible contaminant limits stipulated in the Air...

  1. The Pleistocene archaeology and environments of the Wasiriya Beds, Rusinga Island, Kenya.

    Science.gov (United States)

    Tryon, Christian A; Tyler Faith, J; Peppe, Daniel J; Fox, David L; McNulty, Kieran P; Jenkins, Kirsten; Dunsworth, Holly; Harcourt-Smith, Will

    2010-12-01

    Western Kenya is well known for abundant early Miocene hominoid fossils. However, the Wasiriya Beds of Rusinga Island, Kenya, preserve a Pleistocene sedimentary archive with radiocarbon age estimates of >33-45 ka that contains Middle Stone Age artifacts and abundant, well-preserved fossil fauna: a co-occurrence rare in eastern Africa, particularly in the region bounding Lake Victoria. Artifacts and fossils are associated with distal volcanic ash deposits that occur at multiple localities in the Wasiriya Beds, correlated on the basis of geochemical composition as determined by electron probe microanalysis. Sediment lithology and the fossil ungulates suggest a local fluvial system and associated riparian wooded habitat within a predominantly arid grassland setting that differs substantially from the modern environment, where local climate is strongly affected by moisture availability from Lake Victoria. In particular, the presence of oryx (Oryx gazella) and Grevy's zebra (Equus grevyi) suggest a pre-Last Glacial Maximum expansion of arid grasslands, an environmental reconstruction further supported by the presence of several extinct specialized grazers (Pelorovis antiquus, Megalotragus sp., and a small alcelaphine) that are unknown from Holocene deposits in eastern Africa. The combination of artifacts, a rich fossil fauna, and volcaniclastic sediments makes the Wasiriya Beds a key site for examining the Lake Victoria basin, a biogeographically important area for understanding the diversification and dispersal of Homo sapiens from Africa, whose pre-Last Glacial Maximum history remains poorly understood. Copyright © 2010 Elsevier Ltd. All rights reserved.

  2. Watershed vs. within-lake drivers of nitrogen: phosphorus dynamics in shallow lakes.

    Science.gov (United States)

    Ginger, Luke J; Zimmer, Kyle D; Herwig, Brian R; Hanson, Mark A; Hobbs, William O; Small, Gaston E; Cotner, James B

    2017-10-01

    Research on lake eutrophication often identifies variables affecting amounts of phosphorus (P) and nitrogen (N) in lakes, but understanding factors influencing N:P ratios is important given its influence on species composition and toxin production by cyanobacteria. We sampled 80 shallow lakes in Minnesota (USA) for three years to assess effects of watershed size, proportion of watershed as both row crop and natural area, fish biomass, and lake alternative state (turbid vs. clear) on total N : total P (TN : TP), ammonium, total dissolved phosphorus (TDP), and seston stoichiometry. We also examined N:P stoichiometry in 20 additional lakes that shifted states during the study. Last, we assessed the importance of denitrification by measuring denitrification rates in sediment cores from a subset of 34 lakes, and by measuring seston δ 15 N in four additional experimental lakes before and after they were experimentally manipulated from turbid to clear states. Results showed alternative state had the largest influence on overall N:P stoichiometry in these systems, as it had the strongest relationship with TN : TP, seston C:N:P, ammonium, and TDP. Turbid lakes had higher N at given levels of P than clear lakes, with TN and ammonium 2-fold and 1.4-fold higher in turbid lakes, respectively. In lakes that shifted states, TN was 3-fold higher in turbid lakes, while TP was only 2-fold higher, supporting the notion N is more responsive to state shifts than is P. Seston δ 15 N increased after lakes shifted to clear states, suggesting higher denitrification rates may be important for reducing N levels in clear states, and potential denitrification rates in sediment cores were among the highest recorded in the literature. Overall, our results indicate lake state was a primary driver of N:P dynamics in shallow lakes, and lakes in clear states had much lower N at a given level of P relative to turbid lakes, likely due to higher denitrification rates. Shallow lakes are often

  3. Influence of the Pearl River estuary and vertical mixing in Victoria Harbor on water quality in relation to eutrophication impacts in Hong Kong waters.

    Science.gov (United States)

    Yin, Kedong; Harrison, Paul J

    2007-06-01

    This study presents water quality parameters such as nutrients, phytoplankton biomass and dissolved oxygen based on 11 years of water quality data in Victoria Harbor and examined how the Pearl River estuary discharge in summer and year round sewage discharge influenced these parameters. Nutrients in Victoria Harbor were strongly influenced by both the Pearl River and sewage effluent, as indicated by the high NO(3) inputs from the Pearl River in summer and higher NH(4) and PO(4) in Victoria Harbor than both its sides. N:P ratios were low in the dry season, but increased to >16:1 in the wet season, suggesting that P is potentially the most limiting nutrient in this area during the critical period in the summer. Although there were generally high nutrients, the phytoplankton biomass was not as high as one would expect in Victoria Harbor. In fact, there were high concentrations of chl near the bottom well below the photic zone. Salinity near the bottom was lower in Victoria Harbor than at the two entrances to Victoria Harbor, suggesting strong vertical mixing within Victoria Harbor. Therefore, strong vertical mixing and horizontal advection appear to play an important role in significantly reducing eutrophication impacts in Victoria Harbor. Consequently, dissolved oxygen near the bottom was low in summer, but only occasionally dipped to 2 mgL(-1) despite the high organic loading from sewage effluent.

  4. Integrating three lake models into a Phytoplankton Prediction System for Lake Taihu (Taihu PPS) with Python

    NARCIS (Netherlands)

    Huang, J.; Gao, J.; Hörmann, G.; Mooij, W.M.

    2012-01-01

    In the past decade, much work has been done on integrating different lake models using general frameworks to overcome model incompatibilities. However, a framework may not be flexible enough to support applications in different fields. To overcome this problem, we used Python to integrate three lake

  5. Hydrologic-energy balance constraints on the Holocene lake-level history of lake Titicaca, South America

    Energy Technology Data Exchange (ETDEWEB)

    Rowe, H.D.; Dunbar, R.B. [Stanford University, Geological and Environmental Sciences, Stanford, CA (United States)

    2004-09-01

    A basin-scale hydrologic-energy balance model that integrates modern climatological, hydrological, and hypsographic observations was developed for the modern Lake Titicaca watershed (northern Altiplano, South America) and operated under variable conditions to understand controls on post-glacial changes in lake level. The model simulates changes in five environmental variables (air temperature, cloud fraction, precipitation, relative humidity, and land surface albedo). Relatively small changes in three meteorological variables (mean annual precipitation, temperature, and/or cloud fraction) explain the large mid-Holocene lake-level decrease ({proportional_to}85 m) inferred from seismic reflection profiling and supported by sediment-based paleoproxies from lake sediments. Climatic controls that shape the present-day Altiplano and the sediment-based record of Holocene lake-level change are combined to interpret model-derived lake-level simulations in terms of changes in the mean state of ENSO and its impact on moisture transport to the Altiplano. (orig.)

  6. Hydrologic-energy balance constraints on the Holocene lake-level history of lake Titicaca, South America

    Science.gov (United States)

    Rowe, H. D.; Dunbar, R. B.

    2004-09-01

    A basin-scale hydrologic-energy balance model that integrates modern climatological, hydrological, and hypsographic observations was developed for the modern Lake Titicaca watershed (northern Altiplano, South America) and operated under variable conditions to understand controls on post-glacial changes in lake level. The model simulates changes in five environmental variables (air temperature, cloud fraction, precipitation, relative humidity, and land surface albedo). Relatively small changes in three meteorological variables (mean annual precipitation, temperature, and/or cloud fraction) explain the large mid-Holocene lake-level decrease (˜85 m) inferred from seismic reflection profiling and supported by sediment-based paleoproxies from lake sediments. Climatic controls that shape the present-day Altiplano and the sediment-based record of Holocene lake-level change are combined to interpret model-derived lake-level simulations in terms of changes in the mean state of ENSO and its impact on moisture transport to the Altiplano.

  7. Labouring Together: collaborative alliances in maternity care in Victoria, Australia—protocol of a mixed-methods study

    Science.gov (United States)

    Nagle, Cate; Kent, Bridie; Hutchinson, Alison M

    2017-01-01

    Introduction For over a decade, enquiries into adverse perinatal outcomes have led to reports that poor collaboration has been detrimental to the safety and experience of maternity care. Despite efforts to improve collaboration, investigations into maternity care at Morecambe Bay (UK) and Djerriwarrh Health Services (Australia) have revealed that poor collaboration and decision-making remain a threat to perinatal safety. The Labouring Together study will investigate how elements hypothesised to influence the effectiveness of collaboration are reflected in perceptions and experiences of clinicians and childbearing women in Victoria, Australia. The study will explore conditions that assist clinicians and women to work collaboratively to support positive maternity outcomes. Results of the study will provide a platform for consumers, clinician groups, organisations and policymakers to work together to improve the quality, safety and experience of maternity care. Methods and analysis 4 case study sites have been selected to represent a range of models of maternity care in metropolitan and regional Victoria, Australia. A mixed-methods approach including cross-sectional surveys and interviews will be used in each case study site, involving both clinicians and consumers. Quantitative data analysis will include descriptive statistics, 2-way multivariate analysis of variance for the dependent and independent variables, and χ2 analysis to identify the degree of congruence between consumer preferences and experiences. Interview data will be analysed for emerging themes and concepts. Data will then be analysed for convergent lines of enquiry supported by triangulation of data to draw conclusions. Ethics and dissemination Organisational ethics approval has been received from the case study sites and Deakin University Human Research Ethics Committee (2014–238). Dissemination of the results of the Labouring Together study will be via peer-reviewed publications and conference

  8. Mapping ecosystem services in a Great Lakes estuary supports local decision-making

    Science.gov (United States)

    Estuaries of the Laurentian Great Lakes provide a concentrated supply of ecosystem goods and services from which humans benefit. As long-term centers of human activity, most estuaries of the Great Lakes and have a legacy of chemical contamination, degraded habitats, and non-point...

  9. Potentially avoidable hospitalisation for constipation in Victoria, Australia in 2010-11.

    Science.gov (United States)

    Ansari, Humaira; Ansari, Zahid; Hutson, John M; Southwell, Bridget R

    2014-07-11

    When primary care of constipation fails, the patient may need emergency hospitalisation for disimpaction. This study aimed to provide population-based data on the number of unplanned admissions and the cost to the healthcare system for constipation in Victoria, Australia in financial year 2010-11. The Victorian Admitted Episodes Dataset was examined to find the number of emergency hospital separations coded as constipation (ICD-10-AM Code K390). An estimate of costs was determined from the number of weighted inlier equivalent separations (WIES) multiplied by the WEIS price, used by the Victorian Government for funding purposes. There were 3978 emergency separations for constipation in Victoria in 2010-2011, 92% in public hospitals. Fifty-five percent were female and 38% > 75 years old. One third stayed overnight and 1/3 more than 1 day. The emergency bed day rate was 7.1 per 10,000 of population. The estimate of cost, based on WEIS, was approximately $8.3 million. Potential savings could be made by reducing the number of separations in 6 Local Government Areas (LGAs). This study shows that the burden (in number of admissions, emergency bed days and overall direct costs) in managing emergency admissions for constipation in Victoria, Australia, is very significant and likely to be similar in other developed countries. Improved primary healthcare and alternative ways to achieve faecal disimpaction without emergency admission could save the public health system a proportion of this $8.3 million.

  10. medical recipients of the victoria cross during the anglo-boer war

    African Journals Online (AJOL)

    ofall orders ofchivalry - the most enviable order ofthe. Victoria Cross.' MEDICAL .... Major Babtie, a Scot by birth, obtained his Bachelor of Medicine in 1880 and entered the Army ..... a personality type that is given to this kind of action? Will one.

  11. Decline of the world's saline lakes

    Science.gov (United States)

    Wurtsbaugh, Wayne A.; Miller, Craig; Null, Sarah E.; Derose, R. Justin; Wilcock, Peter; Hahnenberger, Maura; Howe, Frank; Moore, Johnnie

    2017-11-01

    Many of the world's saline lakes are shrinking at alarming rates, reducing waterbird habitat and economic benefits while threatening human health. Saline lakes are long-term basin-wide integrators of climatic conditions that shrink and grow with natural climatic variation. In contrast, water withdrawals for human use exert a sustained reduction in lake inflows and levels. Quantifying the relative contributions of natural variability and human impacts to lake inflows is needed to preserve these lakes. With a credible water balance, causes of lake decline from water diversions or climate variability can be identified and the inflow needed to maintain lake health can be defined. Without a water balance, natural variability can be an excuse for inaction. Here we describe the decline of several of the world's large saline lakes and use a water balance for Great Salt Lake (USA) to demonstrate that consumptive water use rather than long-term climate change has greatly reduced its size. The inflow needed to maintain bird habitat, support lake-related industries and prevent dust storms that threaten human health and agriculture can be identified and provides the information to evaluate the difficult tradeoffs between direct benefits of consumptive water use and ecosystem services provided by saline lakes.

  12. Study of genetic variation in population of Bipolaris victoriae, the ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-11-19

    Nov 19, 2008 ... Isolates of Bipolaris victoriae were analysed by random amplified polymorphic DNA (RAPD) techniques ... According to the protocol, samples ... and fungus species. But some of the isolates of fungus with high genetic similarity have the same origin (Figure. 1). Weikert et al. (2002) reported that species of ...

  13. Coal Corporation of Victoria strategic plan

    Energy Technology Data Exchange (ETDEWEB)

    1987-01-01

    The Coal Corporation has been established by the Victorian Parliament to plan for and to manage the responsible utilisation of the brown coal resource (Victoria's most abundant fossil resource) in order to underpin economic growth and job creation. For each of 5 issues, the Strategic Plan outlines the current situation, reviews recent factors which have affected or may affect the situation and outlines the goals, strategies and targets which have been set for the period 1985/1989. In each case, the achievements to date are also outlined. The issues addressed are: project development, marketing, resource planning and inter corporate relations, organisation of the Corporation, and finance.

  14. Dam safety management in Victoria (Australia)

    International Nuclear Information System (INIS)

    Adem, J.

    1996-01-01

    The Victoria state government's decision to make dam owners accountable for safety and upkeep of their dams was reported. To give effect to this decision a series of guidelines have been developed which outline the required activities and skills to ensure that dams are properly managed within a framework of 'light-handed' regulation. The guidelines are also intended to ensure that dam management becomes an integral part of the business decision making process, not just a set of prescribed technical procedures. Details of the direction being taken and the proposed controls to ensure compliance with national and international standards were described. 4 refs., 2 figs

  15. VICTORIA: A mechanistic model of radionuclide behavior in the reactor coolant system under severe accident conditions. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Heams, T J [Science Applications International Corp., Albuquerque, NM (United States); Williams, D A; Johns, N A; Mason, A [UKAEA, Winfrith, (England); Bixler, N E; Grimley, A J [Sandia National Labs., Albuquerque, NM (United States); Wheatley, C J [UKAEA, Culcheth (England); Dickson, L W [Atomic Energy of Canada Ltd., Chalk River, ON (Canada); Osborn-Lee, I [Oak Ridge National Lab., TN (United States); Domagala, P; Zawadzki, S; Rest, J [Argonne National Lab., IL (United States); Alexander, C A [Battelle, Columbus, OH (United States); Lee, R Y [Nuclear Regulatory Commission, Washington, DC (United States)

    1992-12-01

    The VICTORIA model of radionuclide behavior in the reactor coolant system (RCS) of a light water reactor during a severe accident is described. It has been developed by the USNRC to define the radionuclide phenomena and processes that must be considered in systems-level models used for integrated analyses of severe accident source terms. The VICTORIA code, based upon this model, predicts fission product release from the fuel, chemical reactions involving fission products, vapor and aerosol behavior, and fission product decay heating. Also included is a detailed description of how the model is implemented in VICTORIA, the numerical algorithms used, and the correlations and thermochemical data necessary for determining a solution. A description of the code structure, input and output, and a sample problem are provided.

  16. The burden of hospitalised fall-related injury in community-dwelling older people in Victoria: a database study.

    Science.gov (United States)

    Vu, Trang; Day, Lesley; Finch, Caroline F

    2014-04-01

    To estimate the burden of hospitalised fall-related injury in community-dwelling older people in Victoria. We analysed fall-related, person-identifying hospital discharge data and patient-level hospital treatment costs for community-dwelling older people aged 65+ years from Victoria between 1 July 2005 and 30 June 2008, inclusive. Key outcomes of interest were length of stay (LOS)/episode, cumulative LOS (CLOS)/patient and inpatient costs. The burden of hospitalised fall-related injury in community-dwelling older people aged 65+ years in Victoria was 284,781 hospital bed days in 2005-06, rising to 310,031 hospital bed days in 2007-08. Seventy-one per cent of episodes were multiday. One in 15 acute care episodes was a high LOS outlier and 14% of patients had ≥1 episode classified as high LOS outlier. The median CLOS/patient was nine days (interquartile range 2-27). The annual costs of inpatient care, in June 2009 prices, for fall-related injury in community-dwelling people aged 65+ years in Victoria rose from $213 million in 2005-06 to $237 million in 2007-08. The burden of hospitalised fall-related injury in community-dwelling older women, people aged 85+ years and those with comorbidity was considerable. The burden of hospitalised fall-related injury in community-dwelling older people aged 65+ years in Victoria is significantly more than previously projected. Importantly, this study identifies that women, patients with comorbidity and those aged 85+ years account for a considerable proportion of this burden. A corresponding increase in falls prevention effort is required to ensure that the burden is properly addressed. © 2014 The Authors. ANZJPH © 2014 Public Health Association of Australia.

  17. Triumphs Show: What Makes Art History? Year 7 Exploit the Resources of the Victoria and Albert Museum's Medieval Gallery to Create and Curate Their Own Answer

    Science.gov (United States)

    Copsey, Sarah

    2014-01-01

    What do 14 Year 7 students, an art teacher, a history teacher and the Victoria and Albert Museum have in common? They are all part of the "Stronger Together" Museum Champion project run by The Langley Academy and the River & Rowing Museum and supported by Arts Council England, designed to engage students, teachers and museum staff…

  18. LIMNOLOGY, LAKE BASINS, LAKE WATERS

    Directory of Open Access Journals (Sweden)

    Petre GÂŞTESCU

    2009-06-01

    Full Text Available Limnology is a border discipline between geography, hydrology and biology, and is also closely connected with other sciences, from it borrows research methods. Physical limnology (the geography of lakes, studies lake biotopes, and biological limnology (the biology of lakes, studies lake biocoenoses. The father of limnology is the Swiss scientist F.A. Forel, the author of a three-volume entitled Le Leman: monographie limnologique (1892-1904, which focuses on the geology physics, chemistry and biology of lakes. He was also author of the first textbook of limnology, Handbuch der Seenkunde: allgemeine Limnologie,(1901. Since both the lake biotope and its biohydrocoenosis make up a single whole, the lake and lakes, respectively, represent the most typical systems in nature. They could be called limnosystems (lacustrine ecosystems, a microcosm in itself, as the American biologist St.A. Forbes put it (1887.

  19. Progress in understanding the importance of coastal wetland nursery habitat to Great Lakes fisheries support

    Science.gov (United States)

    Great Lakes coastal wetlands provide important habitat for Great Lakes fishes of all life stages. A literature review of ichthyoplankton surveys conducted in Great Lakes coastal wetlands found at least 82 species reported to be captured during the larval stage. Twenty of those sp...

  20. Un paso de América: Alfonso Reyes, Victoria Ocampo y el cosmopolitismo en la década de 1930 / Un paso de América: Alfonso Reyes, Victoria Ocampo and the Cosmopolitanism in the 1930’s

    Directory of Open Access Journals (Sweden)

    Gorica Majstorovic

    2014-12-01

    Full Text Available El artículo trata de las construcciones americanistas del cosmopolitismo (entendido en relación a la geopolítica imperial en los textos de Victoria Ocampo y Alfonso Reyes de los años treinta. Al analizar su relación con los movimientos de inmigración y la subsiguiente revalorización de la nación, el artículo postula que en Alfonso Reyes la mediación cosmopolita es «des-jerarquizada», ubicada casi siempre en una «periferia», a diferencia de Victoria Ocampo cuyas visiones cosmopolitas son mediadas desde un «centro» —ya sea París o Buenos Aires— y relacionadas con una jerarquía de valores estéticos y políticos.The article deals with Americanist constructions of cosmopolitanism (understood in relation to the imperial geopolitics in the texts of Victoria Ocampo and Alfonso Reyes in the 1930’s. Upon analyzing its relationship with immigration movements and the subsequent revaluation of the nation, the article suggests that in Alfonso Reyes cosmopolitan mediation is «dis-hierarchized», almost always located in a periphery, unlike Victoria Ocampo whose cosmopolitan visions are mediated from a «center» —either Paris or Buenos Aires— and related to a hierarchy of aesthetic and political values.

  1. Environmental isotope signatures of the largest freshwater lake in Kerala

    International Nuclear Information System (INIS)

    Unnikrishnan Warrier, C.

    2007-01-01

    Sasthamkotta lake, the largest freshwater lake in Kerala, serves as a source for drinking water for more than half a million people. Environmental 137 Cs analysis done on undisturbed sediment core samples reveals that the recent rate of sedimentation is not uniform in the lake. The useful life of lake is estimated as about 800 years. The δD and δ 18 O values of the lake waters indicate that the lake is well mixed with a slight variation horizontally. The stable isotope studies on well waters from the catchment indicate hydraulic communication with the lake and lake groundwater system is flow-through type. Analytical model also supports this view. (author)

  2. Population dynamics of Glossina fuscipes fuscipes on Buvuma Island, Lake Victoria, Uganda

    International Nuclear Information System (INIS)

    Ogwal, L.M.; Kangwagye, T.N.

    1990-01-01

    A survey made of Buvuma Island to establish the incidence, distribution and population dynamics of tsetse flies showed that Glossina fuscipes fuscipes Newstead was the most abundant species. This species occurred in the southeastern, western and northern parts of the island. Although the fly is both riverine and peridomestic in its habits, the survey revealed that its population was concentrated mainly within a distance of about 2 km from the lake shores around houses, in banana plantations, at forest edges and roadsides, in fishing villages and ports of call, on grazing grounds and at water collection points. Studies of the population dynamics revealed seasonal variations in the abundance of the species, with a peak during the main dry season, i.e. in the months of January and February. The breeding peak was reached during the minor rainy season. Trap catches were highest in fishing villages and ports of call, followed in decreasing order by catches at forest edge and roadside locations, at water collection points, around houses, in banana plantations and on grazing grounds. It appears that the fishing villages and ports of call were possibly the most suitable breeding grounds. The efficiency of the traps was reflected in the fact that G. f. fuscipes populations were reduced by up to 95% in Tome and 90% in the Bulopa-Walwanda and Lwenyanja villages. Many puparia were also found on the sandy beaches around fishing villages and ports of call. There was evidence of fly movement between the islands and the mainland, indicating that, although geographically isolated, Buvuma Island is not isolated from the mainland in terms of tsetse fly movement. (author). 21 refs, 5 figs, 1 tab

  3. La construcción de legitimidad del Frente para la Victoria (1988-1991 Frente para la Victoria's construction of legitimacy (1988-1991

    Directory of Open Access Journals (Sweden)

    Pamela Sosa

    2011-06-01

    Full Text Available El trabajo aborda la construcción de legitimidad del Frente para la Victoria (FV en el escenario político de Santa Cruz desde su nacimiento en 1988 hasta llegar a la gobernación en 1991. Se identifican tres fuentes de legitimidad construidas de manera alternativa al debilitamiento de la credibilidad de los partidos políticos tradicionales: la UCR, el PJ, el PI y el MID, entre otros. En este contexto, el Frente para la Victoria desplegó sus estrategias de legitimación apelando a la unidad de lo diverso y sumando referentes individuales de todo el arco político. Por otro lado, apeló a través de sus discursos y la conformación de los elencos y organizaciones a representar la fragmentación social propia de una sociedad compuesta por capas migratorias y, por último, construyó una novedosa oferta política a-partidaria acorde a las representaciones de la crisis estatal a mediados del '80 a partir de la reivindicación de los valores de la gestión, la eficiencia, el orden, el trabajo y la gobernabilidad. Sus estrategias de legitimación muestran cómo la primera etapa de construcción de poder político del FV fue efecto de su trayectoria en la frontera de los débiles grupos sociales y políticos.O trabalho aborda a construção de legitimidade do Frente para la Victoria (FV no cenário político de Santa Cruz desde seu nascimento em 1988 até chegar ao governo em 1991. Identificam-se três fontes de legitimidade construídas de maneira alternativa ao enfraquecimento da credibilidade dos partidos políticos tradicionais: a UCR, o PJ, o PI e o MID, entre outros. Neste contexto, o Frente para la Victoria desdobrou suas estratégias de legitimação apelando à unidade do que for diverso e somando referências individuais de todo o arco político. Por outro lado, apelou, através de seus discursos e a conformação dos elencos e organizações, a representar a fragmentação social própria de uma sociedade composta por camadas migrat

  4. Global Lakes Sentinel Services: Evaluation of Chl-a Trends in Deep Clear Lakes

    Science.gov (United States)

    Cazzaniga, Ilaria; Giardino, Claudia; Bresciani, Mariano; Poser, Kathrin; Peters, Steef; Hommersom, Annelies; Schenk, Karin; Heege, Thomas; Philipson, Petra; Ruescas, Ana; Bottcher, Martin; Stelzer, Kerstin

    2016-08-01

    The aim of this study is the analysis of trend in the trophic level evolution in clear deep lakes which, being characterised by good quality state, are important socio- economic resources for their regions. The selected lakes are situated in Europe (Garda, Maggiore, Constance and Vättern), North America (Michigan) and Africa (Malawi and Tanganyika) and cover a range of eco- regions (continental, perialpine, boreal, rift valley) distributed globally.To evaluate trophic level tendency we mainly focused on chlorophyll-a concentrations (chl-a) which is a direct proxy of trophic status. The chl-a concentrations were obtained from 5216 cloud-free MERIS imagery from 2002 to 2012.The 'GLaSS RoIStats tool' available within the GLaSS project was used to extract chl-a in a number of region of interests (ROI) located in pelagic waters as well as some few other stations depending on lakes morphology. For producing the time-series trend, these extracted data were analysed with the Seasonal Kendall test.The results overall show almost stable conditions with a slight increase in concentration for lakes Maggiore, Constance, and the Green Bay of Lake Michigan; a slight decrease for lakes Garda and Tanganyika and absolutely stable conditions for lakes Vättern and Malawi.The results presented in this work show the great capability of MERIS to perform trend tests analysis on trophic status with focus on chl-a concentration. Being chl-a also a key parameter in water quality monitoring plans, this study also supports the managing practices implemented worldwide for using the water of the lakes.

  5. Heavy Metals Pollution in Lake Mariut

    International Nuclear Information System (INIS)

    Saad, M.A.H.; Ezzat, A.A.E.; El-Rayis, O.A.; Hafez, H.

    1981-01-01

    The occurrence and distribution of heavy metals in the water of the heavily polluted Lake Mariut (Egypt) during August 1978 to September 1979 as well as the accumulation of these metals in the different parts of the common fish, Tilapia species, were studied. The study represents a second part of a pilot project on pollution of Lake Mariut supported by IAEA. The mean concentrations of the measured Zn, Gu, Fe, Mn and Cd in the lake water were 10.9, 4.2, 19.1, 26.2 and 0.62 μg/l, respectively

  6. Download this PDF file

    African Journals Online (AJOL)

    User

    Proximate compositions of five economically-important fish species from Lake Victoria and Lake. Tanganyika ... the fish species desirable for consumption during this period. These fish ..... Functional ... Journal of Animal Ecology, 40 : 633-652.

  7. Strategic Actions for Increasing the Submission of Digital Cadastral Data by the Surveying Industry Based on Lessons Learned from Victoria, Australia

    Directory of Open Access Journals (Sweden)

    Hamed Olfat

    2018-02-01

    Full Text Available ePlan, as a digital cadastral data initiative, is a collaborative program between the land authorities and the surveying industry which aims to replace paper and PDF cadastral plans and surveys with digital data. ePlan is currently operational in Australia, New Zealand and Singapore. ePlan was introduced in the State of Victoria in 2011 and has been operational in this jurisdiction for 2D plans since 2013. On average, one ePlan application is currently submitted to a digital plan lodgment portal every two weeks. The low uptake of ePlan is caused by several technical and non-technical challenges. This paper provides an overview of cadastral information transitioning from paper to digital in Victoria. The research methodology to identify the challenges in Victoria for the adoption of ePlan is then described. This is followed by a discussion on the identified challenges. The paper then proposes a generic framework of strategic actions to increase the uptake of digital cadastral data based on the lessons learned from Victoria. The initiatives suggested by this framework to address the ePlan challenges in Victoria and increase its uptake are also introduced. The paper concludes with a direction for future research.

  8. Geophysical investigation of sentinel lakes in Lake, Seminole, Orange, and Volusia Counties, Florida

    Science.gov (United States)

    Reich, Christopher; Flocks, James; Davis, Jeffrey

    2012-01-01

    edges to approximately 12 ohm-m in the center. These well-defined areas may indicate a "ravel" zone of increased porosity or clay content. Within Lake Helen (Volusia County), a parallel set of seismic reflectors within a host of chaotic reflectors may represent fill within a large sinkhole. The feature extends to more than 50 meters (m) deep and contains very steep pinnacles within the center. Seismic data in Lake Helen are supported by high resistivity values from adjacent continuous resistivity profiles that show possible center collapse within the lake and infilling of sandy material. When used together, HRSP and DC resistivity techniques provide a composite image of structure and lithology to detect potential conduits for fluid flow.

  9. Employment Shifts in the Technical and Further Education Workforce in Victoria.

    Science.gov (United States)

    Shah, Chandra

    2003-01-01

    Analyzes changes in Technical and Further Education (TAFE) work force in Victoria, Australia, that occurred during the period 1993-98. Main changes include increased participation of women, significant growth in part-time employment, decline in full-time (mainly male) employment, and an increased use of seasonal teachers. (Includes 10 figures and…

  10. Royal Ageing: The Queen Mother and Queen Victoria

    OpenAIRE

    Mike Hepworth

    2002-01-01

    This paper is a reflection on the contribution of the image of the Queen Mother to the cultural construction of role models of positive ageing. The interest lies in the Queen Mother's performance in public of her roles as woman and royal personage particularly as she grew older. It is suggested that cultural analysis of the icon of the Queen Mother as a blend of gender and power suggests certain significant parallels with the imagery cultivated around the career of Queen Victoria in the later...

  11. Measuring the cost of leaving care in Victoria

    OpenAIRE

    Catherine Forbes; Brett Inder; Sunitha Raman

    2006-01-01

    On any given night in Victoria, around 4,000 children and young people live under the care and protection of the State. For many young people, this care extends over a long period of time, sometimes until their 18th birthday. It is well documented that young people leaving State care often lack the social and economic resources to assist them in making the transition into independent living. As a consequence, the long-term life outcomes from this group are frequently very poor. A recent repor...

  12. The Integrated Genomic Architecture and Evolution of Dental Divergence in East African Cichlid Fishes (Haplochromis chilotes x H. nyererei

    Directory of Open Access Journals (Sweden)

    C. Darrin Hulsey

    2017-09-01

    Full Text Available The independent evolution of the two toothed jaws of cichlid fishes is thought to have promoted their unparalleled ecological divergence and species richness. However, dental divergence in cichlids could exhibit substantial genetic covariance and this could dictate how traits like tooth numbers evolve in different African Lakes and on their two jaws. To test this hypothesis, we used a hybrid mapping cross of two trophically divergent Lake Victoria species (Haplochromis chilotes × Haplochromis nyererei to examine genomic regions associated with cichlid tooth diversity. Surprisingly, a similar genomic region was found to be associated with oral jaw tooth numbers in cichlids from both Lake Malawi and Lake Victoria. Likewise, this same genomic location was associated with variation in pharyngeal jaw tooth numbers. Similar relationships between tooth numbers on the two jaws in both our Victoria hybrid population and across the phylogenetic diversity of Malawi cichlids additionally suggests that tooth numbers on the two jaws of haplochromine cichlids might generally coevolve owing to shared genetic underpinnings. Integrated, rather than independent, genomic architectures could be key to the incomparable evolutionary divergence and convergence in cichlid tooth numbers.

  13. Australian doctors and the visual arts. Part 3. Doctor-artists in Victoria.

    Science.gov (United States)

    Hamilton, D G

    1986-06-09

    The contribution of doctors to the visual arts is being discussed in a series of six articles. The first two articles dealt with doctors and the visual arts in New South Wales. In this, the third, doctor-artists in Victoria are discussed.

  14. Monitoring geodynamic activity in the Victoria Land, East Antarctica: Evidence from GNSS measurements

    Science.gov (United States)

    Zanutta, A.; Negusini, M.; Vittuari, L.; Cianfarra, P.; Salvini, F.; Mancini, F.; Sterzai, P.; Dubbini, M.; Galeandro, A.; Capra, A.

    2017-10-01

    GNSS networks in Antarctica are a fundamental tool to define actual crustal displacements due to geological and geophysical processes and to constrain the glacial isostatic models (GIA). A large network devoted to the detection and monitoring of crustal deformations in the Northern Victoria Land (Victoria Land Network for DEFormation control - VLNDEF), was monumented during the 1999-2000 and 2000-2001 field campaigns, as part of Italian National Program for Antarctic Research and surveyed periodically during the Southern summer seasons. In this paper, GPS observations of VLNDEF collected over a more than 15-year span, together with various selected POLENET sites and more than 70 IGS stations, were processed with Bernese Software, using a classical double difference approach. A solution was obtained combining NEQs by means of ADDNEQ2/FODITS tools embedded in Bernese Software. All the Antarctic sites were kept free and a subset of 50 IGS stations were used to frame VLNDEF into ITRF2008. New evidence provided by analysis of GPS time series for the VLNDEF network is presented; also displacements along the vertical component are compared with the recently published GIA models. The absolute velocities indicate an overall displacement of the northern Victoria Land region along the south-east direction (Ve = 10.6 mm/yr, Vn = -11.5 mm/yr) and an average uplift rate of Vu = 0.5 mm/yr. Two GIA models have been analyzed: ICE-6G_C-VM5a proposed by Argus et al. (2014), Peltier et al. (2015) and W12A_v1 by Whitehouse et al. (2012a,b). Up rates, predicted over the VLNDEF sites by the mentioned GIA models, have been extracted and compared with those observed. A preliminary comparison with GPS-derived vertical rates shows that the Victoria Land ICE-6G_C-VM5 and W12A_v1 GIA models predict overestimated uplift rates of 0.7 and 0.9 mm/yr weighted mean residuals respectively. The mean horizontal relative motions within the Victoria Land (VL) area are in most cases negligible, while only

  15. Potentially avoidable hospitalisation for constipation in Victoria, Australia in 2010–11

    Science.gov (United States)

    2014-01-01

    Background When primary care of constipation fails, the patient may need emergency hospitalisation for disimpaction. This study aimed to provide population-based data on the number of unplanned admissions and the cost to the healthcare system for constipation in Victoria, Australia in financial year 2010–11. Methods The Victorian Admitted Episodes Dataset was examined to find the number of emergency hospital separations coded as constipation (ICD-10-AM Code K390). An estimate of costs was determined from the number of weighted inlier equivalent separations (WIES) multiplied by the WEIS price, used by the Victorian Government for funding purposes. Results There were 3978 emergency separations for constipation in Victoria in 2010–2011, 92% in public hospitals. Fifty-five percent were female and 38% > 75 years old. One third stayed overnight and 1/3 more than 1 day. The emergency bed day rate was 7.1 per 10,000 of population. The estimate of cost, based on WEIS, was approximately $8.3 million. Potential savings could be made by reducing the number of separations in 6 Local Government Areas (LGAs). Conclusions This study shows that the burden (in number of admissions, emergency bed days and overall direct costs) in managing emergency admissions for constipation in Victoria, Australia, is very significant and likely to be similar in other developed countries. Improved primary healthcare and alternative ways to achieve faecal disimpaction without emergency admission could save the public health system a proportion of this $8.3 million. PMID:25015386

  16. Preliminary gut content and dentition analysis reveal subtle resource ...

    African Journals Online (AJOL)

    The trophic relationships between six haplochromine cichlids of Lake Kanyaboli, a satellite lake of Lake Victoria that has not been infested by the Nile perch (Lates niloticus), were studied as a first step towards understanding the cichlid community structure in this threatened wetland ecosystem. Coefficient of similarity ...

  17. A Synoptic Climatology of Heavy Rain Events in the Lake Eyre and Lake Frome Catchments

    Directory of Open Access Journals (Sweden)

    Michael John Pook

    2014-11-01

    Full Text Available The rare occasions when Lake Eyre in central, southern Australia fills with water excite great interest and produce major ecological responses. The filling of other smaller lakes such as Lake Frome, have less impact but can contribute important information about the current and past climates of these arid regions. Here, the dominant synoptic systems responsible for heavy rainfall over the catchments of Lake Eyre and Lake Frome since 1950 are identified and compared. Heavy rain events are defined as those where the mean catchment rainfall for 24 hours reaches a prescribed threshold. There were 25 such daily events at Lake Eyre and 28 in the Lake Frome catchment. The combination of a monsoon trough at mean sea level and a geopotential trough in the mid-troposphere was found to be the synoptic system responsible for the majority of the heavy rain events affecting Lake Eyre and one in five of the events at Lake Frome. Complex fronts where subtropical interactions occurred with Southern Ocean fronts also contributed over 20% of the heavy rainfall events in the Frome catchment. Surface troughs without upper air support were found to be associated with 10% or fewer of events in each catchment, indicating that mean sea level pressure analyses alone do not adequately capture the complexity of the heavy rainfall events. At least 80% of the heavy rain events across both catchments occurred when the Southern Oscillation Index (SOI was in its positive phase, and for Lake Frome, the SOI exceeded +10 on 60% of occasions, suggesting that the background atmospheric state in the Pacific Ocean was tilted towards La Niña. Hydrological modeling of the catchments suggests that the 12-month running mean of the soil moisture in a sub-surface layer provides a low frequency filter of the precipitation and matches measured lake levels relatively well.

  18. Palaeolimnological evidence of vulnerability of Lake Neusiedl (Austria) toward climate related changes since the last "vanished-lake" stage.

