The GRB 060218/SN 2006aj event in the context of other gamma-ray burst supernovae
DEFF Research Database (Denmark)
Ferrero, P.; Kann, D. A.; Zeh, A.
2006-01-01
Gamma rays: bursts: X-rays: individuals: GRB 060218, supernovae: individual: SN 2006aj Udgivelsesdato: Oct.......Gamma rays: bursts: X-rays: individuals: GRB 060218, supernovae: individual: SN 2006aj Udgivelsesdato: Oct....
XRF 100316D/SN 2010bh and the nature of gamma-ray burst supernovae
Cano, Z.; Bersier, D.; Guidorzi, C.; Kobayashi, S.; Levan, A.J.; Tanvir, N.R.; Wiersema, K.; D'Avanzo, P.; Fruchter, A.S.; Garnavich, P.; Gomboc, A.; Gorosabel, J.; Kasen, D.; Kopač, D.; Margutti, R.; Mazzali, P.A.; Melandri, A.; Mundell, C.G.; Nugent, P.E.; Pian, E.; Smith, R.J.; Steele, I.; Wijers, R.A.M.J.; Woosley, S.E.
2011-01-01
We present ground-based and Hubble Space Telescope optical and infrared observations of Swift XRF 100316D/SN 2010bh. It is seen that the optical light curves of SN 2010bh evolve at a faster rate than the archetype gamma-ray burst supernova (GRB-SN) 1998bw, but at a similar rate to SN 2006aj, an SN
SN 2006bt: A PERPLEXING, TROUBLESOME, AND POSSIBLY MISLEADING TYPE Ia SUPERNOVA
International Nuclear Information System (INIS)
Foley, Ryan J.; Narayan, Gautham; Challis, Peter J.; Kirshner, Robert P.; Filippenko, Alexei V.; Silverman, Jeffrey M.; Steele, Thea N.
2010-01-01
SN 2006bt displays characteristics unlike those of any other known Type Ia supernova (SN Ia). We present optical light curves and spectra of SN 2006bt which demonstrate the peculiar nature of this object. SN 2006bt has broad, slowly declining light curves indicative of a hot, high-luminosity SN, but lacks a prominent second maximum in the i band as do low-luminosity SNe Ia. Its spectra are similar to those of low-luminosity SNe Ia, containing features that are only present in cool SN photospheres. Light-curve fitting methods suggest that SN 2006bt is reddened by a significant amount of dust; however, it occurred in the outskirts of its early-type host galaxy and has no strong Na D absorption in any of its spectra, suggesting a negligible amount of host-galaxy dust absorption. C II is possibly detected in our pre-maximum spectra, but at a much lower velocity than other elements. The progenitor was likely very old, being a member of the halo population of a galaxy that shows no signs of recent star formation. SNe Ia have been very successfully modeled as a one-parameter family, and this is fundamental to their use as cosmological distance indicators. SN 2006bt is a challenge to that picture, yet its relatively normal light curves allowed SN 2006bt to be included in cosmological analyses. We generate mock SN Ia data sets which indicate that contamination by similar objects will both increase the scatter of a SN Ia Hubble diagram and systematically bias measurements of cosmological parameters. However, spectra and rest-frame i-band light curves should provide a definitive way to identify and eliminate such objects.
Radioactive decay of the late-time light curves of GRB-SNe
Misra, Kuntal; Fruchte, Andrew Steven
2018-04-01
We present the late-time Hubble Space Telescope observations of two GRB associated supernovae, GRB 030329/SN 2003dh and XRF 060218/SN 2006aj. Using the multi-color data upto ˜ 320 days after the burst, we constrain the late-time decay nature of these supernovae. The decay rates of SN 2003dh are steeper than SN 2006aj. A comparison with two other GRB supernovae, GRB 980425/SN 1998bw and the supernova associated with XRF 020903, shows that the decay rates of SN 2003dh are similar to XRF 020903 and those of SN 2006aj are similar to SN 1998bw. The late-time decay rates are steeper than the 56Co?56Fe radioactive decay rate (0.0098 mag day-1) indicating that there is some leakage of gamma-rays.
Energy Technology Data Exchange (ETDEWEB)
Thomas, R.C.; Aldering, G.; Antilogus, P.; Aragon, C.; Bailey,S.; Baltay, C.; Baron, E.; Bauer, A.; Buton, C.; Bongard, S.; Copin, Y.; Gangler, E.; Gilles, S.; Kessler, R.; Loken, S.; Nugent, P.; Pain, R.; Parrent, J.; Pecontal, E.; Pereira, R.; Perlmutter, S.; Rabinowitz, D.; Rigaudier, G.; Runge, K.; Scalzo, R.; Smadja, G.; Wang, L.; Weaver, B.A.
2006-10-12
We present four spectra of the Type Ia supernova SN Ia 2006Dextending from -7 to +13 days with respect to B-band maximum. The spectrainclude the strongest signature of unburned material at photosphericvelocities observed in a SN Ia to date. The earliest spectrum exhibits CII absorption features below 14,000 km/s, including a distinctive C IIlambda 6580 absorption feature. The carbon signatures dissipate as the SNapproaches peak brightness. In addition to discussing implications ofphotospheric-velocity carbon for white dwarf explosion models, we outlinesome factors that may influence the frequency of its detection before andaround peak brightness. Two effects are explored in this regard,including depopulation of the C II optical levels by non-LTE effects, andline-of-sight effects resulting from a clumpy distribution of unburnedmaterial with low volume-filling factor.
The ASAS-SN bright supernova catalogue - III. 2016
DEFF Research Database (Denmark)
Holoien, T. W. -S.; Brown, J. S.; Stanek, K. Z.
2017-01-01
This catalogue summarizes information for all supernovae discovered by the All-Sky Automated Survey for SuperNovae (ASAS-SN) and all other bright (m(peak)d......This catalogue summarizes information for all supernovae discovered by the All-Sky Automated Survey for SuperNovae (ASAS-SN) and all other bright (m(peak)d...
XRF 100316D/SN 2010bh AND THE NATURE OF GAMMA-RAY BURST SUPERNOVAE
International Nuclear Information System (INIS)
Cano, Z.; Bersier, D.; Guidorzi, C.; Kobayashi, S.; Melandri, A.; Mundell, C. G.; Levan, A. J.; Tanvir, N. R.; Wiersema, K.; D'Avanzo, P.; Margutti, R.; Fruchter, A. S.; Garnavich, P.; Gomboc, A.; Kopac, D.; Gorosabel, J.; Kasen, D.; Mazzali, P. A.; Nugent, P. E.; Pian, E.
2011-01-01
We present ground-based and Hubble Space Telescope optical and infrared observations of Swift XRF 100316D/SN 2010bh. It is seen that the optical light curves of SN 2010bh evolve at a faster rate than the archetype gamma-ray burst supernova (GRB-SN) 1998bw, but at a similar rate to SN 2006aj, an SN that was spectroscopically linked with XRF 060218, and at a similar rate to the non-GRB associated Type Ic SN 1994I. We estimate the rest-frame extinction of this event from our optical data to be E(B - V) = 0.18 ± 0.08 mag. We find the V-band absolute magnitude of SN 2010bh to be M V = -18.62 ± 0.08, which is the faintest peak V-band magnitude observed to date for spectroscopically confirmed GRB-SNe. When we investigate the origin of the flux at t - t 0 = 0.598 days, it is shown that the light is not synchrotron in origin, but is likely coming from the SN shock breakout. We then use our optical and infrared data to create a quasi-bolometric light curve of SN 2010bh, which we model with a simple analytical formula. The results of our modeling imply that SN 2010bh synthesized a nickel mass of M Ni ∼ 0.1 M sun , ejected M ej ∼ 2.2 M sun , and has an explosion energy of E k ∼ 1.4 x 10 52 erg. Thus, while SN 2010bh is an energetic explosion, the amount of nickel created during the explosion is much less than that of SN 1998bw and only marginally more than SN 1994I. Finally, for a sample of 22 GRB-SNe we check for a correlation between the stretch factors and luminosity factors in the R band and conclude that no statistically significant correlation exists.
Multi-wavelength Observations of the Enduring Type IIn Supernovae 2005ip and 2006jd
DEFF Research Database (Denmark)
Stritzinger, Maximilian; Taddia, Francesco; Fransson, Claes
2012-01-01
We present an observational study of the Type IIn supernovae (SNe IIn) 2005ip and 2006jd. Broadband UV, optical, and near-IR photometry, and visual-wavelength spectroscopy of SN 2005ip complement and extend upon published observations to 6.5 years past discovery. Our observations of SN 2006jd...... extend from UV to mid-infrared wavelengths, and like SN 2005ip, are compared to reported X-ray measurements to understand the nature of the progenitor. Both objects display a number of similarities with the 1988Z-like subclass of SN IIn including (1) remarkably similar early- and late-phase optical...... spectra, (2) a variety of high-ionization coronal lines, (3) long-duration optical and near-IR emission, and (4) evidence of cold and warm dust components. However, diversity is apparent, including an unprecedented late-time r-band excess in SN 2006jd. The observed differences are attributed...
The ASAS-SN bright supernova catalogue - III. 2016
Holoien, T. W.-S.; Brown, J. S.; Stanek, K. Z.; Kochanek, C. S.; Shappee, B. J.; Prieto, J. L.; Dong, Subo; Brimacombe, J.; Bishop, D. W.; Bose, S.; Beacom, J. F.; Bersier, D.; Chen, Ping; Chomiuk, L.; Falco, E.; Godoy-Rivera, D.; Morrell, N.; Pojmanski, G.; Shields, J. V.; Strader, J.; Stritzinger, M. D.; Thompson, Todd A.; Woźniak, P. R.; Bock, G.; Cacella, P.; Conseil, E.; Cruz, I.; Fernandez, J. M.; Kiyota, S.; Koff, R. A.; Krannich, G.; Marples, P.; Masi, G.; Monard, L. A. G.; Nicholls, B.; Nicolas, J.; Post, R. S.; Stone, G.; Wiethoff, W. S.
2017-11-01
This catalogue summarizes information for all supernovae discovered by the All-Sky Automated Survey for SuperNovae (ASAS-SN) and all other bright (mpeak ≤ 17), spectroscopically confirmed supernovae discovered in 2016. We then gather the near-infrared through ultraviolet magnitudes of all host galaxies and the offsets of the supernovae from the centres of their hosts from public data bases. We illustrate the results using a sample that now totals 668 supernovae discovered since 2014 May 1, including the supernovae from our previous catalogues, with type distributions closely matching those of the ideal magnitude limited sample from Li et al. This is the third of a series of yearly papers on bright supernovae and their hosts from the ASAS-SN team.
The Type II supernovae 2006V and 2006au: two SN 1987A-like events
DEFF Research Database (Denmark)
Taddia, F.; Stritzinger, M. D.; Sollerman, J.
2012-01-01
1987A. Methods. Optical and near-infrared (NIR) light curves, and optical spectroscopy of SNe 2006V and 2006au are presented. These observations are compared to those of SN 1987A, and are used to estimate properties of their progenitors. Results. Both objects exhibit a slow rise to maximum and light...
The Type II supernovae 2006V and 2006au
DEFF Research Database (Denmark)
Taddia, F.; Stritzinger, M. D.; Sollerman, J.
2012-01-01
curve evolution similar to that of SN 1987A. At the earliest epochs, SN 2006au also displays an initial dip which we interpret as the signature of the adiabatic cooling phase that ensues shock break-out. SNe 2006V and 2006au are both found to be bluer, hotter and brighter than SN 1987A. Spectra of SNe...
Discovery of 11 ASAS-SN Supernovae
Brimacombe, J.; Cacella, P.; Stone, G.; Fernandez, J. M.; Vallely, P.; Stanek, K. Z.; Kochanek, C. S.; Brown, J. S.; Shields, J.; Thompson, T. A.; Shappee, B. J.; Holoien, T. W.-S.; Prieto, J. L.; Bersier, D.; Dong, Subo; Bose, S.; Chen, Ping; Stritzinger, M.; Holmbo, S.; Nicholls, B.; Post, R. S.
2018-05-01
During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from 14-cm telescopes in Hawaii, Texas, South Africa, and Chile, we discovered several new transient sources.
The Peculiar SN 2005hk: Do Some Type Ia Supernovae Explode As Deflagrations?
Energy Technology Data Exchange (ETDEWEB)
Phillips, M.M.; Li, W.; Frieman, J.A.; Blinnikov, S.I.; DePoy, D.; Prieto, J.L.; Milne, P.; Contreras, C.; Folatelli, Gaston; Morrell, N.; Hamuy, M.; Suntzeff, N.B.; Roth, M.; Gonzalez, S.; Krzeminski, W.; Filippenko, A.V.; Freedman, W.L.; Chornock, R.; Jha, S.; Madore, B.F.; Persson, S.E.; /Las Campanas Observ. /UC, Berkeley, Astron. Dept.
2006-11-14
We present extensive u{prime}g{prime}r{prime}i{prime} BV RIY JHK{sub s} photometry and optical spectroscopy of SN 2005hk. These data reveal that SN 2005hk was nearly identical in its observed properties to SN 2002cx, which has been called 'the most peculiar known type Ia supernova'. Both supernovae exhibited high ionization SN 1991T-like pre-maximum spectra, yet low peak luminosities like SN 1991bg. The spectra reveal that SN 2005hk, like SN 2002cx, exhibited expansion velocities that were roughly half those of typical type Ia supernovae. The R and I light curves of both supernovae were also peculiar in not displaying the secondary maximum observed for normal type Ia supernovae. Our Y JH photometry of SN 2005hk reveals the same peculiarity in the near-infrared. By combining our optical and near-infrared photometry of SN 2005hk with published ultraviolet light curves obtained with the Swift satellite, we are able to construct a bolometric light curve from {approx} 10 days before to {approx}60 days after B maximum. The shape and unusually low peak luminosity of this light curve, plus the low expansion velocities and absence of a secondary maximum at red and near-infrared wavelengths, are all in reasonable agreement with model calculations of a 3D deflagration which produces {approx} 0.25 M{sub {circle_dot}} of {sup 56}Ni.
Physics, SN1987A, and the next nearby supernova
International Nuclear Information System (INIS)
Burrows, A.
1989-01-01
The scientific community has extracted quite a bit of information from SN1987A, some of it enduring. I will summarize what I believe we learned, what we did not learn, and what we can learn about supernovae, neutrinos, and particle physics when the next galactic supernova explodes onto the news
Hydrodynamical models of supernova SN 1987 A in the LMC
International Nuclear Information System (INIS)
Grassberg, E.K.; Imshennik, V.S.; Nadezhin, D.K.; Utrobin, V.P.
1987-01-01
It is shown that the properties of SN 1987A in LMC can be described well by hydrodynamical models of explosions of compact massive stars. In accordance with these models, the mass of the expelled envelope the presupernova radius and the total energy of explosion are evaluated for SN 1987A to be ∼ 16M Sun , ∼ 30R Sun , and ∼ 3.10 51 erg, respectively. The progenitor of supernova remnant Cas A may be considered as the prototype to the SN 1987A in our own Galaxy. In other galaxies, this subtype of supernovae can be represented by SN 1948B in NGC6946. If energy of explosion transfers from collapsed core of the star to the envelope within timescale less than 1 hour, then delay Δt ∼ 3 hours between the neutrino pulse and the steep rise of optical luminosity of SN 1987A does not contradict with scenario of explosions of compact massive stars
THE CARNEGIE SUPERNOVA PROJECT: SECOND PHOTOMETRY DATA RELEASE OF LOW-REDSHIFT TYPE Ia SUPERNOVAE
International Nuclear Information System (INIS)
Stritzinger, Maximilian D.; Phillips, M. M.; Campillay, Abdo; Morrell, Nidia; Krzeminski, Wojtek; Roth, Miguel; Boldt, Luis N.; Burns, Chris; Freedman, Wendy L.; Madore, Barry F.; Persson, Sven E.; Contreras, Carlos; Gonzalez, Sergio; Folatelli, Gaston; Salgado, Francisco; DePoy, D. L.; Marshall, J. L.; Rheault, Jean-Philippe; Suntzeff, Nicholas B.; Hamuy, Mario
2011-01-01
The Carnegie Supernova Project (CSP) was a five-year observational survey conducted at Las Campanas Observatory that obtained, among other things, high-quality light curves of ∼100 low-redshift Type Ia supernovae (SNe Ia). Presented here is the second data release of nearby SN Ia photometry consisting of 50 objects, with a subset of 45 having near-infrared follow-up observations. Thirty-three objects have optical pre-maximum coverage with a subset of 15 beginning at least five days before maximum light. In the near-infrared, 27 objects have coverage beginning before the epoch of B-band maximum, with a subset of 13 beginning at least five days before maximum. In addition, we present results of a photometric calibration program to measure the CSP optical (uBgVri) bandpasses with an accuracy of ∼1%. Finally, we report the discovery of a second SN Ia, SN 2006ot, similar in its characteristics to the peculiar SN 2006bt.
Supernova mechanisms: Before and after SN1987a
International Nuclear Information System (INIS)
Kahana, S.H.
1987-01-01
The impact of SN1987a on theoretical studies of the specific mechanism generating Type II supernovae is examined. The explosion energy extracted from analysis of the light curve for SN 1987a is on the edge of distinguishing between a prompt explosion from a hydrodynamic shock and a delayed, neutrino-induced, explosion. The detection of neutrinos from 1987a is also reanalyzed. 30 refs., 2 tabs
Discovery of Ten ASAS-SN Supernovae
Nicholls, B.; Brimacombe, J.; Kiyota, S.; Stone, G.; Cruz, I.; Trappett, D.; Vallely, P.; Stanek, K. Z.; Kochanek, C. S.; Brown, J. S.; Shields, J.; Thompson, T. A.; Shappee, B. J.; Holoien, T. W.-S.; Prieto, J. L.; Bersier, D.; Dong, Subo; Bose, S.; Chen, Ping; Stritzinger, M.; Holmbo, S.
2018-03-01
During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from the quadruple 14-cm "Brutus" telescope in Haleakala, Hawaii, the "Leavitt" telescope in Fort Davis, Texas, the "Payne-Gaposchkin" telescope in Sutherland, South Africa, and the "Cassius" and "Paczynski" telescopes in Cerro Tololo, Chile, we discovered several new transient sources.
Discovery of 11 ASAS-SN Supernovae
Brimacombe, J.; Fernandez, J. M.; Stone, G.; Vallely, P.; Stanek, K. Z.; Kochanek, C. S.; Brown, J. S.; Shields, J.; Thompson, T. A.; Shappee, B. J.; Holoien, T. W.-S.; Prieto, J. L.; Bersier, D.; Dong, Subo; Bose, S.; Chen, Ping; Stritzinger, M.; Holmbo, S.; Nicholls, B.
2018-04-01
During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from the quadruple 14-cm "Brutus" telescope in Haleakala, Hawaii, the "Leavitt" telescope in Fort Davis, Texas, the "Payne-Gaposchkin" telescope in Sutherland, South Africa, and the "Cassius" and "Paczynski" telescopes in Cerro Tololo, Chile, we discovered several new transient sources.
DEFF Research Database (Denmark)
Leloudas, Georgios; Chatzopoulos, E.; Dilday, B.
2012-01-01
to contribute to a better understanding of these objects by studying SN 2006oz, a newly-recognized member of this class. Methods. We present multi-color light curves of SN 2006oz from the SDSS-II SN Survey that cover its rise time, as well as an optical spectrum that shows that the explosion occurred at z ~ 0.......376. We fitted black-body functions to estimate the temperature and radius evolution of the photosphere and used the parametrized code SYNOW to model the spectrum. We constructed a bolometric light curve and compared it with explosion models. In addition, we conducted a deep search for the host galaxy...... to a recombination wave in a circumstellar medium (CSM) and discuss whether this is a common property of all similar explosions. The subsequent rise can be equally well described by input from a magnetar or by ejecta-CSM interaction, but the models are not well constrained owing to the lack of post...
GRB 161219B / SN 2016jca: A low-redshift gamma-ray burst supernova powered by radioactive heating
DEFF Research Database (Denmark)
Cano, Z.; Izzo, L.; De Ugarte Postigo, A.
2017-01-01
Since the first discovery of a broad-lined type Ic supernova (SN) with a long-duration gamma-ray burst (GRB) in 1998, fewer than fifty gamma-ray burst supernovae (GRB-SNe) have been discovered. The intermediate-luminosity Swift GRB 161219B and its associated supernova SN 2016jca, which occurred a...
Discovery of 7 ASAS-SN Supernovae
Brimacombe, J.; Castro, N.; Clocchiatti, A.; Stone, G.; Nicholls, B.; Fernandez, J. M.; Cacella, P.; Vallely, P.; Stanek, K. Z.; Kochanek, C. S.; Brown, J. S.; Shields, J.; Thompson, T. A.; Shappee, B. J.; Holoien, T. W.-S.; Prieto, J. L.; Bersier, D.; Dong, Subo; Bose, S.; Chen, Ping; Stritzinger, M.; Holmbo, S.; Bock, G.
2018-06-01
During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from the quadruple 14-cm "Brutus" telescope in Haleakala, Hawaii, the quadruple 14-cm "Leavitt" telescope in Fort Davis, Texas, the quadruple 14-cm "Payne-Gaposchkin" telescope in Sutherland, South Africa, and the quadruple 14-cm "Cassius" and "Paczynski" telescopes in Cerro Tololo, Chile, we discovered several new transient sources.
Discovery of 9 ASAS-SN Supernovae
Brimacombe, J.; Castro, N.; Clocchiatti, A.; Cacella, P.; Wiethoff, W.; Krannich, G.; Stone, G.; Kiyota, S.; Vallely, P.; Stanek, K. Z.; Kochanek, C. S.; Brown, J. S.; Shields, J.; Thompson, T. A.; Shappee, B. J.; Holoien, T. W.-S.; Prieto, J. L.; Bersier, D.; Dong, Subo; Bose, S.; Chen, Ping; Stritzinger, M.; Holmbo, S.; Bock, G.
2018-05-01
During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from the quadruple 14-cm "Brutus" telescope in Haleakala, Hawaii, the quadruple 14-cm "Leavitt" telescope in Fort Davis, Texas, the quadruple 14-cm "Payne-Gaposchkin" telescope in Sutherland, South Africa, and the quadruple 14-cm "Cassius" and "Paczynski" telescopes in Cerro Tololo, Chile, we discovered several new transient sources.
Discovery of 8 ASAS-SN Supernovae
Brimacombe, J.; Kiyota, S.; Wiethoff, W.; Stone, G.; Vallely, P.; Stanek, K. Z.; Kochanek, C. S.; Brown, J. S.; Shields, J.; Thompson, T. A.; Shappee, B. J.; Holoien, T. W.-S.; Prieto, J. L.; Bersier, D.; Dong, Subo; Bose, S.; Chen, Ping; Stritzinger, M.; Holmbo, S.; Bock, G.
2018-06-01
During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from the quadruple 14-cm "Brutus" telescope in Haleakala, Hawaii, the quadruple 14-cm "Leavitt" telescope in Fort Davis, Texas, the quadruple 14-cm "Payne-Gaposchkin" telescope in Sutherland, South Africa, and the quadruple 14-cm "Cassius" and "Paczynski" telescopes in Cerro Tololo, Chile, we discovered several new transient sources.
Discovery of Six ASAS-SN Supernovae
Brimacombe, J.; Stone, G.; Kiyota, S.; Vallely, P.; Stanek, K. Z.; Kochanek, C. S.; Brown, J. S.; Shields, J.; Thompson, T. A.; Shappee, B. J.; Holoien, T. W.-S.; Prieto, J. L.; Bersier, D.; Dong, Subo; Bose, S.; Chen, Ping; Stritzinger, M.; Holmbo, S.; Bock, G.; Cornect, R.
2018-02-01
During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from the quadruple 14-cm "Brutus" telescope in Haleakala, Hawaii, the quadruple 14-cm "Leavitt" telescope in Fort Davis, Texas, the quadruple 14-cm "Payne-Gaposchkin" telescope in Sutherland, South Africa, and the quadruple 14-cm "Cassius" and "Paczynski" telescopes in Cerro Tololo, Chile, we discovered several new transient sources.
Discovery of 8 ASAS-SN Supernovae
Brimacombe, J.; Tomasella, Lina; Krannich, G.; Stone, G.; Vallely, P.; Stanek, K. Z.; Kochanek, C. S.; Brown, J. S.; Shields, J.; Thompson, T. A.; Shappee, B. J.; Holoien, T. W.-S.; Prieto, J. L.; Bersier, D.; Dong, Subo; Bose, S.; Chen, Ping; Stritzinger, M.; Holmbo, S.; Nicholls, B.; Cacella, P.; Kiyota, S.
2018-05-01
During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from the quadruple 14-cm "Brutus" telescope in Haleakala, Hawaii, the quadruple 14-cm "Leavitt" telescope in Fort Davis, Texas, the quadruple 14-cm "Payne-Gaposchkin" telescope in Sutherland, South Africa, and the quadruple 14-cm "Cassius" and "Paczynski" telescopes in Cerro Tololo, Chile, we discovered several new transient sources.
Discovery of Eight ASAS-SN Supernovae
Stone, G.; Brimacombe, J.; Cacella, P.; Farfan, R. G.; Vallely, P.; Stanek, K. Z.; Kochanek, C. S.; Brown, J. S.; Shields, J.; Thompson, T. A.; Shappee, B. J.; Holoien, T. W.-S.; Prieto, J. L.; Bersier, D.; Dong, Subo; Bose, S.; Chen, Ping; Stritzinger, M.; Holmbo, S.; Trappett, D.
2018-02-01
During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from the quadruple 14-cm "Brutus" telescope in Haleakala, Hawaii, the quadruple 14-cm "Leavitt" telescope in Fort Davis, Texas, the quadruple 14-cm "Payne-Gaposchkin" telescope in Sutherland, South Africa, and the quadruple 14-cm "Cassius" and "Paczynski" telescopes in Cerro Tololo, Chile, we discovered several new transient sources.
Discovery of Four ASAS-SN Supernovae
Brimacombe, J.; Kiyota, S.; Cruz, I.; Stone, G.; Vallely, P.; Stanek, K. Z.; Kochanek, C. S.; Brown, J. S.; Shields, J.; Thompson, T. A.; Shappee, B. J.; Holoien, T. W.-S.; Prieto, J. L.; Bersier, D.; Dong, Subo; Bose, S.; Chen, Ping; Stritzinger, M.; Holmbo, S.
2018-02-01
During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from the quadruple 14-cm "Brutus" telescope in Haleakala, Hawaii, the quadruple 14-cm "Leavitt" telescope in Fort Davis, Texas, the quadruple 14-cm "Payne-Gaposchkin" telescope in Sutherland, South Africa, and the quadruple 14-cm "Cassius" and "Paczynski" telescopes in Cerro Tololo, Chile, we discovered several new transient sources.
Discovery of Nine ASAS-SN Supernovae
Cacella, P.; Brimacombe, J.; Fernandez, J. M.; Kiyota, S.; Krannich, G.; Koff, R. A.; Vallely, P.; Stanek, K. Z.; Kochanek, C. S.; Brown, J. S.; Shields, J.; Thompson, T. A.; Shappee, B. J.; Holoien, T. W.-S.; Prieto, J. L.; Bersier, D.; Dong, Subo; Bose, S.; Chen, Ping; Stritzinger, M.; Holmbo, S.; Aslan, L.; Bock, G.; Stone, G.