    Science.gov (United States)

    Tolotti, Monica; Milan, Manuela; Boscaini, Adriano; Soja, Gerhard; Herzig, Alois

    2013-04-01

    The palaeolimnological reconstruction of secular evolution of Euroepan Lakes with key socio-economical relevance respect to large (climate change) and local scale (land use, tourism) environmental changes, represents one of the objectives of the project EuLakes (European Lakes Under Environmental Stressors, Supporting lake governance to mitigate the impact of climate change, Reg. N. 2CE243P3), launched in 2010 within the Central European Inititiative. The project consortium comprises lakes of different morphology and prevalent human uses, including the meso-eutrophic Lake Neusiedl, the largest Austrian lake (total area 315 km2), and the westernmost shallow (mean depth 1.2 m) steppe lake of the Euro-Asiatic continent. The volume of Lake Neusiedl can potentially change over the years, in relation with changing balance between atmospheric precipitation and lake water evapotranspiration. Changing water budget, together with high lake salinity and turbidity, have important implications over the lake ecosystem. This contribution illustrates results of the multi-proxi palaeolimnological reconstruction of ecologial changes occurred in Lake Neusiedl during the last ca. 140 years, i.e. since the end of the last "vanished-lake" stage (1865-1871). Geochemical and biological proxies anticipate the increase in lake productivity of ca. 10 years (1950s) respect to what reported in the literature. Diatom species composition indicate a biological lake recovery in the late 1980s, and suggest a second increment in lake productivity since the late 1990s, possibly in relation with the progressive increase in the nitrogen input from agriculture. Abundance of diatoms typical of brackish waters indicated no significant long-term change in lake salinity, while variations in species toleranting dessiccation confirm the vulnerability of Lake Neusiedl toward climate-driven changes in the lake water balance. This fragility is aggravated by the the semi-arid climate conditions of the catchemnt

  19. Residues of Organochlorine Pesticides in Lake Mariut

    International Nuclear Information System (INIS)

    Saad, M.A.H.; Abu-Elamayem, M.M.; El-Sebae, A.B.; Sharaf, I.P.

    1981-01-01

    Lake Mariut, a brackish water lake adjoining the Mediterranean Coast of Egypt, has suffered much from intensive pollution in recent years due to the successive increase of human population and industry around it (Saad, 1980). The occurrence and distribution of organochlorine pesticides in the water of Lake Mariut during a period of one year were studied. This study represents an essential part of a pilot project on pollution of Lake Mariut supported by IAEA. The major organochlorine pesticides detected in the water of Lake Mariut were Lindane, p, p'-DDE, o,p'-DDT and p, p'-DDT. The mean concentrations of these pesticides were 2.091, 4.493, 0.009 and 0.134 ppb, respectively. The mean concentration of the calculated total DDT (Σ DDT) was 5.1 PPb

  20. Radon in an underground cave system in Victoria

    International Nuclear Information System (INIS)

    Hedt, J.C.; Boal, T.J.

    1998-01-01

    Radon levels in a cave system in Victoria have been measured. The variation of radon and radon progeny levels with time, position throughout the cave and season have been determined. The radiation exposure of tour guides were estimated. The data is being used to develop a radiation management plan for the tour guides. Radon concentration within a cave system was proven to be dependent to a large extent upon the rate of air exchange with outside. Cave ventilation is the single most important factor in determining if there is diurnal variation in the radon concentration

  1. Hydrochemical determination of source water contributions to Lake Lungo and Lake Ripasottile (central Italy

    Directory of Open Access Journals (Sweden)

    Claire Archer

    2016-12-01

    Full Text Available Lake Lungo and Lake Ripasottile are two shallow (4-5 m lakes located in the Rieti Basin, central Italy, that have been described previously as surface outcroppings of the groundwater table. In this work, the two lakes as well as springs and rivers that represent their potential source waters are characterized physio-chemically and isotopically, using a combination of environmental tracers. Temperature and pH were measured and water samples were analyzed for alkalinity, major ion concentration, and stable isotope (δ2H, δ18O, δ13C of dissolved inorganic carbon, and δ34S and δ18O of sulfate composition.  Chemical data were also investigated in terms of local meteorological data (air temperature, precipitation to determine the sensitivity of lake parameters to changes in the surrounding environment. Groundwater represented by samples taken from Santa Susanna Spring was shown to be distinct with SO42- and Mg2+ content of 270 and 29 mg/L, respectively, and heavy sulfate isotopic composition (δ34S=15.2 ‰ and δ18O=10‰. Outflow from the Santa Susanna Spring enters Lake Ripasottile via a canal and both spring and lake water exhibits the same chemical distinctions and comparatively low seasonal variability. Major ion concentrations in Lake Lungo are similar to the Vicenna Riara Spring and are interpreted to represent the groundwater locally recharged within the plain. The δ13CDIC exhibit the same groupings as the other chemical parameters, providing supporting evidence of the source relationships. Lake Lungo exhibited exceptional ranges of δ13CDIC (±5 ‰ and δ2H, δ18O (±5 ‰ and ±7 ‰, respectively, attributed to sensitivity to seasonal changes. The hydrochemistry results, particularly major ion data, highlight how the two lakes, though geographically and morphologically similar, represent distinct hydrochemical facies. These data also show a different response in each lake to temperature and precipitation patterns in the basin that

  2. Microplastic pollution in lakes and lake shoreline sediments - A case study on Lake Bolsena and Lake Chiusi (central Italy).

    Science.gov (United States)

    Fischer, Elke Kerstin; Paglialonga, Lisa; Czech, Elisa; Tamminga, Matthias

    2016-06-01

    Rivers and effluents have been identified as major pathways for microplastics of terrestrial sources. Moreover, lakes of different dimensions and even in remote locations contain microplastics in striking abundances. This study investigates concentrations of microplastic particles at two lakes in central Italy (Lake Bolsena, Lake Chiusi). A total number of six Manta Trawls have been carried out, two of them one day after heavy winds occurred on Lake Bolsena showing effects on particle distribution of fragments and fibers of varying size categories. Additionally, 36 sediment samples from lakeshores were analyzed for microplastic content. In the surface waters 2.68 to 3.36 particles/m(3) (Lake Chiusi) and 0.82 to 4.42 particles/m(3) (Lake Bolsena) were detected, respectively. Main differences between the lakes are attributed to lake characteristics such as surface and catchment area, depth and the presence of local wind patterns and tide range at Lake Bolsena. An event of heavy winds and moderate rainfall prior to one sampling led to an increase of concentrations at Lake Bolsena which is most probable related to lateral land-based and sewage effluent inputs. The abundances of microplastic particles in sediments vary from mean values of 112 (Lake Bolsena) to 234 particles/kg dry weight (Lake Chiusi). Lake Chiusi results reveal elevated fiber concentrations compared to those of Lake Bolsena what might be a result of higher organic content and a shift in grain size distribution towards the silt and clay fraction at the shallow and highly eutrophic Lake Chiusi. The distribution of particles along different beach levels revealed no significant differences. Copyright © 2016 Elsevier Ltd. All rights reserved.

  3. Preliminary results of the analysis of the population structure of the ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-08-18

    Aug 18, 2008 ... the lake based on a small founder population, which though slow in establishing later exploded to become ... was conducted by the Lake Victoria Research Project funded by .... The matrix of pairwise distances obtained was.

  4. Environmental transformation and distribution of mercury released from gold mining and its implications on human health in Tanzania, studied by nuclear techniques

    International Nuclear Information System (INIS)

    Ikingura, Justinian R.

    2001-01-01

    The catchment areas of Lake Victoria in Tanzania are impacted by mercury contamination from small-scale gold mining activities. A preliminary survey of the mercury contamination has indicated in some cases mercury concentrations that are higher than background levels in soil and river sediment downstream of the mining areas. Average mercury concentration in contaminated soil is in the order of 3.4 mg/kg whereas in river sediment the concentration is about 4.9 mg/kg. Mercury concentrations in fish from a few areas of the Lake Victoria close to gold mining areas are in the range of 2-20 ppb. These fish mercury concentrations are surprisingly low considering the extent of mercury contamination in the Lake Victoria catchment. The dynamics of mercury cycling and their long-term impact on mercury levels in fish and other aquatic organisms in the Lake Victoria gold fields still need to be clarified. Research activities for the first year (2000) will concentrate on the determination of total mercury distribution patterns among soil, river water, sediment, and biota (fish, and other aquatic biota) in two areas (Mugusu-Nungwe Bay and Imweru-Bukombe Bay) of the Lake Victoria gold fields. The relationships between local tropical soil-sediment- and water-chemistry and the distribution of mercury in the contaminated areas will be investigated. Data from this work will be used in the identification and selection of suitable bio-monitors for mercury contamination and human health risk assessment in the study areas. In the second year, the project will focus mainly on methylmercury production and partition between sediment, water and biota in contaminated local tropical sediments. The main factors influencing the methylation and distribution of mercury species will be evaluated in laboratory experiments and extrapolated to environmental conditions. The results of the project will have important implications in mercury pollution monitoring, mitigation, and health risk assessment not

  5. Projected shifts in fish species dominance in Wisconsin lakes under climate change.

    Science.gov (United States)

    Hansen, Gretchen J A; Read, Jordan S; Hansen, Jonathan F; Winslow, Luke A

    2017-04-01

    Temperate lakes may contain both coolwater fish species such as walleye (Sander vitreus) and warmwater fish species such as largemouth bass (Micropterus salmoides). Recent declining walleye and increasing largemouth bass populations have raised questions regarding the future trajectories and management actions for these species. We developed a thermodynamic model of water temperatures driven by downscaled climate data and lake-specific characteristics to estimate daily water temperature profiles for 2148 lakes in Wisconsin, US, under contemporary (1989-2014) and future (2040-2064 and 2065-2089) conditions. We correlated contemporary walleye recruitment and largemouth bass relative abundance to modeled water temperature, lake morphometry, and lake productivity, and projected lake-specific changes in each species under future climate conditions. Walleye recruitment success was negatively related and largemouth bass abundance was positively related to water temperature degree days. Both species exhibited a threshold response at the same degree day value, albeit in opposite directions. Degree days were predicted to increase in the future, although the magnitude of increase varied among lakes, time periods, and global circulation models (GCMs). Under future conditions, we predicted a loss of walleye recruitment in 33-75% of lakes where recruitment is currently supported and a 27-60% increase in the number of lakes suitable for high largemouth bass abundance. The percentage of lakes capable of supporting abundant largemouth bass but failed walleye recruitment was predicted to increase from 58% in contemporary conditions to 86% by mid-century and to 91% of lakes by late century, based on median projections across GCMs. Conversely, the percentage of lakes with successful walleye recruitment and low largemouth bass abundance was predicted to decline from 9% of lakes in contemporary conditions to only 1% of lakes in both future periods. Importantly, we identify up to 85

  6. Landslides in moraines as triggers of glacial lake outburst floods: example from Palcacocha Lake (Cordillera Blanca, Peru)

    Czech Academy of Sciences Publication Activity Database

    Klimeš, Jan; Novotný, J.; Novotná, I.; Urries de, B.J.; Vilímek, V.; Emmer, Adam; Strozzi, T.; Kusák, Michal; Rapre, A.C.; Hartvich, Filip; Frey, H.

    2016-01-01

    Roč. 13, č. 6 (2016), s. 1461-1477 ISSN 1612-510X R&D Projects: GA ČR(CZ) GAP209/11/1000 Institutional support: RVO:67985891 ; RVO:67179843 Keywords : landslides * moraines * glacial lakes * slope stability calculation * glacial lake outburst floods * impact wave models * Cordillera Blanca Subject RIV: DE - Earth Magnetism, Geodesy, Geography; DE - Earth Magnetism, Geodesy, Geography (UEK-B) Impact factor: 3.657, year: 2016

  7. A radical shift from soft-water to hard-water lake: palaeolimnological evidence from Lake Kooraste Kõverjärv, southern Estonia

    Directory of Open Access Journals (Sweden)

    Tiiu Alliksaar

    2012-11-01

    Full Text Available The Water Framework Directive (WFD of the European Union requires the quality of all European water bodies to be examined, and aims to achieve good status by 2015. This study was initiated to assess whether a potential reference lake for identifying lake-type specific reference conditions meets the WFD requirements, of being minimally impacted by human activity during the last centuries. The sediments of Lake Kooraste Kõverjärv were analysed for diatom assemblages and sediment composition; past changes in the lake-water pH and total phosphorus were reconstructed, using quantitative models on sedimentary diatoms. The chronology of sediments was established, using spheroidal fly-ash particles stratigraphy. Palaeolimnological investigations, supported by information from historical maps, revealed that man-made changes around the lake have severely influenced its ecological conditions. The lake, which had been oligotrophic with soft and clear water before the mid-17th century, has been trans­formed into a hard-water lake by modifications to the inflow and outflow. The lake water quality has also been altered by the infiltration of nutrients from a nearby hypertrophic lake that was used for flax retting since the 19th century. Although the ecological status of the lake has remained good despite all these changes, it is still questionable whether to nominate it as a reference lake for stratified hard-water lake types.

  8. Use of regionalisation approach to develop fire frequency curves for Victoria, Australia

    Science.gov (United States)

    Khastagir, Anirban; Jayasuriya, Niranjali; Bhuyian, Muhammed A.

    2017-11-01

    It is important to perform fire frequency analysis to obtain fire frequency curves (FFC) based on fire intensity at different parts of Victoria. In this paper fire frequency curves (FFCs) were derived based on forest fire danger index (FFDI). FFDI is a measure related to fire initiation, spreading speed and containment difficulty. The mean temperature (T), relative humidity (RH) and areal extent of open water (LC2) during summer months (Dec-Feb) were identified as the most important parameters for assessing the risk of occurrence of bushfire. Based on these parameters, Andrews' curve equation was applied to 40 selected meteorological stations to identify homogenous stations to form unique clusters. A methodology using peak FFDI from cluster averaged FFDIs was developed by applying Log Pearson Type III (LPIII) distribution to generate FFCs. A total of nine homogeneous clusters across Victoria were identified, and subsequently their FFC's were developed in order to estimate the regionalised fire occurrence characteristics.

  9. Wapan Sakahikan : the making of a lake

    Energy Technology Data Exchange (ETDEWEB)

    Jaremko, D.

    2009-08-15

    This article discussed an ecosystem project built on reclaimed oil sands lands. The oil sands mine originally required the removal of sections of the Tar and Calumet rivers, tributaries of the Athabasca River. A 76.7 hectare lake was constructed in order to salvage over 100,000 fish. The reclamation included the development of a traditional gathering area for local First Nations and Metis. The lake included a variety of fish habitats and was supported by 5 years of monitoring. The lake will be home to 8 fish species and is 23 meters in depth with shallow areas of 5 meters. Biologists helped to build the habitats, which include deep channels with varying depth and widths; shoals; overhead vegetation; and a rearing habitat area. The lake's littoral zone is approximately 30 per cent of the lake's total area. The involvement of First Nations and Metis included a traditional ceremony on the empty lake bottom. 1 fig.

  10. Hospital-treated injuries from horse riding in Victoria, Australia: time to refocus on injury prevention?

    Science.gov (United States)

    O'Connor, Siobhán; Hitchens, Peta L; Fortington, Lauren V

    2018-01-01

    The most recent report on hospital-treated horse-riding injuries in Victoria was published 20 years ago. Since then, injury countermeasures and new technology have aimed to make horse riding safer for participants. This study provides an update of horse-riding injuries that required hospital treatment in Victoria and examines changes in injury patterns compared with the earlier study. Horse-riding injuries that required hospital treatment (hospital admission (HA) or emergency department (ED) presentations) were extracted from routinely collected data from public and private hospitals in Victoria from 2002-2003 to 2015-2016. Injury incidence rates per 100 000 Victorian population per financial year and age-stratified and sex-stratified injury incidence rates are presented. Poisson regression was used to examine trends in injury rates over the study period. ED presentation and HA rates were 31.1 and 6.6 per 100 000 person-years, increasing by 28.8% and 47.6% from 2002 to 2016, respectively. Female riders (47.3 ED and 10.1 HA per 100 000 person-years) and those aged between 10 and 14 years (87.8 ED and 15.7 HA per 100 000 person-years) had the highest incidence rates. Fractures (ED 29.4%; HA 56.5%) and head injuries (ED 15.4%; HA 18.9%) were the most common injuries. HA had a mean stay of 2.6±4.1 days, and the mean cost per HA was $A5096±8345. Horse-riding injuries have remained similar in their pattern (eg, types of injuries) since last reported in Victoria. HA and ED incidence rates have increased over the last 14 years. Refocusing on injury prevention countermeasures is recommended along with a clear plan for implementation and evaluation of their effectiveness in reducing injury.

  11. Suffering by comparison: Twitter users' reactions to the Victoria's Secret Fashion Show.

    Science.gov (United States)

    Chrisler, Joan C; Fung, Kaitlin T; Lopez, Alexandra M; Gorman, Jennifer A

    2013-09-01

    Social comparison theory suggests that evaluating the self in comparison with others (e.g., peers, celebrities, models) can influence body image. Experimental studies that have tested effects of viewing idealized images in the media often show that women feel worse about themselves after seeing images that illustrate the beauty ideal. Twitter presents a naturally occurring opportunity to study viewers' reactions. An analysis was conducted of 977 tweets sent immediately before and during the 2011 Victoria's Secret Fashion Show that reference the show. Although the majority were idiosyncratic remarks, many tweets contain evidence of upward social comparisons to the fashion models. There were tweets about body image, eating disorders, weight, desires for food or alcohol, and thoughts about self-harm. The results support social comparison theory, and suggest that vulnerable viewers could experience negative affect, or even engage in harmful behaviors, during or after viewing the show or others like it. Copyright © 2013 Elsevier Ltd. All rights reserved.

  12. Alcohol consumption and risky sexual behaviour in the fishing communities: evidence from two fish landing sites on Lake Victoria in Uganda.

    Science.gov (United States)

    Tumwesigye, Nazarius M; Atuyambe, Lynn; Wanyenze, Rhoda K; Kibira, Simon Ps; Li, Qing; Wabwire-Mangen, Fred; Wagner, Glenn

    2012-12-11

    The fishing communities are among population groups that are most at risk of HIV infection, with some studies putting the HIV prevalence at 5 to 10 times higher than in the general population. Alcohol consumption has been identified as one of the major drivers of the sexual risk behaviour in the fishing communities. This paper investigates the relationship between alcohol consumption patterns and risky behaviour in two fishing communities on Lake Victoria. Face-to-face interviews were conducted among 303 men and 172 women at the fish landing sites; categorised into fishermen, traders of fish or fish products and other merchandise, and service providers such as casual labourers and waitresses in bars and hotels, including 12 female sexual workers. Stratified random sampling methodology was used to select study units. Multivariable analysis was conducted to assess independent relationship between alcohol consumption and sexual risky behaviour. Measures of alcohol consumption included the alcohol use disorder test score (AUDIT), having gotten drunk in previous 30 days, drinking at least 2 times a week while measures for risky behaviour included engaging in transactional sex, inconsistent condom use, having sex with non-regular partner and having multiple sexual partners. The level of harmful use of alcohol in the two fishing communities was quite high as 62% of the male and 52% of the female drinkers had got drunk in previous 30 days. The level of risky sexual behaviour was equally high as 63% of the men and 59% of the women had unprotected sex at last sexual event. Of the 3 occupations fishermen had the highest levels of harmful use of alcohol and risky sexual behaviour followed by service providers judging from values of most indicators. The kind of alcohol consumption variables correlated with risky sexual behaviour variables, varied by occupation. Frequent alcohol consumption, higher AUDIT score, having got drunk, longer drinking hours and drinking any day of

  13. Alcohol consumption and risky sexual behaviour in the fishing communities: evidence from two fish landing sites on Lake Victoria in Uganda

    Directory of Open Access Journals (Sweden)

    Tumwesigye Nazarius M

    2012-12-01

    Full Text Available Abstract Background The fishing communities are among population groups that are most at risk of HIV infection, with some studies putting the HIV prevalence at 5 to 10 times higher than in the general population. Alcohol consumption has been identified as one of the major drivers of the sexual risk behaviour in the fishing communities. This paper investigates the relationship between alcohol consumption patterns and risky behaviour in two fishing communities on Lake Victoria. Methods Face-to-face interviews were conducted among 303 men and 172 women at the fish landing sites; categorised into fishermen, traders of fish or fish products and other merchandise, and service providers such as casual labourers and waitresses in bars and hotels, including 12 female sexual workers. Stratified random sampling methodology was used to select study units. Multivariable analysis was conducted to assess independent relationship between alcohol consumption and sexual risky behaviour. Measures of alcohol consumption included the alcohol use disorder test score (AUDIT, having gotten drunk in previous 30 days, drinking at least 2 times a week while measures for risky behaviour included engaging in transactional sex, inconsistent condom use, having sex with non-regular partner and having multiple sexual partners. Results The level of harmful use of alcohol in the two fishing communities was quite high as 62% of the male and 52% of the female drinkers had got drunk in previous 30 days. The level of risky sexual behaviour was equally high as 63% of the men and 59% of the women had unprotected sex at last sexual event. Of the 3 occupations fishermen had the highest levels of harmful use of alcohol and risky sexual behaviour followed by service providers judging from values of most indicators. The kind of alcohol consumption variables correlated with risky sexual behaviour variables, varied by occupation. Frequent alcohol consumption, higher AUDIT score, having

  14. Tackling soil degradation and environmental changes in Lake Manyara Basin, Tanzania to support sustainable landscape/ecosystem management.

    Science.gov (United States)

    Munishi, Linus; Mtei, Kelvin; Bode, Samuel; Dume, Bayu; Navas, Ana; Nebiyu, Amsalu; Semmens, Brice; Smith, Hugh; Stock, Brian; Boeckx, Pascal; Blake, Will

    2017-04-01

    The Lake Manyara Basin (LMB), which encompasses Lake Manyara National Park a world ranking World Biosphere Reserve, is of great ecological and socio-economic value because it hosts a small-holder rain fed and extensive irrigation agriculture, grazing grounds for pastoralists, terrestrial and aquatic habitat for wildlife and tourism business contributing to poverty alleviation. Despite these multiple ecosystem services that support the local communities, the LMB is threatened by; (a) siltation from eroded soil fed from the wider catchment and rift escarpment of the basin and (b) declining water levels due to water capture by agriculture and possibly climate change. These threats to the ecosystem and its services are augmented by increasing human population, pollution by agricultural pesticides, poaching, human encroachment and infrastructure development, and illegal fisheries. Despite these challenges, here is a dearth of information on erosion hotspots and to date soil erosion and siltation problems in LMB have been interpreted largely in qualitative terms, and no coherent interpretative framework of these records exists. Despite concerns that modern sediment fluxes to the Lake may exceed long-term fluxes, little is known about erosion sources, how erosion rates and processes vary across the landscape and how erosion rates are influenced by the strong climate gradients in the basin. This contribution describes a soil erosion and sediment management project that aims to deliver a demonstration dataset generated from inter-disciplinary sediment-source tracing technologies and approaches to assess erosion hotspots, processes and spatial patterns of erosion in the area. The work focuses on a sub basin, the Monduli Sub catchment, located within the greater LMB. This is part of efforts to establish an understanding of soil erosion and landscape degradation in the basin as a pathway for generating and developing knowledge, building capacity to assist conservationists

  15. Can a Skin Cancer Control Program make a Difference? A Profile of the SUNSMART Programme in Victoria

    International Nuclear Information System (INIS)

    Sinclair, C.; Dobbinson, S.; Montague, M.

    2000-01-01

    SunSmart is a programme of the Anti-Cancer Council of Victoria. It is an evidence-based health promotion programme where decisions about the form and content of the programme are influenced by available evidence and community consultation processes. A systematic evaluation and research strategy is in place to ensure that as much information as possible is available on process, impact and outcomes. Over the past 19 years the Anti-Cancer Council of Victoria has made a substantial impact in Victoria in relation to sun protection. It is one of the very few campaigns that has been able to demonstrate substantial changes not only in behaviour and attitudes but also in the downturn of skin cancer rates. Substantial sustainable changes have also occurred in the physical landscape as public authorities and commercial operators design their environment to be as sun protective as possible. This paper focuses on the key strategies that have encouraged positive change in the behaviour and attitudes of the Victorian population and the research that has documented the outcomes. (author)

  16. Tourist Perceptions On Supporting Infrastructure Facilities And Climate-Based Visiting Time Of Ngebel Lake, Ponorogo

    Directory of Open Access Journals (Sweden)

    Ardhila Ayu Prasetyowati

    2014-04-01

    Full Text Available This study aims to analyze the tourists’ perception about the importance and satisfaction on the product of fisheries tourism, and to assess the visiting time of tourist based on climate conditions. The research was conducted in May to June 2013 in Ngebel Lake, Ponorogo. We used descriptive quantitative approach, with 45 respondents. Data collected from interview, questionnaire and observation. Analytical methods were used to determine the perception of tourists on the satisfaction and interest in fisheries tourism products, i.e. Importance Performance Analysis (IPA. We also used Tourism Climate Index (TCI to determine the visiting time of tourist. The results show the value of satisfaction and tourist interest is low, therefore the improvement of several aspects become important. It is encompasses: a the existence of parking area; b the condition of Ngebel Lake; c planning and management system, the condition of the local community; and d activities of fish course restaurant and fish farming system of floating net cages. TCI value indicates ideal conditions for tourists traveled in Ngebel Lake is in November (convenience index value of 106, in December (97 and in April (94. This appropriate time to visit Ngebel Lake is expected to create a good impression for the tourists and enjoy the various fisheries activities in Ngebel Lake. Keywords: Importance Performance Analysis, Ngebel Lake, Tourist Climate Index

  17. Information support of territorial wildlife management of Lake Baikal and the surrounding areas (Russia)

    Science.gov (United States)

    Lesnykh, Svetlana

    2013-04-01

    The UNESCO World Heritage Committee inscribed Lake Baikal in the World Heritage List under all four natural criteria as the most outstanding example of a freshwater ecosystem. It is the oldest and deepest lake in the world, which is the main freshwater reserve surrounded by a system of protected areas that have high scientific and natural values. However, there is a conflict between three main interests within the territory: the preservation of the unique ecosystem of the lake and its surrounding areas, the need for regional economic development, and protection of interests of the population, living on the shores of Lake Baikal. Solutions to the current challenges are seen in the development of control mechanisms for the wildlife management to ensure sustainable development and conservation of lake and the surrounding regions. For development mechanisms of territorial management of the complex and valuable area it is necessary to analyze features of its functioning and self-control (adaptable possibilities), allowing ecosystems to maintain their unique properties under influence of various external factors: anthropogenic (emissions, waste water, streams of tourists) and natural (climate change) load. While determining the direction and usage intensity of the territory these possibilities and their limits should be considered. Also for development of management strategy it is necessary to consider the relation of people to land and water, types of wildlife management, ownership, rent, protection from the negative effects, and etc. The relation of people to the natural area gives a chance to prioritize the direction in the resource use and their protection. Results of the scientific researches (reaction of an ecosystem on influence of various factors and system of relations to wildlife management objects) are the basis for the nature protection laws in the field of wildlife management and environmental protection. The methodology of legal zoning of the territory was

  18. Neoliberal policies and urban reconfigurations. Victoria, San Fernando, province of Buenos Aires, a city understood from theory

    Directory of Open Access Journals (Sweden)

    Laura Ester Donadío

    2016-07-01

    Full Text Available This article aims to explain from a theoretical conceptual approach the particularities that exist in Victoria, San Fernando, Buenos Aires, from its urban production. Through a series of field works, semi-structured interviews and observations, it was possible to perceive that in this locality, there are three logics of city production, market, state and necessity, according to Abramo, P. (2002. The post-development cities of Latin America, a space in which constant tensions are generated that alter the harmonious development of daily life and the interaction of those who inhabit the area. On the other hand, it is also perceived that the inhabitants naturalize that way of life, their spatial disposition, the progressive privatization of public areas and the proliferation of closed housing estates. Here is a quote that we have heard repeatedly in interviews with the neighbors: "No one in Victoria gives a ball to anyone." At the moment of understanding Victoria from the theory, we take into account such concepts as the "heterotopy" of Foucault M. (1967 - understood as the juxtaposition of spaces that would be incompatible -the term "com-fusa city" (Abramo P. - as an urban structure that interweaves two traditional models (the Mediterranean compact and the Anglo-Saxon diffused, the notion of "privatopia" by I.Rodriguez Chumillas (2005 and E. Mckenzie (1994 as private spatial consolidation, and finally the concepts: informative and dual cities of R Castells (1995 terms that emerge from the process of globalization, which may be useful to think about the reality of Victoria .

  19. Genetic analyses of resistance against Leptopilina victoriae in Drosophila bipectinata.

    Science.gov (United States)

    Takigahira, Tomohiro; Kohyama, Tetsuo I; Suwito, Awit; Kimura, Masahito T

    2015-06-01

    Drosophila bipectinata from Iriomote-jima (IR) is susceptible to the endoparasitoid Leptopilina victoriae from Kota Kinabalu (L. victoriae KK), but D. bipectinata from Kota Kinabalu (KK) and Bogor (BG) is resistant. The cross experiments between the resistant (KK) and susceptible (IR) populations of D. bipectinata suggested that the resistance to this parasitoid is a dominant trait and controlled by a single locus or few linked loci on an autosome. In the AFLP analysis using the IR, KK and BG populations of D. bipectinata and the resistant and susceptible populations derived from a mixed population of these three geographic populations, a DNA fragment almost specific to susceptible flies was detected. It also revealed that genes from the IR population were more frequently maintained in the mixed population compared with those from the KK and BG populations, suggesting that at least a number of genes from the IR population are more advantageous under the laboratory conditions. This explains our previous results that the resistance was lowered in the mixed population although the resistance itself is suggested to incur only low costs; i.e., the resistance gene(s) from the KK and BG populations would have been linked with some genes that are disadvantageous under the laboratory conditions.

  20. Surviving neoliberalism, maintaining values: Community health mergers in Victoria, Australia.

    Science.gov (United States)

    Roussy, Véronique; Livingstone, Charles

    2018-04-01

    Independent, not-for-profit community health services in the state of Victoria, Australia, provide one of that country's few models of comprehensive primary health care (PHC). Recent amalgamations among some such agencies created regional-sized community health organisations, in a departure from this sector's traditionally small local structure. This study explored the motivations, desired outcomes, and decision-making process behind these mergers. Qualitative exploratory study was based on 26 semistructured interviews with key informants associated with 2 community health mergers, which took place in 2014 in Victoria, Australia. Thematic data analysis was influenced by concepts derived from institutional theory. Becoming bigger by merging was viewed as the best way to respond to mounting external pressures, such as increasingly neoliberal funding mechanisms, perceived as threatening survival. Desired outcomes were driven by comprehensive PHC values, and related to creating organisational capacity to continue providing quality services to disadvantaged communities. This study offers insights into decision-making processes geared towards protecting the comprehensiveness of PHC service delivery for disadvantaged communities, ensuring financial viability, and surviving neoliberal economic policy whilst preserving communitarian values. These are relevant to an international audience, within a global context of rising health inequities, increasingly tight fiscal environments, and growing neoliberal influences on health policymaking and funding. Copyright © 2018 John Wiley & Sons, Ltd.

  1. Layers of 'Cabo Frio' in 'Victoria Crater'

    Science.gov (United States)

    2006-01-01

    This view of 'Victoria crater' is looking southeast from 'Duck Bay' towards the dramatic promontory called 'Cabo Frio.' The small crater in the right foreground, informally known as 'Sputnik,' is about 20 meters (about 65 feet) away from the rover, the tip of the spectacular, layered, Cabo Frio promontory itself is about 200 meters (about 650 feet) away from the rover, and the exposed rock layers are about 15 meters (about 50 feet) tall. This is an approximately true color rendering of images taken by the panoramic camera (Pancam) on NASA's Mars Exploration Rover Opportunity during the rover's 952nd sol, or Martian day, (Sept. 28, 2006) using the camera's 750-nanometer, 530-nanometer and 430-nanometer filters.

  2. Terrestrial CDOM in Lakes of Yamal Peninsula: Connection to Lake and Lake Catchment Properties

    Directory of Open Access Journals (Sweden)

    Yury Dvornikov

    2018-01-01

    Full Text Available In this study, we analyze interactions in lake and lake catchment systems of a continuous permafrost area. We assessed colored dissolved organic matter (CDOM absorption at 440 nm (a(440CDOM and absorption slope (S300–500 in lakes using field sampling and optical remote sensing data for an area of 350 km2 in Central Yamal, Siberia. Applying a CDOM algorithm (ratio of green and red band reflectance for two high spatial resolution multispectral GeoEye-1 and Worldview-2 satellite images, we were able to extrapolate the a(λCDOM data from 18 lakes sampled in the field to 356 lakes in the study area (model R2 = 0.79. Values of a(440CDOM in 356 lakes varied from 0.48 to 8.35 m−1 with a median of 1.43 m−1. This a(λCDOM dataset was used to relate lake CDOM to 17 lake and lake catchment parameters derived from optical and radar remote sensing data and from digital elevation model analysis in order to establish the parameters controlling CDOM in lakes on the Yamal Peninsula. Regression tree model and boosted regression tree analysis showed that the activity of cryogenic processes (thermocirques in the lake shores and lake water level were the two most important controls, explaining 48.4% and 28.4% of lake CDOM, respectively (R2 = 0.61. Activation of thermocirques led to a large input of terrestrial organic matter and sediments from catchments and thawed permafrost to lakes (n = 15, mean a(440CDOM = 5.3 m−1. Large lakes on the floodplain with a connection to Mordy-Yakha River received more CDOM (n = 7, mean a(440CDOM = 3.8 m−1 compared to lakes located on higher terraces.

  3. Acid rain stimulation of Lake Michigan phytoplankton growth

    Science.gov (United States)

    Manny, Bruce A.; Fahnenstiel, G.L.; Gardner, W.S.

    1987-01-01

    Three laboratory experiments demonstrated that additions of rainwater to epilimnetic lake water collected in southeastern Lake Michigan stimulated chlorophyll a production more than did additions of reagent-grade water during incubations of 12 to 20 d. Chlorophyll a production did not begin until 3–5 d after the rain and lake water were mixed. The stimulation caused by additions of rain acidified to pH 3.0 was greater than that caused by additions of untreated rain (pH 4.0–4.5). Our results support the following hypotheses: (1) Acid rain stimulates the growth of phytoplankton in lake water; (2) phosphorus in rain appears to be the factor causing this stimulation. We conclude that acid rain may accelerate the growth of epilimnetic phytoplankton in Lake Michigan (and other similar lakes) during stratification when other sources of bioavailable phosphorus to the epilimnion are limited

  4. Lake sediments as natural seismographs: Earthquake-related deformations (seismites) in central Canadian lakes

    Science.gov (United States)

    Doughty, M.; Eyles, N.; Eyles, C. H.; Wallace, K.; Boyce, J. I.

    2014-11-01

    -transparent postglacial silty-clay laminations. Postglacial neotectonic activity is recorded by co-seismic water-escape structures, faults, slumps and debris flows in Lake Simcoe (above a terrane boundary) and especially within lakes Timiskaming and Kipawa, recording ongoing deformation within the WQSZ. High resolution seismo-stratigraphic data presented here support the model that ongoing mid-plate earthquake activity is a consequence of brittle deformation of the upper crust of the North American plate. Such activity appears to have been greatest during deglaciation but continues today.

  5. Lake Granbury and Lake Whitney Assessment Initiative Final Scientific/Technical Report Summary

    Energy Technology Data Exchange (ETDEWEB)

    Harris, B. L. [Texas AgriLife Research, College Station, TX (United States); Roelke, Daniel [Texas AgriLife Research, College Station, TX (United States); Brooks, Bryan [Texas AgriLife Research, College Station, TX (United States); Grover, James [Texas AgriLife Research, College Station, TX (United States)

    2010-10-11

    blooms. Our numerical modeling results support the idea that cyanobacteria, through allelopathy, control the timing of golden algae blooms in Lake Granbury. The in-lake experiments in Lake Whitney and Lake Waco also revealed that as golden algae blooms develop, there are natural enemies (a species of rotifer, and a virus) that help slow the population growth. Again, better characterization of these organisms is a high priority as it may be key to managing golden algae blooms. Our laboratory and in-lake experiments and field monitoring have shown that nutrient additions will remove toxicity and prevent golden algae from blooming. In fact, other algae displace the golden algae after nutrient additions. Additions of ammonia are particularly effective, even at low doses (much lower than what is employed in fish hatchery ponds). Application of ammonia in limited areas of lakes, such as in coves, should be explored as a management option. The laboratory experiments and field monitoring also show that the potency of toxins produced by P. parvum is greatly reduced when water pH is lower, closer to neutral levels. Application of mild acid to limited areas of lakes (but not to a level where acidic conditions are created), such as in coves, should be explored as a management option. Finally, our field monitoring and mathematical modeling revealed that flushing/dilution at high enough levels could prevent P. parvum from forming blooms and/or terminate existing blooms. This technique could work using deeper waters within a lake to flush the surface waters of limited areas of the same lakes, such as in coves and should be explored as a management option. In this way, water releases from upstream reservoirs would not be necessary and there would be no addition of nutrients in the lake.

  6. Projected shifts in fish species dominance in Wisconsin lakes under climate change

    Science.gov (United States)

    Hansen, Gretchen JA; Read, Jordan S.; Hansen, Jonathan F.; Winslow, Luke

    2016-01-01

    Temperate lakes may contain both coolwater fish species such as walleye (Sander vitreus) and warmwater fish species such as largemouth bass (Micropterus salmoides). Recent declining walleye and increasing largemouth bass populations have raised questions regarding the future trajectories and management actions for these species. We developed a thermodynamic model of water temperatures driven by downscaled climate data and lake-specific characteristics to estimate daily water temperature profiles for 2148 lakes in Wisconsin, US, under contemporary (1989–2014) and future (2040–2064 and 2065–2089) conditions. We correlated contemporary walleye recruitment and largemouth bass relative abundance to modeled water temperature, lake morphometry, and lake productivity, and projected lake-specific changes in each species under future climate conditions. Walleye recruitment success was negatively related and largemouth bass abundance was positively related to water temperature degree days. Both species exhibited a threshold response at the same degree day value, albeit in opposite directions. Degree days were predicted to increase in the future, although the magnitude of increase varied among lakes, time periods, and global circulation models (GCMs). Under future conditions, we predicted a loss of walleye recruitment in 33–75% of lakes where recruitment is currently supported and a 27–60% increase in the number of lakes suitable for high largemouth bass abundance. The percentage of lakes capable of supporting abundant largemouth bass but failed walleye recruitment was predicted to increase from 58% in contemporary conditions to 86% by mid-century and to 91% of lakes by late century, based on median projections across GCMs. Conversely, the percentage of lakes with successful walleye recruitment and low largemouth bass abundance was predicted to decline from 9% of lakes in contemporary conditions to only 1% of lakes in both future periods. Importantly, we identify up

  7. Three Licentiates of the Royal College of Surgeons of Edinburgh who were decorated with the Victoria Cross.

    Science.gov (United States)

    Kaufman, M H

    2011-08-01

    Since the Victoria Cross was introduced in January 1856 by Queen Victoria to reward acts of valour in the face of the enemy, initially during the Crimean War, over 1350 medals have been awarded. Of these, three were awarded to medical officers who had previously gained the Licentiate Diploma of the Royal College of Surgeons of Edinburgh (LRCS Edin) - Valentine Munbee McMaster on 25 September 1857, Henry Thomas Sylvester on 20 November 1857 (although the acts of valour for which he was awarded his VC occurred on two occasions in September 1855) and Campbell Mellis (or Millis) Douglas on 7 May 1867.