2018-01-01
During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from the quadruple 14-cm "Brutus" telescope in Haleakala, Hawaii, the quadruple 14-cm "Leavitt" telescope in Fort Davis, Texas, the quadruple 14-cm "Payne-Gaposchkin" telescope in Sutherland, South Africa, and the quadruple 14-cm "Cassius" and "Paczynski" telescopes in Cerro Tololo, Chile, we discovered several new transient sources.
Discovery of Five ASAS-SN Supernovae
Brimacombe, J.; Stone, G.; Kiyota, S.; Vallely, P.; Stanek, K. Z.; Kochanek, C. S.; Brown, J. S.; Shields, J.; Thompson, T. A.; Shappee, B. J.; Holoien, T. W.-S.; Prieto, J. L.; Bersier, D.; Dong, Subo; Bose, S.; Chen, Ping; Stritzinger, M.; Holmbo, S.
2018-02-01
During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from the quadruple 14-cm "Brutus" telescope in Haleakala, Hawaii, the quadruple 14-cm "Leavitt" telescope in Fort Davis, Texas, the quadruple 14-cm "Payne-Gaposchkin" telescope in Sutherland, South Africa, and the quadruple 14-cm "Cassius" and "Paczynski" telescopes in Cerro Tololo, Chile, we discovered several new transient sources.
RADIO AND X-RAY OBSERVATIONS OF SN 2006jd: ANOTHER STRONGLY INTERACTING TYPE IIn SUPERNOVA
Energy Technology Data Exchange (ETDEWEB)
Chandra, Poonam [Department of Physics, Royal Military College of Canada, Kingston, ON K7K 7B4 (Canada); Chevalier, Roger A.; Irwin, Christopher M. [Department of Astronomy, University of Virginia, P.O. Box 400325, Charlottesville, VA 22904-4325 (United States); Chugai, Nikolai [Institute of Astronomy of Russian Academy of Sciences, Pyatnitskaya Street 48, 109017 Moscow (Russian Federation); Fransson, Claes [Department of Astronomy, Stockholm University, AlbaNova, SE-106 91 Stockholm (Sweden); Soderberg, Alicia M. [Smithsonian Astrophysical Observatory, 60 Garden Street, MS-20, Cambridge, MA 02138 (United States); Chakraborti, Sayan [Department of Astronomy and Astrophysics, Tata Institute of Fundamental Research, 1 Homi Bhabha Road, Colaba, Mumbai 400005 (India); Immler, Stefan, E-mail: Poonam.Chandra@rmc.ca [Astrophysics Science Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States)
2012-08-20
We report four years of radio and X-ray monitoring of the Type IIn supernova SN 2006jd at radio wavelengths with the Very Large Array, Giant Metrewave Radio Telescope, and Expanded Very Large Array; at X-ray wavelengths with Chandra, XMM-Newton, and Swift-XRT. We assume that the radio and X-ray emitting particles are produced by shock interaction with a dense circumstellar medium. The radio emission shows an initial rise that can be attributed to free-free absorption by cool gas mixed into the nonthermal emitting region; external free-free absorption is disfavored because of the shape of the rising light curves and the low gas column density inferred along the line of sight to the emission region. The X-ray luminosity implies a preshock circumstellar density {approx}10{sup 6} cm{sup -3} at a radius r {approx} 2 Multiplication-Sign 10{sup 16} cm, but the column density inferred from the photoabsorption of X-rays along the line of sight suggests a significantly lower density. The implication may be an asymmetry in the interaction. The X-ray spectrum shows Fe line emission at 6.9 keV that is stronger than is expected for the conditions in the X-ray emitting gas. We suggest that cool gas mixed into the hot gas plays a role in the line emission. Our radio and X-ray data both suggest the density profile is flatter than r{sup -2} because of the slow evolution of the unabsorbed emission.
The Transition of a Type IIL Supernova into a Supernova Remnant: Late-time Observations of SN 2013by
Energy Technology Data Exchange (ETDEWEB)
Black, C. S.; Fesen, R. A. [6127 Wilder Lab, Department of Physics and Astronomy, Dartmouth College, Hanover, NH 03755 (United States); Milisavljevic, D.; Patnaude, D. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Margutti, R. [Center for Interdisciplinary Exploration and Research in Astrophysics (CIERA) and Department of Physics and Astronomy, Northwestern University, Evanston, IL 60208 (United States); Parker, S. [Parkdale Observatory, 225 Warren Road, RDl Oxford, Canterbury 7495 (New Zealand)
2017-10-10
We present early-time Swift and Chandra X-ray data along with late-time optical and near-infrared observations of SN 2013by, a Type IIL supernova (SN) that occurred in the nearby spiral galaxy ESO 138−G10 ( D ∼ 14.8 Mpc). Optical and NIR photometry and spectroscopy follow the late-time evolution of the SN from days +89 to +457 post maximum brightness. The optical spectra and X-ray light curves are consistent with the picture of an SN having prolonged interaction with circumstellar material (CSM) that accelerates the transition from SN to supernova remnant (SNR). Specifically, we find SN 2013by’s H α profile exhibits significant broadening (∼10,000 km s{sup −1}) on day +457, the likely consequence of high-velocity, H-rich material being excited by a reverse shock. A relatively flat X-ray light curve is observed that cannot be modeled using Inverse Compton scattering processes alone, but requires an additional energy source most likely originating from the SN-CSM interaction. In addition, we see the first overtone of CO emission near 2.3 μ m on day +152, signaling the formation of molecules and dust in the SN ejecta and is the first time CO has been detected in a Type IIL SN. We compare SN 2013by with Type IIP SNe, whose spectra show the rarely observed SN-to-SNR transition in varying degrees and conclude that Type IIL SNe may enter the remnant phase at earlier epochs than their Type IIP counterparts.
Neutrino spectrum from SN 1987A and from cosmic supernovae
International Nuclear Information System (INIS)
Yueksel, Hasan; Beacom, John F.
2007-01-01
The detection of neutrinos from SN 1987A by the Kamiokande-II and Irvine-Michigan-Brookhaven detectors provided the first glimpse of core collapse in a supernova, complementing the optical observations and confirming our basic understanding of the mechanism behind the explosion. One long-standing puzzle is that, when fitted with thermal spectra, the two independent detections do not seem to agree with either each other or typical theoretical expectations. We assess the compatibility of the two data sets in a model-independent way and show that they can be reconciled if one avoids any bias on the neutrino spectrum stemming from theoretical conjecture. We reconstruct the neutrino spectrum from SN 1987A directly from the data through nonparametric inferential statistical methods and present predictions for the diffuse supernova neutrino background based on SN 1987A data. We show that this prediction cannot be too small (especially in the 10-18 MeV range), since the majority of the detected events from SN 1987A were above 18 MeV (including 6 events above 35 MeV), suggesting an imminent detection in operational and planned detectors
Supernova SN1961v - an explosion of a very massive star
International Nuclear Information System (INIS)
Utrobin, V.P.
1983-01-01
An investigation of the outburst of the unique supernova SN1961v in the galaxy NGC 1058 is carried out. An analysis of hydrodynamical models of supernoVa outbursts and a comparison with a considerable body of observational data on SN1961v clearly show that the SN1961v phenomenon is an explosion of a very massive star-with the mass of 2000 M and radiUs of about 100 R that results in expelling the envelope with the kinetic energy of 1.8x10 52 erg. The light curve of SN1961v furnishes direct evidence for a heterogeneity of the presupernova interior. The chemical composition produced during the evolution of the very massive star and in the final eXplosion must have a number of the essential features. In particular, hydrogen has to be underabundant relative to the solar content and distributed in the specific manner through the star. At late stages from February 1963 to February 1967, the light curve of SN1961v may be accoUnted for as interaction of the expelled envelope with the stellar wind of presupernova
Supernova 2008J: early time observations of a heavily reddened SN 2002ic-like transient
DEFF Research Database (Denmark)
Taddia, F.; Stritzinger, M. D.; Phillips, M. M.
2012-01-01
Aims: We provide additional observational evidence that some Type Ia supernovae (SNe Ia) show signatures of circumstellar interaction (CSI) with hydrogen-rich material. Methods: Early phase optical and near-infrared (NIR) light curves and spectroscopy of SN 2008J obtained by the Carnegie Supernova...... that their CSI emissions are similarly robust. The high-resolution spectrum reveals narrow emission lines produced from un-shocked gas characterized by a wind velocity of ~50 km s-1. We conclude that SN 2008J best matches an explosion of a SN Ia that interacts with its CSM....
Discovery of Six ASAS-SN Supernova Candidates
Brimacombe, J.; Stone, G.; Vallely, P.; Stanek, K. Z.; Brown, J. S.; Kochanek, C. S.; Shields, J.; Thompson, T. A.; Shappee, B. J.; Holoien, T. W.-S.; Prieto, J. L.; Bersier, D.; Dong, Subo; Bose, S.; Chen, Ping; Conseil, E.
2018-01-01
During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from the quadruple 14-cm "Brutus" telescope in Haleakala, Hawaii, the quadruple 14-cm "Leavitt" telescope in Fort Davis, Texas, the quadruple 14-cm "Payne-Gaposchkin" telescope in Sutherland, South Africa, and the quadruple 14-cm "Cassius" and "Paczynski" telescopes in Cerro Tololo, Chile, we discovered several new transient sources.
SN 2009kn - the twin of the Type IIn supernova 1994W
DEFF Research Database (Denmark)
Kankare, E.; Ergon, M.; Bufano, F.
2012-01-01
We present an optical and near-infrared photometric and spectroscopic study of supernova (SN) 2009kn spanning ~1.5 yr from the discovery. The optical spectra are dominated by the narrow (full width at half-maximum ~1000 km s^-1) Balmer lines distinctive of a Type IIn SN with P Cygni profiles. Con...
X-RAY AND RADIO EMISSION FROM TYPE IIn SUPERNOVA SN 2010jl
Energy Technology Data Exchange (ETDEWEB)
Chandra, Poonam [National Centre for Radio Astrophysics, Tata Institute of Fundamental Research, Pune University Campus, Pune 411 007 (India); Chevalier, Roger A. [Department of Astronomy, University of Virginia, P.O. Box 400325, Charlottesville, VA 22904-4325 (United States); Chugai, Nikolai [Institute of Astronomy of Russian Academy of Sciences, Pyatnitskaya St. 48, 109017 Moscow (Russian Federation); Fransson, Claes [Oskar Klein Centre, Department of Astronomy, Stockholm University, AlbaNova, SE-106 91 Stockholm (Sweden); Soderberg, Alicia M., E-mail: poonam@ncra.tifr.res.in [Smithsonian Astrophysical Observatory, 60 Garden St., MS-20, Cambridge, MA 02138 (United States)
2015-09-01
We present all X-ray and radio observations of the Type IIn supernova SN 2010jl. The X-ray observations cover a period up to day 1500 with Chandra, XMM-Newton, NuSTAR, and Swift-X-ray Telescope (XRT). The Chandra observations after 2012 June, the XMM-Newton observation in 2013 November, and most of the Swift-XRT observations until 2014 December are presented for the first time. All the spectra can be fitted by an absorbed hot thermal model except for Chandra spectra on 2011 October and 2012 June when an additional component is needed. Although the origin of this component is uncertain, it is spatially coincident with the supernova and occurs when there are changes to the supernova spectrum in the energy range close to that of the extra component, indicating that the emission is related to the supernova. The X-ray light curve shows an initial plateau followed by a steep drop starting at day ∼300. We attribute the drop to a decrease in the circumstellar density. The column density to the X-ray emission drops rapidly with time, showing that the absorption is in the vicinity of the supernova. We also present Very Large Array radio observations of SN 2010jl. Radio emission was detected from SN 2010jl from day 570 onwards. The radio light curves and spectra suggest that the radio luminosity was close to its maximum at the first detection. The velocity of the shocked ejecta derived assuming synchrotron self-absorption is much less than that estimated from the optical and X-ray observations, suggesting that free–free absorption dominates.
Mandel, Kaisey; Kirshner, R. P.; Narayan, G.; Wood-Vasey, W. M.; Friedman, A. S.; Hicken, M.
2010-01-01
I have constructed a comprehensive statistical model for Type Ia supernova light curves spanning optical through near infrared data simultaneously. The near infrared light curves are found to be excellent standard candles (sigma(MH) = 0.11 +/- 0.03 mag) that are less vulnerable to systematic error from dust extinction, a major confounding factor for cosmological studies. A hierarchical statistical framework incorporates coherently multiple sources of randomness and uncertainty, including photometric error, intrinsic supernova light curve variations and correlations, dust extinction and reddening, peculiar velocity dispersion and distances, for probabilistic inference with Type Ia SN light curves. Inferences are drawn from the full probability density over individual supernovae and the SN Ia and dust populations, conditioned on a dataset of SN Ia light curves and redshifts. To compute probabilistic inferences with hierarchical models, I have developed BayeSN, a Markov Chain Monte Carlo algorithm based on Gibbs sampling. This code explores and samples the global probability density of parameters describing individual supernovae and the population. I have applied this hierarchical model to optical and near infrared data of over 100 nearby Type Ia SN from PAIRITEL, the CfA3 sample, and the literature. Using this statistical model, I find that SN with optical and NIR data have a smaller residual scatter in the Hubble diagram than SN with only optical data. The continued study of Type Ia SN in the near infrared will be important for improving their utility as precise and accurate cosmological distance indicators.
Spectroscopic Classification of SN 2017ghm as a Type Ia Supernova
Vinko, J.; Wheeler, J. C.; Wang, X.; Li, W.; Li, Z.; Xiang, D.; Rui, L.; Lin, H.; Xu, Z.; Li, B.; Zhao, H.; Wang, L.; Tan, H.; Zhang, J.