  8. Effectiveness of a refuge for Lake Trout in Western Lake Superior II: Simulation of future performance

    Science.gov (United States)

    Akins, Andrea L; Hansen, Michael J.; Seider, Michael J.

    2015-01-01

    Historically, Lake Superior supported one of the largest and most diverse Lake Trout Salvelinus namaycush fisheries in the Laurentian Great Lakes, but Lake Trout stocks collapsed due to excessive fishery exploitation and predation by Sea Lampreys Petromyzon marinus. Lake Trout stocking, Sea Lamprey control, and fishery regulations, including a refuge encompassing Gull Island Shoal (Apostle Islands region), were used to enable recovery of Lake Trout stocks that used this historically important spawning shoal. Our objective was to determine whether future sustainability of Lake Trout stocks will depend on the presence of the Gull Island Shoal Refuge. We constructed a stochastic age-structured simulation model to assess the effect of maintaining the refuge as a harvest management tool versus removing the refuge. In general, median abundances of age-4, age-4 and older (age-4+), and age-8+ fish collapsed at lower instantaneous fishing mortality rates (F) when the refuge was removed than when the refuge was maintained. With the refuge in place, the F that resulted in collapse depended on the rate of movement into and out of the refuge. Too many fish stayed in the refuge when movement was low (0–2%), and too many fish became vulnerable to fishing when movement was high (≥22%); thus, the refuge was more effective at intermediate rates of movement (10–11%). With the refuge in place, extinction did not occur at any simulated level of F, whereas refuge removal led to extinction at all combinations of commercial F and recreational F. Our results indicate that the Lake Trout population would be sustained by the refuge at all simulated F-values, whereas removal of the refuge would risk population collapse at much lower F (0.700–0.744). Therefore, the Gull Island Shoal Refuge is needed to sustain the Lake Trout population in eastern Wisconsin waters of Lake Superior.

  9. Mixed stock analysis of Lake Michigan's Lake Whitefish Coregonus clupeaformis commercial fishery

    Science.gov (United States)

    Andvik, Ryan; Sloss, Brian L.; VanDeHey, Justin A.; Claramunt, Randall M.; Hansen, Scott P.; Isermann, Daniel A.

    2016-01-01

    Lake whitefish (Coregonus clupeaformis) support the primary commercial fishery in Lake Michigan. Discrete genetic stocks of lake whitefish have been identified and tagging data suggest stocks are mixed throughout much of the year. Our objectives were to determine if (1) differential stock harvest occurs in the commercial catch, (2) spatial differences in genetic composition of harvested fish were present, and (3) seasonal differences were present in the harvest by commercial fisheries that operate in management zones WI-2 and WFM-01 (Green Bay, Lake Michigan). Mixed stock analysis was conducted on 17 commercial harvest samples (n = 78–145/sample) collected from various ports lake-wide during 2009–2010. Results showed significant mixing with variability in stock composition across most samples. Samples consisted of two to four genetic stocks each accounting for ≥ 10% the catch. In 10 of 17 samples, the stock contributing the largest proportion made up differences existed in the proportional stock contribution at a single capture location. Samples from Wisconsin's primary commercial fishing management zone (WI-2) were composed predominately of fish from the Big Bay de Noc (Michigan) stock as opposed to the geographically proximate, North–Moonlight Bay (Wisconsin) stock. These findings have implications for management and allocation of fish to various quotas. Specifically, geographic location of harvest, the current means of allocating harvest quotas, is not the best predictor of genetic stock harvest.

  10. Sanctuaries for lake trout in the Great Lakes

    Science.gov (United States)

    Stanley, Jon G.; Eshenroder, Randy L.; Hartman, Wilbur L.

    1987-01-01

    Populations of lake trout, severely depleted in Lake Superior and virtually extirpated from the other Great Lakes because of sea lamprey predation and intense fishing, are now maintained by annual plantings of hatchery-reared fish in Lakes Michigan, Huron, and Ontario and parts of Lake Superior. The extensive coastal areas of the Great Lakes and proximity to large populations resulted in fishing pressure on planted lake trout heavy enough to push annual mortality associated with sport and commercial fisheries well above the critical level needed to reestablish self-sustaining stocks. The interagency, international program for rehabilitating lake trout includes controlling sea lamprey abundance, stocking hatchery-reared lake trout, managing the catch, and establishing sanctuaries where harvest is prohibited. Three lake trout sanctuaries have been established in Lake Michigan: the Fox Island Sanctuary of 121, 500 ha, in the Chippewa-Ottawa Treaty fishing zone in the northern region of the lake; the Milwaukee Reef Sanctuary of 160, 000 ha in midlake, in boundary waters of Michigan and Wisconsin; and Julian's Reef Sanctuary of 6, 500 ha, in Illinois waters. In northern Lake Huron, Drummond Island Sanctuary of 55, 000 ha is two thirds in Indian treaty-ceded waters in Michigan and one third in Ontario waters of Canada. A second sanctuary, Six Fathom Bank-Yankee Reef Sanctuary, in central Lake Huron contains 168, 000 ha. Sanctuary status for the Canadian areas remains to be approved by the Provincial government. In Lake Superior, sanctuaries protect the spawning grounds of Gull Island Shoal (70, 000 ha) and Devils Island Shoal (44, 000 ha) in Wisconsin's Apostle Island area. These seven sanctuaries, established by the several States and agreed upon by the States, Indian tribes, the U.S. Department of the Interior, and the Province of Ontario, contribute toward solving an interjurisdictional fishery problem.

  11. Did the use of chloroform by Queen Victoria influence its acceptance in obstetric practice?

    Science.gov (United States)

    Connor, H; Connor, T

    1996-10-01

    Examination of contemporaneous publications suggests that the use of chloroform by Queen Victoria in 1853 did not result in the major breakthrough in the acceptability of obstetric anaesthesia with which the event has been credited by some later writers.

  12. Biodiversity of the Hypersaline Urmia Lake National Park (NW Iran

    Directory of Open Access Journals (Sweden)

    Alireza Asem

    2014-02-01

    Full Text Available Urmia Lake, with a surface area between 4000 to 6000 km2, is a hypersaline lake located in northwest Iran. It is the saltiest large lake in the world that supports life. Urmia Lake National Park is the home of an almost endemic crustacean species known as the brine shrimp, Artemia urmiana. Other forms of life include several species of algae, bacteria, microfungi, plants, birds, reptiles, amphibians and mammals. As a consequence of this unique biodiversity, this lake has been selected as one of the 59 biosphere reserves by UNESCO. This paper provides a comprehensive species checklist that needs to be updated by additional research in the future.

  13. Great Lakes rivermouths: a primer for managers

    Science.gov (United States)

    Pebbles, Victoria; Larson, James; Seelbach, Paul; Pebbles, Victoria; Larson, James; Seelbach, Paul

    2013-01-01

    Between the North American Great Lakes and their tributaries are the places where the confluence of river and lake waters creates a distinct ecosystem: the rivermouth ecosystem. Human development has often centered around these rivermouths, in part, because they provide a rich array of ecosystem services. Not surprisingly, centuries of intense human activity have led to substantial pressures on, and alterations to, these ecosystems, often diminishing or degrading their ecological functions and associated ecological services. Many Great Lakes rivermouths are the focus of intense restoration efforts. For example, 36 of the active Great Lakes Areas of Concern (AOCs) are rivermouths or areas that include one or more rivermouths. Historically, research of rivermouth ecosystems has been piecemeal, focused on the Great Lakes proper or on the upper reaches of tributaries, with little direct study of the rivermouth itself. Researchers have been divided among disciplines, agencies and institutions; and they often work independently and use disparate venues to communicate their work. Management has also been fragmented with a focus on smaller, localized, sub-habitat units and socio-political or economic elements, rather than system-level consideration. This Primer presents the case for a more holistic approach to rivermouth science and management that can enable restoration of ecosystem services with multiple benefits to humans and the Great Lakes ecosystem. A conceptual model is presented with supporting text that describes the structures and processes common to all rivermouths, substantiating the case for treating these ecosystems as an identifiable class.1 Ecological services provided by rivermouths and changes in how humans value those services over time are illustrated through case studies of two Great Lakes rivermouths—the St. Louis River and the Maumee River. Specific ecosystem services are identified in italics throughout this Primer and follow definitions described

  14. Preliminary isotopic study of Lake Asal system (Republic of Djibouti)

    International Nuclear Information System (INIS)

    Fontes, J.C.; Zuppi, G.M.; Florkowski, T.; Pouchan, P.

    1979-01-01

    The saline Lake Asal at 155 m below sea level in the Afar Rift (Republic of Djibouti) is fed mainly by sea water. In spite of the intense evaporation (about 3 m annually), the 18 O and deuterium enrichments of the lake water are relatively low, because of the reduced activity of water as a consequence of the high salt content. Isotopic balance of the lake, as well as lithium and sulphate balances, support the hypothesis of leakages from the lake of about 15 to 20% of the inflow. (author)

  15. The Killing of the Workers' Educational Association of Victoria: A Myth Challenged

    Science.gov (United States)

    Dadswell, Gordon

    2004-01-01

    On 21 March 1941, the Council of the Workers' Educational Association of Victoria, Australia, (the Association) voted the organisation out of existence. The demise was in no way contemplated, and there was no practical reason why the Council acted in the way it did. This paper is the story of the destruction of a successful adult education…

  16. Evolution of alkaline lakes - Lake Van case study

    Science.gov (United States)

    Tillman Meyer, Felix; Viehberg, Finn; Bahroun, Sonya; Wolf, Annabel; Immenhauser, Adrian; Kwiecien, Ola

    2017-04-01

    Lake Van in Eastern Anatolia (Turkey) is the largest terminal soda lake on Earth. The lake sedimentary profile covers ca. 600 ka (Stockhecke et al. 2014) Based on lithological changes, the presence of freshwater microfossils and close-to-freshwater pH value in the pore water, members of ICDP PALEOVAN concluded that Lake Van might have started as an open lake. Here we show paleontological and geochemical evidence in favour of this idea and constrain the time, when Lake Van likely transformed into a closed lake. Additionally we provide the first conceptual model of how this closure may have happened. Our archives of choice are inorganic and biogenic carbonates, separated by wet sieving. We identified microfossil assemblages (fraction > 125 µm) and performed high-resolution oxygen isotope (delta18O) and elemental (Mg/Ca, Sr/Ca) analyses of the fraction plants growing in the photic zone as food supply. These two aspects point to an increasing salinity in a shallowing lake. The delta18O values of inorganic carbonates are relatively low during the initial phase of Lake Van and increase abruptly (ca. 7‰) after 530 ka BP. At approximately the same time combination of Sr/Ca and Mg/Ca data suggest first occurrence of aragonite. Again, these findings suggest geochemical changes of the lake water concurrent with transition documented by microfossils. Comparison between Lake Van and Lake Ohrid (Lacey et al. 2016) delta18O data, precludes regional climate change (e.g.: increased evaporation) as the main driver of observed changes. With no evidence for increased volcanic or tectonic activity (e.g.: tephra layers, deformation structures, slumping) in the Lake Van sedimentary profile around 530 ka, it seems unlikely that a pyroclastic flow blocked the outflow of the lake. Alternatively, a portion of inflow has been diverged which might have caused a change in the hydrological balance and lake level falling below its outlet. However, as no geomorphological data confirming this

  17. The importance of terrestrial carbon in supporting molluscs in the wetlands of Poyang Lake

    Science.gov (United States)

    Zhang, Huan; Yu, Xiubo; Wang, Yuyu; Xu, Jun

    2017-07-01

    Allochthonous organic matter plays an important role in nutrient cycling and energy mobilization in freshwater ecosystems. However, the subsidies of this carbon source in floodplain ecosystems have not yet well understood. We used a Bayesian mixing model and stable isotopes (δ13C and δ15N) of primary food resources and dominant molluscs species, to estimate the relative importance of allochthonous carbon sources for consumers in a representative sub-lake of Poyang Lake during a prolonged dry season. Our study inferred that terrestrial-derived carbon from Carex spp. could be the primary contributor to snails and mussels in Dahuchi Lake. The mean percentage of allochthonous food resources accounted for 35%-50% of the C incorporated by these consumers. Seston was another important energy sources for benthic consumers. However, during the winter and low water-level period, benthic algae and submerged vegetation contributed less carbon to benthic consumers. Our data highlighted the importance of terrestrial organic carbon to benthic consumers in the wetlands of Poyang Lake during the prolonged dry period. Further, our results provided a perspective that linkages between terrestrial and aquatic ecosystems might be facilitated by wintering geese via their droppings.

  18. Bathymetry of Lake Erie and Lake Saint Clair

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry of Lake Erie and Lake Saint Clair has been compiled as a component of a NOAA project to rescue Great Lakes lake floor geological and geophysical data and...

  19. A recovery-based outreach program in rural Victoria.

    Science.gov (United States)

    Prabhu, Radha; Browne, Mark Oakley

    2007-04-01

    A recovery-based outreach program for people with severe mental illness in regional Victoria is described. The paper covers a description of the program, the services provided and outcomes achieved. The program emphasized active collaboration between patients and clinicians as outlined in the collaborative recovery model and recognized that recovery from mental illness is an individual, personal process. The program provided service to 108 people over 3 years and had a positive impact on clinicians, patients and carers. The benefits of recovery orientation, multidisciplinary teams, collaborative relationships and carer involvement are discussed. The paper highlights the need for a focus on recovery and comprehensive care for people with severe mental illness.

  20. Science support for evaluating natural recovery of polychlorinated biphenyl concentrations in fish from Crab Orchard Lake, Crab Orchard National Wildlife Refuge, Illinois

    Science.gov (United States)

    Kunz, Bethany K.; Hinck, Jo E.; Calfee, Robin D.; Linder, Greg L.; Little, Edward E.

    2018-05-11

    .S. Fish and Wildlife Service sought technical support to understand environmental drivers of current (2017) PCB residues in fish tissue and patterns in PCB residues through time to inform the fish-consumption advisory for Crab Orchard Lake. This project is planned in two phases (Tasks 1 and 2); the first phase is included in this report.Task 1, reported here, includes a review of existing literature and a brief overview focused on environmental and biochemical/physiological processes that drive PCB residues in fish tissue. This review specifically targets processes that are relevant for freshwater lacustrine environments such as those at Crab Orchard Lake. In addition to discussions of environmental fate, metabolism, and accumulation of PCBs, this review includes a brief scientifically based explanation of approaches used to establish fish-consumption advisories.A planned second task (Task 2) will include a compilation and summary of existing data on PCB residues in fish tissue samples from Crab Orchard Lake. This summary will also place Crab Orchard Lake data in a broader geographic context through a comparison with fish data from other Midwestern lakes.When Task 1 and Task 2 are complete, resource managers will have (a) a synthesis of existing literature that characterizes the processes influencing the fate of residual PCBs remaining in systems such as Crab Orchard Lake, (b) a summary of natural PCB attenuation processes for use in risk communication with the public, and (c) a summary of existing data on PCBs in fish tissues from Crab Orchard Lake, including exploratory plots of tissue residues through time. Overall, this project will provide data to help resource managers better understand the ecological and public health consequences of residual PCBs in Crab Orchard Lake.

  1. Do invasive mussels restrict offshore phosphorus transport in Lake Huron?

    Science.gov (United States)

    Cha, Yoonkyung; Stow, Craig A; Nalepa, Thomas F; Reckhow, Kenneth H

    2011-09-01

    Dreissenid mussels were first documented in the Laurentian Great Lakes in the late 1980s. Zebra mussels (Dreissena polymorpha) spread quickly into shallow, hard-substrate areas; quagga mussels (Dreissena rostriformis bugensis) spread more slowly and are currently colonizing deep, offshore areas. These mussels occur at high densities, filter large water volumes while feeding on suspended materials, and deposit particulate waste on the lake bottom. This filtering activity has been hypothesized to sequester tributary phosphorus in nearshore regions reducing offshore primary productivity. We used a mass balance model to estimate the phosphorus sedimentation rate in Saginaw Bay, a shallow embayment of Lake Huron, before and after the mussel invasion. Our results indicate that the proportion of tributary phosphorus retained in Saginaw Bay increased from approximately 46-70% when dreissenids appeared, reducing phosphorus export to the main body of Lake Huron. The combined effects of increased phosphorus retention and decreased phosphorus loading have caused an approximate 60% decrease in phosphorus export from Saginaw Bay to Lake Huron. Our results support the hypothesis that the ongoing decline of preyfish and secondary producers including diporeia (Diporeia spp.) in Lake Huron is a bottom-up phenomenon associated with decreased phosphorus availability in the offshore to support primary production.

  2. STOCK ENHANCEMENT IN INDONESIAN LAKE AND RESERVOIRS FISHERIES

    Directory of Open Access Journals (Sweden)

    Endi Setiadi Kartamihardja

    2012-12-01

    enhancement including providing quality and quantity of seeds, regulating of fish catch, developin g of market system, institution and fisheries co-management have supported a steady yearly increase in yield. The governments should take the initiative in protection of genetic diversity, especially in stock enhancement of lakes inhabited by endemic and or threatened species, such as lakes in Sulawesi and Papua Island.

  3. Towards understanding hydroclimatic change in Victoria, Australia – preliminary insights into the "Big Dry"

    Directory of Open Access Journals (Sweden)

    A. S. Kiem

    2010-03-01

    Full Text Available Since the mid-1990s the majority of Victoria, Australia, has experienced severe drought conditions (i.e. the "Big Dry" characterized by streamflow that is the lowest in approximately 80 years of record. While decreases in annual and seasonal rainfall totals have also been observed, this alone does not seem to explain the observed reduction in flow. In this study, we investigate the large-scale climate drivers for Victoria and demonstrate how these modulate the regional scale synoptic patterns, which in turn alter the way seasonal rainfall totals are compiled and the amount of runoff per unit rainfall that is produced. The hydrological implications are significant and illustrate the need for robust hydrological modelling, that takes into account insights into physical mechanisms that drive regional hydroclimatology, in order to properly understand and quantify the impacts of climate change (natural and/or anthropogenic on water resources.

  4. Community energy plan : village of Burns Lake

    International Nuclear Information System (INIS)

    Rivard, B.

    2008-09-01

    Climate change has a significant impact on the lives of Canadians and their economies. In northern British Columbia, the ability to grow, process and transport food will likely change. The rising cost of fuel and other natural resources will create a need for more resilient communities. This report presented a community energy plan for Burns Lake in order to provide the first steps toward building on an already resilient community. The report answered questions about Burns Lake's energy consumption and greenhouse gas (GHG) emissions as well as the community's views on energy issues. The report provided background information on the Village of Burns Lake and discussed climate change in Burns Lake, energy use, and greenhouse gas emissions. The report also described community engagement by way of a questionnaire on fuel prices, homes and public opinion in Burns Lake. A strategy was also outlined. It was concluded that the village of Burns Lake is well positioned to face challenges regarding future energy use. The community is looking to the municipality for support and leadership, in order to deliver through active opportunities to reduce greenhouse gas emissions. 6 figs., 4 appendices.

  5. Decadal oscillation of lakes and aquifers in the upper Great Lakes region of North America: hydroclimatic implications

    Science.gov (United States)

    Watras, C.J.; Read, J.S.; Holman, K.D.; Liu, Z.; Song, Y.-Y.; Watras, A.J.; Morgan, S.; Stanley, E.H.

    2014-01-01

    We report a unique hydrologic time-series which indicates that water levels in lakes and aquifers across the upper Great Lakes region of North America have been dominated by a climatically-driven, near-decadal oscillation for at least 70 years. The historical oscillation (~13y) is remarkably consistent among small seepage lakes, groundwater tables and the two largest Laurentian Great Lakes despite substantial differences in hydrology. Hydrologic analyses indicate that the oscillation has been governed primarily by changes in the net atmospheric flux of water (P-E) and stage-dependent outflow. The oscillation is hypothetically connected to large-scale atmospheric circulation patterns originating in the mid-latitude North Pacific that support the flux of moisture into the region from the Gulf of Mexico. Recent data indicate an apparent change in the historical oscillation characterized by a ~12y downward trend beginning in 1998. Record low water levels region-wide may mark the onset of a new hydroclimatic regime.

  6. Critical influences on succession management for non-commissioned ranks within Victoria police

    OpenAIRE

    Owbridge, Lynne Michelle

    2017-01-01

    This thesis examines issues affecting succession management within noncommissioned ranks (NCRs) of policing services. Using Victoria Police (VicPol) as a case study, this research explored the organisation's capacity to build individual and organisational capability through adequate recruitment of new police, professional learning, and retaining talent within NCRs. A grounded theory approach was used to explore VicPol's recruitment, foundation training, transfer, promotion, ...

  7. Glacial lake inventory and lake outburst potential in Uzbekistan.

    Science.gov (United States)

    Petrov, Maxim A; Sabitov, Timur Y; Tomashevskaya, Irina G; Glazirin, Gleb E; Chernomorets, Sergey S; Savernyuk, Elena A; Tutubalina, Olga V; Petrakov, Dmitriy A; Sokolov, Leonid S; Dokukin, Mikhail D; Mountrakis, Giorgos; Ruiz-Villanueva, Virginia; Stoffel, Markus

    2017-08-15

    Climate change has been shown to increase the number of mountain lakes across various mountain ranges in the World. In Central Asia, and in particular on the territory of Uzbekistan, a detailed assessment of glacier lakes and their evolution over time is, however lacking. For this reason we created the first detailed inventory of mountain lakes of Uzbekistan based on recent (2002-2014) satellite observations using WorldView-2, SPOT5, and IKONOS imagery with a spatial resolution from 2 to 10m. This record was complemented with data from field studies of the last 50years. The previous data were mostly in the form of inventories of lakes, available in Soviet archives, and primarily included localized in-situ data. The inventory of mountain lakes presented here, by contrast, includes an overview of all lakes of the territory of Uzbekistan. Lakes were considered if they were located at altitudes above 1500m and if lakes had an area exceeding 100m 2 . As in other mountain regions of the World, the ongoing increase of air temperatures has led to an increase in lake number and area. Moreover, the frequency and overall number of lake outburst events have been on the rise as well. Therefore, we also present the first outburst assessment with an updated version of well-known approaches considering local climate features and event histories. As a result, out of the 242 lakes identified on the territory of Uzbekistan, 15% are considered prone to outburst, 10% of these lakes have been assigned low outburst potential and the remainder of the lakes have an average level of outburst potential. We conclude that the distribution of lakes by elevation shows a significant influence on lake area and hazard potential. No significant differences, by contrast, exist between the distribution of lake area, outburst potential, and lake location with respect to glaciers by regions. Copyright © 2017 Elsevier B.V. All rights reserved.

  8. Mitochondrial DNA phylogeography of lake cisco (Coregonus artedi): evidence supporting extensive secondary contacts between two glacial races.

    Science.gov (United States)

    Turgeon, J; Bernatchez, L

    2001-04-01

    The comparative molecular phylogeography of regional fish fauna has revealed the wide distribution of young clades in freshwater fishes of formerly glaciated areas as well as interspecific incongruences in their refugial origins and recolonization routes. In this study, we employed single-strand conformation polymorphism (SSCP) and sequence analyses to describe mitochondrial DNA (mtDNA) polymorphism among 27 populations of the lake cisco (Coregonus artedi) from its entire range of distribution in order to evaluate the hypothesis of dual glacial refuges proposed by Bernatchez & Dodson against the traditional view that this species is solely of Mississippian origin. Results indicate that this taxon is composed of two closely related groups that are widely distributed and intermixed over most of the sampled range. The estimated level of divergence (0.48%), the contrast in the geographical distribution of each group, as well as the general distribution of C. artedi in North America together support the hypothesis that one group dispersed from a Mississippian refuge via the proglacial lakes, while the other is of Atlantic origin and also took advantages of earlier dispersal routes towards eastern Hudson Bay drainages. However, the signal of past range fragmentation revealed by a nested clade analysis was weak, and did not allow to formally exclude the hypothesis of a single Mississippian origin for both lineages. Comparisons with the phylogeographic patterns of other Nearctic freshwater fishes suggest that the salinity tolerance and thermal sensitivity of lake cisco may have been determinant for its extensive postglacial dispersal. The presence or co-occurrence of sympatric or allopatric eco/morphotypes were not found to be necessarily associated with the presence of both haplotype groups.

  9. Cyanotoxins in arctic lakes of southwestern Greenland and the potential for toxin transfer within-lake and across the aquatic-terrestrial boundary

    Science.gov (United States)

    Trout-Haney, J. V.; Cottingham, K. L.

    2015-12-01

    Arctic lakes are often characterized as low-resource environments in which the autotrophic community is limited by factors such as nutrients, temperature, and light. Studies of cyanotoxins have traditionally focused on nutrient-rich lakes with conspicuous blooms, however toxigenic cyanobacteria are confined to neither high nutrient environments nor planktonic taxa. We quantified the occurrence of cyanotoxins across 19 arctic lakes of varying size and depth in the Kangerlussuaq region of southwestern Greenland. Whole lake water microcystins (MC) were detected in all lakes and ranged from low (100 ng/L) concentrations. Benthic colonial cyanobacteria of the genus Nostoc are a prominent feature of certain lakes in this region, with estimated densities ranging between 500 and >500,000 colonies per lake. MC were present in the tissue of Nostoc colonies (95% CI, 1638.9 - 3237.6 pg MC (g wet weight)-1) and were actively released by colonies into surrounding water in laboratory trials. These results highlight the potential importance of toxic benthic cyanobacteria in lake ecosystems. Further, we investigated the transfer of these cyanotoxins to other organisms in the lake as well as several mechanisms (i.e., emerging insects, aerosols) that may influence the movement of toxins into the terrestrial ecosystem. The presence and movement of cyanotoxins in the coupled terrestrial-aquatic ecosystem demonstrate that high-latitude lakes can support toxigenic cyanobacteria, and that we may be underestimating the potential for these systems to develop high levels of toxicity in the future.

  10. Lake Beach Monitoring Locations in Iowa

    Data.gov (United States)

    Iowa State University GIS Support and Research Facility — Monitored state lake beach locations in Iowa. The Watershed Monitoring & Assessment Section of the Iowa DNR takes regular water samples at these listed beaches...

  11. Comparing electricity distribution network revenues and costs in New South Wales, Great Britain and Victoria

    International Nuclear Information System (INIS)

    Mountain, Bruce; Littlechild, Stephen

    2010-01-01

    A decade ago, electricity distribution network revenues per customer in New South Wales (NSW) were twice those in Great Britain (GB). Recent price controls imply that by 2014 they will be nearly four times as high. This paper examines possible reasons for this. The main reason does not seem to be geography, operating environment or industry structure. GB and Victoria have managed to accommodate increasing demand at broadly constant or even declining costs and revenues while delivering higher quality of service, while NSW has not. The regulatory framework and the practice of the regulatory body within that framework seem relevant. Australian regulators have not used benchmarking techniques as the GB regulator has. Perhaps the most important explanatory factor is private ownership in GB and Victoria compared to state ownership in NSW. This could also impact on the nature and effectiveness of regulation. (author)

  12. Paediatric doses from diagnostic radiology in Victoria

    International Nuclear Information System (INIS)

    Boal, T.J.; Cardillo, I.; Einsiedel, P.F.

    1998-01-01

    This study examines doses to paediatric patients from diagnostic radiology. Measurements were made at 29 hospitals and private radiology practices in the state of Victoria. Entrance skin doses in air were measured for the exposure factors used by hospital radiology departments and private radiology practices for a standard size 1, 5, 10 and 15 year old child, for the following procedures: chest AP/PA, lat; abdomen AP; pelvis AP; lumbar spine AP, lat; and skull AP, lat. There was a large range of doses for each particular procedure and age group. Factors contributing to the range of doses were identified. Guidance levels for paediatric radiology based on the third quartile value of the skin entrance doses have been recommended and are compared with guidance levels. Copyright (1998) Australasian Physical and Engineering Sciences in Medicine

  13. Lake-level frequency analysis for Devils Lake, North Dakota

    Science.gov (United States)

    Wiche, Gregg J.; Vecchia, Aldo V.

    1996-01-01

    Two approaches were used to estimate future lake-level probabilities for Devils Lake. The first approach is based on an annual lake-volume model, and the second approach is based on a statistical water mass-balance model that generates seasonal lake volumes on the basis of seasonal precipitation, evaporation, and inflow. Autoregressive moving average models were used to model the annual mean lake volume and the difference between the annual maximum lake volume and the annual mean lake volume. Residuals from both models were determined to be uncorrelated with zero mean and constant variance. However, a nonlinear relation between the residuals of the two models was included in the final annual lakevolume model.Because of high autocorrelation in the annual lake levels of Devils Lake, the annual lake-volume model was verified using annual lake-level changes. The annual lake-volume model closely reproduced the statistics of the recorded lake-level changes for 1901-93 except for the skewness coefficient. However, the model output is less skewed than the data indicate because of some unrealistically large lake-level declines. The statistical water mass-balance model requires as inputs seasonal precipitation, evaporation, and inflow data for Devils Lake. Analysis of annual precipitation, evaporation, and inflow data for 1950-93 revealed no significant trends or long-range dependence so the input time series were assumed to be stationary and short-range dependent.Normality transformations were used to approximately maintain the marginal probability distributions; and a multivariate, periodic autoregressive model was used to reproduce the correlation structure. Each of the coefficients in the model is significantly different from zero at the 5-percent significance level. Coefficients relating spring inflow from one year to spring and fall inflows from the previous year had the largest effect on the lake-level frequency analysis.Inclusion of parameter uncertainty in the model

  14. Lake trout in northern Lake Huron spawn on submerged drumlins

    Science.gov (United States)

    Riley, Stephen C.; Binder, Thomas; Wattrus, Nigel J.; Faust, Matthew D.; Janssen, John; Menzies, John; Marsden, J. Ellen; Ebener, Mark P.; Bronte, Charles R.; He, Ji X.; Tucker, Taaja R.; Hansen, Michael J.; Thompson, Henry T.; Muir, Andrew M.; Krueger, Charles C.

    2014-01-01

    Recent observations of spawning lake trout Salvelinus namaycush near Drummond Island in northern Lake Huron indicate that lake trout use drumlins, landforms created in subglacial environments by the action of ice sheets, as a primary spawning habitat. From these observations, we generated a hypothesis that may in part explain locations chosen by lake trout for spawning. Most salmonines spawn in streams where they rely on streamflows to sort and clean sediments to create good spawning habitat. Flows sufficient to sort larger sediment sizes are generally lacking in lakes, but some glacial bedforms contain large pockets of sorted sediments that can provide the interstitial spaces necessary for lake trout egg incubation, particularly if these bedforms are situated such that lake currents can penetrate these sediments. We hypothesize that sediment inclusions from glacial scavenging and sediment sorting that occurred during the creation of bedforms such as drumlins, end moraines, and eskers create suitable conditions for lake trout egg incubation, particularly where these bedforms interact with lake currents to remove fine sediments. Further, these bedforms may provide high-quality lake trout spawning habitat at many locations in the Great Lakes and may be especially important along the southern edge of the range of the species. A better understanding of the role of glacially-derived bedforms in the creation of lake trout spawning habitat may help develop powerful predictors of lake trout spawning locations, provide insight into the evolution of unique spawning behaviors by lake trout, and aid in lake trout restoration in the Great Lakes.

  15. Supervision and Satisfaction among School Psychologists: An Empirical Study of Professionals in Victoria, Australia

    Science.gov (United States)

    Thielking, Monica; Moore, Susan; Jimerson, Shane R.

    2006-01-01

    This study examined the supervision arrangements and job satisfaction among school psychologists in Victoria, Australia. Participation in professional supervision was explored in relation to the type of employment and job satisfaction. The results revealed that the frequency of participation in supervision activities was less than optimal, with…

  16. Poética de la autotraducción: María Victoria Atencia

    Directory of Open Access Journals (Sweden)

    López Martínez, María Isabel

    2015-12-01

    Full Text Available Self-translation is an ancient but poorly researched practice. This article analyses an exceptional case: the reflection on self-translation as exposed in poetry. A case in point is the poem «Voz traducida», from the poetry collection De la llama en que arde (1988. Indeed, the poem selected for examination was written by M.ª Victoria Atencia (Málaga, 1931, an expert both in writing poetry and in translating literature. Her book of poems also contains an original text, «Rosas», in Galician, and its corresponding Spanish translation. Both translation and reflection are complementary in her compositions. These poetic creations attest to the fact that artfulness works as a depiction of the next creation. Furthermore, this study will deeply explore the poet’s most important literary thoughts.La autotraducción es una práctica antigua, pero poco estudiada. El presente artículo analiza un caso excepcional: la reflexión sobre la autotraducción expuesta en la lírica. Para ello, se analiza el poema de M.ª Victoria Atencia «Voz traducida», perteneciente al libro titulado De la llama en que arde (1988. Es un ejemplo de que la tarea de traducir funciona como un motivo que origina una nueva creación. Además, permite que el lector conozca facetas importantes del pensamiento literario de la escritora. M.ª Victoria Atencia, además de poeta, es una experta traductora. El libro contiene también dos versiones del poema «Rosas», en gallego y en español, pruebas de la dimensión práctica de los planteamientos teóricos de la autora y de su coherencia estética. Ambas facetas, la traducción y la reflexión, son complementarias en la obra de la autora.

  17. Evolution and origin of sympatric shallow-water morphotypes of Lake Trout, Salvelinus namaycush, in Canada's Great Bear Lake.

    Science.gov (United States)

    Harris, L N; Chavarie, L; Bajno, R; Howland, K L; Wiley, S H; Tonn, W M; Taylor, E B

    2015-01-01

    Range expansion in north-temperate fishes subsequent to the retreat of the Wisconsinan glaciers has resulted in the rapid colonization of previously unexploited, heterogeneous habitats and, in many situations, secondary contact among conspecific lineages that were once previously isolated. Such ecological opportunity coupled with reduced competition likely promoted morphological and genetic differentiation within and among post-glacial fish populations. Discrete morphological forms existing in sympatry, for example, have now been described in many species, yet few studies have directly assessed the association between morphological and genetic variation. Morphotypes of Lake Trout, Salvelinus namaycush, are found in several large-lake systems including Great Bear Lake (GBL), Northwest Territories, Canada, where several shallow-water forms are known. Here, we assess microsatellite and mitochondrial DNA variation among four morphotypes of Lake Trout from the five distinct arms of GBL, and also from locations outside of this system to evaluate several hypotheses concerning the evolution of morphological variation in this species. Our data indicate that morphotypes of Lake Trout from GBL are genetically differentiated from one another, yet the morphotypes are still genetically more similar to one another compared with populations from outside of this system. Furthermore, our data suggest that Lake Trout colonized GBL following dispersal from a single glacial refugium (the Mississippian) and support an intra-lake model of divergence. Overall, our study provides insights into the origins of morphological and genetic variation in post-glacial populations of fishes and provides benchmarks important for monitoring Lake Trout biodiversity in a region thought to be disproportionately susceptible to impacts from climate change.

  18. Lake sturgeon population characteristics in Rainy Lake, Minnesota and Ontario

    Science.gov (United States)

    Adams, W.E.; Kallemeyn, L.W.; Willis, D.W.

    2006-01-01

    Rainy Lake contains a native population of lake sturgeon Acipenser fulvescens that has been largely unstudied. The aims of this study were to document the population characteristics of lake sturgeon in Rainy Lake and to relate environmental factors to year-class strength for this population. Gill-netting efforts throughout the study resulted in the capture of 322 lake sturgeon, including 50 recaptures. Lake sturgeon in Rainy Lake was relatively plump and fast growing compared with a 32-population summary. Population samples were dominated by lake sturgeon between 110 and 150 cm total length. Age–structure analysis of the samples indicated few younger (<10 years) lake sturgeon, but the smallest gill net mesh size used for sampling was 102 mm (bar measure) and would not retain small sturgeon. Few lake sturgeon older than age 50 years were captured, and maximum age of sampled fish was 59 years. Few correlations existed between lake sturgeon year-class indices and both annual and monthly climate variables, except that mean June air temperature was positively correlated with year-class strength. Analysis of Rainy Lake water elevation and resulting lake sturgeon year-class strength indices across years yielded consistent but weak negative correlations between late April and early June, when spawning of lake sturgeon occurs. The baseline data collected in this study should allow Rainy Lake biologists to establish more specific research questions in the future.

  19. Layers of 'Cabo Frio' in 'Victoria Crater' (Stereo)

    Science.gov (United States)

    2006-01-01

    This view of 'Victoria crater' is looking southeast from 'Duck Bay' towards the dramatic promontory called 'Cabo Frio.' The small crater in the right foreground, informally known as 'Sputnik,' is about 20 meters (about 65 feet) away from the rover, the tip of the spectacular, layered, Cabo Frio promontory itself is about 200 meters (about 650 feet) away from the rover, and the exposed rock layers are about 15 meters (about 50 feet) tall. This is a red-blue stereo anaglyph generated from images taken by the panoramic camera (Pancam) on NASA's Mars Exploration Rover Opportunity during the rover's 952nd sol, or Martian day, (Sept. 28, 2006) using the camera's 430-nanometer filters.

  20. Zooplankton communities in a large prealpine lake, Lake Constance: comparison between the Upper and the Lower Lake

    Directory of Open Access Journals (Sweden)

    Gerhard MAIER

    2005-08-01

    Full Text Available The zooplankton communities of two basins of a large lake, Lake Constance, were compared during the years 2002 and 2003. The two basins differ in morphology, physical and chemical conditions. The Upper Lake basin has a surface area of 470 km2, a mean depth of 100 and a maximum depth of 250 m; the Lower Lake basin has a surface area of 62 km2, a mean depth of only 13 and a maximum depth of 40 m. Nutrient, chlorophyll-a concentrations and mean temperatures are somewhat higher in the Lower than in the Upper Lake. Total abundance of rotifers (number per m2 lake surface was higher and rotifer development started earlier in the year in the Lower than in the Upper Lake. Total abundance of crustaceans was higher in the Upper Lake in the year 2002; in the year 2003 no difference in abundance could be detected between the lake basins, although in summer crustacean abundance was higher in the Lower than in the Upper Lake. Crustacean communities differed significantly between lake basins while there was no apparent difference in rotifer communities. In the Lower Lake small crustaceans, like Bosmina spp., Ceriodaphnia pulchella and Thermocyclops oithonoides prevailed. Abundance (number per m2 lake surface of predatory cladocerans, large daphnids and large copepods was much lower in the Lower than in the Upper Lake, in particular during the summer months. Ordination with nonmetric multidimensional scaling (NMS separated communities of both lakes along gradients that correlated with temperature and chlorophyll a concentration. Clutches of copepods were larger in the Lower than in the Upper Lake. No difference could be detected in clutch size of large daphnids between lake basins. Our results show that zooplankton communities in different basins of Lake Constance can be very different. They further suggest that the lack of large crustaceans in particular the lack of large predatory cladocerans in the Lower Lake can have negative effects on growth and

  1. Bathymetric map and area/capacity table for Castle Lake, Washington

    Science.gov (United States)

    Mosbrucker, Adam R.; Spicer, Kurt R.