2017-09-01
An optical spectrum (range 360-680 nm) of SN 2017ghm (=PTSS-17uyml), discovered by the PMO-Tsinghua Supernova Survey (PTSS, http://www.cneost.org/ptss/), was obtained with the new "Low Resolution Spectrograph-2" (LRS2) on the 10m Hobby-Eberly Telescope at McDonald Observatory by S. Rostopchin on 2017 Aug 31.17 UT. The spectrum is consistent with that of a heavily reddened Type Ia supernova (with Av > 2.3 mag) around maximum light.
Scattered-Light Echoes from the Historical Galactic Supernovae Cassiopeia A and Tycho (SN 1572)
Energy Technology Data Exchange (ETDEWEB)
Rest, A; Welch, D L; Suntzeff, N B; Oaster, L; Lanning, H; Olsen, K; Smith, R C; Becker, A C; Bergmann, M; Challis, P; Clocchiatti, A; Cook, K H; Damke, G; Garg, A; Huber, M E; Matheson, T; Minniti, D; Prieto, J L; Wood-Vasey, W M
2008-05-06
We report the discovery of an extensive system of scattered light echo arclets associated with the recent supernovae in the local neighborhood of the Milky Way: Tycho (SN 1572) and Cassiopeia A. Existing work suggests that the Tycho SN was a thermonuclear explosion while the Cas A supernova was a core collapse explosion. Precise classifications according to modern nomenclature require spectra of the outburst light. In the case of ancient SNe, this can only be done with spectroscopy of their light echo, where the discovery of the light echoes from the outburst light is the first step. Adjacent light echo positions suggest that Cas A and Tycho may share common scattering dust structures. If so, it is possible to measure precise distances between historical Galactic supernovae. On-going surveys that alert on the development of bright scattered-light echo features have the potential to reveal detailed spectroscopic information for many recent Galactic supernovae, both directly visible and obscured by dust in the Galactic plane.
Scattered-Light Echoes from the Historical Galactic Supernovae Cassiopeia A and Tycho (SN 1572)
International Nuclear Information System (INIS)
Rest, A.; Welch, D.L.; Suntzeff, N.B.; Oaster, L.; Lanning, H.; Olsen, K.; Smith, R.C.; Becker, A.C.; Bergmann, M.; Challis, P.; Clocchiatti, A.; Cook, K.H.; Damke, G.; Garg, A.; Huber, M.E.; Matheson, T.; Minniti, D.; Prieto, J.L.; Wood-Vasey, W.M.
2008-01-01
We report the discovery of an extensive system of scattered light echo arclets associated with the recent supernovae in the local neighborhood of the Milky Way: Tycho (SN 1572) and Cassiopeia A. Existing work suggests that the Tycho SN was a thermonuclear explosion while the Cas A supernova was a core collapse explosion. Precise classifications according to modern nomenclature require spectra of the outburst light. In the case of ancient SNe, this can only be done with spectroscopy of their light echo, where the discovery of the light echoes from the outburst light is the first step. Adjacent light echo positions suggest that Cas A and Tycho may share common scattering dust structures. If so, it is possible to measure precise distances between historical Galactic supernovae. On-going surveys that alert on the development of bright scattered-light echo features have the potential to reveal detailed spectroscopic information for many recent Galactic supernovae, both directly visible and obscured by dust in the Galactic plane
On the Possibility of Fast Radio Bursts from Inside Supernovae: The Case of SN 1986J
Bietenholz, Michael F.; Bartel, Norbert
2017-12-01
We discuss the possibility of obtaining fast radio bursts (FRBs) from the interior of supernovae, in particular SN 1986J. Young neutron stars are involved in many of the possible scenarios for the origin of FRBs, and it has been suggested that the high dispersion measures observed in FRBs might be produced by the ionized material in the ejecta of associated supernovae. Using VLA and VLBI measurements of the Type IIn SN 1986J, which has a central compact component not seen in other supernovae, we can directly observe for the first time radio signals, which originate in the interior of a young (∼30 year old) supernova. We show that at an age of 30 years, any FRB signal at ∼1 GHz would still be largely absorbed by the ejecta. By the time the ejecta have expanded so that a 1 GHz signal would be visible, the internal dispersion measure due to the SN ejecta would be below the values typically seen for FRBs. The high dispersion measures seen for the FRBs detected so far could of course be due to propagation through the intergalactic medium provided that the FRBs are at distances much larger than that of SN 1986J, which is 10 Mpc. We conclude that if FRBs originate in Type II SNe/SNRs, they would likely not become visible until 60 ∼ 200 years after the SN explosion.
Bartel, N.
2009-08-01
We review VLBI observations of supernovae over the last quarter century and discuss the prospect of imaging future supernovae with space VLBI in the context of VSOP-2. From thousands of discovered supernovae, most of them at cosmological distances, ˜50 have been detected at radio wavelengths, most of them in relatively nearby galaxies. All of the radio supernovae are Type II or Ib/c, which originate from the explosion of massive progenitor stars. Of these, 12 were observed with VLBI and four of them, SN 1979C, SN 1986J, SN 1993J, and SN 1987A, could be imaged in detail, the former three with VLBI. In addition, supernovae or young supernova remnants were discovered at radio wavelengths in highly dust-obscured galaxies, such as M82, Arp 299, and Arp 220, and some of them could also be imaged in detail. Four of the supernovae so far observed were sufficiently bright to be detectable with VSOP-2. With VSOP-2 the expansion of supernovae can be monitored and investigated with unsurpassed angular resolution, starting as early as the time of the supernova's transition from its opaque to transparent stage. Such studies can reveal, in a movie, the aftermath of a supernova explosion shortly after shock break out.
PHOTOMETRIC TYPE Ia SUPERNOVA CANDIDATES FROM THE THREE-YEAR SDSS-II SN SURVEY DATA
International Nuclear Information System (INIS)
Sako, Masao; Connolly, Brian; Gladney, Larry; Bassett, Bruce; Dilday, Benjamin; Cambell, Heather; Lampeitl, Hubert; Nichol, Robert C.; Frieman, Joshua A.; Kessler, Richard; Marriner, John; Miquel, Ramon; Schneider, Donald P.; Smith, Mathew; Sollerman, Jesper
2011-01-01
We analyze the three-year Sloan Digital Sky Survey II (SDSS-II) Supernova (SN) Survey data and identify a sample of 1070 photometric Type Ia supernova (SN Ia) candidates based on their multiband light curve data. This sample consists of SN candidates with no spectroscopic confirmation, with a subset of 210 candidates having spectroscopic redshifts of their host galaxies measured while the remaining 860 candidates are purely photometric in their identification. We describe a method for estimating the efficiency and purity of photometric SN Ia classification when spectroscopic confirmation of only a limited sample is available, and demonstrate that SN Ia candidates from SDSS-II can be identified photometrically with ∼91% efficiency and with a contamination of ∼6%. Although this is the largest uniform sample of SN candidates to date for studying photometric identification, we find that a larger spectroscopic sample of contaminating sources is required to obtain a better characterization of the background events. A Hubble diagram using SN candidates with no spectroscopic confirmation, but with host galaxy spectroscopic redshifts, yields a distance modulus dispersion that is only ∼20%-40% larger than that of the spectroscopically confirmed SN Ia sample alone with no significant bias. A Hubble diagram with purely photometric classification and redshift-distance measurements, however, exhibits biases that require further investigation for precision cosmology.
Photometric type Ia supernova candidates from the three-year SDSS-II SN survey data
Energy Technology Data Exchange (ETDEWEB)
Sako, Masao; /Pennsylvania U.; Bassett, Bruce; /South African Astron. Observ. /Cape Town U., Dept. Math.; Connolly, Brian; /Pennsylvania U.; Dilday, Benjamin; /Las Cumbres Observ. /UC, Santa Barbara /Rutgers U., Piscataway; Cambell, Heather; /Portsmouth U., ICG; Frieman, Joshua A.; /Chicago U. /Chicago U., KICP /Fermilab; Gladney, Larry; /Pennsylvania U.; Kessler, Richard; /Chicago U. /Chicago U., KICP; Lampeitl, Hubert; /Portsmouth U., ICG; Marriner, John; /Fermilab; Miquel, Ramon; /Barcelona, IFAE /ICREA, Barcelona /Portsmouth U., ICG
2011-07-01
We analyze the three-year Sloan Digital Sky Survey II (SDSS-II) Supernova (SN) Survey data and identify a sample of 1070 photometric Type Ia supernova (SN Ia) candidates based on their multiband light curve data. This sample consists of SN candidates with no spectroscopic confirmation, with a subset of 210 candidates having spectroscopic redshifts of their host galaxies measured while the remaining 860 candidates are purely photometric in their identification. We describe a method for estimating the efficiency and purity of photometric SN Ia classification when spectroscopic confirmation of only a limited sample is available, and demonstrate that SN Ia candidates from SDSS-II can be identified photometrically with {approx}91% efficiency and with a contamination of {approx}6%. Although this is the largest uniform sample of SN candidates to date for studying photometric identification, we find that a larger spectroscopic sample of contaminating sources is required to obtain a better characterization of the background events. A Hubble diagram using SN candidates with no spectroscopic confirmation, but with host galaxy spectroscopic redshifts, yields a distance modulus dispersion that is only {approx}20%-40% larger than that of the spectroscopically confirmed SN Ia sample alone with no significant bias. A Hubble diagram with purely photometric classification and redshift-distance measurements, however, exhibits biases that require further investigation for precision cosmology.
SN 2008iy: An Unusual Type IIn Supernova with an Enduring 400 Day Rise Time
Miller, A. A.; Silverman, J. M.; Butler, N. R.; Bloom, J. S.; Chornock, R.; Filippenko, A. V.; Ganeshalingam, M.; Klein, C. R.; Li, W.; Nugent, P. E.; Smith, N.; Steele, T. N.
2009-01-01
We present spectroscopic and photometric observations of the Type IIn supernova (SN) 2008iy. SN 2008iy showed an unprecedentedly long rise time of ~400 days, making it the first SN to take significantly longer than 100 days to reach peak optical luminosity. The peak absolute magnitude of SN 2008iy was M_r ~ -19.1 mag, and the total radiated energy over the first ~700 days was ~2 x 10^50 erg. Spectroscopically, SN 2008iy is very similar to the Type IIn SN 1988Z at late times, and, like SN 1988...
The curious case of SN 2011dn: A very peculiar type Ia supernova?
Rachubo, Alisa
Type Ia supernovae (SNe Ia) are excellent cosmological distance indicators due to the uniformity in their light curves, which led to the major discovery of the accelerated expansion of the universe. However, SNe Ia are not so uniform as one may expect, as there are many peculiar SNe Ia that exhibit differences in their photometric and spectroscopic behavior from normal SNe Ia. One of the goals of supernova cosmology today is to produce a cleaner sample of SNe Ia without these peculiar SNe Ia. Here we consider SN 2011dn, a peculiar SN Ia candidate. In 2011, Salvo, et al. carried out a preliminary analysis of a subset of the data prescribed here, and identified spectral and photometric peculiarities in this object's evolution that warranted further analysis. Here, we present a complete re-reduction and reanalysis of B, V,R, and I photometry of SN 2011dn obtained at Mount Laguna Observatory, spanning from 7 days before maximum light in B to 88 days past maximum light. In addition, we also consider total flux spectra from 9 days before maximum light to 4 days after maximum light, along with ultraviolet (UV) photometry obtained with the Swift telescope. From SN 2011dn's optical spectra, we find that SN 2011dn most closely resembles a SN 1991T-like type Ia supernova ('91T-like SN Ia). Such SNe Ia are typically more luminous than normal SNe Ia, and possess broader (i.e., they decline less rapidly than normal from maximum light) light curves. Their Deltam15(B) (drop in B magnitude 15 days after maximum light) are typically significantly less than the canonical value of 1.1, and can be as low as 0.8. In the earlier preliminary analysis, Salvo et al. measured a surprisingly high Deltam15(B) value for SN 2011dn, of ˜ 1.1. Since SN 2011dn was embedded in UGC 11501 (its host galaxy), however, it is possible that some of the light from the host galaxy was included in the photometric aperture, resulting in inaccurate photometric measurements. Here, in order to better isolate the
Very-high-energy gamma-ray observations of the Type Ia Supernova SN 2014J with the MAGIC telescopes
Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Antoranz, P.; Arcaro, C.; Babic, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Berti, A.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Borracci, F.; Bretz, T.; Carosi, R.; Carosi, A.; Chatterjee, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Cumani, P.; Da Vela, P.; Dazzi, F.; De Angelis, A.; De Lotto, B.; de Oña Wilhelmi, E.; Di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Engelkemeier, M.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Frantzen, K.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Garrido Terrats, D.; Gaug, M.; Giammaria, P.; Godinović, N.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Hughes, G.; Idec, W.; Kodani, K.; Konno, Y.; Kubo, H.; Kushida, J.; La Barbera, A.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; López-Coto, R.; Majumdar, P.; Makariev, M.; Mallot, K.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Marcote, B.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Miranda, J. M.; Mirzoyan, R.; Moralejo, A.; Moretti, E.; Nakajima, D.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Nishijima, K.; Noda, K.; Nogués, L.; Paiano, S.; Palacio, J.; Palatiello, M.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Poutanen, J.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Garcia, J. R.; Reichardt, I.; Rhode, W.; Ribó, M.; Rico, J.; Saito, T.; Satalecka, K.; Schroeder, S.; Schweizer, T.; Sillanpää, A.; Sitarek, J.; Snidaric, I.; Sobczynska, D.; Stamerra, A.; Strzys, M.; Surić, T.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Torres, D. F.; Toyama, T.; Treves, A.; Vanzo, G.; Vazquez Acosta, M.; Vovk, I.; Ward, J. E.; Will, M.; Wu, M. H.; Zanin, R.
2017-06-01
Context. In this work we present data from observations with the MAGIC telescopes of SN 2014J detected on January 21 2014, the closest Type Ia supernova since Imaging Air Cherenkov Telescopes started to operate. Aims: We aim to probe the possibility of very-high-energy (VHE; E ≥ 100 GeV) gamma rays produced in the early stages of Type Ia supernova explosions. Methods: We performed follow-up observations after this supernova (SN) explosion for five days, between January 27 and February 2 2014. We searched for gamma-ray signals in the energy range between 100 GeV and several TeV from the location of SN 2014J using data from a total of 5.5 h of observations. Prospects for observing gamma rays of hadronic origin from SN 2014J in the near future are also being addressed. Results: No significant excess was detected from the direction of SN 2014J. Upper limits at 95% confidence level on the integral flux, assuming a power-law spectrum, dF/dE ∝ E- Γ, with a spectral index of Γ = 2.6, for energies higher than 300 GeV and 700 GeV, are established at 1.3 × 10-12 and 4.1 × 10-13 photons cm-2 s-1, respectively. Conclusions: For the first time, upper limits on the VHE emission of a Type Ia supernova are established. The energy fraction isotropically emitted into TeV gamma rays during the first 10 days after the supernova explosion for energies greater than 300 GeV is limited to 10-6 of the total available energy budget ( 1051 erg). Within the assumed theoretical scenario, the MAGIC upper limits on the VHE emission suggest that SN 2014J will not be detectable in the future by any current or planned generation of Imaging Atmospheric Cherenkov Telescopes.
The X-Ray Light Curve of the Very Luminous Supernova SN 1978K in NGC 1313
Schlegel, Eric M.; Petre, R.; Colbert, E. J. M.
1996-01-01
We present the 0.5-2.0 keV light curve of the X-ray luminous supernova SN 1978K in NGC 1313, based on six ROSAT observations spanning 1990 July to t994 July. SN 1978K is one of a few supernovae or supernova remnants that are very luminous (˜1039-1040 ergs s-1) in the X-ray, optical, and radio bands, and the first, at a supernova age of 10-20 yr, for which sufficient data exist to create an X-ray light curve. The X-ray flux is approximately constant over the 4 yr sampled by our observations, which were obtained 12-16 yr after the initial explosion. Three models exist to explain the large X-ray luminosity: pulsar input, a reverse shock running back into the expanding debris of the supernova, and the outgoing shock crushing of cloudlets in the debris field. Based upon calculations of Chevalier & Fransson, a pulsar cannot provide sufficient energy to produce the soft X-ray luminosity. Based upon the models and the light curve to date, it is not possible to discern the evolutionary phase of the supernova.
International Nuclear Information System (INIS)
Khan, Rubab; Stanek, K. Z.; Beacom, J. F.; Szczygiel, D. M.; Mogren, K.; Eastman, J. D.; Martini, P.; Stoll, R.; Prieto, J. L.; Pojmanski, G.; Pilecki, B.
2011-01-01
We present photometric and spectroscopic observations of the Type Ia supernova SN 2009nr in UGC 8255 (z = 0.0122). Following the discovery announcement at what turned out to be 10 days after peak, we detected it at V ≅15.7 mag in data collected by the All-Sky Automated Survey (ASAS) North telescope 2 weeks prior to the peak, and then followed it up with telescopes ranging in aperture from 10 cm to 6.5 m. Using early photometric data available only from ASAS, we find that the supernova is similar to the overluminous Type Ia SN 1991T, with a peak at M V ≅ -19.6 mag, and a slow decline rate of Δm 15 (B) ≅ 0.95 mag. The early post-maximum spectra closely resemble those of SN 1991T, while the late-time spectra are more similar to those of normal Type Ia supernovae (SNe Ia). Interestingly, SN 2009nr has a projected distance of 13.0 kpc (∼4.3 disk scale lengths) from the nucleus of the small star-forming host galaxy UGC 8255. This indicates that the progenitor of SN 2009nr is not associated with a young stellar population, calling into question the conventional association of luminous SNe Ia with the 'prompt' component directly correlated with current star formation. The pre-discovery observation of SN 2009nr using ASAS demonstrates the science utility of high-cadence all sky surveys conducted using small telescopes for the discovery of nearby (d ∼< 50 Mpc) supernovae.
Highly reddened Type Ia supernova SN 2004ab: another case of anomalous extinction
Chakradhari, N. K.; Sahu, D. K.; Anupama, G. C.; Prabhu, T. P.
2018-02-01
We present optical photometric and spectroscopic data for supernova SN 2004ab, a highly reddened normal Type Ia supernova. The total reddening is estimated as E(B - V) = 1.70 ± 0.05 mag. The intrinsic decline-rate parameter Δm15(B)true is 1.27 ± 0.05, and the B-band absolute magnitude at maximum MB^{max} is -19.31 ± 0.25 mag. The host galaxy NGC 5054 is found to exhibit anomalous extinction with a very low value of RV = 1.41 ± 0.06 in the direction of SN 2004ab. The peak bolometric luminosity is derived as log L_bol^max = 43.10 ± 0.07 erg s-1. The photospheric velocity measured from the absorption minimum of the Si II λ6355 line shows a velocity gradient of \\dot{v} = 90 km s-1 d-1, indicating that SN 2004ab is a member of the high velocity gradient (HVG) subgroup. The ratio of the strengths of the Si II λ5972 and λ6355 absorption lines, R(Si II), is estimated as 0.37, while their pseudo-equivalent widths suggest that SN 2004ab belongs to the broad line (BL) type subgroup.
No Evidence of Circumstellar Gas Surrounding Type Ia Supernova SN 2017cbv
Ferretti, Raphael; Amanullah, Rahman; Bulla, Mattia; Goobar, Ariel; Johansson, Joel; Lundqvist, Peter
2017-12-01
Nearby type Ia supernovae (SNe Ia), such as SN 2017cbv, are useful events to address the question of what the elusive progenitor systems of the explosions are. Hosseinzadeh et al. suggested that the early blue excess of the light curve of SN 2017cbv could be due to the supernova ejecta interacting with a non-degenerate companion star. Some SN Ia progenitor models suggest the existence of circumstellar (CS) environments in which strong outflows create low-density cavities of different radii. Matter deposited at the edges of the cavities should be at distances at which photoionization due to early ultraviolet (UV) radiation of SNe Ia causes detectable changes to the observable Na I D and Ca II H&K absorption lines. To study possible narrow absorption lines from such material, we obtained a time series of high-resolution spectra of SN 2017cbv at phases between ‑14.8 and +83 days with respect to B-band maximum, covering the time at which photoionization is predicted to occur. Both narrow Na I D and Ca II H&K are detected in all spectra, with no measurable changes between the epochs. We use photoionization models to rule out the presence of Na I and Ca II gas clouds along the line of sight of SN 2017cbv between ∼8 × 1016–2 × 1019 cm and ∼1015–1017 cm, respectively. Assuming typical abundances, the mass of a homogeneous spherical CS gas shell with radius R must be limited to {M}{{H} {{I}}}{CSM}R/{10}17[{cm}])}2 {M}ȯ . The bounds point to progenitor models that deposit little gas in their CS environment.
Type Ia supernova rate studies from the SDSS-II Supernova Study
Energy Technology Data Exchange (ETDEWEB)
Dilday, Benjamin [Univ. of Chicago, IL (United States)
2008-08-01
The author presents new measurements of the type Ia SN rate from the SDSS-II Supernova Survey. The SDSS-II Supernova Survey was carried out during the Fall months (Sept.-Nov.) of 2005-2007 and discovered ~ 500 spectroscopically confirmed SNe Ia with densely sampled (once every ~ 4 days), multi-color light curves. Additionally, the SDSS-II Supernova Survey has discovered several hundred SNe Ia candidates with well-measured light curves, but without spectroscopic confirmation of type. This total, achieved in 9 months of observing, represents ~ 15-20% of the total SNe Ia discovered worldwide since 1885. The author describes some technical details of the SN Survey observations and SN search algorithms that contributed to the extremely high-yield of discovered SNe and that are important as context for the SDSS-II Supernova Survey SN Ia rate measurements.
INTERACTING SUPERNOVAE AND SUPERNOVA IMPOSTORS: SN 2009ip, IS THIS THE END?
International Nuclear Information System (INIS)
Pastorello, A.; Cappellaro, E.; Benetti, S.; Inserra, C.; Smartt, S. J.; Fraser, M.; Pignata, G.; Takáts, K.; Bufano, F.; Valenti, S.; Benitez, S.; Botticella, M. T.; Brimacombe, J.; Cellier-Holzem, F.; Costado, M. T.; Cupani, G.; Curtis, I.; Elias-Rosa, N.; Ergon, M.; Fynbo, J. P. U.
2013-01-01
We report the results of a three-year-long dedicated monitoring campaign of a restless luminous blue variable (LBV) in NGC 7259. The object, named SN 2009ip, was observed photometrically and spectroscopically in the optical and near-infrared domains. We monitored a number of erupting episodes in the past few years, and increased the density of our observations during eruptive episodes. In this paper, we present the full historical data set from 2009 to 2012 with multi-wavelength dense coverage of the two high-luminosity events between 2012 August and September. We construct bolometric light curves and measure the total luminosities of these eruptive or explosive events. We label them the 2012a event (lasting ∼50 days) with a peak of 3 × 10 41 erg s –1 , and the 2012b event (14 day rise time, still ongoing) with a peak of 8 × 10 42 erg s –1 . The latter event reached an absolute R-band magnitude of about –18, comparable to that of a core-collapse supernova (SN). Our historical monitoring has detected high-velocity spectral features (∼13,000 km s –1 ) in 2011 September, one year before the current SN-like event. This implies that the detection of such high-velocity outflows cannot, conclusively, point to a core-collapse SN origin. We suggest that the initial peak in the 2012a event was unlikely to be due to a faint core-collapse SN. We propose that the high intrinsic luminosity of the latest peak, the variability history of SN 2009ip, and the detection of broad spectral lines indicative of high-velocity ejecta are consistent with a pulsational pair-instability event, and that the star may have survived the last outburst. The question of the survival of the LBV progenitor star and its future fate remain open issues, only to be answered with future monitoring of this historically unique explosion.
SN REFSDAL: CLASSIFICATION AS A LUMINOUS AND BLUE SN 1987A-LIKE TYPE II SUPERNOVA
Energy Technology Data Exchange (ETDEWEB)
Kelly, P. L.; Filippenko, A. V.; Graham, M. L. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Brammer, G.; Strolger, L.-G.; Riess, A. G. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Selsing, J.; Hjorth, J.; Christensen, L. [Dark Cosmology Centre, Niels Bohr Institute, University of Copenhagen, Juliane Maries Vej 30, DK-2100 Copenhagen (Denmark); Foley, R. J. [Department of Physics, University of Illinois at Urbana-Champaign, 1110 W. Green Street, Urbana, IL 61801 (United States); Rodney, S. A. [Department of Physics and Astronomy, University of South Carolina, 712 Main St., Columbia, SC 29208 (United States); Treu, T. [University of California, Los Angeles, CA 90095 (United States); Steidel, C. C.; Strom, A.; Zitrin, A. [California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Schmidt, K. B.; McCully, C. [Department of Physics, University of California, Santa Barbara, CA 93106-9530 (United States); Bradač, M. [University of California, Davis, 1 Shields Avenue, Davis, CA 95616 (United States); Jha, S. W. [Department of Physics and Astronomy, Rutgers, The State University of New Jersey, Piscataway, NJ 08854 (United States); Graur, O., E-mail: pkelly@astro.berkeley.edu [Center for Cosmology and Particle Physics, New York University, New York, NY 10003 (United States); and others
2016-11-10
We have acquired Hubble Space Telescope (HST) and Very Large Telescope near-infrared spectra and images of supernova (SN) Refsdal after its discovery as an Einstein cross in fall 2014. The HST light curve of SN Refsdal has a shape consistent with the distinctive, slowly rising light curves of SN 1987A-like SNe, and we find strong evidence for a broad H α P-Cygni profile and Na I D absorption in the HST grism spectrum at the redshift ( z = 1.49) of the spiral host galaxy. SNe IIn, largely powered by circumstellar interaction, could provide a good match to the light curve of SN Refsdal, but the spectrum of a SN IIn would not show broad and strong H α and Na I D absorption. From the grism spectrum, we measure an H α expansion velocity consistent with those of SN 1987A-like SNe at a similar phase. The luminosity, evolution, and Gaussian profile of the H α emission of the WFC3 and X-shooter spectra, separated by ∼2.5 months in the rest frame, provide additional evidence that supports the SN 1987A-like classification. In comparison with other examples of SN 1987A-like SNe, photometry of SN Refsdal favors bluer B - V and V - R colors and one of the largest luminosities for the assumed range of potential magnifications. The evolution of the light curve at late times will provide additional evidence about the potential existence of any substantial circumstellar material. Using MOSFIRE and X-shooter spectra, we estimate a subsolar host-galaxy metallicity (8.3 ± 0.1 dex and <8.4 dex, respectively) near the explosion site.
Measurements of the diameter of the supernova SN 1987A
International Nuclear Information System (INIS)
Karovska, M.; Nisenson, P.; Standley, C.; Heathcote, S.R.