    2017-11-14

    The May 18, 1980, eruption of Mount St. Helens produced a 2.5-cubic-kilometer debris avalanche that dammed South Fork Castle Creek, causing Castle Lake to form behind a 20-meter-tall blockage. Risk of a catastrophic breach of the newly impounded lake led to outlet channel stabilization work, aggressive monitoring programs, mapping efforts, and blockage stability studies. Despite relatively large uncertainty, early mapping efforts adequately supported several lake breakout models, but have limited applicability to current lake monitoring and hazard assessment. Here, we present the results of a bathymetric survey conducted in August 2012 with the purpose of (1) verifying previous volume estimates, (2) computing an area/capacity table, and (3) producing a bathymetric map. Our survey found seasonal lake volume ranges between 21.0 and 22.6 million cubic meters with a fundamental vertical accuracy representing 0.88 million cubic meters. Lake surface area ranges between 1.13 and 1.16 square kilometers. Relationships developed by our results allow the computation of lake volume from near real-time lake elevation measurements or from remotely sensed imagery.

  2. Lake trout rehabilitation in Lake Erie: a case history

    Science.gov (United States)

    Cornelius, Floyd C.; Muth, Kenneth M.; Kenyon, Roger

    1995-01-01

    Native lake trout (Salvelinus namaycush) once thrived in the deep waters of eastern Lake Erie. The impact of nearly 70 years of unregulated exploitation and over 100 years of progressively severe cultural eutrophication resulted in the elimination of lake trout stocks by 1950. Early attempts to restore lake trout by stocking were unsuccessful in establishing a self-sustaining population. In the early 1980s, New York's Department of Environmental Conservation, Pennsylvania's Fish and Boat Commission, and the U.S. Fish and Wildlife Service entered into a cooperative program to rehabilitate lake trout in the eastern basin of Lake Erie. After 11 years of stocking selected strains of lake trout in U.S. waters, followed by effective sea lamprey control, lake trout appear to be successfully recolonizing their native habitat. Adult stocks have built up significantly and are expanding their range in the lake. Preliminary investigations suggest that lake trout reproductive habitat is still adequate for natural reproduction, but natural recruitment has not been documented. Future assessments will be directed toward evaluation of spawning success and tracking age-class cohorts as they move through the fishery.

  3. Contaminant Monitoring Strategy for Henrys Lake, Idaho

    Energy Technology Data Exchange (ETDEWEB)

    John S. Irving; R. P. Breckenridge

    1992-12-01

    Henrys Lake, located in southeastern Idaho, is a large, shallow lake (6,600 acres, {approx} 17.1 feet maximum depth) located at 6,472 feet elevation in Fremont Co., Idaho at the headwaters of the Henrys Fork of the Snake River. The upper watershed is comprised of high mountains of the Targhee National Forest and the lakeshore is surrounded by extensive flats and wetlands, which are mostly privately owned. The lake has been dammed since 1922, and the upper 12 feet of the lake waters are allocated for downriver use. Henrys Lake is a naturally productive lake supporting a nationally recognized ''Blue Ribbon'' trout fishery. There is concern that increasing housing development and cattle grazing may accelerate eutrophication and result in winter and early spring fish kills. There has not been a recent thorough assessment of lake water quality. However, the Department of Environmental Quality (DEQ) is currently conducting a study of water quality on Henrys Lake and tributary streams. Septic systems and lawn runoff from housing developments on the north, west, and southwest shores could potentially contribute to the nutrient enrichment of the lake. Many houses are on steep hillsides where runoff from lawns, driveways, etc. drain into wetland flats along the lake or directly into the lake. In addition, seepage from septic systems (drainfields) drain directly into the wetlands enter groundwater areas that seep into the lake. Cattle grazing along the lake margin, riparian areas, and uplands is likely accelerating erosion and nutrient enrichment. Also, cattle grazing along riparian areas likely adds to nutrient enrichment of the lake through subsurface flow and direct runoff. Stream bank and lakeshore erosion may also accelerate eutrophication by increasing the sedimentation of the lake. Approximately nine streams feed the lake (see map), but flows are often severely reduced or completely eliminated due to irrigation diversion. In addition, subsurface

  4. The Tangible Economic benefits of the 20th Session of the United Nations World Tourism Organisation General Assembly to Victoria Falls, Zimbabwe

    Directory of Open Access Journals (Sweden)

    Cleopas Njerekai

    2014-01-01

    Full Text Available This paper is a documentation of the tangible economic benefits that accrued to the town of Victoria Falls, Zimbabwe, by co-hosting with Zambia, the 20th session of the United Nations World Tourism Organisation (UNWTO General Assembly (GA in 2013. The paper intends to offset speculations, half-truths and exaggerations on the tangible economic benefits of the event to the town and to contribute significantly to the scanty existing literature on the impact of these events to developing countries. A single case study research design focusing on the town was adopted for this study. The study participants to the research included tourism and hospitality organizations, the Victoria Falls municipality authorities, service providers and Victoria Falls town residents. Researcher administered questionnaires, semi-structured interviews and observation check lists were used to collect the data. In general, although the GA brought some significant transformative effects to the town of Victoria Falls in terms of employment creation, infrastructural development, revenue generation and the country's image, future host cities and countries to this event should mobilize adequate funds for the event, time it appropriately, ensure a fair spread of the benefits to various sectors and put up structures that do not turn into white elephants soon after the event.

  5. Ikaite precipitation by mixing of shoreline springs and lake water, Mono Lake, California, USA

    Science.gov (United States)

    Bischoff, James L.; Stine, Scott; Rosenbauer, Robert J.; Fitzpatrick, John A.; Stafford, Thomas W., Jr.

    1993-08-01

    Metastable ikaite (CaCO 3·6H 2O) forms abundantly during winter months along the south shoreline of Mono Lake where shoreline springs mix with lake water. Ikaite precipitates because of its decreased solubility at low temperature and because of orthophosphate-ion inhibition of calcite and aragonite. During the spring some of the ikaite is transformed to anhydrous CaCO 3 and is incorporated into tufa, but most is dispersed by wave action into the lake where it reacts to form gaylussite (Na 2Ca(CO 3) 2· 5H 2O). Spring waters have low pH values, are dominantly Ca-Na-HCO 3, have low radiocarbon activities, and are mixtures of deep-seated geothermal and cold groundwaters. Chemical modeling reveals that precipitation of CaCO 3 can occur over a broad range of mixtures of spring and lake water with a maximum production occurring at 96% spring water and 4% lake water. Under these conditions all the Ca and a significant fraction of the CO 3 of the precipitate is spring supplied. A radiocarbon age of 19,580 years obtained on a natural ikaite sample supports this conclusion. With the springs supplying a large and probably variable portion of the carbonate, and with apparent 14C age of the carbonate varying from spring to spring, tufa of similar actual antiquity may yield significantly different 14C dates, making tufa at this location unsuitable for absolute age dating by the radiocarbon method.

  6. Mercury and water level fluctuations in lakes of northern Minnesota

    Science.gov (United States)

    Larson, James H.; Maki, Ryan P; Christensen, Victoria G.; Sandheinrich, Mark B.; LeDuc, Jaime F.; Kissane, Claire; Knights, Brent C.

    2017-01-01

    Large lake ecosystems support a variety of ecosystem services in surrounding communities, including recreational and commercial fishing. However, many northern temperate fisheries are contaminated by mercury. Annual variation in mercury accumulation in fish has previously been linked to water level (WL) fluctuations, opening the possibility of regulating water levels in a manner that minimizes or reduces mercury contamination in fisheries. Here, we compiled a long-term dataset (1997-2015) of mercury content in young-of-year Yellow Perch (Perca flavescens) from six lakes on the border between the U.S. and Canada and examined whether mercury content appeared to be related to several metrics of WL fluctuation (e.g., spring WL rise, annual maximum WL, and year-to-year change in maximum WL). Using simple correlation analysis, several WL metrics appear to be strongly correlated to Yellow Perch mercury content, although the strength of these correlations varies by lake. We also used many WL metrics, water quality measurements, temperature and annual deposition data to build predictive models using partial least squared regression (PLSR) analysis for each lake. These PLSR models showed some variation among lakes, but also supported strong associations between WL fluctuations and annual variation in Yellow Perch mercury content. The study lakes underwent a modest change in WL management in 2000, when winter WL minimums were increased by about 1 m in five of the six study lakes. Using the PLSR models, we estimated how this change in WL management would have affected Yellow Perch mercury content. For four of the study lakes, the change in WL management that occurred in 2000 likely reduced Yellow Perch mercury content, relative to the previous WL management regime.

  7. Can migration mitigate the effects of ecosystem change? Patterns of dispersal, energy acquisition and allocation in Great Lakes lake whitefish (Coregonus clupeaformis)

    Science.gov (United States)

    Rennie, Michael D.; Ebener, Mark P.; Wagner, Tyler

    2012-01-01

    Migration can be a behavioural response to poor or declining home range habitat quality and can occur when the costs of migration are overcome by the benefi ts of encountering higher-quality resources elsewhere. Despite dramatic ecosystem-level changes in the benthic food web of the Laurentian Great Lakes since the colonization of dreissenid mussels, coincident changes in condition and growth rates among benthivorous lake whitefi sh populations have been variable. We hypothesized that this variation could be in part mitigated by differences in migratory habits among populations, where increased migration distance can result in an increased probability of encountering high-quality habitat (relative to the home range). Results from four Great Lakes populations support this hypothesis; relative growth rates increased regularly with migration distance. The population with the largest average migration distance also had the least reduction in size-at-age during a period of signifi cant ecosystem change and among the highest estimated consumption and activity rates. In comparison, the population with the greatest declines in size-at-age was among the least mobile, demonstrating only moderate rates of consumption and activity. The least mobile population of lake whitefi sh was supported by a remnant Diporeia population and has experienced only moderate temporal growth declines. Our study provides evidence for the potential role of migration in mitigating the effects of ecosystem change on lake whitefi sh populations.

  8. Observing a catastrophic thermokarst lake drainage in northern Alaska

    Science.gov (United States)

    Jones, Benjamin M.; Arp, Christopher D.

    2015-01-01

    The formation and drainage of thermokarst lakes have reshaped ice-rich permafrost lowlands in the Arctic throughout the Holocene. North of Teshekpuk Lake, on the Arctic Coastal Plain of northern Alaska, thermokarst lakes presently occupy 22.5% of the landscape, and drained thermokarst lake basins occupy 61.8%. Analysis of remotely sensed imagery indicates that nine lakes (>10 ha) have drained in the 1,750 km2 study area between 1955 and 2014. The most recent lake drainage was observed using in situ data loggers providing information on the duration and magnitude of the event, and a nearby weather station provided information on the environmental conditions preceding the lake drainage. Lake 195 (L195), an 80 ha thermokarst lake with an estimated water volume of ~872,000 m3, catastrophically drained on 05 July 2014. Abundant winter snowfall and heavy early summer precipitation resulted in elevated lake water levels that likely promoted bank overtopping, thermo-erosion along an ice-wedge network, and formation of a 9 m wide, 2 m deep, and 70 m long drainage gully. The lake emptied in 36 hours, with 75% of the water volume loss occurring in the first ten hours. The observed peak discharge of the resultant flood was 25 m3/s, which is similar to that in northern Alaska river basins whose areas are more than two orders of magnitude larger. Our findings support the catastrophic nature of sudden lake drainage events and the mechanistic hypotheses developed by J. Ross Mackay.

  9. Fish assemblages in borrow-pit lakes of the Lower Mississippi River

    Science.gov (United States)

    Miranda, Leandro E.; Killgore, K. J.; Hoover, J.J.

    2013-01-01

    Borrow-pit lakes encompass about a third of the lentic water habitats (by area) in the active floodplain of the Lower Mississippi River, yet little is known about their fish assemblages. We investigated whether fish assemblages supported by borrow-pit lakes resembled those in oxbow lakes to help place the ecological relevance of borrow-pit lakes in context with that of natural floodplain lakes. In all, we collected 75 fish species, including 65 species in eight borrow-pit lakes, 52 species in four riverside oxbow lakes, and 44 species in eight landside oxbow lakes. Significant differences in several species richness metrics were evident between borrow-pit lakes and landside oxbow lakes but not between borrow-pit lakes and riverside oxbow lakes. All three lake types differed in fish assemblage composition. Borrow-pit lakes and riverside oxbow lakes tended to include a greater representation of fish species that require access to diverse environments, including lentic, lotic, and palustrine habitats; fish assemblages in landside oxbow lakes included a higher representation of lacustrine species. None of the fish species collected in borrow-pit lakes was federally listed as threatened or endangered, but several were listed as species of special concern by state governments in the region, suggesting that borrow-pit lakes provide habitat for sensitive riverine and wetland fish species. Differences in fish assemblages among borrow-pit lakes were linked to engineered morphologic features, suggesting that diversity in engineering can contribute to diversity in fish assemblages; however, more research is needed to match engineering designs with fish assemblage structures that best meet conservation needs.

  10. An Array of Opportunities: Building a Sustainable Future at Leech Lake Tribal College

    Science.gov (United States)

    Buckland, Hannah

    2018-01-01

    With support from Leech Lake Tribal College (LLTC) in Cass Lake, Minnesota, solar energy infrastructure--as well as specialized training and well-paying jobs--are coming to the Leech Lake Nation. Rather than power LLTC's facilities, a 40- kilowatt solar garden installed on the college's campus during the 2017 fall semester, along with four similar…

  11. NAPLAN Scores as Predictors of Access to Higher Education in Victoria

    OpenAIRE

    Brendan Houng; Moshe Justman

    2014-01-01

    This paper examines the extent to which year-9 performance on the National Assessment Program—Language Arts and Numeracy (NAPLAN) predicts access to higher education as determined by subsequent achievement on year-12 Victoria Certificate of Education (VCE) exams. VCE performance is measured via three binary indicators: achieving an Australian tertiary admission rank (ATAR) above 50 ("ATAR50"), above 70 ("ATAR70"), and above 90 ("ATAR90"); and two continuous indicators: ATAR and the Tertiary E...

  12. Holocene Lake-Level Fluctuations of Lake Aricota, Southern Peru

    Science.gov (United States)

    Placzek, Christa; Quade, Jay; Betancourt, Julio L.

    2001-09-01

    Lacustrine deposits exposed around Lake Aricota, Peru (17° 22‧S), a 7.5-km2 lake dammed by debris flows, provide a middle to late Holocene record of lake-level fluctuations. Chronological context for shoreline deposits was obtained from radiocarbon dating of vascular plant remains and other datable material with minimal 14C reservoir effects (<350 yr). Diatomites associated with highstands several meters above the modern lake level indicate wet episodes. Maximum Holocene lake level was attained before 6100 14C yr B.P. and ended ∼2700 14C yr B.P. Moderately high lake levels occurred at 1700 and 1300 14C yr B.P. The highstand at Lake Aricota during the middle Holocene is coeval with a major lowstand at Lake Titicaca (16°S), which is only 130 km to the northeast and shares a similar climatology. Comparisons with other marine and terrestrial records highlight emerging contradictions over the nature of mid-Holocene climate in the central Andes.

  13. Chlamydia pecorum Infection in Free-ranging Koalas ( Phascolarctos cinereus ) on French Island, Victoria, Australia.

    Science.gov (United States)

    Legione, Alistair R; Amery-Gale, Jemima; Lynch, Michael; Haynes, Leesa; Gilkerson, James R; Sansom, Fiona M; Devlin, Joanne M

    2016-04-28

    We detected Chlamydia pecorum in two koalas ( Phascolarctos cinereus ) from a closed island population in Victoria, Australia, previously free of Chlamydia infection. The ompA and multilocus sequence type were most closely related to published isolates of livestock rather than koala origin, suggesting potential cross-species transmission of C. pecorum .

  14. An ecohydrological-based management of Lake Beratan in Bedugul, Bali

    Science.gov (United States)

    Atmaja, D. M.; Budiastuti, M. S.; Setyono, P.; Sunarto

    2018-04-01

    Lake Beratan is one of waterway ecosystems located in the upper land of Bedugul, Bali and has become a tourist object which is visited by many foreign as well as domestic tourists. This is supported by a sufficiently high economic growth which, without the community’s being aware of, has caused environmental problems such as the shallowing of the lake, erosion, and water pollution to such an extent that have resulted in the degradation of the function of the lake as the site of catchment. The degradation of the function of the lake can be overcome by ecohydrological-based management. This study was aimed at developing an integrated and long lasting Lake Beratan environment management concept. The study used a descriptive qualitative approach using a survey, by collecting primary and secondary data. On the basis of those data the mapping of the potentials of the lake and problems of the lake which were then integrated to formulate criteria for sustainable use of Lake Beratan waters environment resources. The determination of zonation of the lake was done based on those criteria and the community’s existence consideration as well as the exising system of the lake waterway environment use. Based on the study in the field, some recommendations could be made concerning Lake Beratan waterway sustainable and integrated management.

  15. Mara River and Associated Wetland as a Refuge of Threatened ...

    African Journals Online (AJOL)

    A study was carried out in Mara River and Lake Kirumi in January/February, 2005 to investigate the importance oJ. the wetland as a refuge site for indigenous cichlids particularly tilapiines which have either disappeared from Lake Victoria or threatened. Fish samples were obtained using experimental gillnets whose ...

  16. IDRC in Tanzania

    International Development Research Centre (IDRC) Digital Library (Canada)

    BURUNDI. RWANDA. Indian. Ocean. La ke. Ta n g a n yika. Lake. Victoria. Lake. Malawi. 100 km. Bolstering think tanks. IDRC is strengthening the capacity of three independent policy research institutes in the country. The Think Tank Initiative has awarded core funding to the. • Economic and Social Research Foundation.

  17. IDRC in Kenya

    International Development Research Centre (IDRC) Digital Library (Canada)

    Researchers are working on a vaccine for cattle disease. For more information visit the Regional. Office for Sub-Saharan Africa website: www.idrc.ca/rossa. Subscribe to the IDRC Bulletin: www.idrc.ca/idrcbulletin/. SOMALIA. UGANDA. SUDAN. TANZANIA. Lake. Victoria. Lake. Turkana. INDIAN. OCEAN. Nairobi ✪. ○. ○. ○.

  18. Chironomidae (Insecta: Diptera) Collected from Hydrilla Verticillata ...

    African Journals Online (AJOL)

    A survey of the aquatic weed Hydrilla verticillata was conducted in selected Kenyan and Ugandan lakes, and emerging chironomid adults were collected from samples of Hydrilla and seven other aquatic macrophytes. Hydrilla was absent from Lake Victoria, in sites where it previously occurred. Hydrilla was found in four of ...

  19. Integrated Water, Sanitation and Solid Waste Management in Small ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Inadequate water and sanitation services are having an negative effect on human health and polluting Lake Victoria in East Africa. At the request of the governments of Kenya, Tanzania and Uganda, UN-Habitat has undertaken an initiative to provide water and sanitation services in the region and protect the Lake basin.

  20. Factors relating to hospitalisation and economic burden of paediatric constipation in the state of Victoria, Australia, 2002-2009.

    Science.gov (United States)

    Ansari, Humaira; Ansari, Zahid; Lim, Tracy; Hutson, John M; Southwell, Bridget R

    2014-12-01

    Constipation is common, with severe symptoms requiring hospitalisation. Constipation can be a primary (present at admission and requires treatment or investigation) or principal (first listed) diagnosis for hospitalisation. In the USA, constipation is the second most common ambulatory care digestive diagnosis with total costs >US$1.7 billion/year. Incidence of hospitalisation for constipation in children peaks at toilet-training age. This study determined the burden of paediatric constipation to hospital care in Victoria, Australia. The Victorian Admitted Episodes Dataset was analysed retrospectively, examining hospital admissions with a primary diagnosis of constipation in the 7-year period 2002/2003 to 2008/2009. For children, constipation was recorded as a primary diagnosis in 8688 admissions (3.6/1000 of population). In-hospital prevalence was ∼1.0%. Mean length of stay was 4.4 days (median 1.0, range 0-993, standard deviation 16.7). There were 1121 readmissions in 668 children. Average treatment cost was A$4235/admission (median A$1461, range A$0-$278 816), with annual costs of ∼A$5 505 500. Children in the highest socio-economic area had ∼50% fewer admissions (P disadvantage, public hospital, planned admission, longer length of stay and association with other medical conditions. This study identified that constipation in children is a significant cost burden in Victoria (costing public hospitals ∼A$5.5 million/year). Hospitalisation in Victoria is 10-fold higher than in the USA with 10% readmissions within a month. We conclude that strategies aimed at reducing hospitalisation for constipation could result in significant savings for the paediatric public health system in Victoria, Australia. © 2014 The Authors. Journal of Paediatrics and Child Health © 2014 Paediatrics and Child Health Division (Royal Australasian College of Physicians).

  1. Lake Morphometry for NHD Lakes in Great Lakes Region 4 HUC

    Data.gov (United States)

    U.S. Environmental Protection Agency — Lake morphometry metrics are known to influence productivity in lakes and are important for building various types of ecological and environmental models of lentic...

  2. The origin of shallow lakes in the Khorezm Province, Uzbekistan, and the history of pesticide use around these lakes

    Science.gov (United States)

    Rosen, Michael R.; Crootof, Arica; Reidy, Liam; Saito, Laurel; Nishonov, Bakhriddin; Scott, Julian A.

    2018-01-01

    The economy of the Khorezm Province in Uzbekistan relies on the large-scale agricultural production of cotton. To sustain their staple crop, water from the Amu Darya is diverted for irrigation through canal systems constructed during the early to mid-twentieth century when this region was part of the Soviet Union. These diversions severely reduce river flow to the Aral Sea. The Province has >400 small shallow (data indicate that the majority of the lakes investigated are less than 150 years old, which supports a recent origin of the lakes. The thickness of lacustrine sediments in the cores analyzed ranged from 20 to 60 cm in all but two of the lakes, indicating a relatively slow sedimentation rate and a relatively short-term history for the lakes. Hydrologic changes in the lakes are evident from loss on ignition and pollen analyses of a subset of the lake cores. The data indicate that the lakes have transitioned from a dry, saline, arid landscape during pre-lake conditions (low organic carbon content) and low pollen concentrations (in the basal sediments) to the current freshwater lakes (high organic content), with abundant freshwater pollen taxa over the last 50–70 years. Sediments at the base of the cores contain pollen taxa dominated by Chenopodiaceae and Tamarix, indicating that the vegetation growing nearby was tolerant to arid saline conditions. The near surface sediments of the cores are dominated by Typha/Sparganium, which indicate freshwater conditions. Increases in pollen of weeds and crop plants indicate an intensification of agricultural activities since the 1950s in the watersheds of the lakes analyzed. Pesticide profiles of DDT (dichlorodiphenyltrichloroethane) and its degradates and γ-HCH (gamma-hexachlorocyclohexane), which were used during the Soviet era, show peak concentrations in the top 10 cm of some of the cores, where estimated ages of the sediments (1950–1990) are associated with peak pesticide use during the Soviet era. These data

  3. Spatiotemporal patterns of high-mountain lakes and related hazards in western Austria

    Czech Academy of Sciences Publication Activity Database

    Emmer, Adam; Merkl, S.; Mergili, M.

    2015-01-01

    Roč. 246, oct (2015), s. 602-616 ISSN 0169-555X Institutional support: RVO:67179843 Keywords : lake development * geoenvironmental change * GLOF * high-mountain lakes * susceptibility analysis Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 2.813, year: 2015

  4. The radiocarbon dating project at Aboriginal Affairs, Victoria

    International Nuclear Information System (INIS)

    Godfrey, M.C.S.

    1997-01-01

    The purpose of this project has been to publish a complete list of the age estimates relating to the archaeological sites in the State of Victoria from 1951 to 1995, and to assess the value and the limitations of this information for interpreting the prehistory of this region. This project has recorded 476 dates coming from 14 laboratories, and ranging in age from the time of European settlement to the limit of the technique at around 40,000 years BP. However, the available evidence indicates that large discrepancies may exist in these results, and this has lead to the recommendation that this data should not be used in research projects requiring dating accuracies of less than a few hundred years

  5. Spatial and temporal genetic diversity of lake whitefish (Coregonus clupeaformis (Mitchill)) from Lake Huron and Lake Erie

    Science.gov (United States)

    Stott, Wendylee; Ebener, Mark P.; Mohr, Lloyd; Hartman, Travis; Johnson, Jim; Roseman, Edward F.

    2013-01-01

    Lake whitefish (Coregonus clupeaformis (Mitchill)) are important commercially, culturally, and ecologically in the Laurentian Great Lakes. Stocks of lake whitefish in the Great Lakes have recovered from low levels of abundance in the 1960s. Reductions in abundance, loss of habitat and environmental degradation can be accompanied by losses of genetic diversity and overall fitness that may persist even as populations recover demographically. Therefore, it is important to be able to identify stocks that have reduced levels of genetic diversity. In this study, we investigated patterns of genetic diversity at microsatellite DNA loci in lake whitefish collected between 1927 and 1929 (historical period) and between 1997 and 2005 (contemporary period) from Lake Huron and Lake Erie. Genetic analysis of lake whitefish from Lakes Huron and Erie shows that the amount of population structuring varies from lake to lake. Greater genetic divergences among collections from Lake Huron may be the result of sampling scale, migration patterns and demographic processes. Fluctuations in abundance of lake whitefish populations may have resulted in periods of increased genetic drift that have resulted in changes in allele frequencies over time, but periodic genetic drift was not severe enough to result in a significant loss of genetic diversity. Migration among stocks may have decreased levels of genetic differentiation while not completely obscuring stock boundaries. Recent changes in spatial boundaries to stocks, the number of stocks and life history characteristics of stocks further demonstrate the potential of coregonids for a swift and varied response to environmental change and emphasise the importance of incorporating both spatial and temporal considerations into management plans to ensure that diversity is preserved.

  6. Lake Sturgeon, Lake Whitefish, and Walleye egg deposition patterns with response to fish spawning substrate restoration in the St. Clair–Detroit River system

    Science.gov (United States)

    Fischer, Jason L.; Pritt, Jeremy J.; Roseman, Edward; Prichard, Carson G.; Craig, Jaquelyn M.; Kennedy, Gregory W.; Manny, Bruce A.

    2018-01-01

    Egg deposition and use of restored spawning substrates by lithophilic fishes (e.g., Lake Sturgeon Acipenser fulvescens, Lake Whitefish Coregonus clupeaformis, and Walleye Sander vitreus) were assessed throughout the St. Clair–Detroit River system from 2005 to 2016. Bayesian models were used to quantify egg abundance and presence/absence relative to site-specific variables (e.g., depth, velocity, and artificial spawning reef presence) and temperature to evaluate fish use of restored artificial spawning reefs and assess patterns in egg deposition. Lake Whitefish and Walleye egg abundance, probability of detection, and probability of occupancy were assessed with detection-adjusted methods; Lake Sturgeon egg abundance and probability of occurrence were assessed using delta-lognormal methods. The models indicated that the probability of Walleye eggs occupying a site increased with water velocity and that the rate of increase decreased with depth, whereas Lake Whitefish egg occupancy was not correlated with any of the attributes considered. Egg deposition by Lake Whitefish and Walleyes was greater at sites with high water velocities and was lower over artificial spawning reefs. Lake Sturgeon eggs were collected least frequently but were more likely to be collected over artificial spawning reefs and in greater abundances than elsewhere. Detection-adjusted egg abundances were not greater over artificial spawning reefs, indicating that these projects may not directly benefit spawning Walleyes and Lake Whitefish. However, 98% of the Lake Sturgeon eggs observed were collected over artificial spawning reefs, supporting the hypothesis that the reefs provided spawning sites for Lake Sturgeon and could mitigate historic losses of Lake Sturgeon spawning habitat.

  7. Fish populations in a large group of acid-stressed lakes

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, H H

    1975-01-01

    The purpose of this study was to determine the effects of environmental stress on the number and diversity of fish species in a group of acid-stressed lakes. The study area was the La Cloche Mountains, a series of quartzite ridges covering 1,300 km/sup 2/ along the north shore of Georgian Bay and north channel of Lake Huron. Within these ridges are 173 lakes; 68 of the largest of these made up the study sample. The lakes of the La Cloche Mountains are undergoing rapid acidification. Coincident with this there has been the loss of sport fishes from several lakes. Lakes such as Nellie, Lumsden, O.S.A., Acid and Killarney supported good sport fisheries for the lake trout, (Salvelinus namaycush) for many years, but have ceased to do so in the last 5 to 15 years. Other sport fishes, notably the walleye (Stizostedion vitreum) and smallmouth bass (micropterus dolomieu) have disappeared from some of the La Cloche Lakes. Thus recreational fishing alone could not have been the cause of the change. Beamish (1974) recorded the extreme sparcity of the three remaining fish species in O.S.A. Lake. Many of the lakes of the La Cloche mountains are accessible only with difficulty and little or no information exists for these lakes prior to this study. This precluded simple comparison of these lakes before and during acidification. This lack of historic data determined in part the approach taken in this study; a comparison of the fish communities of a group of lakes differing in degree of acid stress.

  8. [Lake eutrophication modeling in considering climatic factors change: a review].

    Science.gov (United States)

    Su, Jie-Qiong; Wang, Xuan; Yang, Zhi-Feng

    2012-11-01

    Climatic factors are considered as the key factors affecting the trophic status and its process in most lakes. Under the background of global climate change, to incorporate the variations of climatic factors into lake eutrophication models could provide solid technical support for the analysis of the trophic evolution trend of lake and the decision-making of lake environment management. This paper analyzed the effects of climatic factors such as air temperature, precipitation, sunlight, and atmosphere on lake eutrophication, and summarized the research results about the lake eutrophication modeling in considering in considering climatic factors change, including the modeling based on statistical analysis, ecological dynamic analysis, system analysis, and intelligent algorithm. The prospective approaches to improve the accuracy of lake eutrophication modeling with the consideration of climatic factors change were put forward, including 1) to strengthen the analysis of the mechanisms related to the effects of climatic factors change on lake trophic status, 2) to identify the appropriate simulation models to generate several scenarios under proper temporal and spatial scales and resolutions, and 3) to integrate the climatic factors change simulation, hydrodynamic model, ecological simulation, and intelligent algorithm into a general modeling system to achieve an accurate prediction of lake eutrophication under climatic change.

  9. Rare occurrence of nine Microcystis species (Chroococcales, Cyanobacteria) in a single lake (Lake Dojran, fYR Macedonia)

    Czech Academy of Sciences Publication Activity Database

    Krstić, S.; Aleksovski, B.; Komárek, Jiří

    2017-01-01

    Roč. 8, č. 1 (2017), s. 4-21 ISSN 1947-573X Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : Lake Dojran * Microcystis * microcystins Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany

  10. Plutonium and americium in Lake Michigan sediments

    International Nuclear Information System (INIS)

    Edgington, D.N.; Alberts, J.J.; Wahlgren, M.A.; Karttunen, J.O.; Reeve, C.A.

    1975-01-01

    The vertical distributions of 239 , 240 Pu, 238 Pu, and 137 Cs have been measured in sediment cores taken from Lake Michigan. Sections from a limited number of cores have been analyzed for 241 Am. In addition, grab samples from ten locations in the southern basin of the lake have been analyzed for phase distribution of 239 , 240 Pu using a sequential extraction technique. The results indicate that the 239 , 240 Pu, 238 Pu, and 137 Cs from weapons testing, and the 241 Am formed in situ are concentrated in the sediments. A comparison of the total deposition of 239 , 240 Pu and 137 Cs indicates that 137 Cs may be valuable as a monitor for 239 , 240 Pu deposition in the sediments. Values of the 238 Pu/ 239 , 240 Pu ratio are in agreement with values reported in Lake Ontario sediments (and Lake Michigan plankton) and show little variation with depth. 241 Am data support the concept of in situ production with little preferential mobility after formation. Studies of sedimentary phase distributions show that 239 , 240 Pu is associated with hydrous oxide phases which are chemically stable under the prevailing conditions in lake sediments. Since Lake Michigan sediments remain aerobic, relatively little 239 , 240 Pu is available for chemical mobilization from the hydrous oxide or organic phases present in the sediments

  11. Lake Urmia (Iran): can future socio-ecologically motivated river basin management restore lake water levels in an arid region with extensive agricultural development?

    Science.gov (United States)

    Fazel, Nasim; Berndtsson, Ronny; Bertacchi Uvo, Cintia; Klove, Bjorn; Madani, Kaveh

    2015-04-01

    Lake Urmia, one of the world's largest hyper saline lakes located in northwest of Iran, is a UNESCO Biosphere Reserve and Ramsar site, protected as a national park and, supports invaluable and unique biodiversity and related ecosystem services for the region's 6.5 million inhabitants. Due to increased development of the region's water resources for agriculture and industry and to a certain extent climate change, the lake has started to shrink dramatically since 1995 and now is holding less than 30 percent of its volume. Rapid development in agricultural sector and land-use changes has resulted in immense construction of dams and water diversions in almost all lake feeding rivers, intensifying lake shrinking, increasing salinity and degrading its ecosystem. Recently, lake's cultural and environmental importance and social pressure has raised concerns and brought government attention to the lake restoration plans. Along with poor management, low yield agriculture as the most water consuming activity in the region with, rapid, insufficient development is one of the most influential drivers in the lake desiccation. Part of the lake restoration plans in agricultural sector is to restrict the agricultural areas in the main feeding river basins flowing mostly in the southern part of the lake and decreasing the agricultural water use in this area. This study assess the efficiency and effectiveness of the proposed plans and its influence on the lake level rise and its impacts on economy in the region using a system dynamics model developed for the Lake consist of hydrological and agro-economical sub-systems. The effect of decrease in agricultural area in the region on GDP and region economy was evaluated and compared with released water contribution in lake level rise for a five year simulation period.

  12. Changes in lake level and trophy at Lake Vrana, a large karstic lake on the Island of Cres (Croatia, with respect to palaeoclimate and anthropogenic impacts during the last approx. 16,000 years

    Directory of Open Access Journals (Sweden)

    Ante BARIĆ

    2000-08-01

    Full Text Available A multi-proxy approach study (cladocerans, diatoms, geochemistry, plant macrofossils, pollen, was performed on a sediment core from Lake Vrana (Vransko Jezero, a large and deep karstic lake on the northern Adriatic island of Cres, Croatia. Considerable lake-level changes occurred during the last approx. 16,000 years. The stratigraphic evidence suggests that periods of enhanced precipitation and the post-LGM rise in sea level were the main driving forces. The lake records indicate early human impacts. Sediment echo-sounding indicated that >25 m of lake sediments lies within the site, from which 5 m have been cored. Shallow lake stages occurred from 14.4 14C ky BP to early Holocene. Prior to Alleröd, interglacial sediments were redeposited, reflecting the influences of rising sea-level (forming a local groundwater barrier, a temporary increase in precipitation, and lake-level changes. There appears to be a hiatus in the sequence, for no sediments assignable to the Alleröd chronozone could be found. A discordance in the echo profile at the appropriate horizon in the sequence supports this interpretation. Groundwater level increased again at 10.6 ky BP (during Younger Dryas chronozone, a swamp vegetation formed, which gave way to a shallow lake. During the Preboreal chronozone, this freshwater lake persisted with fluctuating levels. The establishment and subsequent persistence of the present deep water lake at about 8.5 ky BP, correspond with findings of a pluvial period at the Dalmatian coast, which lasted from 8.4 to 6 ky BP. First human catchment disturbances were related to settlements of Neolithic or Bronze Age. The increase in summer drought, coupled with forest clearance during Illyrian times, are assumed to be responsible for the change towards present evergreen oak vegetation in the lake catchment. The intensification in land-use during Roman and post-Roman settlements caused a slight increase in the lake trophic level.

  13. Conflicts of Shared Resources: A Case Study of River Nile

    Science.gov (United States)

    2012-03-22

    the source of water for the Mesopotamian basin, pose a similar problem between Syria and Iraq. There is therefore, need to...open water. Apart of having a big share of Lake Victoria, Uganda is also the home to Lake George and Lake Kyoga, and parts of Albert and Edward. The ...forge co-operation amongst its countries, in areas of infrastructure, environmental co- operation, culture and trade. The group held sixty-six

  14. Energy density of lake whitefish Coregonus clupeaformis in Lakes Huron and Michigan

    Science.gov (United States)

    Pothoven, S.A.; Nalepa, T.F.; Madenjian, C.P.; Rediske, R.R.; Schneeberger, P.J.; He, J.X.

    2006-01-01

    We collected lake whitefish Coregonus clupeaformis off Alpena and Tawas City, Michigan, USA in Lake Huron and off Muskegon, Michigan USA in Lake Michigan during 2002–2004. We determined energy density and percent dry weight for lake whitefish from both lakes and lipid content for Lake Michigan fish. Energy density increased with increasing fish weight up to 800 g, and then remained relatively constant with further increases in fish weight. Energy density, adjusted for weight, was lower in Lake Huron than in Lake Michigan for both small (≤800 g) and large fish (>800 g). Energy density did not differ seasonally for small or large lake whitefish or between adult male and female fish. Energy density was strongly correlated with percent dry weight and percent lipid content. Based on data from commercially caught lake whitefish, body condition was lower in Lake Huron than Lake Michigan during 1981–2003, indicating that the dissimilarity in body condition between the lakes could be long standing. Energy density and lipid content in 2002–2004 in Lake Michigan were lower than data for comparable sized fish collected in 1969–1971. Differences in energy density between lakes were attributed to variation in diet and prey energy content as well as factors that affect feeding rates such as lake whitefish density and prey abundance.

  15. Effects of lake trout refuges on lake whitefish and cisco in the Apostle Islands Region of Lake Superior

    Science.gov (United States)

    Zuccarino-Crowe , Chiara M.; Taylor, William W.; Hansen, Michael J.; Seider, Michael J.; Krueger, Charles C.

    2016-01-01

    Lake trout refuges in the Apostle Islands region of Lake Superior are analogous to the concept of marine protected areas. These refuges, established specifically for lake trout (Salvelinus namaycush) and closed to most forms of recreational and commercial fishing, were implicated as one of several management actions leading to successful rehabilitation of Lake Superior lake trout. To investigate the potential significance of Gull Island Shoal and Devils Island Shoal refuges for populations of not only lake trout but also other fish species, relative abundances of lake trout, lake whitefish (Coregonus clupeaformis), and cisco (Coregonus artedi) were compared between areas sampled inside versus outside of refuge boundaries. During 1982–2010, lake trout relative abundance was higher and increased faster inside the refuges, where lake trout fishing was prohibited, than outside the refuges. Over the same period, lake whitefish relative abundance increased faster inside than outside the refuges. Both evaluations provided clear evidence that refuges protected these species. In contrast, trends in relative abundance of cisco, a prey item of lake trout, did not differ significantly between areas inside and outside the refuges. This result did not suggest indirect or cascading refuge effects due to changes in predator levels. Overall, this study highlights the potential of species-specific refuges to benefit other fish species beyond those that were the refuges' original target. Improved understanding of refuge effects on multiple species of Great Lakes fishes can be valuable for developing rationales for refuge establishment and predicting associated fish community-level effects.

  16. ‘A token of their love’: Queen Victoria Memorials in New Zealand

    OpenAIRE

    Stocker, Mark

    2016-01-01

    This article provides an overview of the four metropolitan sculptural memorials to Queen Victoria in late-colonial New Zealand, which all immediately precede the colony’s Dominion status (1907). In chronological order, they were erected in Auckland, Christchurch, Wellington, and Dunedin. While the Auckland memorial was unveiled within the Queen’s lifetime, her death in 1901 catalysed the commission of more ambitious counterparts in Wellington and Dunedin, and a degree of intercity rivalry was...

  17. A real-options analysis of wine grape farming in north west Victoria

    OpenAIRE

    Seyoum, Emayenesh; Chan, Chris

    2012-01-01

    This paper reports a use of a real-options valuation methodology to analyse wine grape farm investment under price and yield uncertainty. Revenue levels to incentivise entry and exit were calculated for three different sizes of wine grape farms in North West Victoria. The modelling identified lower exit and higher entry triggers than indicated by conventional net present value calculation. The wide gap of estimated indeterminacy in farm investment highlights the intertwined influence of numer...

  18. The origins of the Frente para la Victoria in Argentina (1988-2003

    Directory of Open Access Journals (Sweden)

    Pamela SOSA

    2017-10-01

    Full Text Available The article reconstructs the trajectory of the Frente para la Victoria in the Argentinean province of Santa Cruz between 1988 y 2003. Period during which this political force was formed, forged its main attributes and amass the political capital that allow it to reach the presidency of the Nation in 2003, position that holds to December 2015. This organization was built outside the dominant structures and groups of the provincial politics.

  19. LAKE ICE DETECTION IN LOW-RESOLUTION OPTICAL SATELLITE IMAGES

    Directory of Open Access Journals (Sweden)

    M. Tom

    2018-05-01

    Full Text Available Monitoring and analyzing the (decreasing trends in lake freezing provides important information for climate research. Multi-temporal satellite images are a natural data source to survey ice on lakes. In this paper, we describe a method for lake ice monitoring, which uses low spatial resolution (250 m–1000 m satellite images to determine whether a lake is frozen or not. We report results on four selected lakes in Switzerland: Sihl, Sils, Silvaplana and St. Moritz. These lakes have different properties regarding area, altitude, surrounding topography and freezing frequency, describing cases of medium to high difficulty. Digitized Open Street Map (OSM lake outlines are back-projected on to the image space after generalization. As a pre-processing step, the absolute geolocation error of the lake outlines is corrected by matching the projected outlines to the images. We define the lake ice detection as a two-class (frozen, non-frozen semantic segmentation problem. Several spectral channels of the multi-spectral satellite data are used, both reflective and emissive (thermal. Only the cloud-free (clean pixels which lie completely inside the lake are analyzed. The most useful channels to solve the problem are selected with xgboost and visual analysis of histograms of reference data, while the classification is done with non-linear support vector machine (SVM. We show experimentally that this straight-forward approach works well with both MODIS and VIIRS satellite imagery. Moreover, we show that the algorithm produces consistent results when tested on data from multiple winters.

  20. Lake Ice Detection in Low-Resolution Optical Satellite Images

    Science.gov (United States)

    Tom, M.; Kälin, U.; Sütterlin, M.; Baltsavias, E.; Schindler, K.

    2018-05-01

    Monitoring and analyzing the (decreasing) trends in lake freezing provides important information for climate research. Multi-temporal satellite images are a natural data source to survey ice on lakes. In this paper, we describe a method for lake ice monitoring, which uses low spatial resolution (250 m-1000 m) satellite images to determine whether a lake is frozen or not. We report results on four selected lakes in Switzerland: Sihl, Sils, Silvaplana and St. Moritz. These lakes have different properties regarding area, altitude, surrounding topography and freezing frequency, describing cases of medium to high difficulty. Digitized Open Street Map (OSM) lake outlines are back-projected on to the image space after generalization. As a pre-processing step, the absolute geolocation error of the lake outlines is corrected by matching the projected outlines to the images. We define the lake ice detection as a two-class (frozen, non-frozen) semantic segmentation problem. Several spectral channels of the multi-spectral satellite data are used, both reflective and emissive (thermal). Only the cloud-free (clean) pixels which lie completely inside the lake are analyzed. The most useful channels to solve the problem are selected with xgboost and visual analysis of histograms of reference data, while the classification is done with non-linear support vector machine (SVM). We show experimentally that this straight-forward approach works well with both MODIS and VIIRS satellite imagery. Moreover, we show that the algorithm produces consistent results when tested on data from multiple winters.

  1. Rehabilitation Utilization following a Work-Related Traumatic Brain Injury: A Sex-Based Examination of Workers' Compensation Claims in Victoria, Australia.

    Directory of Open Access Journals (Sweden)

    E Niki Guerriero

    Full Text Available To report on and examine differences in the use of four types of rehabilitation services (occupational therapy, physiotherapy, psychology, and speech therapy by men and women following a work-related traumatic brain injury in Victoria, Australia; and to examine the importance of demographic, need, work-related and geographic factors in explaining these differences.A retrospective cohort design was used to analyze 1786 work-related traumatic brain injury workers' compensation claims lodged between 2004 and 2012 in Victoria, Australia. ZINB regressions were conducted for each type of rehabilitation service to examine the relationship between sex and rehabilitation use. Covariates included demographic, need-related, work-related, and geographic factors.Out of all claims (63% male, 37% female, 13% used occupational therapy, 23% used physiotherapy, 9% used psychology, and 2% used speech therapy at least once during the first year of service utilization. After controlling for demographic, need-related, work-related, and geographic factors, women were more likely to use physiotherapy compared to men. Men and women were equally likely to use occupational therapy and psychology services. The number of visits in the first year for each type of service did not differ between male and female users.Our findings support a sex-based approach to studying rehabilitation utilization in work-related populations. Future research is needed to examine other factors associated with rehabilitation utilization and to determine the implications of different rehabilitation utilization patterns on health and return-to-work outcomes.

  2. Hazards of volcanic lakes: analysis of Lakes Quilotoa and Cuicocha, Ecuador

    Directory of Open Access Journals (Sweden)

    G. Gunkel

    2008-01-01

    Full Text Available Volcanic lakes within calderas should be viewed as high-risk systems, and an intensive lake monitoring must be carried out to evaluate the hazard of potential limnic or phreatic-magmatic eruptions. In Ecuador, two caldera lakesLakes Quilotoa and Cuicocha, located in the high Andean region >3000 a.s.l. – have been the focus of these investigations. Both volcanoes are geologically young or historically active, and have formed large and deep calderas with lakes of 2 to 3 km in diameter, and 248 and 148 m in depth, respectively. In both lakes, visible gas emissions of CO2 occur, and an accumulation of CO2 in the deep water body must be taken into account.

    Investigations were carried out to evaluate the hazards of these volcanic lakes, and in Lake Cuicocha intensive monitoring was carried out for the evaluation of possible renewed volcanic activities. At Lake Quilotoa, a limnic eruption and diffuse CO2 degassing at the lake surface are to be expected, while at Lake Cuicocha, an increased risk of a phreatic-magmatic eruption exists.

  3. Characterization of dissolved organic material in the interstitial brine of Lake Vida, Antarctica

    Science.gov (United States)

    Cawley, Kaelin M.; Murray, Alison E.; Doran, Peter T.; Kenig, Fabien; Stubbins, Aron; Chen, Hongmei; Hatcher, Patrick G.; McKnight, Diane M.

    2016-06-01

    Lake Vida (LV) is located in the McMurdo Dry Valleys (Victoria Valley, East Antarctica) and has no inflows, outflows, or connectivity to the atmosphere due to a thick (16 m), turbid ice surface and cold (organic carbon concentration (DOC; 580 mg-C L-1 or greater); the study of which provides a unique opportunity to better understand biological and/or abiotic processes taking place in an isolated saline ecosystem with no external inputs. We isolated two sub-fractions of LV dissolved organic matter (DOM) by chemical separation using XAD-8 and XAD-4 resins in series. This separation was followed by physical separation using ultrafiltration to isolate a higher molecular weight (HMW) fraction that was retained by the membrane and a salty, dilute low molecular weight fraction. This analytical path resulted in three, low salt sub-fractions and allowed comparison to other Antarctic lake DOM samples isolated using similar procedures. Compared to other Antarctic lakes, a lower portion of the DOC was retained by XAD-8 (∼10% vs. 16-24%) resin, while the portions retained by XAD-4 (∼8%) resin and the 1 kDa ultrafiltration membrane (∼50%) were similar. The 14C radiocarbon ages of the XAD-8 (mean 3940 ybp), XAD-4 (mean 4048 ybp) and HMW (mean 3270 ybp) fractions are all older than the apparent age of ice-cover formation (2800 ybp). Ultrahigh resolution mass spectrometry showed that compounds with two and three nitrogen atoms in the molecular formulas were common in both the LV-XAD8 and LV-XAD4 fractions, consistent with microbial production and processing. The long-term oxidation of LVBr DOM by abiotic oxidants including perchlorate and chlorate may explain the low portion in the XAD8 fraction and the lack of aromatic carbon, as measured by 13C NMR spectroscopy, found for all but the most hydrophobic fraction, LV-XAD8. Overall, the chemical characteristics of Lake Vida brine DOM suggest that legacy DOM sealed and concentrated within the brine has been altered due to a

  4. A study of the degree of Pollution in Nakivubo Channel, Kampala ...

    African Journals Online (AJOL)

    Nakivubo channel traverses highly populated Kampala slums, markets, industrial areas and a wetland. It discharges its water at Murchison bay in Lake Victoria. The degree of pollution in the channel has a direct effect on the aquatic life in the lake, the health of communities along the channel, and the cost of water treatment ...

  5. Review Paper Variations and changes in habitat, productivity ...

    African Journals Online (AJOL)

    The Kyoga lake system, which is c. 4 m deep, originally had a diverse fish fauna, extensive macrophytes and wetlands. Most (82%) of its water comes from Lake Victoria, is controlled through three dams and has a short residence time of c. 3 months. Physical and chemical factors, plankton productivity and composition vary ...

  6. Consumption, indigeneous knowledge and cultural values of the ...

    African Journals Online (AJOL)

    Of the edible insects, lakeflies (Chaoborus and Chironomus sp) are least documented as items of human consumption. They are eaten by the Luo communities living within the Lake Victoria basin. The purpose of this study was to evaluate the importance of lake flies as a source of food and its role in cultural practices.

  7. REGULARITIES OF CONGELATION ICE DEVELOPMENT IN SUBGLACIAL LAKE VOSTOK

    Directory of Open Access Journals (Sweden)

    V. Ya. Lipenkov

    2012-01-01

    Full Text Available Petrographic studies performed on the continuous basis along the two ice cores obtained from holes 5G-1 and 5G-2 at Vostok Station has allowed to characterize with great details the evolution of the ice texture and fabric in the 232-m thick stratum of accreted ice formed from theLakeVostokwater. Conventionally the whole thickness of accreted ice is divided into two strata: lake ice 1 and lake ice 2. Lake ice 1 (3537–3618 m, formed in the sallow strait50 kmupstream of Vostok, is characterized by presence of disseminated mineral inclusions of Lake Vostok sediments, as well as of «water pockets» that represent frozen water inclusions trapped during the ice accretion. The latter constitute less than 1% of the total ice volume, their mean size is about0.5 cm. Gases trapped by «water pockets» during ice formation transform into crystalline inclusions of mixed gas hydrates. Accretion of lake ice 2 (3618–3769 m proceeds in the deep part of the lake at a very small rate that does not assume trapping of liquid water inclusions and gases.Both strata of accreted ice are formed by orthotropic crystal growth from pure water. The main tendency in the evolution of accreted ice texture is growth of the mean crystal size with depth as the lake ice becomes younger towards the ice-water interface. The high-amplitude variations of crystal size and orientation observed around this general trend are shown to be linked with temporal and spatial variability of the supercooled melt-water flux from the northern part of the lake towards the ice formation site. The presence of supercooled water at the crystallization front supports persistent preferable growth of ice crystals with sub-horizontally oriented c-axes. The lack of supercooled water in turn support persistent growth of ice crystals with vertical or inclined with respect to the crystallization front c-axis orientation. It means that each of these preferred fabric orientations could serve as an indicator of

  8. Interaction of hydrological regime and vegetation in a seasonally flooded lake wetland (Poyang Lake) in China

    Science.gov (United States)

    Zhang, Qi

    2017-04-01

    Hydrological regime has been widely recognized as one of the major forces determining vegetation distribution in seasonally flooded wetlands. To explore the influences of hydrological conditions on the spatial distribution of wetland vegetation, an experimental transect in Poyang Lake wetland, the largest freshwater lake in China, was selected as a study area. In-situ high time frequency observations of climate, soil moisture, groundwater level and surface water level were simultaneously conducted. Vegetation was sampled periodically to obtain species composition, diversity and biomass. Results show that significant hydrological gradient exists along the experimental transect. Both groundwater level and soil moisture demonstrate high correlation with the distribution of different communities of vegetation. Above- and belowground biomass present Gaussian models along the gradient of groundwater depth in growing seasons. It was found that the optimal average groundwater depths for above- and belowground biomass are 0.8 m and 0.5 m, respectively. Numerical simulations using HYDRUS-1D further indicated that the groundwater depths had significant influences on the water usage by vegetation, which suggested the high dependence of wetland vegetation on groundwater, even in a wet climate zone such as Poyang Lake. The study revealed new knowledge on the interaction of hydrological regime and wetland vegetation, and provided scientific support for an integrated management of balancing wetland ecology and water resources development in Poyang Lake, and other lake floodplain wetlands, with strong human interferences.

  9. A decreasing trend in fall-related hip fracture incidence in Victoria, Australia.

    Science.gov (United States)

    Cassell, E; Clapperton, A

    2013-01-01

    In Victoria, Australia, the age-standardised incidence of fall-related hip fracture hospitalisations decreased significantly by 25% over the period 1998/1999-2008/2009. Significant decreases in fall-related hip fractures were observed in males and females, across all 5-year age groups, in Australian-born and overseas-born Victorians, in all socio-economic quintiles and in community-dwelling older people. The study aim was to investigate trends in the incidence of fall-related and hip fracture hospitalisations among Victorians aged 65 years and older overall and by age, gender, country of birth, socio-economic status (SES) and location of the event (home, residential care institution, etc.) over the 11-year period 1998/1999 to 2008/2009. Annual counts and age-standardised rates for fall-related hospitalisations among people aged 65 years and older were estimated using Victorian hospital admissions data. The statistical significance of changes in trends over time were analysed using a log-linear regression model of the rate data assuming a Poisson distribution of cases. Although the age-standardised incidence of fall-related hospitalisations increased significantly by 13% (95% confidence interval [CI], 9% to 18%) in Victoria, the age-standardised incidence of fall-related hip fracture hospitalisations decreased from 600/100,000 in 1998/1999 to 467/100,000 in 2008/2009 - an estimated overall reduction of 25% (95% CI, -29% to -22%). By contrast, the age-standardised incidence of fall-related hospitalisations for fractures at other body sites either increased significantly or showed no significant change. Significant decreases in fall-related hip fractures were observed in both males and females, across all 5-year age groups, in both Australian-born and overseas-born Victorians, in all socio-economic quintiles and in community-dwelling older people but not in people living in residential care facilities. Despite the downward trend in the age-standardised incidence of

  10. Layers of 'Cabo Frio' in 'Victoria Crater' (False Color)

    Science.gov (United States)

    2006-01-01

    This view of 'Victoria crater' is looking southeast from 'Duck Bay' towards the dramatic promontory called 'Cabo Frio.' The small crater in the right foreground, informally known as 'Sputnik,' is about 20 meters (about 65 feet) away from the rover, the tip of the spectacular, layered, Cabo Frio promontory itself is about 200 meters (about 650 feet) away from the rover, and the exposed rock layers are about 15 meters (about 50 feet) tall. This is an enhanced false color rendering of images taken by the panoramic camera (Pancam) on NASA's Mars Exploration Rover Opportunity during the rover's 952nd sol, or Martian day, (Sept. 28, 2006) using the camera's 750-nanometer, 530-nanometer and 430-nanometer filters.

  11. Principles of lake sedimentology

    International Nuclear Information System (INIS)

    Janasson, L.

    1983-01-01

    This book presents a comprehensive outline on the basic sedimentological principles for lakes, and focuses on environmental aspects and matters related to lake management and control-on lake ecology rather than lake geology. This is a guide for those who plan, perform and evaluate lake sedimentological investigations. Contents abridged: Lake types and sediment types. Sedimentation in lakes and water dynamics. Lake bottom dynamics. Sediment dynamics and sediment age. Sediments in aquatic pollution control programmes. Subject index

  12. Lake Cadagno

    DEFF Research Database (Denmark)

    Tonolla, Mauro; Storelli, Nicola; Danza, Francesco

    2017-01-01

    cycles. The chemocline lies at about 12 m depth, stabilized by density differences of salt-rich water supplied by sub-aquatic springs to the monimolimnion and of electrolyte-poor surface water feeding the mixolimnion. Steep sulphide and light gradients in the chemocline support the growth of a large...... in the chemocline. Small-celled PSB together with the sulfate-reducing bacterium Desulfocapsa thiozymogenes sp. form stable aggregates in the lake, which represent small microenvironments with an internal sulphur cycle. Eukaryotic primary producers in the anoxic zones are dominated by Cryptomonas phaseolus...

  13. Evidence that lake trout served as a buffer against sea lamprey predation on burbot in Lake Erie

    Science.gov (United States)

    Stapanian, M.A.; Madenjian, C.P.

    2007-01-01

    The population of burbot Lota lota in Lake Erie recovered during 1986–2003, mainly because of the control of sea lamprey Petromyzon marinus, which began in 1986. Burbot populations continued to grow during 1996–1998, when sea lamprey control was substantially reduced. We calculated mortality parameters for burbot in Lake Erie by estimating age at capture for 2,793 burbot caught in annual gill-net surveys of eastern Lake Erie from 1994 to 2003. Based on catch-curve analysis, annual mortality in Lake Erie during 1994–2003 was estimated as 33%. Annual mortality of the 1992 year-class of burbot was estimated as 30%. The mortality of burbot during the years of reduced sea lamprey control was not different from that during the 3 years preceding reduced control and was significantly lower than that during the entire portion of the time series in which full sea lamprey control was conducted. These results suggest that the reduction in sea lamprey control did not lead to increased burbot mortality. The catch per gill-net lift of large burbot (total length > 600 mm), the size preferred by sea lampreys, was lower than that of adult lake trout Salvelinus namaycush (age 5 and older; total length > 700 mm) before lampricide application was reduced. Although adult lake trout populations declined, the abundance of large burbot did not change during the period of reduced lampricide application. These results support a hypothesis that a healthy population of adult lake trout can serve as a buffer species, acting to reduce predation of burbot by sea lampreys when sea lamprey populations increase. Burbot attained sexual maturity at a relatively early age (3 or 4 years) and a total length (approximately 500 mm) that was smaller than the preferred prey size for sea lampreys. These characteristics and the buffering effect of the lake trout population enabled growth of the burbot population during the brief period when lamprey control was reduced.

  14. Temporal associations with declining Trichomonas vaginalis diagnosis rates among women in the state of Victoria, Australia, 1947 to 2005.

    Science.gov (United States)

    Marrone, John; Fairley, Christopher K; Saville, Marian; Bradshaw, Catriona; Bowden, Francis J; Horvath, Leonie B; Donovan, Basil; Chen, Marcus; Hocking, Jane S

    2008-06-01

    To investigate the temporal associations between Trichomonas vaginalis (TV) diagnoses in women at a large urban sexual health clinic and a major Papanicolaou (Pap) smear screening laboratory in Victoria, Australia with Pap smear screening rates and the introduction of nitroimidazole treatments. An ecological analysis of TV diagnosis rates at the Melbourne Sexual Health Centre and the Victorian Cytology Service, Pap smear screening rates and nitroimidazole prescription data. Diagnoses of TV at the Melbourne Sexual Health Centre peaked in the 1950s at 20% to 30% and then rapidly declined through the 1960s and 1970s to below 1% in 1990. A similar pattern was observed at the Victorian Cytology Service. Metronidazole prescribing and opportunistic Pap smear screening began in Victoria in the 1960s coinciding with declining TV. The availability of tinidazole in 1976 led to further declines in TV in the late 1970s. A national cervical screening program introduced in 1991 was temporally associated with further declines in TV. Our analyses suggest that the introduction of metronidazole was associated with a large reduction in TV among Victorian women in the 1960s. The subsequent availability of tinidazole and increased Pap smear screening may have contributed to the current low TV prevalence in Victoria.

  15. Dependence of Wetland Vegetation on Hydrological Regime in a Large Floodplain Lake (Poyang Lake) in the Middle Yangtze River

    Science.gov (United States)

    Zhang, Q.; Tan, Z.; Xu, X.

    2017-12-01

    Exemplified in the Yangtze River floodplain lake, Poyang Lake, investigations were carried out to examine the dependence of vegetation on hydrological variables. The Lake is one of the few lakes that remain naturally connected to the Yangtze River. The Lake surface expanses to 4000 km2 in wet seasons, and reduces to less than 1000 km2 in dry seasons, creating some 3000 km2 vital wetland habitats for many animals. Remote sensing was used to obtain the spatial distribution of wetland vegetations. A lake hydrodynamic model using MIKE 21 was employed to determine the variability of wetland inundation. In-situ high time frequency observations of climate, soil moisture, and groundwater depth were also conducted in a typical wetland transect of 1 km long. Vegetations were sampled periodically to obtain species composition, diversity and biomass. Results showed that the spatial distribution of vegetation highly depended on the inundation duration and depth. Optimal hydrological variables existed for the typical vegetations in Poyang Lake wetland. Numerical simulations using HYDRUS-1D further demonstrated that both groundwater depth and soil moisture had significant effects on the growth of vegetation and the water demand in terms of transpiration, even in a wet climate zone such as middle Yangtze River. It was found that the optimal groundwater depths existed for both above- and belowground biomass. Simulation scenarios indicated that climate changes and human modification of hydrology would affect the water usage of vegetation and may cause a strategic adaptation of the vegetation to the stressed hydrological conditions. The study revealed new knowledge on the high dependence of wetland vegetation on both surface water regime and groundwater depths, in wet climate zone. Outcomes of this study may provide support for an integrated management of balancing water resources development and wetland sustainability maintenance in Poyang Lake, and other floodplain wetlands, with

  16. Water quality of Lake Austin and Town Lake, Austin, Texas

    Science.gov (United States)

    Andrews, Freeman L.; Wells, Frank C.; Shelby, Wanda J.; McPherson, Emma

    1988-01-01

    Lake Austin and Town Lake are located on the Colorado River in Travis County, central Texas, and serve as a source of water for municipal and industrial water supplies, electrical-power generation, and recreation for more than 500,000 people in the Austin metropolitan area. Lake Austin, located immediately downstream of Lake Travis, extends for more than 20 miles into the western edge of the city of Austin. Town Lake extends through the downtown area of the city of Austin for nearly 6 miles where the Colorado River is impounded by Longhorn Dam.

  17. The altered ecology of Lake Christina: A record of regime shifts, land-use change, and management from a temperate shallow lake

    International Nuclear Information System (INIS)

    Theissen, Kevin M.; Hobbs, William O.; Hobbs, Joy M. Ramstack; Zimmer, Kyle D.; Domine, Leah M.; Cotner, James B.; Sugita, Shinya

    2012-01-01

    We collected two sediment cores and modern submerged aquatic plants and phytoplankton from two sub-basins of Lake Christina, a large shallow lake in west-central Minnesota, and used stable isotopic and elemental proxies from sedimentary organic matter to explore questions about the pre- and post-settlement ecology of the lake. The two morphologically distinct sub-basins vary in their sensitivities to internal and external perturbations offering different paleoecological information. The record from the shallower and much larger western sub-basin reflects its strong response to internal processes, while the smaller and deeper eastern sub-basin record primarily reflects external processes including important post-settlement land-use changes in the area. A significant increase in organic carbon accumulation (3–4 times pre-settlement rates) and long-term trends in δ 13 C, organic carbon to nitrogen ratios (C/N), and biogenic silica concentrations shows that primary production has increased and the lake has become increasingly phytoplankton-dominated in the post-settlement period. Significant shifts in δ 15 N values reflect land-clearing and agricultural practices in the region and support the idea that nutrient inputs have played an important role in triggering changes in the trophic status of the lake. Our examination of hydroclimatic data for the region over the last century suggests that natural forcings on lake ecology have diminished in their importance as human management of the lake increased in the mid-1900s. In the last 50 years, three chemical biomanipulations have temporarily shifted the lake from the turbid, algal-dominated condition into a desired clear water regime. Two of our proxies (δ 13 C and BSi) measured from the higher resolution eastern basin record responded significantly to these known regime shifts. -- Highlights: ► We explore the sediment geochemistry from Lake Christina's two distinct sub-basins. ► Our geochemical data show

  18. Energy and water in the Great Lakes.

    Energy Technology Data Exchange (ETDEWEB)

    Tidwell, Vincent Carroll

    2011-11-01

    The nexus between thermoelectric power production and water use is not uniform across the U.S., but rather differs according to regional physiography, demography, power plant fleet composition, and the transmission network. That is, in some regions water demand for thermoelectric production is relatively small while in other regions it represents the dominate use. The later is the case for the Great Lakes region, which has important implications for the water resources and aquatic ecology of the Great Lakes watershed. This is today, but what about the future? Projected demographic trends, shifting lifestyles, and economic growth coupled with the threat of global climate change and mounting pressure for greater U.S. energy security could have profound effects on the region's energy future. Planning for such an uncertain future is further complicated by the fact that energy and environmental planning and regulatory decisionmaking is largely bifurcated in the region, with environmental and water resource concerns generally taken into account after new energy facilities and technologies have been proposed, or practices are already in place. Based on these confounding needs, the objective of this effort is to develop Great Lakes-specific methods and tools to integrate energy and water resource planning and thereby support the dual goals of smarter energy planning and development, and protection of Great Lakes water resources. Guiding policies for this planning are the Great Lakes and St. Lawrence River Basin Water Resources Compact and the Great Lakes Water Quality Agreement. The desired outcome of integrated energy-water-aquatic resource planning is a more sustainable regional energy mix for the Great Lakes basin ecosystem.

  19. Prospects of obtaining samples of bottom sediments from subglacial lake Vostok

    Directory of Open Access Journals (Sweden)

    Н. И. Васильев

    2017-04-01

    Full Text Available The paper proves the timeliness of obtaining and examining bottom sediments from subglacial Lake Vostok. Predictive geological section of Lake Vostok and information value of bottom sediments have been examined. Severe requirements towards environmental security of lake examinations and sampling of bottom sediments rule out the use of conventional drilling technologies, as they would pollute the lake with injection liquid from the borehole. In order to carry out sampling of bottom sediments from the subglacial lake, it is proposed to use a dynamically balanced tool string, which enables rotary drilling without any external support on borehole walls to transmit counter torque.     A theoretical analysis has been carried out to assess the operation of the tool string, which is a two-mass oscillatory electromechanical system of reciprocating and rotating motion (RRM with two degrees of freedom.

  20. Changes in Rongbuk lake and Imja lake in the Everest region of Himalaya

    Science.gov (United States)

    Chen, W.; Doko, T.; Liu, C.; Ichinose, T.; Fukui, H.; Feng, Q.; Gou, P.

    2014-12-01

    The Himalaya holds the world record in terms of range and elevation. It is one of the most extensively glacierized regions in the world except the Polar Regions. The Himalaya is a region sensitive to climate change. Changes in the glacial regime are indicators of global climate changes. Since the second half of the last century, most Himalayan glaciers have melted due to climate change. These changes directly affected the changes of glacial lakes in the Himalayan region due to the glacier retreat. New glacial lakes are formed, and a number of them have expanded in the Everest region of the Himalayas. This paper focuses on the two glacial lakes which are Imja Lake, located at the southern slope, and Rongbuk Lake, located at the northern slope in the Mt. Everest region, Himalaya to present the spatio-temporal changes from 1976 to 2008. Topographical conditions between two lakes were different (Kruskal-Wallis test, p < 0.05). Rongbuk Lake was located at 623 m higher than Imja Lake, and radiation of Rongbuk Lake was higher than the Imja Lake. Although size of Imja Lake was larger than the Rongbuk Lake in 2008, the growth speed of Rongbuk Lake was accelerating since 2000 and exceeds Imja Lake in 2000-2008. This trend of expansion of Rongbuk Lake is anticipated to be continued in the 21st century. Rongbuk Lake would be the biggest potential risk of glacial lake outburst flood (GLOF) at the Everest region of Himalaya in the future.

  1. A previously unrecognized path of early Holocene base flow and elevated discharge from Lake Minong to Lake Chippewa across eastern Upper Michigan

    Science.gov (United States)

    Loope, Walter L.; Jol, Harry M.; Fisher, Timothy G.; Blewett, William L.; Loope, Henry M.; Legg, Robert J.

    2014-01-01

    It has long been hypothesized that flux of fresh meltwater from glacial Lake Minong in North America's Superior Basin to the North Atlantic Ocean triggered rapid climatic shifts during the early Holocene. The spatial context of recent support for this idea demands a reevaluation of the exit point of meltwater from the Superior Basin. We used ground penetrating radar (GPR), foundation borings from six highway bridges, a GIS model of surface topography, geologic maps, U.S. Department of Agriculture–Natural Resources Conservation Service soils maps, and well logs to investigate the possible linkage of Lake Minong with Lake Chippewa in the Lake Michigan Basin across eastern Upper Michigan. GPR suggests that a connecting channel lies buried beneath the present interlake divide at Danaher. A single optical age hints that the channel aggraded to 225 m as elevated receipt of Lake Agassiz meltwater in the Superior Basin began to wane GIS model of Minong's shoreline are consistent with another transgression of Minong after ca. 9.5 ka. At the peak of the latter transgression, the southeastern rim of the Superior Basin (Nadoway Drift Barrier) failed, ending Lake Minong. Upon Minong's final drop, aggradational sediments were deposited at Danaher, infilling the prior breach.

  2. Biomagnification of mercury through lake trout (Salvelinus namaycush) food webs of lakes with different physical, chemical and biological characteristics

    Energy Technology Data Exchange (ETDEWEB)

    Kidd, Karen A., E-mail: kiddk@unbsj.ca [Canadian Rivers Institute and Biology Department, University of New Brunswick, Saint John, NB, Canada E2L 4L5 (Canada); Muir, Derek C.G., E-mail: derek.muir@ec.gc.ca [Aquatic Contaminants Research Division, Environment Canada, Burlington, ON, Canada L7R 4A6 (Canada); Evans, Marlene S., E-mail: marlene.evans@ec.gc.ca [Aquatic Contaminants Research Division, Environment Canada, Saskatoon, SK, Canada S7N 3H5 (Canada); Wang, Xioawa, E-mail: xiaowa.wang@ec.gc.ca [Aquatic Contaminants Research Division, Environment Canada, Burlington, ON, Canada L7R 4A6 (Canada); Whittle, Mike [Aquatic Contaminants Research Division, Environment Canada, Burlington, ON, Canada L7R 4A6 (Canada); Swanson, Heidi K., E-mail: heidikswanson@yahoo.ca [Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada T6G 2E9 (Canada); Johnston, Tom, E-mail: tjohnston@laurentian.ca [Cooperative Freshwater Ecology Unit, Ontario Ministry of Natural Resources, and Biology Department, Laurentian University, Sudbury, ON, Canada P3E 2C6 (Canada); Guildford, Stephanie, E-mail: sguildfo@d.umn.edu [Department of Biology and Large Lakes Observatory, University of Minnesota Duluth, 2205 5th St., Duluth, MN, 55812 (United States)

    2012-11-01

    Mercury (Hg) biomagnification in aquatic ecosystems remains a concern because this pollutant is known to affect the health of fish-eating wildlife and humans, and the fish themselves. The 'rate' of mercury biomagnification is being assessed more frequently using stable nitrogen isotope ratios ({delta}{sup 15}N), a measure of relative trophic position of biota within a food web. Within food webs and across diverse systems, log-transformed Hg concentrations are significantly and positively related to {delta}{sup 15}N and the slopes of these models vary from one study to another for reasons that are not yet understood. Here we compared the rates of Hg biomagnification in 14 lake trout lakes from three provinces in Canada to understand whether any characteristics of the ecosystems explained this among-system variability. Several fish species, zooplankton and benthic invertebrates were collected from these lakes and analyzed for total Hg (fish only), methyl Hg (invertebrates) and stable isotopes ({delta}{sup 15}N; {delta}{sup 13}C to assess energy sources). Mercury biomagnification rates varied significantly across systems and were higher for food webs of larger (surface area), higher nutrient lakes. However, the slopes were not predictive of among-lake differences in Hg in the lake trout. Results indicate that among-system differences in the rates of Hg biomagnification seen in the literature may be due, in part, to differences in ecosystem characteristics although the mechanisms for this variability are not yet understood. -- Highlights: Black-Right-Pointing-Pointer Mercury biomagnifies through aquatic food webs to toxic levels in top predator fishes. Black-Right-Pointing-Pointer Among-system differences in mercury transfer through food webs occur but have not been explained. Black-Right-Pointing-Pointer Diverse lakes supporting lake trout were compared to understand the ecosystem processes that affect mercury biomagnification. Black

  3. Lake-wide distribution of Dreissena in Lake Michigan, 1999

    Science.gov (United States)

    Fleischer, Guy W.; DeSorcie, Timothy J.; Holuszko, Jeffrey D.

    2001-01-01

    The Great Lakes Science Center has conducted lake-wide bottom trawl surveys of the fish community in Lake Michigan each fall since 1973. These systematic surveys are performed at depths of 9 to 110 m at each of seven index sites around Lake Michigan. Zebra mussel (Dreissena polymorpha) populations have expanded to all survey locations and at a level to sufficiently contribute to the bottom trawl catches. The quagga (Dreissena bugensis), recently reported in Lake Michigan, was likely in the catches though not recognized. Dreissena spp. biomass ranged from about 0.6 to 15 kg/ha at the various sites in 1999. Dreissenid mussels were found at depths of 9 to 82 m, with their peak biomass at 27 to 46 m. The colonization of these exotic mussels has ecological implications as well as potential ramifications on the ability to sample fish consistently and effectively with bottom trawls in Lake Michigan.

  4. Great Lakes water quality initiative technical support document for the procedure to determine bioaccumulation factors. Draft report

    International Nuclear Information System (INIS)

    1993-03-01

    The purpose of the document is to provide the technical information and rationale in support of the proposed procedures to determine bioaccumulation factors. Bioaccumulation factors, together with the quantity of aquatic organisms eaten, determine the extent to which people and wildlife are exposed to chemicals through the consumption of aquatic organisms. The more bioaccumulative a pollutant is, the more important the consumption of aquatic organisms becomes as a potential source of contaminants to humans and wildlife. Bioaccumulation factors are needed to determine both human health and wildlife tier I water quality criteria and tier II values. Also, they are used to define Bioaccumulative Chemicals of Concern among the Great Lakes Initiative universe of pollutants. Bioaccumulation factors range from less than one to several million

  5. Large Lakes Dominate CO2 Evasion From Lakes in an Arctic Catchment

    Science.gov (United States)

    Rocher-Ros, Gerard; Giesler, Reiner; Lundin, Erik; Salimi, Shokoufeh; Jonsson, Anders; Karlsson, Jan

    2017-12-01

    CO2 evasion from freshwater lakes is an important component of the carbon cycle. However, the relative contribution from different lake sizes may vary, since several parameters underlying CO2 flux are size dependent. Here we estimated the annual lake CO2 evasion from a catchment in northern Sweden encompassing about 30,000 differently sized lakes. We show that areal CO2 fluxes decreased rapidly with lake size, but this was counteracted by the greater overall coverage of larger lakes. As a result, total efflux increased with lake size and the single largest lake in the catchment dominated the CO2 evasion (53% of all CO2 evaded). By contrast, the contribution from the smallest ponds (about 27,000) was minor (evasion at the landscape scale.

  6. Microbiological Safety and Food Handling Practices of Seed Sprout Products in the Australian State of Victoria.

    Science.gov (United States)

    Symes, Sally; Goldsmith, Paul; Haines, Heather

    2015-07-01

    Seed sprouts have been implicated as vehicles for numerous foodborne outbreaks worldwide. Seed sprouts pose a unique food safety concern because of the ease of microbiological seed contamination, the inherent ability of the sprouting process to support microbial growth, and their consumption either raw or lightly cooked. To examine seed sprout safety in the Australian state of Victoria, a survey was conducted to detect specific microbes in seed sprout samples and to investigate food handling practices relating to seed sprouts. A total of 298 seed sprout samples were collected from across 33 local council areas. Escherichia coli was detected in 14.8%, Listeria spp. in 12.3%, and Listeria monocytogenes in 1.3% of samples analyzed. Salmonella spp. were not detected in any of the samples. A range of seed sprout handling practices were identified as potential food safety issues in some food businesses, including temperature control, washing practices, length of storage, and storage in proximity to unpackaged ready-to-eat potentially hazardous foods.

  7. Using Satellite Imagery to Monitor the Major Lakes; Case Study Lake Hamun

    Science.gov (United States)

    Norouzi, H.; Islam, R.; Bah, A.; AghaKouchak, A.