1991-01-01
Speckle interferometric measurements of the angular diameter of SN 1987A in the Large Magellanic Cloud, obtained at 664 days after the outburst are presented. Diameters were estimated with milliarcsec precision at 657 nm and 550 nm by fitting model visibility functions to the data corresponding to different intensity distributions for the supernova disk. Measurements made assuming a uniform intensity distribution were compared to the uniform disk measurements obtained from 30 days after the explosion. Diameter measurements obtained near the center of the H-alpha line are consistent with homologous expansion of the supernova shell with a mean velocity of 2850 km/s. The linear least-squares fit to the measurements obtained at other wavelengths from 260 days after the explosion yielded a somewhat lower mean expansion velocity. 8 refs
SN 2009bb: A PECULIAR BROAD-LINED TYPE Ic SUPERNOVA ,
International Nuclear Information System (INIS)
Pignata, Giuliano; Stritzinger, Maximilian; Phillips, M. M.; Morrell, Nidia; Boldt, Luis; Campillay, Abdo; Contreras, Carlos; Gonzalez, Sergio; Krzeminski, Wojtek; Roth, Miguel; Salgado, Francisco; Soderberg, Alicia; Mazzali, Paolo; Anderson, J. P.; Folatelli, Gaston; Foerster, Francisco; Hamuy, Mario; Maza, Jose; Levesque, Emily M.; Rest, Armin
2011-01-01
Ultraviolet, optical, and near-infrared photometry and optical spectroscopy of the broad-lined Type Ic supernova (SN) 2009bb are presented, following the flux evolution from -10 to +285 days past B-band maximum. Thanks to the very early discovery, it is possible to place tight constraints on the SN explosion epoch. The expansion velocities measured from near maximum spectra are found to be only slightly smaller than those measured from spectra of the prototype broad-lined SN 1998bw associated with GRB 980425. Fitting an analytical model to the pseudobolometric light curve of SN 2009bb suggests that 4.1 ± 1.9 M sun of material was ejected with 0.22 ± 0.06 M sun of it being 56 Ni. The resulting kinetic energy is 1.8 ± 0.7 x 10 52 erg. This, together with an absolute peak magnitude of M B = -18.36 ± 0.44, places SN 2009bb on the energetic and luminous end of the broad-lined Type Ic (SN Ic) sequence. Detection of helium in the early time optical spectra accompanied with strong radio emission and high metallicity of its environment makes SN 2009bb a peculiar object. Similar to the case for gamma-ray bursts (GRBs), we find that the bulk explosion parameters of SN 2009bb cannot account for the copious energy coupled to relativistic ejecta, and conclude that another energy reservoir (a central engine) is required to power the radio emission. Nevertheless, the analysis of the SN 2009bb nebular spectrum suggests that the failed GRB detection is not imputable to a large angle between the line-of-sight and the GRB beamed radiation. Therefore, if a GRB was produced during the SN 2009bb explosion, it was below the threshold of the current generation of γ-ray instruments.
INVERSE COMPTON X-RAY EMISSION FROM SUPERNOVAE WITH COMPACT PROGENITORS: APPLICATION TO SN2011fe
International Nuclear Information System (INIS)
Margutti, R.; Soderberg, A. M.; Chomiuk, L.; Milisavljevic, D.; Foley, R. J.; Slane, P.; Moe, M.; Chevalier, R.; Hurley, K.; Hughes, J. P.; Fransson, C.; Barthelmy, S.; Cummings, J.; Boynton, W.; Enos, H.; Fellows, C.; Briggs, M.; Connaughton, V.; Costa, E.; Del Monte, E.
2012-01-01
We present a generalized analytic formalism for the inverse Compton X-ray emission from hydrogen-poor supernovae and apply this framework to SN 2011fe using Swift X-Ray Telescope (XRT), UVOT, and Chandra observations. We characterize the optical properties of SN 2011fe in the Swift bands and find them to be broadly consistent with a 'normal' SN Ia, however, no X-ray source is detected by either XRT or Chandra. We constrain the progenitor system mass-loss rate M-dot -9 M ☉ yr -1 (3σ c.l.) for wind velocity v w = 100 km s –1 . Our result rules out symbiotic binary progenitors for SN 2011fe and argues against Roche lobe overflowing subgiants and main-sequence secondary stars if ∼> 1% of the transferred mass is lost at the Lagrangian points. Regardless of the density profile, the X-ray non-detections are suggestive of a clean environment (n CSM –3 ) for 2 × 10 15 ∼ 16 cm around the progenitor site. This is either consistent with the bulk of material being confined within the binary system or with a significant delay between mass loss and supernova explosion. We furthermore combine X-ray and radio limits from Chomiuk et al. to constrain the post-shock energy density in magnetic fields. Finally, we searched for the shock breakout pulse using gamma-ray observations from the Interplanetary Network and find no compelling evidence for a supernova-associated burst. Based on the compact radius of the progenitor star we estimate that the shock breakout pulse was likely not detectable by current satellites.
Spectroscopic classification of SN 2018brz as a type Ia supernova before maximum
Galbany, Lluis; Lopez-Sanchez, Angel R.; Ascasibar, Yago; Fiegert, Kristin
2018-05-01
We report the spectroscopic classification of SN 2018brz (RA=08:33:22.27, DEC=-76:37:39.8) in an anonymous host galaxy. The candidate was discovered by the All-Sky Automated Survey for SuperNovae (ASAS-SN: Shappee et al. 2014) on UT 2018-05-15 at 16.5 mag. Observations were performed on the 4m Anglo-Australian Telescope at Siding Spring Observatory on 2018 May 19 9:15 UT, using Koala+AAOmega and Grisms 580V+1000R (3500-6000A and 6300-7300A).
DEFF Research Database (Denmark)
Frederiksen, Teddy
Type Ia supernovae (SNe) have long been the gold standard for precision cosmology and after several decades of intense research the supernova (SN) community was in 2011 honored by giving the Nobel Prize in physics for the discovery of Dark Energy to the leaders of the two big SN collaborations: S...
Detection of a very bright source close to the LMC supernova SN 1987A
Nisenson, P.; Papaliolios, C.; Karovska, M.; Noyes, R.
1987-01-01
High angular resolution observations of the supernova in the Large Magellanic Cloud, SN 1987A, have revealed a bright source separated from the SN by approximately 60 mas with a magnitude difference of 2.7 at 656 nm (H-alpha). Speckle imaging techniques were applied to data recorded with the CfA two-dimensional photon counting detector on the CTIO 4 m telescope on March 25 and April 2 to allow measurements in H-alpha on both nights and at 533 nm and 450 nm on the second night. The nature of this object is as yet unknown, though it is almost certainly a phenomenon related to the SN.
DEFF Research Database (Denmark)
Pastorello, A.; Kochanek, C. S.; Fraser, M.
2018-01-01
Supernova (SN) 2016bdu is an unusual transient resembling SN 2009ip. SN 2009ip-like events are characterized by a long-lasting phase of erratic variability which ends with two luminous outbursts a few weeks apart. The second outburst is significantly more luminous (about 3 mag) than the first. In...
iPTF17cw: An Engine-driven Supernova Candidate Discovered Independent of a Gamma-Ray Trigger
International Nuclear Information System (INIS)
Corsi, A.; Palliyaguru, N. T.; Cenko, S. B.; Singer, L. P.; Kutyrev, A.; Kasliwal, M. M.; Kulkarni, S. R.; Blagorodnova, N.; Kupfer, T.; Vedantham, H.; Quimby, R.; Frail, D. A.; Goldstein, A. M.; Connaughton, V.; Perley, D. A.; Copperwheat, C. M.; Piascik, A. S.; Steele, I. A.; Fremling, C.; Taddia, F.
2017-01-01
We present the discovery, classification, and radio-to-X-ray follow-up observations of iPTF17cw, a broad-lined (BL) type Ic supernova (SN) discovered by the intermediate Palomar Transient Factory (iPTF). Although it is unrelated to the gravitational wave trigger, this SN was discovered as a happy by-product of the extensive observational campaign dedicated to the follow-up of Advanced LIGO event GW 170104. The spectroscopic properties and inferred peak bolometric luminosity of iPTF17cw are most similar to the gamma-ray-burst (GRB)-associated SN, SN 1998bw, while the shape of the r -band light curve is most similar to that of the relativistic SN, SN 2009bb. Karl G. Jansky Very Large Array (VLA) observations of the iPTF17cw field reveal a radio counterpart ≈10 times less luminous than SN 1998bw, and with a peak radio luminosity comparable to that of SN 2006aj/GRB 060218 and SN 2010bh/GRB 100316D. Our radio observations of iPTF17cw imply a relativistically expanding outflow. However, further late-time observations with the VLA in its most extended configuration are needed to confirm fading of the iPTF17cw radio counterpart at all frequencies. X-ray observations carried out with Chandra reveal the presence of an X-ray counterpart with a luminosity similar to that of SN 2010bh/GRB 100316D. Searching the Fermi catalog for possible γ -rays reveals that GRB 161228B is spatially and temporally compatible with iPTF17cw. The similarity to SN 1998bw and SN 2009bb, the radio and X-ray detections, and the potential association with GRB 161228B all point to iPTF17cw being a new candidate member of the rare sample of optically discovered engine-driven BL-Ic SNe associated with relativistic ejecta.
iPTF17cw: An Engine-driven Supernova Candidate Discovered Independent of a Gamma-Ray Trigger
Energy Technology Data Exchange (ETDEWEB)
Corsi, A.; Palliyaguru, N. T. [Department of Physics and Astronomy, Texas Tech University, Box 1051, Lubbock, TX 79409-1051 (United States); Cenko, S. B.; Singer, L. P.; Kutyrev, A. [Astrophysics Science Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Kasliwal, M. M.; Kulkarni, S. R.; Blagorodnova, N.; Kupfer, T.; Vedantham, H. [Division of Physics, Mathematics, and Astronomy, California Institute of Technology, Pasadena, CA 91125 (United States); Quimby, R. [Department of Astronomy/Mount Laguna Observatory, San Diego State University, San Diego, CA 92182 (United States); Frail, D. A. [National Radio Astronomy Observatory, P.O. Box O, Socorro, NM 87801 (United States); Goldstein, A. M.; Connaughton, V. [Universities Space Research Association, NSSTC, 320 Sparkman Drive, Huntsville, AL 35805 (United States); Perley, D. A.; Copperwheat, C. M.; Piascik, A. S.; Steele, I. A. [Astrophysics Research Institute, Liverpool John Moores University, IC2, Liverpool Science Park, 146 Brownlow Hill, Liverpool, L3 5RF (United Kingdom); Fremling, C.; Taddia, F., E-mail: alessandra.corsi@ttu.edu [Oskar Klein Centre, Department of Astronomy, Stockholm University, Albanova University Centre, SE-106 91 Stockholm (Sweden); and others
2017-09-20
We present the discovery, classification, and radio-to-X-ray follow-up observations of iPTF17cw, a broad-lined (BL) type Ic supernova (SN) discovered by the intermediate Palomar Transient Factory (iPTF). Although it is unrelated to the gravitational wave trigger, this SN was discovered as a happy by-product of the extensive observational campaign dedicated to the follow-up of Advanced LIGO event GW 170104. The spectroscopic properties and inferred peak bolometric luminosity of iPTF17cw are most similar to the gamma-ray-burst (GRB)-associated SN, SN 1998bw, while the shape of the r -band light curve is most similar to that of the relativistic SN, SN 2009bb. Karl G. Jansky Very Large Array (VLA) observations of the iPTF17cw field reveal a radio counterpart ≈10 times less luminous than SN 1998bw, and with a peak radio luminosity comparable to that of SN 2006aj/GRB 060218 and SN 2010bh/GRB 100316D. Our radio observations of iPTF17cw imply a relativistically expanding outflow. However, further late-time observations with the VLA in its most extended configuration are needed to confirm fading of the iPTF17cw radio counterpart at all frequencies. X-ray observations carried out with Chandra reveal the presence of an X-ray counterpart with a luminosity similar to that of SN 2010bh/GRB 100316D. Searching the Fermi catalog for possible γ -rays reveals that GRB 161228B is spatially and temporally compatible with iPTF17cw. The similarity to SN 1998bw and SN 2009bb, the radio and X-ray detections, and the potential association with GRB 161228B all point to iPTF17cw being a new candidate member of the rare sample of optically discovered engine-driven BL-Ic SNe associated with relativistic ejecta.
Nearby supernova host galaxies from the CALIFA survey. II. Supernova environmental metallicity
Galbany, L.; Stanishev, V.; Mourão, A. M.; Rodrigues, M.; Flores, H.; Walcher, C. J.; Sánchez, S. F.; García-Benito, R.; Mast, D.; Badenes, C.; González Delgado, R. M.; Kehrig, C.; Lyubenova, M.; Marino, R. A.; Mollá, M.; Meidt, S.; Pérez, E.; van de Ven, G.; Vílchez, J. M.
2016-01-01
The metallicity of a supernova progenitor, together with its mass, is one of the main parameters that can rule the progenitor's fate. We present the second study of nearby supernova (SN) host galaxies (0.005 ⊙) > 10 dex) by targeted searches. We neither found evidence that the metallicity at the SN
Spectroscopic Classification of SN 2018nt as a Reddened Type Ia Supernova
Vinko, J.; Szeged, U.; Wheeler, J. C.
2018-02-01
An optical spectrum (range 360-700 nm) of SN 2018nt (K2 C16-0043), was obtained with the "Low Resolution Spectrograph-2" (LRS2) on the 10m Hobby-Eberly Telescope at McDonald Observatory by S. Odewahn on 2018 Feb 05.20 UT. The spectrum is consistent with that of a heavily reddened Type Ia supernova (with Av > 2 mag) about 3 weeks after maximum light.
Supernova SN 2011fe from an exploding carbon-oxygen white dwarf star.
Nugent, Peter E; Sullivan, Mark; Cenko, S Bradley; Thomas, Rollin C; Kasen, Daniel; Howell, D Andrew; Bersier, David; Bloom, Joshua S; Kulkarni, S R; Kandrashoff, Michael T; Filippenko, Alexei V; Silverman, Jeffrey M; Marcy, Geoffrey W; Howard, Andrew W; Isaacson, Howard T; Maguire, Kate; Suzuki, Nao; Tarlton, James E; Pan, Yen-Chen; Bildsten, Lars; Fulton, Benjamin J; Parrent, Jerod T; Sand, David; Podsiadlowski, Philipp; Bianco, Federica B; Dilday, Benjamin; Graham, Melissa L; Lyman, Joe; James, Phil; Kasliwal, Mansi M; Law, Nicholas M; Quimby, Robert M; Hook, Isobel M; Walker, Emma S; Mazzali, Paolo; Pian, Elena; Ofek, Eran O; Gal-Yam, Avishay; Poznanski, Dovi
2011-12-14
Type Ia supernovae have been used empirically as 'standard candles' to demonstrate the acceleration of the expansion of the Universe even though fundamental details, such as the nature of their progenitor systems and how the stars explode, remain a mystery. There is consensus that a white dwarf star explodes after accreting matter in a binary system, but the secondary body could be anything from a main-sequence star to a red giant, or even another white dwarf. This uncertainty stems from the fact that no recent type Ia supernova has been discovered close enough to Earth to detect the stars before explosion. Here we report early observations of supernova SN 2011fe in the galaxy M101 at a distance from Earth of 6.4 megaparsecs. We find that the exploding star was probably a carbon-oxygen white dwarf, and from the lack of an early shock we conclude that the companion was probably a main-sequence star. Early spectroscopy shows high-velocity oxygen that slows rapidly, on a timescale of hours, and extensive mixing of newly synthesized intermediate-mass elements in the outermost layers of the supernova. A companion paper uses pre-explosion images to rule out luminous red giants and most helium stars as companions to the progenitor.
Krisciunas, Kevin; Contreras, Carlos; Burns, Christopher R.; Phillips, M. M.; Stritzinger, Maximilian D.; Morrell, Nidia; Hamuy, Mario; Anais, Jorge; Boldt, Luis; Busta, Luis; Campillay, Abdo; Castellón, Sergio; Folatelli, Gastón; Freedman, Wendy L.; González, Consuelo; Hsiao, Eric Y.; Krzeminski, Wojtek; Persson, Sven Eric; Roth, Miguel; Salgado, Francisco; Serón, Jacqueline; Suntzeff, Nicholas B.; Torres, Simón; Filippenko, Alexei V.; Li, Weidong; Madore, Barry F.; DePoy, D. L.; Marshall, Jennifer L.; Rheault, Jean-Philippe; Villanueva, Steven
2017-11-01
We present final natural-system optical (ugriBV) and near-infrared (YJH) photometry of 134 supernovae (SNe) with probable white dwarf progenitors that were observed in 2004-2009 as part of the first stage of the Carnegie Supernova Project (CSP-I). The sample consists of 123 Type Ia SNe, 5 Type Iax SNe, 2 super-Chandrasekhar SN candidates, 2 Type Ia SNe interacting with circumstellar matter, and 2 SN 2006bt-like events. The redshifts of the objects range from z=0.0037 to 0.0835; the median redshift is 0.0241. For 120 (90%) of these SNe, near-infrared photometry was obtained. Average optical extinction coefficients and color terms are derived and demonstrated to be stable during the five CSP-I observing campaigns. Measurements of the CSP-I near-infrared bandpasses are also described, and near-infrared color terms are estimated through synthetic photometry of stellar atmosphere models. Optical and near-infrared magnitudes of local sequences of tertiary standard stars for each supernova are given, and a new calibration of Y-band magnitudes of the Persson et al. standards in the CSP-I natural system is presented.
SN 2008jb: A 'LOST' CORE-COLLAPSE SUPERNOVA IN A STAR-FORMING DWARF GALAXY AT ∼10 Mpc
International Nuclear Information System (INIS)
Prieto, J. L.; Lee, J. C.; Drake, A. J.; Djorgovski, S. G.; McNaught, R.; Garradd, G.; Beacom, J. F.; Beshore, E.; Catelan, M.; Pojmanski, G.; Stanek, K. Z.; Szczygieł, D. M.
2012-01-01
We present the discovery and follow-up observations of SN 2008jb, a core-collapse supernova in the southern dwarf irregular galaxy ESO 302–14 (M B = –15.3 mag) at 9.6 Mpc. This nearby transient was missed by galaxy-targeted surveys and was only found in archival optical images obtained by the Catalina Real-time Transient Survey and the All-Sky Automated Survey. The well-sampled archival photometry shows that SN 2008jb was detected shortly after explosion and reached a bright optical maximum, V max ≅ 13.6 mag (M V,max ≅ –16.5). The shape of the light curve shows a plateau of ∼100 days, followed by a drop of ∼1.4 mag in the V band to a slow decline with an approximate 56 Co decay slope. The late-time light curve is consistent with 0.04 ± 0.01 M ☉ of 56 Ni synthesized in the explosion. A spectrum of the supernova obtained two years after explosion shows a broad, boxy Hα emission line, which is unusual for normal Type II-Plateau supernovae at late times. We detect the supernova in archival Spitzer and WISE images obtained 8-14 months after explosion, which show clear signs of warm (600-700 K) dust emission. The dwarf irregular host galaxy, ESO 302–14, has a low gas-phase oxygen abundance, 12 + log(O/H) = 8.2 (∼1/5 Z ☉ ), similar to those of the Small Magellanic Cloud and the hosts of long gamma-ray bursts and luminous core-collapse supernovae. This metallicity is one of the lowest among local (∼ 5 M ☉ for the star formation complex, assuming a single-age starburst. These properties are consistent with the expanding Hα supershells observed in many well-studied nearby dwarf galaxies, which are tell-tale signs of feedback from the cumulative effect of massive star winds and supernovae. The age estimated for the star-forming region where SN 2008jb exploded suggests a relatively high-mass progenitor star with an initial mass M ∼ 20 M ☉ and warrants further study. We discuss the implications of these findings in the study of core
International Nuclear Information System (INIS)
Petschek, A.
1990-01-01
This book offers papers incorporating the latest results and understanding about supernovae, including SN1987A. There are several chapters reviewing all the radio through infrared, visible, and ultraviolet to X-rays and gamma-rays but also neutrinos. Other chapters deal with the classification of supernovae, depending on their spectra and light curves. Three chapters treat supernovae theory, including an idea of a fractal burning front and another on the behavior of neutron stars
Energy Technology Data Exchange (ETDEWEB)
Otsuka, Masaaki; Meixner, Margaret; Panagia, Nino [Space Telescope Science Institute, 3700 San Martin Dr., Baltimore, MD 21218 (United States); Fabbri, Joanna; Barlow, Michael J.; Wesson, Roger [Department of Physics and Astronomy, University College London, Gower Street, London WC1E 6BT (United Kingdom); Clayton, Geoffrey C.; Andrews, Jennifer E. [Department of Physics and Astronomy, Louisiana State University, Baton Rouge, LA 70803 (United States); Gallagher, Joseph S. [Department of Mathematics, Physics, and Computer Science, Raymond Walters College, 9555 Plain field Rd., Blue Ash, OH 45236 (United States); Sugerman, Ben E. K. [Department of Physics and Astronomy, Goucher College, 1021 Dulaney Valley Road, Baltimore, MD 21204 (United States); Ercolano, Barbara [Universitaets-Sternwarte Muenchen, Scheinerstr. 1, 81679 Muenchen (Germany); Welch, Douglas, E-mail: otsuka@stsci.edu, E-mail: otsuka@asiaa.sinica.edu.tw [Department of Physics and Astronomy, McMaster University, Hamilton, Ontario L8S 4M1 (Canada)
2012-01-01
We present BVRIJHK-band photometry of six core-collapse supernovae, SNe 1999bw, 2002hh, 2003gd, 2004et, 2005cs, and 2006bc, measured at late epochs (>2 yr) based on the Hubble Space Telescope (HST), and the Gemini North, and WIYN telescopes. We also show the JHK light curves of supernova impostor SN 2008S up to day 575 because it was serendipitously in our SN 2002hh field of view. Of our 43 HST observations in total, 36 observations are successful in detecting the light from the SNe alone and measuring magnitudes of all the targets. HST observations show a resolved scattered light echo around SN 2003gd at day 1520 and around SN 2002hh at day 1717. Our Gemini and WIYN observations detected SNe 2002hh and 2004et as well. Combining our data with previously published data, we show VRIJHK-band light curves and estimate decline magnitude rates at each band in four different phases. Our prior work on these light curves and other data indicate that dust is forming in our targets from days {approx}300 to 400, supporting SN dust formation theory. In this paper we focus on other physical properties derived from late-time light curves. We estimate {sup 56}Ni masses for our targets (0.5-14 Multiplication-Sign 10{sup -2} M{sub Sun }) from the bolometric light curve of each of days {approx}150-300 using SN 1987A as a standard (7.5 Multiplication-Sign 10{sup -2} M{sub Sun }). The flattening or sometimes increasing fluxes in the late-time light curves of SNe 2002hh, 2003gd, 2004et, and 2006bc indicate the presence of light echoes. We estimate the circumstellar hydrogen density of the material causing the light echo and find that SN 2002hh is surrounded by relatively dense materials (n(H) >400 cm{sup -3}) and SNe 2003gd and 2004et have densities more typical of the interstellar medium ({approx}1 cm{sup -3}). We analyze the sample as a whole in the context of physical properties derived in prior work. The {sup 56}Ni mass appears well correlated with progenitor mass with a slope of 0
Supernova 1987A in the Large Magellanic Cloud
Kafatos, Minas; Michalitsianos, Andrew G.
2006-11-01
Foreword; Acknowledgements; Workshop participants; 1. Images and spectrograms of Sanduleak - 69º202, the SN 1987a progenitor N. R. Walborn; 2. The progenitor of SN 1987A G. Sonneborn; 3. Another supernova with a blue progenitor C. M. Gaskell and W. C. Keel; 4. Optical and infrared observations of SN 1987A from Cerro Tololo Inter-American Observatory M. M. Phillips; 5. SN 1987A: observational results obtained at ESO I. J. Danziger, P. Bouchet, R. A. E. Fosbury, C. Gouiffes, L. B. Lucy, A. F. M. Moorwood, E. Oliva and F. Rufener; 6. Observations of SN 1987A at the South African Astronomical Observatory (SAAO) M. W. Feast; 7. Observations of SN 1987A at the Anglo-Australian Telescope W. J. Couch; 8. Linear polarimetric study of SN 1987A A. Clocchiatti, M. Méndez, O. Benvenuto, C. Feinstein, H. Marraco, B. García and N. Morrell; 9. Infrared spectroscopy of SN 1987A from the NASA Kuiper Airborne Observatory H. P. Larson, S. Drapatz, M. J. Mumma and H. A. Weaver; 10. Radio observations of SN 1987A N. Bartel et al.; 11. Ultraviolet observations of SN 1987A: clues to mass loss R. P. Kirshner; 12. On the energetics of SN 1987A N. Panagia; 13. On the nature and apparent uniqueness of SN 1987A A. V. Filippenko; 14. A comparison of the SN 1987A light curve with other type II supernovae, and the detectability of similar supernovae M. F. Schmitz and C. M. Gaskell; 15. P-Cygni features and photospheric velocities L. Bildsten and J. C. L. Wang; 16. The Neutrino burst from SN 1987A detected in the Mont Blanc LSD experiment M. Aglietta et al.; 17. Toward observational neutrino astrophysics M. Koshiba; 18. The discovery of neutrinos from SN 1987A with the IMB detector J. Matthews; 19. Peering into the abyss: the neutrinos from SN 1987A A. Burrows; 20. Phenomenological analysis of neutrino emission from SN 1987A J. N. Bahcall, D. N. Spergel and W. H. Press; 21. Mass determination of neutrinos H. Y. Chiu; 22. Neutrino transport in a type II supernova D. C. Ellison, P. M. Giovanoni
Radio emission from supernovae. I. One to twelve year old supernovae
International Nuclear Information System (INIS)
Weiler, K.W.; Panagia, N.; Sramek, R.A.; Van Der Hulst, J.M.; Roberts, M.S.
1989-01-01
All recorded optical supernovae brighter than 14.0 mag from SN 1970A to SN 1981A were observed in May 1982 using VLA at 6 cm. Apart from the known radio supernovae (SN 1970G, SN 1979C, and SN 1980K), radio emissions were not detected from any of the objects to a limit of about 0.5 mJy. Limits on mass-loss rates from the presupernova systems are established. It is found that Type Ia Sns originate in systems which contain very little circumstellar material at the time of explosion. These systems are very different from those which originate Type Ib Sns. With some exceptions, Type II SNs originate with the high presupernova mass-loss rates expected from red supergiant progenitors with original main-sequence masses greater than about 8 solar masses. 16 references
de Jaeger, T.; Galbany, L.; Filippenko, A. V.; González-Gaitán, S.; Yasuda, N.; Maeda, K.; Tanaka, M.; Morokuma, T.; Moriya, T. J.; Tominaga, N.; Nomoto, K.; Komiyama, Y.; Anderson, J. P.; Brink, T. G.; Carlberg, R. G.; Folatelli, G.; Hamuy, M.; Pignata, G.; Zheng, W.
2017-12-01
Although Type Ia supernova cosmology has now reached a mature state, it is important to develop as many independent methods as possible to understand the true nature of dark energy. Recent studies have shown that Type II supernovae (SNe II) offer such a path and could be used as alternative distance indicators. However, the majority of these studies were unable to extend the Hubble diagram above redshift z = 0.3 because of observational limitations. Here, we show that we are now ready to move beyond low redshifts and attempt high-redshift (z ≳ 0.3) SN II cosmology as a result of new-generation deep surveys such as the Subaru/Hyper Suprime-Cam survey. Applying the 'standard candle method' to SN 2016jhj (z = 0.3398 ± 0.0002; discovered by HSC) together with a low-redshift sample, we are able to construct the highest-redshift SN II Hubble diagram to date with an observed dispersion of 0.27 mag (i.e. 12-13 per cent in distance). This work demonstrates the bright future of SN II cosmology in the coming era of large, wide-field surveys like that of the Large Synoptic Survey Telescope.