    2015-12-01

    Proper lakes function can ease the impact of floods and drought especially in arid and semi-arid regions. They are important environmentally and can directly affect human lives. Better understanding of the effect of climate change and human-driven changes on lakes would provide invaluable information for policy-makers and local people. As part of a comprehensive study, we aim to monitor the land-cover/ land-use changes in the world's major lakes using satellite observations. As a case study, Hamun Lake which is a pluvial Lake, also known as shallow Lake, located on the south-east of Iran and adjacent to Afghanistan, and Pakistan borders is investigated. The Lake is the main source of resources (agriculture, fishing and hunting) for the people around it and politically important in the region since it is shared among three different countries. The purpose of the research is to find the Lake's area from 1972 to 2015 and to see if any drought or water resources management has affected the lake. Analyzing satellites imagery from Landsat shows that the area of the Lake changes seasonally and intra-annually. Significant seasonal effects are found in 1975,1977, 1987, 1993, 1996, 1998, 2000, 2009 and 2011, as well as, substantial amount of shallow water is found throughout the years. The precipitation records as well as drought historical records are studied for the lake's basin. Meteorological studies suggest that the drought, decrease of rainfalls in the province and the improper management of the Lake have caused environmental, economic and geographical consequences. The results reveal that lake has experienced at least two prolong dryings since 1972 which drought cannot solely be blamed as main forcing factor.Proper lakes function can ease the impact of floods and drought especially in arid and semi-arid regions. They are important environmentally and can directly affect human lives. Better understanding of the effect of climate change and human-driven changes on lakes

  8. Use of Satellite and In Situ Reflectance Data for Lake Water Color Characterization in the Everest Himalayan Region

    Directory of Open Access Journals (Sweden)

    Erica Matta

    2017-02-01

    Full Text Available This study applied remote sensing techniques to the study of water color in Himalayan glacial lakes as a proxy of suspended solid load. In situ measurements gathered in 5 lakes in October 2014 during satellite data acquisition enabled the characterization of water reflectance and clarity and supported image processing. Field data analysis led to a distinction between 3 water colors and a consequent lake water color classification on a regional scale from Landsat-8 data previously corrected for atmospheric and adjacency effects. Several morphometric parameters (lake size and shape, distance between lake and glacier were also computed for the lakes thus classified. The results showed spatial and temporal variations in lake water color, suggestive of relationships between glacier shrinkage and the presence of brighter and more turbid water. A finer-scale analysis of the spatial variability of water reflectance on Chola Lake (based on GeoEye-1 data captured on 18 October 2014 showed the contribution of water component absorption from the inflow. Overall, the findings support further research to monitor Himalayan lakes using both Landsat-8 and Sentinel-2 (with its improved resolutions.

  9. Communicating Risk with Parents: Exploring the Methods and Beliefs of Outdoor Education Coordinators in Victoria, Australia

    Science.gov (United States)

    Dallat, Clare

    2009-01-01

    This paper examines the risk communication strategies currently being employed by seven outdoor education co-ordinators in Government schools in Victoria, Australia. Of particular interest are the beliefs and assumptions held by these co-ordinators in relation to communicating risk with parents. Current policy stipulates that parents must be…

  10. Adverse events in surgical inpatients: A comparative analysis of public hospitals in Victoria

    OpenAIRE

    Katharina Hauck; Xueyan Zhao; Terri Jackson

    2010-01-01

    We compare adverse event rates for surgical inpatients across 36 public hospitals in the state of Victoria, Australia, conditioning on differences in patient complexity across hospitals. We estimate separate models for elective and emergency patients which stay at least one night in hospitals, using fixed effects complementary log-log models to estimate AEs as a function of patient and episode characteristics, and hospital effects. We use 4 years of patient level administrative hospital data ...

  11. Outbreaks of sarcoptic mange in free-ranging koala populations in Victoria and South Australia: a case series.

    Science.gov (United States)

    Speight, K N; Whiteley, P L; Woolford, L; Duignan, P J; Bacci, B; Lathe, S; Boardman, W; Scheelings, T F; Funnell, O; Underwood, G; Stevenson, M A

    2017-07-01

    To describe outbreaks of sarcoptic mange caused by Sarcoptes scabiei in free-ranging koalas in Victoria (December 2008 to November 2015) and South Australia (October 2011 to September 2014). Koalas affected by mange-like lesions were reported by wildlife carers, veterinary practitioners or State Government personnel to the Faculty of Veterinary and Agricultural Sciences at The University of Melbourne and the School of Animal and Veterinary Sciences at The University of Adelaide. Skin scrapings were taken from live and dead koalas and S. scabiei mites were identified. Tissues from necropsied koalas were examined histologically. Outbreaks of sarcoptic mange were found to occur in koalas from both Victoria (n = 29) and South Australia (n = 29) for the first time. The gross pathological and histopathological changes are described. We present the first reported cases of sarcoptic mange outbreaks in free-ranging koalas. © 2017 Australian Veterinary Association.

  12. The near boiling reactor: design of a small nuclear reactor for extending the operational envelope of the Victoria Class Submarine

    International Nuclear Information System (INIS)

    Cole, C.; Bonin, H.

    2005-01-01

    A small, inherently safe nuclear reactor that will provide enough power to maintain the hotel load of the Victoria Class Submarine and extend her operational envelope, has been conceptually designed. The final reactor concept, named the Near Boiling (NB) Reactor, employs TRISO fuel particles in Zirconium cladded fuel rods. The reactor is light water moderated and cooled. The core life is specifically designed to coincide with the refit cycle of the Victoria Class Submarine. The reactor employs a simple and reliable control and shut down system that requires little intervention on the part of the submarine's crew. Also, a kinetic model is developed that demonstrates the inherent safety features of the reactor during several accident scenarios. (author)

  13. The near boiling reactor: design of a small nuclear reactor for extending the operational envelope of the Victoria Class Submarine

    Energy Technology Data Exchange (ETDEWEB)

    Cole, C.; Bonin, H. [Royal Military College of Canada, Dept. of Chemistry and Chemical Engineering, Kingston, Ontario (Canada)]. E-mail: chris.cole@rmc.ca; bonin-h@rmc.ca

    2005-07-01

    A small, inherently safe nuclear reactor that will provide enough power to maintain the hotel load of the Victoria Class Submarine and extend her operational envelope, has been conceptually designed. The final reactor concept, named the Near Boiling (NB) Reactor, employs TRISO fuel particles in Zirconium cladded fuel rods. The reactor is light water moderated and cooled. The core life is specifically designed to coincide with the refit cycle of the Victoria Class Submarine. The reactor employs a simple and reliable control and shut down system that requires little intervention on the part of the submarine's crew. Also, a kinetic model is developed that demonstrates the inherent safety features of the reactor during several accident scenarios. (author)

  14. LakeMetabolizer: An R package for estimating lake metabolism from free-water oxygen using diverse statistical models

    Science.gov (United States)

    Winslow, Luke; Zwart, Jacob A.; Batt, Ryan D.; Dugan, Hilary; Woolway, R. Iestyn; Corman, Jessica; Hanson, Paul C.; Read, Jordan S.

    2016-01-01

    Metabolism is a fundamental process in ecosystems that crosses multiple scales of organization from individual organisms to whole ecosystems. To improve sharing and reuse of published metabolism models, we developed LakeMetabolizer, an R package for estimating lake metabolism from in situ time series of dissolved oxygen, water temperature, and, optionally, additional environmental variables. LakeMetabolizer implements 5 different metabolism models with diverse statistical underpinnings: bookkeeping, ordinary least squares, maximum likelihood, Kalman filter, and Bayesian. Each of these 5 metabolism models can be combined with 1 of 7 models for computing the coefficient of gas exchange across the air–water interface (k). LakeMetabolizer also features a variety of supporting functions that compute conversions and implement calculations commonly applied to raw data prior to estimating metabolism (e.g., oxygen saturation and optical conversion models). These tools have been organized into an R package that contains example data, example use-cases, and function documentation. The release package version is available on the Comprehensive R Archive Network (CRAN), and the full open-source GPL-licensed code is freely available for examination and extension online. With this unified, open-source, and freely available package, we hope to improve access and facilitate the application of metabolism in studies and management of lentic ecosystems.

  15. Mapping invasive Phragmites australis in the coastal Great Lakes with ALOS PALSAR satellite imagery for decision support

    Science.gov (United States)

    Bourgeau-Chavez, Laura L.; Kowalski, Kurt P.; Carlson Mazur, Martha L.; Scarbrough, Kirk A.; Powell, Richard B.; Brooks, Colin N.; Huberty, Brian; Jenkins, Liza K.; Banda, Elizabeth C.; Galbraith, David M.; Laubach, Zachary M.; Riordan, Kevin

    2013-01-01

    The invasive variety of Phragmites australis (common reed) forms dense stands that can cause negative impacts on coastal Great Lakes wetlands including habitat degradation and reduced biological diversity. Early treatment is key to controlling Phragmites, therefore a map of the current distribution is needed. ALOS PALSAR imagery was used to produce the first basin-wide distribution map showing the extent of large, dense invasive Phragmites-dominated habitats in wetlands and other coastal ecosystems along the U.S. shore of the Great Lakes. PALSAR is a satellite imaging radar sensor that is sensitive to differences in plant biomass and inundation patterns, allowing for the detection and delineation of these tall (up to 5 m), high density, high biomass invasive Phragmites stands. Classification was based on multi-season ALOS PALSAR L-band (23 cm wavelength) HH and HV polarization data. Seasonal (spring, summer, and fall) datasets were used to improve discrimination of Phragmites by taking advantage of phenological changes in vegetation and inundation patterns over the seasons. Extensive field collections of training and randomly selected validation data were conducted in 2010–2011 to aid in mapping and for accuracy assessments. Overall basin-wide map accuracy was 87%, with 86% producer's accuracy and 43% user's accuracy for invasive Phragmites. The invasive Phragmites maps are being used to identify major environmental drivers of this invader's distribution, to assess areas vulnerable to new invasion, and to provide information to regional stakeholders through a decision support tool.

  16. Spatial distribution of seepage at a flow-through lake: Lake Hampen, Western Denmark

    DEFF Research Database (Denmark)

    Kidmose, Jacob Baarstrøm; Engesgaard, Peter Knudegaard; Nilsson, Bertel

    2011-01-01

    recharge patiern of the lake and relating these to the geologic history of the lake. Recharge of the surrounding aquifer by lake water occurs off shore in a narrow zone, as measured from lake–groundwater gradients. A 33-m-deep d18O profi le at the recharge side shows a lake d18O plume at depths...... that corroborates the interpretation of lake water recharging off shore and moving down gradient. Inclusion of lake bed heterogeneity in the model improved the comparison of simulated and observed discharge to the lake. The apparent age of the discharging groundwater to the lake was determined by CFCs, resulting...

  17. Preventing childhood obesity: the sentinel site for obesity prevention in Victoria, Australia.

    Science.gov (United States)

    Bell, A Colin; Simmons, Anne; Sanigorski, Andrea M; Kremer, Peter J; Swinburn, Boyd A

    2008-12-01

    In spite of greater awareness of the need for action to reduce obesity, the evidence on sustainable community approaches to prevent childhood and adolescent obesity is surprisingly sparse. This paper describes the design and methodological components of the Sentinel Site for Obesity Prevention, a demonstration site in the Barwon-South West region of Victoria, Australia, that aims to build the programs, skills and evidence necessary to attenuate and eventually reverse the obesity epidemic in children and adolescents. The Sentinel Site for Obesity Prevention is based on a partnership between the region's university (Deakin University) and its health, education and local government agencies. The three basic foundations of the Sentinel Site are: multi-strategy, multi-setting interventions; building community capacity; and undertaking program evaluations and population monitoring. Three intervention projects have been supported that cover different age groups (preschool: 2-5 years, primary school: 5-12 years, secondary school: 13-17 years), but that have many characteristics in common including: community participation and ownership of the project; an intervention duration of at least 3 years; and full evaluations with impact (behaviours) and outcome measures (anthropometry) compared with regionally representative comparison populations. We recommend the Sentinel Site approach to others for successfully building evidence for childhood obesity prevention and stimulating action on reducing the epidemic.

  18. Results of photochemical modeling sensitivity analyses in the Lake Michigan region: Current status of Lake Michigan Ozone Control Program (LMOP) modeling

    Energy Technology Data Exchange (ETDEWEB)

    Dolwick, P.D. [Lake Michigan Air Directors Consortium, Des Plaines, IL (United States); Kaleel, R.J. [Illinois Environmental Protection Agency, Springfield, IL (United States); Majewski, M.A. [Wisconsin Dept. of Natural Resources, Madison, WI (United States)

    1994-12-31

    The four states that border Lake Michigan are cooperatively applying a state-of-the-art nested photochemical grid model to assess the effects of potential emission control strategies on reducing elevated tropospheric ozone concentrations in the region to levels below the national ambient air quality standard. In order to provide an extensive database to support the application of the photochemical model, a substantial data collection effort known as the Lake Michigan Ozone Study (LMOS) was completed during the summer of 1991. The Lake Michigan Ozone Control Program (LMOP) was established by the States of Illinois, Wisconsin, Michigan, and Indiana to carry out the application of the modeling system developed from the LMOS, in terms of developing the attainment demonstrations required from this area by the Clean Air Act Amendments of 1990.

  19. The influence of climate variability on numbers of three waterbird species in Western Port, Victoria, 1973 2002

    Science.gov (United States)

    Chambers, Lynda E.; Loyn, Richard H.

    2006-05-01

    Seasonal and annual movements of Australian waterbirds are generally more complex than those of their Northern Hemisphere counterparts, and long-term data are needed to understand their relationships with climatic variables. This paper explores a long-term (1973 2002) set of waterbird counts from coastal Victoria and relates them to climatic data at local and continental scales. Three species (Black Swan Cygnus atratus, White-faced Heron Egretta novaehollandiae and Grey Teal Anas gracilis) were chosen for this analysis. Black Swans have large local breeding populations near the study region; White-faced Herons have smaller local breeding populations and Grey Teal breed extensively in ephemeral inland floodplains, such as those in the Murray-Darling Basin. All showed significant relationships with streamflow, regional rainfall and the Southern Oscillation Index (SOI) at appropriate scales and time-lags, with streamflow explaining the most variance. Black Swans showed a strong seasonal cycle in abundance and local climate variables had the greatest influence on the counts. Numbers were positively correlated with streamflow in southern Victoria three to six seasons before each count. Broader-scale climatic patterns were more important for the other two species. Numbers of White-faced Herons were positively correlated with streamflow or rainfall over various parts of Australia seven to nine seasons before each count. Numbers of Grey Teal showed weak seasonal cycles, and were negatively correlated with rainfall in Victoria or the Murray-Darling Basin in the seasons before or during each count, and positively with streamflow in the Murray-Darling Basin 15 18 months before each count.

  20. Lake Victoria water resources management challenges and ...

    African Journals Online (AJOL)

    ... governing management measures capable of meeting the needs of riparian states and ensuring sustainability within the basin is highlighted. Keywords: biodiversity loss; East Africa; eutrophication; heavy metal pollution; international treaties; Nile Basin; shared water resources. African Journal of Aquatic Science 2008, ...

  1. "Embodied Knowing": Exploring the Founding of the Melbourne Rudolf Steiner School in 1970S Victoria, Australia

    Science.gov (United States)

    Bak, Tao

    2018-01-01

    Education in Victoria, Australia not only underwent significant change in the 1970s, but was witness to a widespread educational reform project. Whilst exploration of the more widespread alternatives has been of some interest, the smaller progressive traditions that emerged in some ways "alongside" the broader reforms have rarely been…

  2. La memoria del último exilio español en la escritura de tres mujeres: Victoria Kent, Dolores Ibárruri y Carmen Parga

    Directory of Open Access Journals (Sweden)

    Bettina Pacheco

    2011-11-01

    Full Text Available Resumo: Este artigo realiza uma breve análise de três obras de testemunhos do exílio escritas por mulheres: Victoria Kent, destacada advogada socialista cromprometida com o governo da República Espanhola; Dolores Ibárruri, a mítica Pasionária; e Carmen Parga, republicana exilada na Rússia e México. As três dão sua visão, a sua maneira e através da escrita, sobre o drama vivido oferecendo sua concepção particular do exílio. Antes de entrar nas obras aludidas, examina-se brevemente as duas concepções sobre a dramática experiência do exilado que Cláudio Guillén reconheceu na escrita dos clássicos: Ovídio e Plutarco.Palavras-chave: Literatura comparada; literatura espanhola; Victoria Kent; Dolores Ibárruri; Carmen Parga; literatura latina; Ovídio; Plutarco; exílio.Resumen: Este artículo realiza um somero análisis de três obras testimoniales del exílio escritas por mujeres: Victoria Kent, destacada abogada socialista comprometida com el gobierno de la República Española; Dolores Ibárruri, la mítica Pasionaria; y Carmen Parga, republicana exiliada en Rusía y México. Las tres dan su visión, a su manera y a través de la escritura, sobre el drama vivido ofreciendo su concepción particular del exílio. Antes de entrar en las obras aludidas, se examina brevemente las dos concepiones sobre la dramática experiencia del exilado que Cláudio Guillén há reconocido em la escritura de dos clássicos: Ovídio y Plutarco.Palabras-clave: Literatura comparada; literatura española; Victoria Kent; Dolores Ibárruri; Carmen Parga; literatura latina; Ovídio; Plutarco; exílio.Keywords: Comparative literature; Spanish literature; Victoria Kent; Dolores Ibárruri; Carmen Parga; latin literature; Ovid; Plutarch; exile.

  3. Possible implications of Rabbit Calicivirus Disease for malleefowl Leipoa ocellata Gould in the north-west of Victoria

    NARCIS (Netherlands)

    Sandell, P.

    1999-01-01

    Parks Victoria and the Department of Natural Resources & Environment (NRE) are collaborating with agencies from the other States and the Commonwealth of Australia in a national program of detailed monitoring and surveillance of the effects of Rabbit Calicivirus Disease (RCD). A component of the

  4. Aquatic macrophyte richness in Danish lakes in relation to alkalinity, transparency, and lake area

    DEFF Research Database (Denmark)

    Vestergaard, Ole Skafte; Sand-Jensen, Kaj

    2000-01-01

    We examined the relationship between environmental factors and the richness of submerged macrophytes species in 73 Danish lakes, which are mainly small, shallow, and have mesotrophic to hypertrophic conditions. We found that mean species richness per lake was only 4.5 in acid lakes of low...... alkalinity but 12.3 in lakes of high alkalinity due to a greater occurrence of the species-rich group of elodeids. Mean species richness per lake also increased significantly with increasing Secchi depth. No significant relationship between species richness and lake surface area was observed among the entire...... group of lakes or a subset of eutrophic lakes, as the growth of submerged macrophytes in large lakes may be restricted by wave action in shallow water and light restriction in deep water. In contrast, macrophyte species richness increased with lake surface area in transparent lakes, presumably due...

  5. Saline lakes of the glaciated Northern Great Plains

    Science.gov (United States)

    Mushet, David M.

    2011-01-01

    Unless you have flown over the region or seen aerial photographs, it is hard to grasp the scale of the millions of lakes and wetlands that dot the prairie landscape of the glaciated Northern Great Plains (Figure 1). This region of abundant aquatic habitats within a grassland matrix provides for the needs of a wide diversity of wildlife species and has appropriately been deemed the "duck factory of North America." While the sheer number of lakes and wetlands within this area of the Northern Great Plains can be truly awe-inspiring, their diversity in terms of the chemical composition of their water adds an equally important component supporting biotic diversity and productivity. Water within these lakes and wetlands can range from extremely fresh with salinities approaching that of rainwater to hypersaline with salinity ten times greater than that of seawater. Additionally, while variation in salinity among these water bodies can be great, the ionic composition of lakes and wetlands with similar salinities can vary markedly, influencing the overall spatial and temporal diversity of the region's biota.

  6. LakeMIP Kivu: evaluating the representation of a large, deep tropical lake by a set of one-dimensional lake models

    Directory of Open Access Journals (Sweden)

    WIM Thiery

    2014-02-01

    Full Text Available The African great lakes are of utmost importance for the local economy (fishing, as well as being essential to the survival of the local people. During the past decades, these lakes experienced fast changes in ecosystem structure and functioning, and their future evolution is a major concern. In this study, for the first time a set of one-dimensional lake models are evaluated for Lake Kivu (2.28°S; 28.98°E, East Africa. The unique limnology of this meromictic lake, with the importance of salinity and subsurface springs in a tropical high-altitude climate, presents a worthy challenge to the seven models involved in the Lake Model Intercomparison Project (LakeMIP. Meteorological observations from two automatic weather stations are used to drive the models, whereas a unique dataset, containing over 150 temperature profiles recorded since 2002, is used to assess the model's performance. Simulations are performed over the freshwater layer only (60 m and over the average lake depth (240 m, since salinity increases with depth below 60 m in Lake Kivu and some lake models do not account for the influence of salinity upon lake stratification. All models are able to reproduce the mixing seasonality in Lake Kivu, as well as the magnitude and seasonal cycle of the lake enthalpy change. Differences between the models can be ascribed to variations in the treatment of the radiative forcing and the computation of the turbulent heat fluxes. Fluctuations in wind velocity and solar radiation explain inter-annual variability of observed water column temperatures. The good agreement between the deep simulations and the observed meromictic stratification also shows that a subset of models is able to account for the salinity- and geothermal-induced effects upon deep-water stratification. Finally, based on the strengths and weaknesses discerned in this study, an informed choice of a one-dimensional lake model for a given research purpose becomes possible.

  7. A Review of the Taxation of Property: Local Government Rates in Victoria 1

    OpenAIRE

    Johnson, David T.

    1993-01-01

    The paper reviews the taxation of property in Victoria and in particular the method of raising revenue for local government from rural landowners. A major contradiction between the apparent philosophical basis and its application is identified. A modification to the existing method of calculation is suggested based on the use value of rural land. The advantages and disadvantages of the use value modification are discussed and compared to the system of property taxes presently used. The use me...

  8. The Socio-economics and Alternative Livelihood Options of Fishers ...

    African Journals Online (AJOL)

    The Socio-economics and Alternative Livelihood Options of Fishers of Lake Victoria, ... PROMOTING ACCESS TO AFRICAN RESEARCH ... Most fishers were males aged 29-38yrs while women were involved in processing and marketing.

  9. Quantifying Cyanobacteria and High Biomass Bloms from Satellite to Support Environmental Management and Public Use of U.S. Lakes and Estuaries

    Science.gov (United States)

    Tomlinson, Michelle C.; Stumpf, Richard P.; Dupuy, Danielle; Wynne, Timothy T.; Briggs, Travis

    2015-12-01

    Algal blooms of high biomass and cyanobacteria are on the rise, occurring both nationally and internationally. These blooms can foul beaches, clog water intakes, produce toxins that contaminate drinking water, and pose a threat to human and domestic animal health. A quantitative tool can aid in the management needs to respond to these issues. These blooms can affect many lakes within a state management district, pointing to the need for a synoptic and timely assessment. The 300 m Medium Resolution Imaging Spectrometer (MERIS) satellite imagery provided by the European Space Agency from 2002 to 2012 has led to advances in our ability to monitor these systems. Algorithms specific to quantifying high biomass blooms have been developed for use by state managers through a comparison of field radiometry, water quality and cell enumeration measurements, and remotely-sensed satellite data. These algorithms are designed to detect blooms even with atmospheric interference and suspended sediments. Initial evaluations were conducted for Florida lakes and the St. Johns River, Florida, USA and showed that cyanobacteria blooms, especially of Microcystis, can be identified and their biomass can be estimated (as chlorophyll concentration and other metrics). Forecasts and monitoring have been demonstrated for Lake Erie and for Florida. A multi-agency (NASA, EPA, NOAA, and USGS) project, “Cyanobacteria Assessment Network (CyAN)” intends to apply these methods to Sentinel-3 data in near real-time on a U.S. national scale, in order to support state management agencies in protecting public health and the environment.

  10. CE–QUAL–W2 water-quality model and supporting LOADEST models for Lake St. Croix, Wisconsin and Minnesota, 2013

    Data.gov (United States)

    Department of the Interior — A mechanistic, biophysical water-quality model (CE–QUAL–W2) was developed and calibrated for Lake St. Croix, Wisconsin and Minnesota. The Lake St. Croix CE–QUAL–W2...

  11. Methane emissions from permafrost thaw lakes limited by lake drainage.

    NARCIS (Netherlands)

    van Huissteden, J.; Berrittella, C.; Parmentier, F.J.W.; Mi, Y.; Maximov, T.C.; Dolman, A.J.

    2011-01-01

    Thaw lakes in permafrost areas are sources of the strong greenhouse gas methane. They develop mostly in sedimentary lowlands with permafrost and a high excess ground ice volume, resulting in large areas covered with lakes and drained thaw-lake basins (DTLBs; refs,). Their expansion is enhanced by

  12. The reduction of the intrapartum still birth rate at the Queen Victoria Memorial Hospital.

    Science.gov (United States)

    Anderson, I; Chang, A; Renou, P; Wood, C

    1977-06-18

    A significant reduction in intrapartum anoxic fetal deaths has occurred at the Queen Victoria Memorial Hospital over the last ten years. The possible explanations for this include a variety of factors, which may either improve the health of the population presenting to the hospital, or improve obstetric care. Epidemiological evidence suggests that the use of fetal diagnostic techniques has contributed to the reduction of intrapartum anoxic still births.

  13. Water Balance and Level Change of Lake Babati, Tanzania: Sensitivity to Hydroclimatic Forcings

    Directory of Open Access Journals (Sweden)

    René P. Mbanguka

    2016-12-01

    Full Text Available We develop and present a novel integrated water balance model that accounts for lake water—groundwater interactions, and apply it to the semi-closed freshwater Lake Babati system, Northern Tanzania, East Africa. The model was calibrated and used to evaluate the lake level sensitivity to changes in key hydro-climatic variables such as temperature, precipitation, humidity and cloudiness. The lake response to the Coupled Model Intercomparison Project, Phase 5 (CMIP5 output on possible future climate outcomes was evaluated, an essential basis in understanding future water security and flooding risk in the region. Results show high lake level sensitivity to cloudiness. Increased focus on cloud fraction measurement and interpretation could likely improve projections of lake levels and surface water availability. Modelled divergent results on the future (21st century development of Lake Babati can be explained by the precipitation output variability of CMIP5 models being comparable to the precipitation change needed to drive the water balance model from lake dry-out to overflow; this condition is likely shared with many other East African lake systems. The developed methodology could be useful in investigations on change-driving processes in complex climate—drainage basin—lake systems, which are needed to support sustainable water resource planning in data scarce tropical Africa.

  14. Great Lakes Bathymetry

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry of Lakes Michigan, Erie, Saint Clair, Ontario and Huron has been compiled as a component of a NOAA project to rescue Great Lakes lake floor geological and...

  15. Lake and lake-related drainage area parameters for site investigation program

    Energy Technology Data Exchange (ETDEWEB)

    Blomqvist, P.; Brunberg, A.K. [Uppsala Univ. (Sweden). Dept. of Limnology; Brydsten, L [Umeaa Univ. (Sweden). Dept. of Ecology and Environmental Science

    2000-09-01

    In this paper, a number of parameters of importance to a preliminary determination of the ecological function of lakes are presented. The choice of parameters have been made with respect to a model for the determination of the nature conservation values of lakes which is currently being developed by the authors of this report, but is also well suited for a general description of the lake type and the functioning of the inherent ecosystem. The parameters have been divided into five groups: (1) The location of the object relative important gradients in the surrounding nature; (2) The lake catchment area and its major constituents; (3) The lake morphometry; (4) The lake ecosystem; (5) Human-induced damages to the lake ecosystem. The first two groups, principally based on the climate, hydrology, geology and vegetation of the catchment area represent parameters that can be used to establish the rarity and representativity of the lake, and will in the context of site investigation program be used as a basis for generalisation of the results. The third group, the lake morphometry parameters, are standard parameters for the outline of sampling programmes and for calculations of the physical extension of different key habitats in the system. The fourth group, the ecosystem of the lake, includes physical, chemical and biological parameters required for determination of the stratification pattern, light climate, influence from the terrestrial ecosystem of the catchment area, trophic status, distribution of key habitats, and presence of fish and rare fauna and flora in the lake. In the context of site investigation program, the parameters in these two groups will be used for budget calculations of the flow of energy and material in the system. The fifth group, finally, describes the degree on anthropogenic influence on the ecosystem and will in the context of site investigation programmes be used to judge eventual malfunctioning within the entire, or parts of, the lake

  16. Lake and lake-related drainage area parameters for site investigation program

    International Nuclear Information System (INIS)

    Blomqvist, P.; Brunberg, A.K.; Brydsten, L

    2000-09-01

    In this paper, a number of parameters of importance to a preliminary determination of the ecological function of lakes are presented. The choice of parameters have been made with respect to a model for the determination of the nature conservation values of lakes which is currently being developed by the authors of this report, but is also well suited for a general description of the lake type and the functioning of the inherent ecosystem. The parameters have been divided into five groups: 1) The location of the object relative important gradients in the surrounding nature; 2) The lake catchment area and its major constituents; 3) The lake morphometry; 4) The lake ecosystem; 5) Human-induced damages to the lake ecosystem. The first two groups, principally based on the climate, hydrology, geology and vegetation of the catchment area represent parameters that can be used to establish the rarity and representativity of the lake, and will in the context of site investigation program be used as a basis for generalisation of the results. The third group, the lake morphometry parameters, are standard parameters for the outline of sampling programmes and for calculations of the physical extension of different key habitats in the system. The fourth group, the ecosystem of the lake, includes physical, chemical and biological parameters required for determination of the stratification pattern, light climate, influence from the terrestrial ecosystem of the catchment area, trophic status, distribution of key habitats, and presence of fish and rare fauna and flora in the lake. In the context of site investigation program, the parameters in these two groups will be used for budget calculations of the flow of energy and material in the system. The fifth group, finally, describes the degree on anthropogenic influence on the ecosystem and will in the context of site investigation programmes be used to judge eventual malfunctioning within the entire, or parts of, the lake ecosystem

  17. Health (Radiation Safety) Act 1983 (Victoria) No. 9889 of 17 May 1983

    International Nuclear Information System (INIS)

    1983-01-01

    This Act amends the Health Act 1958 by adding a new Section entitled ''Radiation Safety''. In addition to establishing guidelines for the registration and licensing of certain radiation apparatus and sealed radioactive sources, this new Section authorises the Governor in Council to make regulations concerning, inter alia, transport and disposal of radioactive substances and public health and safety. The Act also sets up a Radiation Advisory Committee and a Radiographers and Radiation Technologists Registration Board of Victoria and amends the Nuclear Activities (Prohibitions) Act 1983 in respect of certain licensing provisions. (NEA) [fr

  18. Birth centre confinement at the Queen Victoria Medical Centre: four years' experience.

    Science.gov (United States)

    Morris, N; Campbell, J; Biro, M A; Lumley, J; Rao, J; Spensley, J

    1986-06-09

    A review of the first four years of the functioning of the birth centre at the Queen Victoria Medical Centre is presented. In that time, 1040 pregnant women were accepted for confinement there. Of these, 52 withdrew for non-obstetric reasons, while 470 were transferred to alternative obstetrical care--274 because of antepartum complications and 196 because of intrapartum problems. Therefore, 518 women were delivered in the birth centre. The care of the women is entrusted almost entirely to a team of midwives and this review demonstrates an enviable safety record.

  19. Rubidium-strontium ages from the Oxford Lake-Knee Lake greenstone belt, northern Manitoba

    International Nuclear Information System (INIS)

    Clark, G.S.; Cheung, S.-P.

    1980-01-01

    Rb-Sr whole-rock ages have been determined for rocks from the Oxford Lake-Knee Lake-Gods Lake geenstone belt in the Superior Province of northeastern Manitoba. The age of the Magill Lake Pluton is 2455 +- 35 Ma(lambda 87 Rb = 1.42 x 10 -11 yr -1 ), with an initial 87 Sr/ 86 Sr ratio of 0.7078 +- 0.0043. This granite stock intrudes the Oxford Lake Group, so it is post-tectonic and probably related to the second, weaker stage of metamorphism. The age of the Bayly Lake Pluton is 2424 +- 74 Ma, with an initial 87 Sr/ 86 Sr ratio of 0.7029 +- 0.0001. This granodioritic batholith complex does not intrude the Oxford Lake Group. It is syn-tectonic and metamorphosed. The age of volcanic rocks of the Hayes River Group, from Goose Lake (30 km south of Gods Lake Narrows), is 2680 +- 125 Ma, with an initial 87 Sr/ 86 Sr ratio of 0.7014 +- 0.0009. The age for the Magill Lake and Bayly Lake Plutons can be interpreted as the minimum ages of granite intrusion in the area. The age for the Hayes River Group volcanic rocks is consistent with Rb-Sr ages of volcanic rocks from other Archean greenstone belts within the northwestern Superior Province. (auth)

  20. Socioeconomic constraints to sustainable cocoyam production in the ...

    African Journals Online (AJOL)

    AGHOGHO A

    Full Length Research Paper ... 4Makerere University, Department of Crop Science, P. O. Box 7062, ... Cocoyam production, social and economic constraints, Lake Victoria region. .... available throughout the year and is also a stable source.

  1. Turning attention to clinician engagement in Victoria.

    Science.gov (United States)

    Jorm, Christine; Hudson, Robyn; Wallace, Euan

    2017-11-16

    The engagement of clinicians with employing organisations and with the broader health system results in better safer care for patients. Concerns about the adequacy of clinician engagement in the state of Victoria led the Victorian Department of Health and Human Services to commission a scoping study. During this investigation more than 100 clinicians were spoken with and 1800 responded to surveys. The result was creation of a clear picture of what engagement and disengagement looked like at all levels - from the clinical microsystem to state health policy making. Multiple interventions are possible to enhance clinician engagement and thus the care of future patients. A framework was developed to guide future Victorian work with four elements: setting the agenda, informing, involving and empowering clinicians. Concepts of work or employee engagement that are used in other industries don't directly translate to healthcare and thus the definition of engagement chosen for use centred on involvement. This was designed to encourage system managers to ensure clinicians are full participants in design, planning and evaluation and in all decisions that affect them and their patients.

  2. Development of Turbulent Diffusion Transfer Algorithms to Estimate Lake Tahoe Water Budget

    Science.gov (United States)

    Sahoo, G. B.; Schladow, S. G.; Reuter, J. E.

    2012-12-01

    The evaporative loss is a dominant component in the Lake Tahoe hydrologic budget because watershed area (813km2) is very small compared to the lake surface area (501 km2). The 5.5 m high dam built at the lake's only outlet, the Truckee River at Tahoe City can increase the lake's capacity by approximately 0.9185 km3. The lake serves as a flood protection for downstream areas and source of water supply for downstream cities, irrigation, hydropower, and instream environmental requirements. When the lake water level falls below the natural rim, cessation of flows from the lake cause problems for water supply, irrigation, and fishing. Therefore, it is important to develop algorithms to correctly estimate the lake hydrologic budget. We developed a turbulent diffusion transfer model and coupled to the dynamic lake model (DLM-WQ). We generated the stream flows and pollutants loadings of the streams using the US Environmental Protection Agency (USEPA) supported watershed model, Loading Simulation Program in C++ (LSPC). The bulk transfer coefficients were calibrated using correlation coefficient (R2) as the objective function. Sensitivity analysis was conducted for the meteorological inputs and model parameters. The DLM-WQ estimated lake water level and water temperatures were in agreement to those of measured records with R2 equal to 0.96 and 0.99, respectively for the period 1994 to 2008. The estimated average evaporation from the lake, stream inflow, precipitation over the lake, groundwater fluxes, and outflow from the lake during 1994 to 2008 were found to be 32.0%, 25.0%, 19.0%, 0.3%, and 11.7%, respectively.

  3. A Dynamical Downscaling study over the Great Lakes Region Using WRF-Lake: Historical Simulation

    Science.gov (United States)

    Xiao, C.; Lofgren, B. M.

    2014-12-01

    As the largest group of fresh water bodies on Earth, the Laurentian Great Lakes have significant influence on local and regional weather and climate through their unique physical features compared with the surrounding land. Due to the limited spatial resolution and computational efficiency of general circulation models (GCMs), the Great Lakes are geometrically ignored or idealized into several grid cells in GCMs. Thus, the nested regional climate modeling (RCM) technique, known as dynamical downscaling, serves as a feasible solution to fill the gap. The latest Weather Research and Forecasting model (WRF) is employed to dynamically downscale the historical simulation produced by the Geophysical Fluid Dynamics Laboratory-Coupled Model (GFDL-CM3) from 1970-2005. An updated lake scheme originated from the Community Land Model is implemented in the latest WRF version 3.6. It is a one-dimensional mass and energy balance scheme with 20-25 model layers, including up to 5 snow layers on the lake ice, 10 water layers, and 10 soil layers on the lake bottom. The lake scheme is used with actual lake points and lake depth. The preliminary results show that WRF-Lake model, with a fine horizontal resolution and realistic lake representation, provides significantly improved hydroclimates, in terms of lake surface temperature, annual cycle of precipitation, ice content, and lake-effect snowfall. Those improvements suggest that better resolution of the lakes and the mesoscale process of lake-atmosphere interaction are crucial to understanding the climate and climate change in the Great Lakes region.

  4. [Characterizing chromophoric dissolved organic matter (CDOM) in Lake Honghu, Lake Donghu and Lake Liangzihu using excitation-emission matrices (EEMs) fluorescence and parallel factor analysis (PARAFAC)].

    Science.gov (United States)

    Zhou, Yong-Qiang; Zhang, Yun-Lin; Niu, Cheng; Wang, Ming-Zhu

    2013-12-01

    Little is known about DOM characteristics in medium to large sized lakes located in the middle and lower reaches of Yangtze River, like Lake Honghu, Lake Donghu and Lake Liangzihu. Absorption, fluorescence and composition characteristics of chromophoric dissolved organic matter (CDOM) are presented using the absorption spectroscopy, the excitation-emission ma trices (EEMs) fluorescence and parallel factor analysis (PARAFAC) model based on the data collected in Sep-Oct. 2007 including 15, 9 and 10 samplings in Lake Honghu, Lake Donghu and Lake Liangzihu, respectively. CDOM absorption coefficient at 350 nm a(350) coefficient in Lake Honghu was significantly higher than those in Lake Donghu and Lake Liangzihu (t-test, pCDOM spectral slope in the wavelength range of 280-500 nm (S280-500) and a(350) (R2 =0. 781, p<0. 001). The mean value of S280-500 in Lake Honghu was significantly lower than those in Lake Donghu (t-test, pLake Liangzihu (t-test, p<0. 001). The mean value of spectral slope ratio SR in Lake Honghu was also significantly lower than those in Lake Donghu and Lake Liangzihu (t-test, p<0. 05). Two humic-like (C1, C2) and two protein-like fluorescent components (C3, C4) were identified by PARAFAC model, among which significant positive correlations were found between C1 and C2 (R2 =0. 884, p<0. 001), C3 and C4 (R2 =0. 677, p<0.001), respectively, suggesting that the sources of the two humic-like components as well as the two protein-like components were similar. However, no significant correlation has been found between those 4 fluorescent components and DOC concentration. Th e fluorescenceindices of FI255 (HIX), Fl265, FI310 (BIX) and Fl370 in Lake Donghu were all significantly higher than those in Lake Liangzihu (t-test, p <0.05) and Lake Honghu (t-test, p<0. 01), indicating that the eutrophication status in Lake Donghu was higher than Lake Honghu and Lake Liangzihu.

  5. A 400-year phytolith-based reconstruction of wild rice (Zizania palustris) abundance from Mud Lake core sediments, Fond du Lac Band of Lake Superior Chippewa Reservation, Minnesota, USA.

    Science.gov (United States)

    Munoz, R.; Caylor, E.; Yost, C. L.; Drake, C.; Ladwig, J. L.; Myrbo, A.; Howes, T.

    2014-12-01

    Wild rice (Zizania palustris L.) is an aquatic grass with spiritual and subsistence significance to Native people of the Great Lakes region of North America. Mud Lake (Mashkiigwaagamaag), located on the Fond du Lac Band of Lake Superior Chippewa Reservation in Carlton County, Minnesota, USA, once supported an extensive population of wild rice (manoomin). However, early 20th century attempts to ditch and drain surrounding wetlands for landuse intensification severely altered the natural hydrological system that supports wild rice. Fond du Lac Resource Management (FDLRM) technicians are currently working to increase the wild rice population in Mud Lake. As part of these efforts, this phytolith study was undertaken to better understand how wild rice abundance has fluctuated over the past 400 years, with particular emphasis on the 19th and 20th centuries. Phytoliths are microscopic opal silica plant remains that are incorporated into soils and lake sediments after the plant-parts that contain them decay. Wild rice produces phytolith morphotypes that are unequivocally diagnostic. Mud Lake core MNMN-MUD11-1C-1P-1 (46°43'38.39"N, 92°42'2.45"W) was piston cored by LacCore (National Lacustrine Core Facility) and FDLRM technicians on 24 May 2011. Initial core descriptions, multi-sensor core logging, phytolith sampling and phytolith extractions were completed during the summer of 2014 at LacCore. Wild rice phytolith identification and quantification was conducted on twelve samples using brightfield microscopy at 400x magnification. Wild rice phytolith concentration values ranged from 68 to 2,300 phytoliths/cm3. Wild rice accumulation rates ranged from 9 to 383 phytoliths/ cm2/yr, peaking in 1952 AD. Wild rice abundance in Mud Lake appears to be influenced by a complex set of variables that include anthropogenic disturbance, climatic events and aquatic plant community succession.

  6. Contributions of local knowledge to the physical limnology of Lake Como, Italy.

    Science.gov (United States)

    Laborde, Sarah; Imberger, Jörg; Toussaint, Sandy

    2012-04-24

    This article shows how local knowledge may be valuably integrated into a scientific approach in the study of large and complex hydrological systems where data collection at high resolution is a challenge. This claim is supported through a study of the hydrodynamics of a large lake where qualitative data collected from professional fishers was combined with theory to develop a hypothesis that was then verified by numerical modeling. First the fishermen's narratives were found to describe with accuracy internal wave motions that were evident in water column temperature records, which revealed their practical knowledge of the lake's hydrodynamics. Second, local knowledge accounts emphasized the recurrent formation of mesoscale gyres and return flows in certain zones of the lake in stratified conditions, which did not appear in the physical data because of limitations of sampling resolution. We hypothesized that these features developed predominantly because of the interaction of wind-driven internal motions with the lake's bathymetry, and the Earth's rotation in the widest areas of the basin. Numerical simulation results corroborated the fishers' descriptions of the flow paths and supported the hypothesis about their formation. We conclude that the collaboration between scientific and local knowledge groups, although an unusual approach for a physical discipline of the geosciences, is worth exploring in the pursuit of a more comprehensive understanding of complex geophysical systems such as large lakes.

  7. Integrated satellite InSAR and slope stability modeling to support hazard assessment at the Safuna Alta glacial lake, Peru

    Science.gov (United States)

    Cochachin, Alejo; Frey, Holger; Huggel, Christian; Strozzi, Tazio; Büechi, Emanuel; Cui, Fanpeng; Flores, Andrés; Saito, Carlos

    2017-04-01

    The Safuna glacial lakes (77˚ 37' W, 08˚ 50' S) are located in the headwater of the Tayapampa catchment, in the northernmost part of the Cordillera Blanca, Peru. The upper lake, Laguna Safuna Alta at 4354 m asl has formed in the 1960s behind a terminal moraine of the retreating Pucajirca Glacier, named after the peak south of the lakes. Safuna Alta currently has a volume of 15 x 106 m3. In 2002 a rock fall of several million m3 from the proximal left lateral moraine hit the Safuna Alta lake and triggered an impact wave which overtopped the moraine dam and passed into the lower lake, Laguna Safuna Baja, which absorbed most of the outburst flood from the upper lake, but nevertheless causing loss in cattle, degradation of agricultural land downstream and damages to a hydroelectric power station in Quitaracsa gorge. Event reconstructions showed that the impact wave in the Safuna Alta lake had a runup height of 100 m or more, and weakened the moraine dam of Safuna Alta. This fact, in combination with the large lake volumes and the continued possibility for landslides from the left proximal moraine pose a considerable risk for the downstream settlements as well as the recently completed Quitaracsa hydroelectric power plant. In the framework of a project funded by the European Space Agency (ESA), the hazard situation at the Safuna Alta lake is assessed by a combination of satellite radar data analysis, field investigations, and slope stability modeling. Interferometric analyses of the Synthetic Aperture Radar (InSAR) of ALOS-1 Palsar-1, ALOS-2 Palsar-2 and Sentinel-1 data from 2016 reveal terrain displacements of 2 cm y-1 in the detachment zone of the 2002 rock avalanche. More detailed insights into the characteristics of these terrain deformations are gained by repeat surveys with differential GPS (DGPS) and tachymetric measurements. A drone flight provides the information for the generation of a high-resolution digital elevation model (DEM), which is used for the

  8. What do we know about Indonesian tropical lakes? Insights from high frequency measurement

    Science.gov (United States)

    Budi Santoso, Arianto; Triwisesa, Endra; Fakhrudin, Muh.; Harsono, Eko; Agita Rustini, Hadiid

    2018-02-01

    When measuring ecological variables in lakes, sampling frequency is critical in capturing an environmental pattern. Discrete sampling of traditional monitoring programs is likely to result in vital knowledge gaps in understanding any processes particularly those with fine temporal scale characteristics. The development of high frequency measurements offer a sophisticated range of information in recording any events in lakes at a finer time scale. We present physical indices of a tropical deep Lake Maninjau arrayed from OnLine Monitoring System (OLM). It is revealed that Lake Maninjau mostly has a diurnal thermal stratification pattern. The calculated lake stability (Schmidt stability), however, follows a seasonal pattern; low in December-January and around August, and high in May and September. Using a 3D numerical model simulation (ELCOM), we infer how wind and solar radiation intensity control lake’s temperature profiles. In this review, we highlight the needs of high frequency measurement establishment in Indonesian tropical lakes to better understand the unique processes and to support the authorities’ decision making in maximizing the provision of ecosystem services supplied by lakes and reservoirs.

  9. Deglaciation, lake levels, and meltwater discharge in the Lake Michigan basin

    Science.gov (United States)

    Colman, Steven M.; Clark, J.A.; Clayton, L.; Hansel, A.K.; Larsen, C.E.

    1994-01-01

    The deglacial history of the Lake Michigan basin, including discharge and routing of meltwater, is complex because of the interaction among (1) glacial retreats and re-advances in the basin (2) the timing of occupation and the isostatic adjustment of lake outlets and (3) the depositional and erosional processes that left evidence of past lake levels. In the southern part of the basin, a restricted area little affected by differential isostasy, new studies of onshore and offshore areas allow refinement of a lake-level history that has evolved over 100 years. Important new data include the recognition of two periods of influx of meltwater from Lake Agassiz into the basin and details of the highstands gleaned from sedimentological evidence. Major disagreements still persist concerning the exact timing and lake-level changes associated with the Algonquin phase, approximately 11,000 BP. A wide variety of independent data suggests that the Lake Michigan Lobe was thin, unstable, and subject to rapid advances and retreats. Consequently, lake-level changes were commonly abrupt and stable shorelines were short-lived. The long-held beliefs that the southern part of the basin was stable and separated from deformed northern areas by a hinge-line discontinuity are becoming difficult to maintain. Numerical modeling of the ice-earth system and empirical modeling of shoreline deformation are both consistent with observed shoreline tilting in the north and with the amount and pattern of modern deformation shown by lake-level gauges. New studies of subaerial lacustrine features suggest the presence of deformed shorelines higher than those originally ascribed to the supposed horizontal Glenwood level. Finally, the Lake Michigan region as a whole appears to behave in a similar manner to other areas, both local (other Great Lakes) and regional (U.S. east coast), that have experienced major isostatic changes. Detailed sedimentological and dating studies of field sites and additional

  10. Lakes, Lagerstaetten, and Evolution

    Science.gov (United States)

    Kordesch, E. G.; Park, L. E.

    2001-12-01

    The diversity of terrestrial systems is estimated to be greater than in the marine realm. However no hard data yet exists to substantiate this claim. Ancient lacustrine deposits may preserve an exceptionally diverse fossil fauna and aid in determining continental faunal diversities. Fossils preserved in lake deposits, especially those with exceptional preservation (i.e. Konservat Lagerstaetten), may represent a dependable method for determining species diversity changes in the terrestrial environment because of their faunal completeness. Important Konservat Lagerstaetten, such as the Green River Formation (US) and Messel (Germany), both Eocene in age, are found in lake sediments and show a remarkable faunal diversity for both vertebrates and invertebrates. To date information from nearly 25 lake lagerstaetten derived from different types of lake basins from the Carboniferous to the Miocene have been collected and described. Carboniferous sites derive from the cyclothems of Midcontinent of the US while many Cenozoic sites have been described from North and South America as well as Europe and Australia. Asian sites contain fossils from the Mesozoic and Cenozoic. With this data, insight into the evolutionary processes associated with lake systems can be examined. Do lakes act as unique evolutionary crucibles in contrast to marine systems? The speciation of cichlid fishes in present-day African lakes appears to be very high and is attributed to the diversity of environments found in large rift lakes. Is this true of all ancient lakes or just large rift lakes? The longevity of a lake system may be an important factor in allowing speciation and evolutionary processes to occur; marine systems are limited only in the existence of environments as controlled by tectonics and sea level changes, on the order of tens of millions of years. Rift lakes are normally the longest lived in the millions of years. Perhaps there are only certain types of lakes in which speciation of

  11. The Meaning of ‘General Paralysis of the Insane’ in Victoria, Australia; 1886 to 1906

    Directory of Open Access Journals (Sweden)

    Roberts, Phillip

    2014-06-01

    Full Text Available This paper presents a conclusion to the meaning of the historical diagnosis “general paralysis of the insane” in nineteenth century Victorian Registrar General”s reports. Most studies suggest that in the past the diagnosis refers to neuro-syphilis, and while after 1906 this is not disputed, this paper will show that the diagnosis had a much broader meaning incorporating many forms of degenerative brain disease during the study period (Victoria 1886 to 1906. It is acknowledged, however, that the use of this diagnosis may have varied dramatically in the past based on a doctor’s education and/or background. This conclusion has been arrived at by analysing both government and general hospital records on the Australian, Victorian population. This paper also presents methods for determining the meaning of obsolete medical diagnoses where the definition is poorly understood.En este trabajo presenta una conclusión sobre el significado de la “parálisis general de los locos” como diagnóstico en los informes del Victorian Registrar General durante el siglo XIX. La mayoría de los estudios sugieren que en el pasado el diagnóstico se refiere a la neuro-sífilis, y aunque después de 1906 no se discute, este trabajo mostrará que el diagnóstico tiene un significado mucho más amplio e incorpora muchas formas de enfermedad degenerativa del cerebro durante el período de estudio (Victoria 1886 a 1906. Se reconoce, sin embargo, que el uso de este diagnóstico puede haber variado drásticamente en el pasado dependiendo de la formación y del ambiente médico. Se ha llegado a esta conclusión mediante el análisis de los registros hospitalarios de la población de Victoria, Australia. Este documento también presenta métodos para determinar el significado de los diagnósticos médicos obsoletos cuya definición es confusa.

  12. Suspended-sediment budget, flow distribution, and lake circulation for the Fox Chain of Lakes in Lake and McHenry Counties, Illinois, 1997-99

    Science.gov (United States)

    Schrader, David L.; Holmes, Robert R.

    2000-01-01

    The Fox Chain of Lakes is a glacial lake system in McHenry and Lake Counties in northern Illinois and southern Wisconsin. Sedimentation and nutrient overloading have occurred in the lake system since the first dam was built (1907) in McHenry to raise water levels in the lake system. Using data collected from December 1, 1997, to June 1, 1999, suspended-sediment budgets were constructed for the most upstream lake in the system, Grass Lake, and for the lakes downstream from Grass Lake. A total of 64,900 tons of suspended sediment entered Grass Lake during the study, whereas a total of 70,600 tons of suspended sediment exited the lake, indicating a net scour of 5,700 tons of sediment. A total of 44,100 tons of suspended sediment was measured exiting the Fox Chain of Lakes at Johnsburg, whereas 85,600 tons entered the system downstream from Grass Lake. These suspended-sediment loads indicate a net deposition of 41,500 tons downstream from Grass Lake, which represents a trapping efficiency of 48.5 percent. A large amount of recreational boating takes place on the Fox Chain of Lakes during summer months, and suspended-sediment load was observed to rise from 110 tons per day to 339 tons per day during the 1999 Memorial Day weekend (May 26 ?31, 1999). Presumably, this rise was the result of the boating traffic because no other hydrologic event is known to have occurred that might have caused the rise. This study covers a relatively short period and may not represent the long-term processes of the Fox Chain of Lakes system, although the sediment transport was probably higher than an average year. The bed sediments found on the bottom of the lakes are composed of mainly fine particles in the silt-clay range. The Grass Lake sediments were characterized as black peat with an organic content of between 9 and 18 percent, and the median particle size ranged from 0.000811 to 0.0013976 inches. Other bed material samples were collected at streamflow-gaging stations on the

  13. Myxomatosis in the Mallee region of Victoria, Australia.

    Science.gov (United States)

    Shepherd, R C; Edmonds, J W; Nolan, I F; Gocs, A

    1978-10-01

    Sharp reductions in the wild rabbit (Oryctolagus cuniculus (L.)) population in the Mallee are associated with annual myxomatosis epizootics. The extent to which the population reductions are the direct result of the epizootics varies with time of epizootic occurrence. All grazing animals in the Mallee are under nutritional stress each summer and autumn. When the epizootic occurs during the early summer heavy losses occur in a previously healthy population. Similar losses which occur in the late summer and autumn are the result of a nutritional stress - epizootic complex. The end result in each case is a population reduction of about 80%. This reduction occurs in a population which is the most resistant to myxomatosis known in Victoria and in association with epizootics caused by field strains of myxoma virus of moderate virulence only. The earlier summer epizootics are of considerable economic importance because they sharply reduce the pressure on the limited food available for other grazing animals.

  14. Experimental Support for Evaluation of the Victoria Class Virtual Submarine (VCVS)

    Science.gov (United States)

    2012-03-01

    comportementales de ce genre . y A P P R O V A L S H E E T Document No. 5283-001 Version 03 Document Name: Experimental Support for Evaluation...encountered that reduced access to HMCS Corner Brook: 11  Cold moves to charge submarine batteries;  Filming events; and,  Slight delays due

  15. 33 CFR 162.220 - Hoover Dam, Lake Mead, and Lake Mohave (Colorado River), Ariz.-Nev.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Hoover Dam, Lake Mead, and Lake... REGULATIONS § 162.220 Hoover Dam, Lake Mead, and Lake Mohave (Colorado River), Ariz.-Nev. (a) Lake Mead and... the axis of Hoover Dam and that portion of Lake Mohave (Colorado River) extending 4,500 feet...

  16. First evidence of successful natural reproduction by planted lake trout in Lake Huron

    Science.gov (United States)

    Nester, Robert T.; Poe, Thomas P.

    1984-01-01

    Twenty-two lake trout (Salvelinus namaycush) swim-up fry, 24-27 mm long, were captured with emergent fry traps and a tow net in northwestern Lake Huron on a small nearshore reef off Alpena, Michigan, between May 10 and June 1, 1982. These catches represent the first evidence of successful production of swim-up fry by planted, hatchery-reared lake trout in Lake Huron since the lake trout rehabilitation program began in 1973.

  17. Estimation of lake water - groundwater interactions in meromictic mining lakes by modelling isotope signatures of lake water.

    Science.gov (United States)

    Seebach, Anne; Dietz, Severine; Lessmann, Dieter; Knoeller, Kay

    2008-03-01

    A method is presented to assess lake water-groundwater interactions by modelling isotope signatures of lake water using meteorological parameters and field data. The modelling of delta(18)O and deltaD variations offers information about the groundwater influx into a meromictic Lusatian mining lake. Therefore, a water balance model is combined with an isotope water balance model to estimate analogies between simulated and measured isotope signatures within the lake water body. The model is operated with different evaporation rates to predict delta(18)O and deltaD values in a lake that is only controlled by weather conditions with neither groundwater inflow nor outflow. Comparisons between modelled and measured isotope values show whether the lake is fed by the groundwater or not. Furthermore, our investigations show that an adaptation of the Craig and Gordon model [H. Craig, L.I. Gordon. Deuterium and oxygen-18 variations in the ocean and the marine atmosphere. In Stable Isotopes in Oceanographic Studies and Paleotemperature, Spoleto, E. Tongiorgi (Ed.), pp. 9-130, Consiglio Nazionale delle Ricerche, Laboratorio di Geologia Nucleare, Pisa (1965).] to specific conditions in temperate regions seems necessary.

  18. Modelling catchment hydrological responses in a Himalayan Lake ...

    Indian Academy of Sciences (India)

    water extent of the lake barely covers 11.5 km2. (Badar and Romshoo ... Recent developments of decision support systems based on GIS and distributed hydrological models .... flow of the methodology is given in figure 2. 3.1.1 Model structure ...

  19. Lake Sturgeon, Acipenser fulvescens, movements in Rainy Lake, Minnesota and Ontario

    Science.gov (United States)

    Adams, W.E.; Kallemeyn, L.W.; Willis, D.W.

    2006-01-01

    Rainy Lake, Minnesota-Ontario, contains a native population of Lake Sturgeon (Acipenser fulvescens) that has gone largely unstudied. The objective of this descriptive study was to summarize generalized Lake Sturgeon movement patterns through the use of biotelemetry. Telemetry data reinforced the high utilization of the Squirrel Falls geographic location by Lake Sturgeon, with 37% of the re-locations occurring in that area. Other spring aggregations occurred in areas associated with Kettle Falls, the Pipestone River, and the Rat River, which could indicate spawning activity. Movement of Lake Sturgeon between the Seine River and the South Arm of Rainy Lake indicates the likelihood of one integrated population on the east end of the South Arm. The lack of re-locations in the Seine River during the months of September and October may have been due to Lake Sturgeon moving into deeper water areas of the Seine River and out of the range of radio telemetry gear or simply moving back into the South Arm. Due to the movements between Minnesota and Ontario, coordination of management efforts among provincial, state, and federal agencies will be important.

  20. Determining the influence of Itaipu Lake on thermal conditions for soybean development in adjacent lands

    Science.gov (United States)

    Wagner-Riddle, C.; Werner, S. S.; Caramori, P.; Ricce, W. S.; Nitsche, P.; von Bertoldi, P.; de Souza, E. F.

    2015-10-01

    Previous numerical simulations have suggested that the area adjacent to Itaipu Lake in Southern Brazil is significantly affecting the local thermal regime through development of a lake breeze. This has led to concerns that soybean growth and development, and consequently yield, has been affected by the creation of the artificial lake in this important agricultural region, but a systematic climatological study of the thermal effects of Itaipu Lake has not been conducted. The objectives of this study were to assess the spatial pattern of minimum and maximum air temperatures in a 10-km-wide area adjacent to Itaipu Lake as affected by distance from the water. Measurements were conducted over 3 years in seven transects along the shore of Itaipu Lake, with five weather stations placed in each transect. Phenological observations in soybean fields surrounding the weather stations were also conducted. Generalized additive models for location, scale, and shape (GAMLSS) analysis indicated no difference in the temperature time series as distance from water increased. Semivariograms showed that the random components in the air temperature were predominant and that there was no spatial structure to the signal. Wind direction measured over the three growing seasons demonstrated that, on average, the development of a lake breeze is limited to a few locations and a few hours of the day, supporting the temporal and spatial analysis. Phenological observations did not show differences in the timing of critical soybean stages. We suggest that the concerns that soybean development is potentially affected by the presence of Itaipu Lake are not supported by the thermal environment observed.

  1. Download this PDF file

    African Journals Online (AJOL)

    EJIRO

    source pollutants in Lake Victoria: A case study of. Gaba Landing ... 2004) have documented pollution as one of the major problems .... loaded with ions that conduct an electric current. .... sediments by Energy Dispersive X-Ray Fluorescence.

  2. Determining lake surface water temperatures worldwide using a tuned one-dimensional lake model (FLake, v1)

    Science.gov (United States)

    Layden, Aisling; MacCallum, Stuart N.; Merchant, Christopher J.

    2016-06-01

    A tuning method for FLake, a one-dimensional (1-D) freshwater lake model, is applied for the individual tuning of 244 globally distributed large lakes using observed lake surface water temperatures (LSWTs) derived from along-track scanning radiometers (ATSRs). The model, which was tuned using only three lake properties (lake depth, snow and ice albedo and light extinction coefficient), substantially improves the measured mean differences in various features of the LSWT annual cycle, including the LSWTs of saline and high altitude lakes, when compared to the observed LSWTs. Lakes whose lake-mean LSWT persists below 1 °C for part of the annual cycle are considered to be seasonally ice-covered. For trial seasonally ice-covered lakes (21 lakes), the daily mean and standard deviation (2σ) of absolute differences between the modelled and observed LSWTs are reduced from 3.07 °C ± 2.25 °C to 0.84 °C ± 0.51 °C by tuning the model. For all other trial lakes (14 non-ice-covered lakes), the improvement is from 3.55 °C ± 3.20 °C to 0.96 °C ± 0.63 °C. The post tuning results for the 35 trial lakes (21 seasonally ice-covered lakes and 14 non-ice-covered lakes) are highly representative of the post-tuning results of the 244 lakes. For the 21 seasonally ice-covered lakes, the modelled response of the summer LSWTs to changes in snow and ice albedo is found to be statistically related to lake depth and latitude, which together explain 0.50 (R2adj, p = 0.001) of the inter-lake variance in summer LSWTs. Lake depth alone explains 0.35 (p = 0.003) of the variance. Lake characteristic information (snow and ice albedo and light extinction coefficient) is not available for many lakes. The approach taken to tune the model, bypasses the need to acquire detailed lake characteristic values. Furthermore, the tuned values for lake depth, snow and ice albedo and light extinction coefficient for the 244 lakes provide some guidance on improving FLake LSWT modelling.

  3. Cardboard Boxes and Invisible Fences: Homelessness and Public Space in City of Victoria v. Adams

    Directory of Open Access Journals (Sweden)

    Sarah Buhler

    2009-02-01

    Full Text Available This paper analyzes the recent decision of the British Columbia Supreme Court in City of Victoria v. Adams. Specifically, the paper considers three interlocking themes that emerge from the decision: (1 the nature of “public space” in the context of homelessness; (2 the autonomy of homeless individuals; and (3 the meaning and value of the “homeless body.” With reference to each theme, the paper explores how the judgment in Adams grapples with the purportedly normative “Law and Economics”- type arguments put forth by the City of Victoria. By drawing on insights from Critical Legal Studies theory and feminist jurisprudence, the paper shows that Adams subverts and destabilizes certain “normative” perspectives about public space and homelessness. However, the paper goes on to argue that in its conflation of “cardboard box” shelters with the “invisible fences” envisioned by Justice Wilson in Morgentaler, Adams presents an ambiguous victory for anti-poverty advocates. The paper argues that the decision may serve to increase barriers for a broader and more progressive understanding of section 7 in the future. Dans cet article, on analyse le jugement récent de la Cour Suprême de la Colombie Britannique dans City of Victoria v. Adams. Plus précisément, on considère trois thèmes qui ressortent du jugement et qui s’entrecroisent : (1 la nature d’«espace public» dans le contexte de l’itinérance; (2 l’autonomie des sans-abri; et (3 la signification et la valeur du «corps sans abri». En rapport avec chaque thème, on explore comment l’arrêt Adams compose avec les arguments supposément normatifs du genre «La Loi et l’Économie» avancés par la ville de Victoria. En s’inspirant de perceptions tirées de la théorie des Critical Legal Studies et de la jurisprudence féministe, l’auteure démontre que l’arrêt Adams subvertit et déséquilibre certaines perspectives «normatives» au sujet de l

  4. Geochemical monitoring of volcanic lakes. A generalized box model for active crater lakes

    Directory of Open Access Journals (Sweden)

    Franco Tassi

    2011-06-01

    Full Text Available

    In the past, variations in the chemical contents (SO42−, Cl−, cations of crater lake water have not systematically demonstrated any relationships with eruptive activity. Intensive parameters (i.e., concentrations, temperature, pH, salinity should be converted into extensive parameters (i.e., fluxes, changes with time of mass and solutes, taking into account all the internal and external chemical–physical factors that affect the crater lake system. This study presents a generalized box model approach that can be useful for geochemical monitoring of active crater lakes, as highly dynamic natural systems. The mass budget of a lake is based on observations of physical variations over a certain period of time: lake volume (level, surface area, lake water temperature, meteorological precipitation, air humidity, wind velocity, input of spring water, and overflow of the lake. This first approach leads to quantification of the input and output fluxes that contribute to the actual crater lake volume. Estimating the input flux of the "volcanic" fluid (Qf- kg/s –– an unmeasurable subsurface parameter –– and tracing its variations with time is the major focus during crater lake monitoring. Through expanding the mass budget into an isotope and chemical budget of the lake, the box model helps to qualitatively characterize the fluids involved. The (calculated Cl− content and dD ratio of the rising "volcanic" fluid defines its origin. With reference to continuous monitoring of crater lakes, the present study provides tips that allow better calculation of Qf in the future. At present, this study offers the most comprehensive and up-to-date literature review on active crater lakes.

  5. The State Electricity Commission of Victoria and the greenhouse effect

    International Nuclear Information System (INIS)

    Hoy, R.D.

    1990-01-01

    The State Electricity Commission of Victoria is examining how the greenhouse issue may affect its electricity supply system in the future. Possible generation scenarios for 2005 are presented in order to show how the Toronto goal of a 20% reduction on 1988 levels of CO 2 emissions could be achieved. The main approaches to achieving these emission reductions include energy conservation and cogeneration, new gas-fired plant, use of renewable energy, reduction of energy system losses, retirement of older brown coal plant and an extensive tree planting program. It is estimated that achieving the Toronto goal would require electricity prices to rise by 1% to 1.5%, on average, each year by more than they otherwise would have, for the next 15 years. 12 refs., 3 tabs

  6. Water-quality and lake-stage data for Wisconsin lakes, water year 2014

    Science.gov (United States)

    Manteufel, S. Bridgett; Robertson, Dale M.

    2017-05-25

    IntroductionThe U.S. Geological Survey (USGS), in cooperation with local and other agencies, collects data at selected lakes throughout Wisconsin. These data, accumulated over many years, provide a database for developing an improved understanding of the water quality of lakes. To make these data available to interested parties outside the USGS, the data are published annually in this report series. The locations of water-quality and lake-stage stations in Wisconsin for water year 2014 are shown in figure 1. A water year is the 12-month period from October 1 through September 30. It is designated by the calendar year in which it ends. Thus, the periodOctober 1, 2013, through September 30, 2014, is called “water year 2014.”The purpose of this report is to provide information about the chemical and physical characteristics of Wisconsin lakes. Data that have been collected at specific lakes, and information to aid in the interpretation of those data, are included in this report. Data collected include measurements of in-lake water quality and lake stage. Time series of Secchi depths, surface total phosphorus, and chlorophyll a concentrations collected during nonfrozen periods are included for many lakes. Graphs of vertical profiles of temperature, dissolved oxygen, pH, and specific conductance are included for sites where these parameters were measured. Descriptive information for each lake includes the location of the lake, area of the lake’s watershed, period for which data are available, revisions to previously published records, and pertinent remarks. Additional data, such as streamflow and water quality in tributary and outlet streams of some of the lakes, are published online at http://nwis.waterdata.usgs.gov/wi/nwis.Water-resources data, including stage and discharge data at most streamflow-gaging stations, are available online. The Wisconsin Water Science Center’s home page is at https://www.usgs.gov/centers/wisconsin-water-science-center. Information

  7. Water and waste water management Generation Victoria - Latrobe Valley

    Energy Technology Data Exchange (ETDEWEB)

    Longmore, G. [Hazelwood Power Corporation, VIC (Australia); Pacific Power (International) Pty. Ltd., Sydney, NSW (Australia)

    1995-12-31

    Water is a necessary resource for coal fired power plant and waste water is generated. The efficient management of water and waste water systems becomes an important operational environmental factor. This paper describes the development and implementation of a ten year water and waste water management strategy for the Latrobe Valley Group of brown coal fired power stations in Victoria. In early 1991, a team was put together of representatives from each power site to develop the strategy entitled `SECV Latrobe Valley Water and Wastewater Management Strategy`. The strategy was developed with extensive public consultation, which was a factor in protracting the process such that the final document was not promulgated until late 1992. However, the final comprehensive document endorsed and agreed by management, has since attracted favourable comment as a model of its type. (author). 2 figs.

  8. Water and waste water management Generation Victoria - Latrobe Valley

    International Nuclear Information System (INIS)

    Longmore, G.

    1995-01-01

    Water is a necessary resource for coal fired power plant and waste water is generated. The efficient management of water and waste water systems becomes an important operational environmental factor. This paper describes the development and implementation of a ten year water and waste water management strategy for the Latrobe Valley Group of brown coal fired power stations in Victoria. In early 1991, a team was put together of representatives from each power site to develop the strategy entitled 'SECV Latrobe Valley Water and Wastewater Management Strategy'. The strategy was developed with extensive public consultation, which was a factor in protracting the process such that the final document was not promulgated until late 1992. However, the final comprehensive document endorsed and agreed by management, has since attracted favourable comment as a model of its type. (author). 2 figs

  9. Residual stress characterization of a fabrication weld from the VICTORIA-Class submarine pressure hull: revealing the unseen

    International Nuclear Information System (INIS)

    McGregor, R.J.; Rogge, R.B.

    2010-01-01

    Explicit understanding of the residual-stress character of primary submarine pressure hull weldments will improve the fidelity of numerical analysis and experimentation supporting operational envelope and design life. A length of circumferential-seam closure weld was contained within a section of hull plate removed from the HMCS VICTORIA during the extended docking work period (EDWP) refit operations. This has provided a rare opportunity for detailed characterization of the as-received condition of this common weld-type from original vessel assembly. In collaboration with the Canadian Neutron Beam Centre of the National Research Council (NRC), a program was conducted to study this weld using neutron diffraction. Neutron diffraction is able to survey nondestructively through the section thickness, providing a three-dimensional characterization, while leaving the specimen intact for complementary study by other methods. Results indicate tensile stress peaks of up to 80% of the base-material yield stress. Understanding the three-dimensional behaviour of residual stress in this type of weld provides a valuable resource to the numerical modelling community. The results can also support fatigue and fracture experimental work and serve to confirm and improve the interpretation of the existing body of 'surface-only' work conducted on similar welds. (author)

  10. Lake Michigan Offshore Wind Feasibility Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Boezaart, Arnold [GVSU; Edmonson, James [GVSU; Standridge, Charles [GVSU; Pervez, Nahid [GVSU; Desai, Neel [University of Michigan; Williams, Bruce [University of Delaware; Clark, Aaron [GVSU; Zeitler, David [GVSU; Kendall, Scott [GVSU; Biddanda, Bopi [GVSU; Steinman, Alan [GVSU; Klatt, Brian [Michigan State University; Gehring, J. L. [Michigan State University; Walter, K. [Michigan State University; Nordman, Erik E. [GVSU

    2014-06-30

    The purpose of this project was to conduct the first comprehensive offshore wind assessment over Lake Michigan and to advance the body of knowledge needed to support future commercial wind energy development on the Great Lakes. The project involved evaluation and selection of emerging wind measurement technology and the permitting, installation and operation of the first mid-lake wind assessment meteorological (MET) facilities in Michigan’s Great Lakes. In addition, the project provided the first opportunity to deploy and field test floating LIDAR and Laser Wind Sensor (LWS) technology, and important research related equipment key to the sitting and permitting of future offshore wind energy development in accordance with public participation guidelines established by the Michigan Great Lakes Wind Council (GLOW). The project created opportunities for public dialogue and community education about offshore wind resource management and continued the dialogue to foster Great Lake wind resource utilization consistent with the focus of the GLOW Council. The technology proved to be effective, affordable, mobile, and the methods of data measurement accurate. The public benefited from a substantial increase in knowledge of the wind resources over Lake Michigan and gained insights about the potential environmental impacts of offshore wind turbine placements in the future. The unique first ever hub height wind resource assessment using LWS technology over water and development of related research data along with the permitting, sitting, and deployment of the WindSentinel MET buoy has captured public attention and has helped to increase awareness of the potential of future offshore wind energy development on the Great Lakes. Specifically, this project supported the acquisition and operation of a WindSentinel (WS) MET wind assessment buoy, and associated research for 549 days over multiple years at three locations on Lake Michigan. Four research objectives were defined for the

  11. Simulating Lake-Groundwater Interactions During Decadal Climate Cycles: Accounting For Variable Lake Area In The Watershed

    Science.gov (United States)

    Virdi, M. L.; Lee, T. M.

    2009-12-01

    The volume and extent of a lake within the topo-bathymetry of a watershed can change substantially during wetter and drier climate cycles, altering the interaction of the lake with the groundwater flow system. Lake Starr and other seepage lakes in the permeable sandhills of central Florida are vulnerable to climate changes as they rely exclusively on rainfall and groundwater for inflows in a setting where annual rainfall and recharge vary widely. The groundwater inflow typically arrives from a small catchment area bordering the lake. The sinkhole origin of these lakes combined with groundwater pumping from underlying aquifers further complicate groundwater interactions. Understanding the lake-groundwater interactions and their effects on lake stage over multi-decadal climate cycles is needed to manage groundwater pumping and public expectation about future lake levels. The interdependence between climate, recharge, changing lake area and the groundwater catchment pose unique challenges to simulating lake-groundwater interactions. During the 10-year study period, Lake Starr stage fluctuated more than 13 feet and the lake surface area receded and expanded from 96 acres to 148 acres over drier and wetter years that included hurricanes, two El Nino events and a La Nina event. The recently developed Unsaturated Zone Flow (UZF1) and Lake (LAK7) packages for MODFLOW-2005 were used to simulate the changing lake sizes and the extent of the groundwater catchment contributing flow to the lake. The lake area was discretized to occupy the largest surface area at the highest observed stage and then allowed to change size. Lake cells convert to land cells and receive infiltration as receding lake area exposes the underlying unsaturated zone to rainfall and recharge. The unique model conceptualization also made it possible to capture the dynamic size of the groundwater catchment contributing to lake inflows, as the surface area and volume of the lake changed during the study

  12. Bromine species fluxes from Lake Constance’s catchment, and a preliminary lake mass balance

    Science.gov (United States)

    Gilfedder, B. S.; Petri, M.; Wessels, M.; Biester, H.

    2011-06-01

    the catchment, which is supported by Ti, Zr and Br/C org data. In the lake bromine was irreversibly lost to the sediments, with best flux estimates based on mass-balance and sediment trap data of +50-90 μg Br m -2 d -1. Overall, it appears that bromine is not simply a cyclic salt in the case of Lake Constance, with a clear geological component and dynamic lacustrine biogeochemistry.

  13. Identification of indigenous tree and shrub fodder species in the ...

    African Journals Online (AJOL)

    Mo

    intensive livestock systems in the Lake Victoria shore region of Uganda. It recommends further .... in some cases is sold. Goats and pigs are kept for sale and ..... techniques that optimize multiple products rather than maximize one product.

  14. Prevalence of Schistosoma mansoni and soil transmitted helminths ...

    African Journals Online (AJOL)

    Perennial rivers and streams run in the basin towards Lake. Victoria. ... The topographical map of ... Multivariable logistic regression was done to identify the independent ... A p –value lower than 0.05 was considered as statistically significant.

  15. African Journal of Environmental Science and Technology - Vol 5 ...

    African Journals Online (AJOL)

    Sustainable development in Cameroon's forestry sector: Progress, ... and their dispersion in Lake Victoria: A case study of Gaba landing site in Uganda ... Study on the changes in the levels of membrane-bound ATPases activity and some ...

  16. Gambling revenues as a public administration issue: electronic gaming machines in Victoria.

    Science.gov (United States)

    Pickernell, David; Keast, Robyn; Brown, Kerry; Yousefpour, Nina; Miller, Chris

    2013-12-01

    Gambling activities and the revenues derived have been seen as a way to increase economic development in deprived areas. There are also, however, concerns about the effects of gambling in general and electronic gaming machines (EGMs) in particular, on the resources available to the localities in which they are situated. This paper focuses on the factors that determine the extent and spending of community benefit-related EGM-generated resources within Victoria, Australia, focusing in particular on the relationships between EGM activity and socio-economic and social capital indicators, and how this relates to the community benefit resources generated by gaming.

  17. Visibility in health statistics: a population data linkage study more accurately identifying Aboriginal and Torres Strait Islander Births in Victoria, Australia, 1988-2008

    Directory of Open Access Journals (Sweden)

    Rebecca Ritte

    2017-04-01

    This is the first time that the VPDC and RBDM birth data were linked in Victoria. The matched birth information established a more complete population profile of Aboriginal and/or Torres Strait Islander births. These data will provide a more accurate baseline to enhance the Victorian and Australian governments’ ability to plan services, allocate resources and evaluate funded activities aimed at eliminating disparity experienced by Aboriginal and/or Torres Strait Islander peoples. Importantly, it has established a more accurate denominator from which to calculate Aboriginal infant mortality rates for Victoria, Australia. *Until 2009, the mother’s Indigenous identification only was recorded in the VPDC

  18. Human impact on lake ecosystems: the case of Lake Naivasha, Kenya

    African Journals Online (AJOL)

    Lake Naivasha is a wetland of national and international importance. However, it is under constant anthropogenic pressures, which include the quest for socioeconomic development within the lake ecosystem itself as well as other activities within the catchment. The lake is an important source of fresh water in an otherwise ...

  19. Lake whitefish and Diporeia spp. in the Great lakes: an overview

    Science.gov (United States)

    Nalepa, Thomas F.; Mohr, Lloyd C.; Henderson, Bryan A.; Madenjian, Charles P.; Schneeberger, Philip J.

    2005-01-01

    Because of growing concern in the Great Lakes over declines in abundance and growth of lake whitefish (Coregonus clupeaformis) and declines in abundance of the benthic amphipod Diporeia spp., a workshop was held to examine past and current trends, to explore trophic links, and to discuss the latest research results and needs. The workshop was divided into sessions on the status of populations in each of the lakes, bioenergetics and trophic dynamics, and exploitation and management. Abundance, growth, and condition of whitefish populations in Lakes Superior and Erie are stable and within the range of historical means, but these variables are declining in Lakes Michigan and Ontario and parts of Lake Huron. The loss of Diporeia spp., a major food item of whitefish, has been a factor in observed declines, particularly in Lake Ontario, but density-dependent factors also likely played a role in Lakes Michigan and Huron. The loss of Diporeia spp. is temporally linked to the introduction and proliferation of dreissenid mussels, but a direct cause for the negative response of Diporeia spp. has not been established. Given changes in whitefish populations, age-structured models need to be re-evaluated. Other whitefish research needs to include a better understanding of what environmental conditions lead to strong year-classes, improved aging techniques, and better information on individual population (stock) structure. Further collaborations between assessment biologists and researchers studying the lower food web would enhance an understanding of links between trophic levels.

  20. Classical Biological Control of Water Hyacinth, Eichhornia Crassipes (Liliales: Pomteridiaeae), Using Neochentina Spp, Weevils (Curculionidae), During the Re-Inversion Period in the Lake victoria

    International Nuclear Information System (INIS)

    Ochiel, G.R.S.

    2002-01-01

    The paper presents recent results from an ongoing classical biological control programme for water hyacinth, implemented by Kenya Agricultural Research Institute Under the Lake Environmental Project. After the successful control of the weed, a re-inversion in the lake was experienced in August 2000 in Nyakach Bay. Between november 2000 and June 2001, approximately 5600 adults Neochetina spp. (coleoptera: Curculionidae) weevils, biological control agents for water hyacinth Eichhornia crassipes (Liliales: Ponteridaceae) were harvested, from the Kibos rearing facility, Namba-Okana 'field security' and community weevil rearing units. Weevils were released on water hyacinth at thirteen sites in Berkeley, Nyakach, Osodo, Kendu, Homa and Karungu and Muhuru Bays, at Kuja-Migori river tributaries and upstream of Nzoia, Yala and Sondu-Miriu rivers. In general, reproductive and growth potential (number of daughter plants, petiole length and laminar area) and fresh weight of the weed was suppressed. there was a gradual increase in insect population levels (number of weevils plant -1 ) and damage to plants by weevil larvae. there is need to carry out an aerial survey to verify the visual estimates of water hyacinth cover and intensify mass rearing and releases of weevils in hotspot areas and to concentrate releases in riverine systems

  1. Sources and distribution of microplastics in China's largest inland lake - Qinghai Lake.

    Science.gov (United States)

    Xiong, Xiong; Zhang, Kai; Chen, Xianchuan; Shi, Huahong; Luo, Ze; Wu, Chenxi

    2018-04-01

    Microplastic pollution was studied in China's largest inland lake - Qinghai Lake in this work. Microplastics were detected with abundance varies from 0.05 × 10 5 to 7.58 × 10 5 items km -2 in the lake surface water, 0.03 × 10 5 to 0.31 × 10 5 items km -2 in the inflowing rivers, 50 to 1292 items m -2 in the lakeshore sediment, and 2 to 15 items per individual in the fish samples, respectively. Small microplastics (0.1-0.5 mm) dominated in the lake surface water while large microplastics (1-5 mm) are more abundant in the river samples. Microplastics were predominantly in sheet and fiber shapes in the lake and river water samples but were more diverse in the lakeshore sediment samples. Polymer types of microplastics were mainly polyethylene (PE) and polypropylene (PP) as identified using Raman Spectroscopy. Spatially, microplastic abundance was the highest in the central part of the lake, likely due to the transport of lake current. Based on the higher abundance of microplastics near the tourist access points, plastic wastes from tourism are considered as an important source of microplastics in Qinghai Lake. As an important area for wildlife conservation, better waste management practice should be implemented, and waste disposal and recycling infrastructures should be improved for the protection of Qinghai Lake. Copyright © 2018 Elsevier Ltd. All rights reserved.

  2. Out of the ashes: the new bachelor of midwifery curriculum at Victoria University.

    Science.gov (United States)

    Carolan, Mary; Kruger, Gina; Brown, Vera

    2007-09-01

    In the past decade, midwifery education has changed significantly in Australia. Previously, a nursing qualification (division 1) was required for entry into midwifery programs and on completion, graduands obtained a postgraduate diploma of midwifery. More recently, bachelor of midwifery programs have also been offered in Australia and currently, a considerable percentage of midwives are prepared for practice in this way. In Victoria, the bachelor of midwifery has been available since 2002, and at this time the third group of graduands are poised to enter the field. Implementation of the bachelor of midwifery program has given rise to many concerns about the development and applicability of this course. Concerns include: complexities of registration with a regulatory board set up primarily for nursing registration; concerns about readiness for practice among bachelor of midwifery graduands; escalating requirements within midwifery courses; and difficulties with meeting course requirements. As this course comes of age in Victoria, it is useful to reflect on some of the challenges encountered along the way. Thus, this paper reports on the journey of one university as it approaches the end of a first year of implementing an independent bachelor of midwifery program, following 5 years involvement as a consortium partner. In particular, it addresses concerns and difficulties encountered during early implementation of the program and then outlines strategies used to improve and strengthen the course. The basic premise of the paper is lessons learnt along the way.

  3. Regions of High Out-Of-Hospital Cardiac Arrest Incidence and Low Bystander CPR Rates in Victoria, Australia.

    Science.gov (United States)

    Straney, Lahn D; Bray, Janet E; Beck, Ben; Finn, Judith; Bernard, Stephen; Dyson, Kylie; Lijovic, Marijana; Smith, Karen

    2015-01-01

    Out-of-hospital cardiac arrest (OHCA) remains a major public health issue and research has shown that large regional variation in outcomes exists. Of the interventions associated with survival, the provision of bystander CPR is one of the most important modifiable factors. The aim of this study is to identify census areas with high incidence of OHCA and low rates of bystander CPR in Victoria, Australia. We conducted an observational study using prospectively collected population-based OHCA data from the state of Victoria in Australia. Using ArcGIS (ArcMap 10.0), we linked the location of the arrest using the dispatch coordinates (longitude and latitude) to Victorian Local Government Areas (LGAs). We used Bayesian hierarchical models with random effects on each LGA to provide shrunken estimates of the rates of bystander CPR and the incidence rates. Over the study period there were 31,019 adult OHCA attended, of which 21,436 (69.1%) cases were of presumed cardiac etiology. Significant variation in the incidence of OHCA among LGAs was observed. There was a 3 fold difference in the incidence rate between the lowest and highest LGAs, ranging from 38.5 to 115.1 cases per 100,000 person-years. The overall rate of bystander CPR for bystander witnessed OHCAs was 62.4%, with the rate increasing from 56.4% in 2008-2010 to 68.6% in 2010-2013. There was a 25.1% absolute difference in bystander CPR rates between the highest and lowest LGAs. Significant regional variation in OHCA incidence and bystander CPR rates exists throughout Victoria. Regions with high incidence and low bystander CPR participation can be identified and would make suitable targets for interventions to improve CPR participation rates.

  4. Outflows of groundwater in lakes: case study of Lake Raduńske Górne

    Directory of Open Access Journals (Sweden)

    Cieśliński Roman

    2014-12-01

    Full Text Available The aim of the study was to locate and describe groundwater outflows in a selected lake basin. The study hypothesis was based on the fact that, according to the specialist literature, one of the forms of lake water supply is through groundwater outflows. It was also assumed that the lakes of the Kashubian Lake District are characterised by such a form of lake water supply. The time scope of the work included the period from January 2011 to September 2012. The spatial scope of the work included the area of Lake Raduńskie Górne, located in the Kashubian Lake District in north Poland. The research plot was in the north-eastern part of the lake. Office works were aimed at gathering and studying source materials and maps. Cartographic materials were analysed with the use of the MapInfo Professional 9.5. The purpose of the field work was to find the groundwater outflows in the basin of Lake Raduńskie Górne. During the field research diving was carried out in the lake. During the dive audiovisual documentation was conducted using a Nikon D90 camera with Ikelite underwater housing for Nikon D90 and an Ikelite DS 161 movie substrobe, as well as a GoPro HD HERO 2 Outdoor camera. During the project, four groundwater outflows were found. In order to examine these springs audiovisual and photographic documentation was made. To systematise the typology of the discovered springs, new nomenclature was suggested, namely under-lake springs with subtypes: an under-lake slope spring and under-lake offshore spring

  5. Changing values of lake ecosystem services as a result of bacteriological contamination on Lake Trzesiecko and Lake Wielimie, Poland

    Directory of Open Access Journals (Sweden)

    Cichoń Małgorzata

    2017-12-01

    Full Text Available Lake ecosystems, on the one hand, are affected by tourism, and on the other by development for tourism. Lake ecosystem services include: water with its self-cleaning processes, air with climate control processes, as well as flora and fauna. Utilisation of services leads to interventions in the structure of ecosystems and their processes. Only to a certain extent, this is specific to each type of environmental interference, remains within the limits of ecosystem resilience and does not lead to its degradation. One of the threats is bacteriological contamination, for which the most reliable sanitation indicator is Escherichia coli. In lake water quality studies it is assumed that the lakeshore cannot be a source of bacteria. It has been hypothesised that the problem of bacterial contamination can be serious for the places that do not have any infrastructure, especially sanitation. Consequently, the purpose of the study was to determine the extent to which lakeshore sanitation, in particular the level of bacteriological contamination, has an impact on the value of services provided by the selected lake ecosystems (Lake Trzesiecko and Lake Wielimie – Szczecinek Lake District. Five selected services related to lake ecosystems are: water, control over the spread of contagious diseases, aesthetic values, tourism and recreation, as well as the hydrological cycle with its self-cleaning function. Services, as well as the criteria adopted for evaluation, allow us to conclude that the services provided by the lake ecosystems are suitable to fulfill a recreation function. However, the inclusion of quality criteria for sanitary status has shown that the value of system services has dropped by as much as 50%. Value changes are visible primarily for water and aesthetic qualities. Such a significant decrease in the value of services clearly indicates the importance of the sanitary conditions of lakes and their appropriate infrastructure. In view of the

  6. Indigenous Young People Transitioning from Out-of-Home Care (OOHC in Victoria, Australia: The Perspectives of Workers in Indigenous-Specific and Non-Indigenous Non-Government Services

    Directory of Open Access Journals (Sweden)

    Philip Mendes

    2016-08-01

    Full Text Available Indigenous children and young people are overrepresented in the Australian out-of-home care (OOHC system. To date, specific research has not been undertaken on workers' perspectives regarding the Indigenous-specific and non-Indigenous supports and services available to Indigenous young people exiting the system. This exploratory research involved focus group consultations with workers from seven child and family welfare agencies to examine the current support services available to Indigenous young people who are in or will be leaving out-of-home care in the State of Victoria. Findings suggest that Aboriginal Community Controlled Organisations (ACCOs play a positive role in working with non-Indigenous agencies to assist Indigenous care leavers. Participants identified some key strategies to improve outcomes, such as facilitating stronger relationships between Indigenous and non-Indigenous services, and improving the resourcing of ACCOs.

  7. Resilience and Restoration of Lakes

    Directory of Open Access Journals (Sweden)

    Stephen R. Carpenter

    1997-06-01

    Full Text Available Lake water quality and ecosystem services are normally maintained by several feedbacks. Among these are nutrient retention and humic production by wetlands, nutrient retention and woody habitat production by riparian forests, food web structures that cha nnel phosphorus to consumers rather than phytoplankton, and biogeochemical mechanisms that inhibit phosphorus recycling from sediments. In degraded lakes, these resilience mechanisms are replaced by new ones that connect lakes to larger, regional economi c and social systems. New controls that maintain degraded lakes include runoff from agricultural and urban areas, absence of wetlands and riparian forests, and changes in lake food webs and biogeochemistry that channel phosphorus to blooms of nuisance al gae. Economic analyses show that degraded lakes are significantly less valuable than normal lakes. Because of this difference in value, the economic benefits of restoring lakes could be used to create incentives for lake restoration.

  8. classification of plants according to their heavy metal content around

    African Journals Online (AJOL)

    Mgina

    accumulated heavy metals around North Mara Gold Mine were not known. To study such ... heavy metal hyperaccumulator plants for possible future remediation of the study area. ... mine is about 100 kilometers east of Lake. Victoria and 20 ...

  9. Response of the St. Joseph River to lake level changes during the last 12,000 years in the Lake Michigan basin

    Science.gov (United States)

    Kincare, K.A.

    2007-01-01

    The water level of the Lake Michigan basin is currently 177 m above sea level. Around 9,800 14C years B.P., the lake level in the Lake Michigan basin had dropped to its lowest level in prehistory, about 70 m above sea level. This low level (Lake Chippewa) had profound effects on the rivers flowing directly into the basin. Recent studies of the St. Joseph River indicate that the extreme low lake level rejuvenated the river, causing massive incision of up to 43 m in a valley no more than 1.6 km wide. The incision is seen 25 km upstream of the present shoreline. As lake level rose from the Chippewa low, the St. Joseph River lost competence and its estuary migrated back upstream. Floodplain and channel sediments partially refilled the recently excavated valley leaving a distinctly non-classical morphology of steep sides with a broad, flat bottom. The valley walls of the lower St. Joseph River are 12-18 m tall and borings reveal up to 30 m of infill sediment below the modern floodplain. About 3 ?? 108 m3 of sediment was removed from the St. Joseph River valley during the Chippewa phase lowstand, a massive volume, some of which likely resides in a lowstand delta approximately 30 km off-shore in Lake Michigan. The active floodplain below Niles, Michigan, is inset into an upper terrace and delta graded to the Calumet level (189 m) of Lake Chicago. In the lower portion of the terrace stratigraphy a 1.5-2.0 m thick section of clast-supported gravel marks the entry of the main St. Joseph River drainage above South Bend, Indiana, into the Lake Michigan basin. This gravel layer represents the consolidation of drainage that probably occurred during final melting out of ice-marginal kettle chains allowing stream piracy to proceed between Niles and South Bend. It is unlikely that the St. Joseph River is palimpsest upon a bedrock valley. The landform it cuts across is a glaciofluvial-deltaic feature rather than a classic unsorted moraine that would drape over pre-glacial topography

  10. Yellowstone Lake Nanoarchaeota

    Directory of Open Access Journals (Sweden)

    Scott eClingenpeel

    2013-09-01

    Full Text Available Considerable Nanoarchaeota novelty and diversity were encountered in Yellowstone Lake, Yellowstone National Park, where sampling targeted lake floor hydrothermal vent fluids, streamers and sediments associated with these vents, and in planktonic photic zones in three different regions of the lake. Significant homonucleotide repeats (HR were observed in pyrosequence reads and in near full-length Sanger sequences, averaging 112 HR per 1,349 bp clone and could confound diversity estimates derived from pyrosequencing, resulting in false nucleotide insertions or deletions (indels. However, Sanger sequencing of two different sets of PCR clones (110 bp, 1349 bp demonstrated that at least some of these indels are real. The majority of the Nanoarchaeota PCR amplicons were vent associated; however, curiously, one relatively small Nanoarchaeota OTU (70 pyrosequencing reads was only found in photic zone water samples obtained from a region of the lake furthest removed from the hydrothermal regions of the lake. Extensive pyrosequencing failed to demonstrate the presence of an Ignicoccus lineage in this lake, suggesting the Nanoarchaeota in this environment are associated with novel Archaea hosts. Defined phylogroups based on near full-length PCR clones document the significant Nanoarchaeota 16S rRNA gene diversity in this lake and firmly establish a terrestrial clade distinct from the marine Nanoarcheota as well as from other geographical locations.

  11. Contaminant trends in lake trout and walleye from the Laurentian Great Lakes

    Science.gov (United States)

    DeVault, David S.; Hesselberg, Robert J.; Rodgers, Paul W.; Feist, Timothy J.

    1996-01-01

    Trends in PCBs, DDT, and other contaminants have been monitored in Great Lakes lake trout and walleye since the 1970s using composite samples of whole fish. Dramatic declines have been observed in concentrations of PCB, ΣDDT, dieldrin, and oxychlordane, with declines initially following first order loss kinetics. Mean PCB concentrations in Lake Michigan lake trout increased from 13 μg/g in 1972 to 23 μg/g in 1974, then declined to 2.6 μg/g by 1986. Between 1986 and 1992 there was little change in concentration, with 3.5 μg/g observed in 1992. ΣDDT in Lake Michigan trout followed a similar trend, decreasing from 19.2 μg/g in 1970 to 1.1 μg/g in 1986, and 1.2 μg/g in 1992. Similar trends were observed for PCBs and ΣDDT in lake trout from Lakes Superior, Huron and Ontario. Concentrations of both PCB and ΣDDT in Lake Erie walleye declined between 1977 and 1982, after which concentrations were relatively constant through 1990. When originally implemented it was assumed that trends in the mean contaminant concentrations in open-lake fish would serve as cost effective surrogates to trends in the water column. While water column data are still extremely limited it appears that for PCBs in lakes Michigan and Superior, trends in lake trout do reasonably mimic those in the water column over the long term. Hypotheses to explain the trends in contaminant concentrations are briefly reviewed. The original first order loss kinetics used to describe the initial decline do not explain the more recent leveling off of contaminant concentrations. Recent theories have examined the possibilities of multiple contaminant pools. We suggest another hypothesis, that changes in the food web may have resulted in increased bioaccumulation. However, a preliminary exploration of this hypothesis using a change point analysis was inconclusive.

  12. Identification of sulfur-cycle prokaryotes in a low-sulfate lake (Lake Pavin) using aprA and 16S rRNA gene markers.

    Science.gov (United States)

    Biderre-Petit, Corinne; Boucher, Delphine; Kuever, Jan; Alberic, Patrick; Jézéquel, Didier; Chebance, Brigitte; Borrel, Guillaume; Fonty, Gérard; Peyret, Pierre

    2011-02-01

    Geochemical researches at Lake Pavin, a low-sulfate-containing freshwater lake, suggest that the dominant biogeochemical processes are iron and sulfate reduction, and methanogenesis. Although the sulfur cycle is one of the main active element cycles in this lake, little is known about the sulfate-reducer and sulfur-oxidizing bacteria. The aim of this study was to assess the vertical distribution of these microbes and their diversities and to test the hypothesis suggesting that only few SRP populations are involved in dissimilatory sulfate reduction and that Epsilonproteobacteria are the likely key players in the oxidative phase of sulfur cycle by using a PCR aprA gene-based approach in comparison with a 16S rRNA gene-based analysis. The results support this hypothesis. Finally, this preliminary work points strongly the likelihood of novel metabolic processes upon the availability of sulfate and other electron acceptors.

  13. Mud Lake, a modern analog of oil shale deposition in Florida

    Energy Technology Data Exchange (ETDEWEB)

    Burgess, J.D.

    1987-01-01

    Mud Lake in north-central Florida was identified by Bradley as an analog of oil shale-type kerogen deposition. This lake supports an abundant diatom and algal flora which is unique in that the accumulating algal ooze does not decay as long as it stays oxygenated. This same material does not nutritionally support many invertebrates, owing to its flocculent consistency and apparent indigestibility, although fish are abundant and an occasional crocodile is found in the lake. Accumulation of the algal ooze is very slow at roughly 1 foot per 52,000 years based on radiocarbon dates. An understanding of oil shale depositional conditions could be translated into a predictive model for location and recognition of hydrocarbon generating source rocks. When oil shales are mentioned the first association is likely to be that with the Eocene Green River Formation of the Western US. Conditions leading to deposition and preservation of this massive quantity of organic debris is difficult to comprehend, but recognition of modern analogs provide an available area for study and comparison.

  14. Design of a small nuclear reactor for extending the operational envelope of the Victoria Class Submarine

    International Nuclear Information System (INIS)

    Cole, C.J.P.

    2003-01-01

    The purpose of this research is to conceptually design a small, inherently safe, quasi-homogeneous nuclear reactor that will provide enough power to maintain the hotel load of the Victoria Class Submarine and extend her operational envelope. This research is in its early stages. The purpose of this paper is to outline the background of the research, present results found to date, and indicate the direction of the research over the next two years. The Canadian Forces has recently acquired four U.K. built Upholder Class submarines to replace the ageing Oberon Class submarines purchased in the early 1960's. The Upholders, like the Oberons, are diesel-electric powered. The Upholders were renamed the Victoria Class upon commissioning in Canada. Submarines are strategic military weapons that have several roles including: intelligence gathering, inflicting surprise attacks, controlling shipping lanes and covert operations. For each of these roles the submarine must remain undetected. To remain undetected, it is imperative that the submarine remains submerged. To remain submerged and continue to function, a submarine requires an air-independent power generation system, such as a nuclear reactor. (author)

  15. The Fontaine Pluton : an early Ross Orogeny calc-alkaline gabbro from southern Victoria Land, Antarctica

    International Nuclear Information System (INIS)

    Cottle, J.M.; Cooper, A.F.

    2006-01-01

    The Fontaine Pluton is a previously undescribed mafic intrusion outcropping at Fontaine Bluff on the south side of the Carlyon Glacier in southern Victoria Land, Antarctica. It is the southern-most member of a laterally extensive mafic suite emplaced at mid-crustal depths during the initial stages of the Ross Orogeny. The pluton comprises recrystallised hornblende-biotite gabbro, which in places shows well-defined centimetre to metre scale primary igneous layering. Recrystallised ultramafic enclaves composed of amphibole-chlorite-talc are inferred to be remnants of a chemically and mineralogically distinct cumulate fraction. The intrusion has a 87 Sr/ 86 Sr (i) ratio of 0.70679 and a 143 Nd/ 144 Nd (i) ratio of 0.51187 (εNd (i) = -1.2). This, coupled with other geochemical data, implies that the Fontaine Pluton was formed by c. 15% partial melting of a depleted mantle source that was subsequently contaminated by continental crust. Preliminary U-Pb geochronology on zircon suggests an emplacement age for the pluton of 546 ± 10 Ma. These new data indicate that Ross Orogeny magmatism in this area of southern Victoria Land was initiated in the late Neoproterozoic along a subducting plate margin. (author). 55 refs., 10 figs., 3 tabs

  16. Water quality and fish dynamics in forested wetlands associated with an oxbow lake

    Science.gov (United States)

    Andrews, Caroline S.; Miranda, Leandro E.; Kroger, Robert

    2015-01-01

    Forested wetlands represent some of the most distinct environments in the Lower Mississippi Alluvial Valley. Depending on season, water in forested wetlands can be warm, stagnant, and oxygen-depleted, yet may support high fish diversity. Fish assemblages in forested wetlands are not well studied because of difficulties in sampling heavily structured environments. During the April–July period, we surveyed and compared the water quality and assemblages of small fish in a margin wetland (forested fringe along a lake shore), contiguous wetland (forested wetland adjacent to a lake), and the open water of an oxbow lake. Dissolved-oxygen levels measured hourly 0.5 m below the surface were higher in the open water than in either of the forested wetlands. Despite reduced water quality, fish-species richness and catch rates estimated with light traps were greater in the forested wetlands than in the open water. The forested wetlands supported large numbers of fish and unique fish assemblages that included some rare species, likely because of their structural complexity. Programs developed to refine agricultural practices, preserve riparian zones, and restore lakes should include guidance to protect and reestablish forested wetlands.

  17. Pollution at Lake Mariut

    International Nuclear Information System (INIS)

    Nour ElDin, H.; Halim, S. N.; Shalby, E.

    2004-01-01

    Lake Mariut, south Alexandria, Egypt suffered in the recent decades from intensive pollution as a result of a continuous discharge of huge amounts of agriculture wastewater that contains a large concentration of the washed pesticides and fertilizers in addition to domestic and industrial untreated wastewater. The over flow from the lake is discharged directly to the sea through El-Max pumping station via EI-Umum drain. Lake Mariout is surrounded by a huge number of different industrial activities and also the desert road is cutting the lake, this means that a huge number of various pollutants cycle through the air and settle down in the lake, by the time and during different seasons these pollutants after accumulation and different chemical interactions will release again from the lake to the surrounding area affecting the surrounding zone

  18. The Development and Use of Individual Learning Plans for Deaf and Hard of Hearing Students in Victoria, Australia

    Science.gov (United States)

    Brown, P. Margaret; Byrnes, Linda J.

    2014-01-01

    This study investigated the Individual Learning Plans of eighty-eight students who were deaf and hard of hearing attending facilities and schools for the deaf in Victoria Australia. The students' assessment and planning portfolios were scrutinised for evidence of formal and informal assessment used to generate goals for the Individual Learning…

  19. Recent lake ice-out phenology within and among lake districts of Alaska, U.S.A.

    Science.gov (United States)

    Arp, Christopher D.; Jones, Benjamin M.; Grosse, Guido

    2013-01-01

    The timing of ice-out in high latitudes is a fundamental threshold for lake ecosystems and an indicator of climate change. In lake-rich regions, the loss of ice cover also plays a key role in landscape and climatic processes. Thus, there is a need to understand lake ice phenology at multiple scales. In this study, we observed ice-out timing on 55 large lakes in 11 lake districts across Alaska from 2007 to 2012 using satellite imagery. Sensor networks in two lake districts validated satellite observations and provided comparison with smaller lakes. Over this 6 yr period, the mean lake ice-out for all lakes was 27 May and ranged from 07 May in Kenai to 06 July in Arctic Coastal Plain lake districts with relatively low inter-annual variability. Approximately 80% of the variation in ice-out timing was explained by the date of 0°C air temperature isotherm and lake area. Shoreline irregularity, watershed area, and river connectivity explained additional variation in some districts. Coherence in ice-out timing within the lakes of each district was consistently strong over this 6 yr period, ranging from r-values of 0.5 to 0.9. Inter-district analysis of coherence also showed synchronous ice-out patterns with the exception of the two arctic coastal districts where ice-out occurs later (June–July) and climatology is sea-ice influenced. These patterns of lake ice phenology provide a spatially extensive baseline describing short-term temporal variability, which will help decipher longer term trends in ice phenology and aid in representing the role of lake ice in land and climate models in northern landscapes.

  20. 33 CFR 162.132 - Connecting waters from Lake Huron to Lake Erie; communications rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; communications rules. 162.132 Section 162.132 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.132 Connecting waters from Lake Huron to Lake Erie; communications rules. (a...

  1. 33 CFR 162.140 - Connecting waters from Lake Huron to Lake Erie; miscellaneous rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; miscellaneous rules. 162.140 Section 162.140 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.140 Connecting waters from Lake Huron to Lake Erie; miscellaneous rules. (a...

  2. State Electricity Commission of Victoria annual report 1991/92

    Energy Technology Data Exchange (ETDEWEB)

    1992-01-01

    The 73rd annual report of the State Electricity Commission (SEC) of Victoria covers the financial year ended 30 June 1992. A total revenue of 3,300 million dollars and a net profit of 155.7 million dollars was recorded. There was continued improvement in employee productivity. Progress was made on the Victorian Power Pool (VicPool) pooling arrangement in anticipation of open access to the power grid. A 3-year business plan was formulated and corporate strategy revised. The Strategic Research Program on brown coal technologies, aimed at reducing costs of electricity and emissions of CO[sub 2], continued. Environmental activities continued in the areas of renewable energy source development, air quality monitoring, acid rain, water management, land rehabilitation and improvements to powerlines. The report includes statistical data on customer statistics, electricity sales, power stations, brown coal and briquette production and financial sales.

  3. Real-estate lakes

    Science.gov (United States)

    Rickert, David A.; Spieker, Andrew Maute

    1971-01-01

    Since the dawn of civilization waterfront land has been an irresistible attraction to man. Throughout history he has sought out locations fronting on oceans, rivers, and lakes. Originally sought for proximity .to water supply and transportation, such locations are now sought more for their esthetic qualities and for recreation. Usable natural waterfront property is limited, however, and the more desirable sites in many of our urban areas have already been taken. The lack of available waterfront sites has led to the creation of many artificial bodies of water. The rapid suburbanization that has characterized urban growth in America since the end of World War II, together with increasing affluence and le-isure time, has created a ready market for waterfront property. Accordingly, lake-centered subdivisions and developments dot the suburban landscape in many of our major urban areas. Literally thousands of lakes surrounded by homes have materialized during this period of rapid growth. Recently, several "new town" communities have been planned around this lake-centered concept. A lake can be either an asset or a liaoility to a community. A clean, clear, attractively landscaped lake is a definite asset, whereas a weed-choked, foul-smelling mudhole is a distinct liability. The urban environment poses both problems and imaginative opportunities in the development of lakes. Creation of a lake causes changes in all aspects of the environment. Hydrologic systems and ecological patterns are usually most severely altered. The developer should be aware of the potential changes; it is not sufficient merely to build a dam across a stream or to dig a hole in the ground. Development of Gl a successful lake requires careful planning for site selection and design, followed by thorough and cc ntinual management. The purpose of this report is to describe the characteristics of real-estate lakes, to pinpoint potential pmblems, and to suggest possible planning and management guidelines

  4. Assessment of lake hydromorphological status within the French territory

    Science.gov (United States)

    Gay, Aurore; Argillier, Christine; Reynaud, Nathalie; Nicolas, Delphine; Baudoin, Jean-Marc

    2017-04-01

    In France, in accordance with the expectations of the European Water Framework Directive, the biological and physico-chemical status of lakes have been assessed thanks to the use of different indicators and threshold values (Argillier et al., 2013; Roubeix et al., 2016). However, the hydromorphological conditions have not been included in the final evaluation of the lakes ecological status yet, due to i) a lack of indicators to evaluate these conditions, ii) a lack of knowledge on the combined impact of hydromorphological changes on the biota, and iii) the difficulties in defining reference conditions for the hydromorphology of lakes. Recently, the LAKe HYdromorphological Conditions tool (LAKHYC tool, Gay et al., in prep) has been developed to overcome this lack and assess the hydromorphological conditions of lakes in Europe. The tool is successfully applied on the 201 French lakes for which accurate data are available, and which represents 42% of the total number of lakes in France with an area greater than 50ha. The first results indicate that the obtained LAKHYC values cover the entire range of possible values (between 0 and 1). The values are then grouped into 5 classes according to quintile thresholds to highlight lakes presenting a very bad/very high hydromorphological status. No sign of particular geographical distribution patterns is found. This first application of the LAKHYC tool represents an important step in the final evaluation of the ecological status of French lakes considering the biological, the physico-chemical and the hydromorphological compartments altogether. It will certainly help stakeholders to define priority lakes for financial support to implement conservation or restoration practices. As perspectives to this work, the forthcoming detailed level fluctuations data will ensure a finer and more robust estimation of the lakes hydromorphological quality. Moreover, further investigations on the link between hydromorphological degradation and

  5. Lake Morphometry for NHD Lakes in California Region 18 HUC

    Data.gov (United States)

    U.S. Environmental Protection Agency — Lake morphometry metrics are known to influence productivity in lakes and are important for building various types of ecological and environmental models of lentic...

  6. Lake Morphometry for NHD Lakes in Tennessee Region 6 HUC

    Data.gov (United States)

    U.S. Environmental Protection Agency — Lake morphometry metrics are known to influence productivity in lakes and are important for building various types of ecological and environmental models of lentic...

  7. Lake Morphometry for NHD Lakes in Ohio Region 5 HUC

    Data.gov (United States)

    U.S. Environmental Protection Agency — Lake morphometry metrics are known to influence productivity in lakes and are important for building various types of ecological and environmental models of lentic...

  8. Bathymetry of Lake Ontario

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry of Lake Ontario has been compiled as a component of a NOAA project to rescue Great Lakes lake floor geological and geophysical data and make it more...

  9. Bathymetry of Lake Michigan

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry of Lake Michigan has been compiled as a component of a NOAA project to rescue Great Lakes lake floor geological and geophysical data and make it more...

  10. Bathymetry of Lake Superior

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry of Lake Superior has been compiled as a component of a NOAA project to rescue Great Lakes lake floor geological and geophysical data and make it more...

  11. Bathymetry of Lake Huron

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry of Lake Huron has been compiled as a component of a NOAA project to rescue Great Lakes lake floor geological and geophysical data and make it more...

  12. Benthic algal production across lake size gradients: interactions among morphometry, nutrients, and light.

    Science.gov (United States)

    Vadeboncoeur, Yvonne; Peterson, Garry; Vander Zanden, M Jake; Kalff, Jacob

    2008-09-01

    Attached algae play a minor role in conceptual and empirical models of lake ecosystem function but paradoxically form the energetic base of food webs that support a wide variety of fishes. To explore the apparent mismatch between perceived limits on contributions of periphyton to whole-lake primary production and its importance to consumers, we modeled the contribution of periphyton to whole-ecosystem primary production across lake size, shape, and nutrient gradients. The distribution of available benthic habitat for periphyton is influenced by the ratio of mean depth to maximum depth (DR = z/ z(max)). We modeled total phytoplankton production from water-column nutrient availability, z, and light. Periphyton production was a function of light-saturated photosynthesis (BPmax) and light availability at depth. The model demonstrated that depth ratio (DR) and light attenuation strongly determined the maximum possible contribution of benthic algae to lake production, and the benthic proportion of whole-lake primary production (BPf) declined with increasing nutrients. Shallow lakes (z benthic or pelagic primary productivity depending on trophic status. Moderately deep oligotrophic lakes had substantial contributions by benthic primary productivity at low depth ratios and when maximum benthic photosynthesis was moderate or high. Extremely large, deep lakes always had low fractional contributions of benthic primary production. An analysis of the world's largest lakes showed that the shapes of natural lakes shift increasingly toward lower depth ratios with increasing depth, maximizing the potential importance of littoral primary production in large-lake food webs. The repeatedly demonstrated importance of periphyton to lake food webs may reflect the combination of low depth ratios and high light penetration characteristic of large, oligotrophic lakes that in turn lead to substantial contributions of periphyton to autochthonous production.

  13. Integrated Application of Remote Sensing, GIS and Hydrological Modeling to Estimate the Potential Impact Area of Earthquake-Induced Dammed Lakes

    OpenAIRE

    Bo Cao; Shengmei Yang; Song Ye

    2017-01-01

    Dammed lakes are an important secondary hazard caused by earthquakes. They can induce further damage to nearby humans. Current hydrology calculation research on dammed lakes usually lacks spatial expressive ability and cannot accurately conduct impact assessment without the support of remote sensing, which obtains important characteristic information of dammed lakes. The current study aims to address the issues of the potential impact area estimate of earthquake-induced dammed lakes by combin...

  14. Circulation and sedimentation in a tidal-influenced fjord lake: Lake McKerrow, New Zealand

    Science.gov (United States)

    Pickrill, R. A.; Irwin, J.; Shakespeare, B. S.

    1981-01-01

    Lake McKerrow is a tide-influenced fjord lake, separated from the open sea by a Holocene barrier spit. Fresh, oxygenated waters of the epilimnion overlie saline, deoxygenated waters of the hypolimnion. During winter, water from the Upper Hollyford River interflows along the pycnocline, depositing coarse silt on the steep delta and transporting finer sediment down-lake. An extensive sub-lacustrine channel system on the foreset delta slope is possibly maintained by turbidity currents. Saline waters of the hypolimnion are periodically replenished. During high tides and low lake levels saline water flows into the lake and downslope into the lake basin as a density current in a well defined channel.

  15. 33 CFR 162.130 - Connecting waters from Lake Huron to Lake Erie; general rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; general rules. 162.130 Section 162.130 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.130 Connecting waters from Lake Huron to Lake Erie; general rules. (a) Purpose. The...

  16. Great Lakes Restoration Initiative Great Lakes Mussel Watch(2009-2014)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Following the inception of the Great Lakes Restoration Initiative (GLRI) to address the significant environmental issues plaguing the Great Lakes region, the...

  17. Review of fish diversity in the Lake Huron basin

    Science.gov (United States)

    Roseman, E.F.; Schaeffer, J.S.; Steen, P.J.

    2009-01-01

    Lake Huron has a rich aquatic habitat diversity that includes shallow embayments, numerous tributaries, shallow mid-lake reef complexes, archipelagos, and profundal regions. These habitats provide support for warm, cool, and cold water fish communities. Diversity of fishes in Lake Huron reflects post-glaciation colonization events, current climate conditions, accidental and intentional introductions of non-indigenous species, and extinctions. Most extinction events have been largely associated with habitat alterations, exploitation of fisheries, and interactions with non-indigenous species. The most recent historical survey of extirpated and imperiled species conducted in the late 1970s identified 79 fish species in Lake Huron proper and about 50 additional species in tributaries. Of those 129 species, 20 are now considered extirpated or imperiled. Extirpated species include Arctic grayling, paddlefish, weed shiner, deepwater cisco, blackfin cisco, shortnose cisco, and kiyi. Six species have declined appreciably due to loss of clear-water stream habitat: the river redhorse, river darter, black redhorse, pugnose shiner, lake chubsucker, redside dace, eastern sand darter, and channel darter. While numerous agencies, universities, and other organizations routinely monitor nearshore and offshore fish distribution and abundance, there is a need for more rigorous examination of the distribution and abundance of less-common species to better understand their ecology. This information is critical to the development of management plans aimed at ecosystem remediation and restoration.

  18. Occupational skin disease in Victoria, Australia.

    Science.gov (United States)

    Cahill, Jennifer L; Williams, Jason D; Matheson, Melanie C; Palmer, Amanda M; Burgess, John A; Dharmage, Shyamali C; Nixon, Rosemary L

    2016-05-01

    To describe the characteristics of patients with occupational skin disease (OSD) in a tertiary referral clinic in Victoria, Australia. A retrospective review was conducted of records from patients seen at the Occupational Dermatology Clinic in Melbourne, Australia between 1 January 1993 and 31 December 2010. Of the 2894 people assessed in the clinic during the 18-year period, 44% were women and 56% were men. In all, 2177 (75%) were diagnosed with occupational skin disease (OSD). Of the patients with a work-related skin condition, 45% (n = 979) were considered to be atopic. The most common diagnosis in those with OSD was irritant contact dermatitis (ICD) (44%), followed by allergic contact dermatitis (33%) and endogenous eczema (11%). Women were significantly more likely to have soaps and detergents (P Occupational groups with the highest incidence of OSD were the hair and beauty professions (70 per 100 000), followed by machine and plant operators (38 per 100 000) and health-care workers (21 per 100 000). We confirm the importance of occupational contact dermatitis as the most common cause of OSD, with ICD being the most common diagnosis. There are differences in the causes of ICD between our group of male and female workers. For the first time in Australia, rates of OSD in certain industries have been calculated. © 2015 The Australasian College of Dermatologists.

  19. 33 CFR 162.134 - Connecting waters from Lake Huron to Lake Erie; traffic rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; traffic rules. 162.134 Section 162.134 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.134 Connecting waters from Lake Huron to Lake Erie; traffic rules. (a) Detroit River. The...

  20. 33 CFR 162.138 - Connecting waters from Lake Huron to Lake Erie; speed rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; speed rules. 162.138 Section 162.138 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.138 Connecting waters from Lake Huron to Lake Erie; speed rules. (a) Maximum speed limit for...