DEFF Research Database (Denmark)
Pastorello...[], A.; Pumo, M.L.; Navasardyan, H.
2012-01-01
. In this paper we investigate the properties of SN 2009E, which exploded in a relatively nearby spiral galaxy (NGC 4141) and that is probably the faintest 1987A-like supernova discovered so far. We also attempt to characterize this subgroup of core-collapse supernovae with the help of the literature and present...... observations which started about 2 months after the supernova explosion, highlight significant differences between SN 2009E and the prototypical SN 1987A. Modelling the data of SN 2009E allows us to constrain the explosion parameters and the properties of the progenitor star, and compare the inferred estimates...... 2009E ejected about 0.04 M⊙ of 56Ni, which is the smallest 56Ni mass in our sample of 1987A-like events. Modelling the observations with a radiation hydrodynamics code, we infer for SN 2009E a kinetic plus thermal energy of about 0.6 foe, an initial radius of ~7 × 1012 cm and an ejected mass of ~19 M...
Supernova will continue to glow
International Nuclear Information System (INIS)
Anon.
1987-01-01
On the night of 23/24 February 1987 a new supernova called SN 1987A, was discovered. Within a few hours of the announcement of the discovery, the South African Astronomical Observatory (SAAO) began a series of observations. In this article, the importance of supernovae-exploding stars, and what the SAAO has discovered so far from SN 1987A are discussed
Spectroscopic classification of PTSS-18ecg (SN 2018bhb) as a type Ia supernova around maximum
Zhang, Jujia; Ding, Xu; Wang, Xiaofeng; Li, Wenxiong; Li, Bin; Xu, Zhijian; Tan, Hanjie; Zhao, Haibin; Wang, Lifan; Li, Zhitong
2018-05-01
We obtained an optical spectrum (range 350-890 nm) of PTSS-18ecg (SN 2018bhb), discovered by the PMO-Tsinghua Supernova Survey (PTSS, http://www.cneost.org/ptss/), on UT 2018 May 10.7 with the Li-Jiang 2.4 m telescope (LJT+YFOSC) at Li-Jiang Observatory of Yunnan Observatories.
Holoien, Thomas W.-S.; Marshall, Philip J.; Wechsler, Risa H.
2017-06-01
We describe two new open-source tools written in Python for performing extreme deconvolution Gaussian mixture modeling (XDGMM) and using a conditioned model to re-sample observed supernova and host galaxy populations. XDGMM is new program that uses Gaussian mixtures to perform density estimation of noisy data using extreme deconvolution (XD) algorithms. Additionally, it has functionality not available in other XD tools. It allows the user to select between the AstroML and Bovy et al. fitting methods and is compatible with scikit-learn machine learning algorithms. Most crucially, it allows the user to condition a model based on the known values of a subset of parameters. This gives the user the ability to produce a tool that can predict unknown parameters based on a model that is conditioned on known values of other parameters. EmpiriciSN is an exemplary application of this functionality, which can be used to fit an XDGMM model to observed supernova/host data sets and predict likely supernova parameters using a model conditioned on observed host properties. It is primarily intended to simulate realistic supernovae for LSST data simulations based on empirical galaxy properties.
Energy Technology Data Exchange (ETDEWEB)
Holoien, Thomas W.-S.; /Ohio State U., Dept. Astron. /Ohio State U., CCAPP /KIPAC, Menlo Park /SLAC; Marshall, Philip J.; Wechsler, Risa H.; /KIPAC, Menlo Park /SLAC
2017-05-11
We describe two new open-source tools written in Python for performing extreme deconvolution Gaussian mixture modeling (XDGMM) and using a conditioned model to re-sample observed supernova and host galaxy populations. XDGMM is new program that uses Gaussian mixtures to perform density estimation of noisy data using extreme deconvolution (XD) algorithms. Additionally, it has functionality not available in other XD tools. It allows the user to select between the AstroML and Bovy et al. fitting methods and is compatible with scikit-learn machine learning algorithms. Most crucially, it allows the user to condition a model based on the known values of a subset of parameters. This gives the user the ability to produce a tool that can predict unknown parameters based on a model that is conditioned on known values of other parameters. EmpiriciSN is an exemplary application of this functionality, which can be used to fit an XDGMM model to observed supernova/host data sets and predict likely supernova parameters using a model conditioned on observed host properties. It is primarily intended to simulate realistic supernovae for LSST data simulations based on empirical galaxy properties.
X-ray characteristics of the Lupus Loop and SN1006 supernova remnants
Energy Technology Data Exchange (ETDEWEB)
Toor, A [California Univ., Livermore (USA). Lawrence Livermore Lab.
1980-01-01
The spatial extent of the Lupus Loop and spectra for the Lupus Loop and SN1006 supernova remnants have been determined with a rocket-borne payload. The Lupus Loop is an extended source of soft X-rays (approx. 300' diam) that shows a correlation between its brightest X-ray and radio-emission regions. Its spectrum is characterized by a temperature of 350 eV. Thus, the Lupus Loop appears similar to Vela X and Cygnus Loop, although much weaker. Emission from SN1006 is spatially unresolved and exhibits a harder spectrum than that of the Lupus Loop. All spectral data (0.2 100 keV) from our observation and previous observations are satisfactorily fit with a power law (index = 2.15). This spectral dependence suggests the possibility that a rotating neutron star is the underlying source of the radiated energy although such an interpretation appears inconsistent with the remnant's morphology.
X-ray characteristics of the Lupus Loop and SN1006 supernova remnants
International Nuclear Information System (INIS)
Toor, A.
1980-01-01
The spatial extent of the Lupus Loop and spectra for the Lupus Loop and SN1006 supernova remnants have been determined with a rocket-borne payload. The Lupus Loop is an extended source of soft X-rays (approx. 300' diam) that shows a correlation between its brightest X-ray and radio-emission regions. Its spectrum is characterized by a temperature of 350 eV. Thus, the Lupus Loop appears similar to Vela X and Cygnus Loop, although much weaker. Emission from SN1006 is spatially unresolved and exhibits a harder spectrum than that of the Lupus Loop. All spectral data (0.2 100 keV) from our observation and previous observations are satisfactorily fit with a power law (index = 2.15). This spectral dependence suggests the possibility that a rotating neutron star is the underlying source of the radiated energy although such an interpretation appears inconsistent with the remnant's morphology. (orig.)
Energy Technology Data Exchange (ETDEWEB)
McCully, Curtis; Jha, Saurabh W. [Department of Physics and Astronomy, Rutgers, the State University of New Jersey, 136 Frelinghuysen Road, Piscataway, NJ 08854 (United States); Foley, Ryan J. [Astronomy Department, University of Illinois at Urbana-Champaign, 1002 West Green Street, Urbana, IL 61801 (United States); Chornock, Ryan [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Holtzman, Jon A. [Department of Astronomy, MSC 4500, New Mexico State University, P.O. Box 30001, Las Cruces, NM 88003 (United States); Balam, David D. [Dominion Astrophysical Observatory, Herzberg Institute of Astrophysics, 5071 West Saanich Road, Victoria, BC V9E 2E7 (Canada); Branch, David [Homer L. Dodge Department of Physics and Astronomy, University of Oklahoma, Norman, OK 73019 (United States); Filippenko, Alexei V.; Ganeshalingam, Mohan; Li, Weidong [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Frieman, Joshua [Kavli Institute for Cosmological Physics and Department of Astronomy and Astrophysics, University of Chicago, 5640 South Ellis Avenue, Chicago, IL 60637 (United States); Fynbo, Johan; Leloudas, Giorgos [Dark Cosmology Centre, Niels Bohr Institute, University of Copenhagen, Juliane Maries Vej 30, DK-2100 Copenhagen Ø (Denmark); Galbany, Lluis [Institut de Física d' Altes Energies, Universitat Autònoma de Barcelona, E-08193 Bellaterra (Barcelona) (Spain); Garnavich, Peter M. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Graham, Melissa L. [Las Cumbres Observatory Global Telescope Network, Goleta, CA 93117 (United States); Hsiao, Eric Y. [Carnegie Observatories, Las Campanas Observatory, Colina El Pino, Casilla 601 (Chile); Leonard, Douglas C., E-mail: cmccully@physics.rutgers.edu [Department of Astronomy, San Diego State University, San Diego, CA 92182 (United States); and others
2014-05-10
We present Hubble Space Telescope (HST) and ground-based optical and near-infrared observations of SN 2005hk and SN 2008A, typical members of the Type Iax class of supernovae (SNe). Here we focus on late-time observations, where these objects deviate most dramatically from all other SN types. Instead of the dominant nebular emission lines that are observed in other SNe at late phases, spectra of SNe 2005hk and 2008A show lines of Fe II, Ca II, and Fe I more than a year past maximum light, along with narrow [Fe II] and [Ca II] emission. We use spectral features to constrain the temperature and density of the ejecta, and find high densities at late times, with n{sub e} ≳ 10{sup 9} cm{sup –3}. Such high densities should yield enhanced cooling of the ejecta, making these objects good candidates to observe the expected 'infrared catastrophe', a generic feature of SN Ia models. However, our HST photometry of SN 2008A does not match the predictions of an infrared catastrophe. Moreover, our HST observations rule out a 'complete deflagration' that fully disrupts the white dwarf for these peculiar SNe, showing no evidence for unburned material at late times. Deflagration explosion models that leave behind a bound remnant can match some of the observed properties of SNe Iax, but no published model is consistent with all of our observations of SNe 2005hk and 2008A.
International Nuclear Information System (INIS)
McCully, Curtis; Jha, Saurabh W.; Foley, Ryan J.; Chornock, Ryan; Holtzman, Jon A.; Balam, David D.; Branch, David; Filippenko, Alexei V.; Ganeshalingam, Mohan; Li, Weidong; Frieman, Joshua; Fynbo, Johan; Leloudas, Giorgos; Galbany, Lluis; Garnavich, Peter M.; Graham, Melissa L.; Hsiao, Eric Y.; Leonard, Douglas C.
2014-01-01
We present Hubble Space Telescope (HST) and ground-based optical and near-infrared observations of SN 2005hk and SN 2008A, typical members of the Type Iax class of supernovae (SNe). Here we focus on late-time observations, where these objects deviate most dramatically from all other SN types. Instead of the dominant nebular emission lines that are observed in other SNe at late phases, spectra of SNe 2005hk and 2008A show lines of Fe II, Ca II, and Fe I more than a year past maximum light, along with narrow [Fe II] and [Ca II] emission. We use spectral features to constrain the temperature and density of the ejecta, and find high densities at late times, with n e ≳ 10 9 cm –3 . Such high densities should yield enhanced cooling of the ejecta, making these objects good candidates to observe the expected 'infrared catastrophe', a generic feature of SN Ia models. However, our HST photometry of SN 2008A does not match the predictions of an infrared catastrophe. Moreover, our HST observations rule out a 'complete deflagration' that fully disrupts the white dwarf for these peculiar SNe, showing no evidence for unburned material at late times. Deflagration explosion models that leave behind a bound remnant can match some of the observed properties of SNe Iax, but no published model is consistent with all of our observations of SNe 2005hk and 2008A.
Detection of a Very Bright Source Close to the LMC Supernova SN 1987A: Erratum
Nisenson, P.; Papaliolios, C.; Karovska, M.; Noyes, R.
1988-01-01
In the Letter "Detection of a Very Bright Source Close to the LMC Supernova SN 1987A" by P. Nisenson, C. Papaliolios, M. Karovska, and R. Noyes (1987 Ap. J. [Letters], 320, L15), two of the figure labels for Figure 1 were inadvertently transposed in the production process. A corrected version of the figure appears as Plate L4. The Journal regrets the error.
Supernovae Discovery Efficiency
John, Colin
2018-01-01
Abstract:We present supernovae (SN) search efficiency measurements for recent Hubble Space Telescope (HST) surveys. Efficiency is a key component to any search, and is important parameter as a correction factor for SN rates. To achieve an accurate value for efficiency, many supernovae need to be discoverable in surveys. This cannot be achieved from real SN only, due to their scarcity, so fake SN are planted. These fake supernovae—with a goal of realism in mind—yield an understanding of efficiency based on position related to other celestial objects, and brightness. To improve realism, we built a more accurate model of supernovae using a point-spread function. The next improvement to realism is planting these objects close to galaxies and of various parameters of brightness, magnitude, local galactic brightness and redshift. Once these are planted, a very accurate SN is visible and discoverable by the searcher. It is very important to find factors that affect this discovery efficiency. Exploring the factors that effect detection yields a more accurate correction factor. Further inquires into efficiency give us a better understanding of image processing, searching techniques and survey strategies, and result in an overall higher likelihood to find these events in future surveys with Hubble, James Webb, and WFIRST telescopes. After efficiency is discovered and refined with many unique surveys, it factors into measurements of SN rates versus redshift. By comparing SN rates vs redshift against the star formation rate we can test models to determine how long star systems take from the point of inception to explosion (delay time distribution). This delay time distribution is compared to SN progenitors models to get an accurate idea of what these stars were like before their deaths.
Astrophysical and terrestrial neutrinos in Supernova detectors
International Nuclear Information System (INIS)
Lagage, P.O.
1985-09-01
Supernova (SN) explosions are the place of very fundamental phenomena, whose privileged messengers are neutrinos. But such events are very rare. Then, SN detection has to be combined with other purposes. The recent developments of SN detectors have been associated with developments of underground particle physics (proton decay, monopoles ...). But here, I will restrict myself to discuss the possibilities for a supernova detector to be sensitive to other sources of neutrinos, astrophysical or terrestrial
A Model of the Vela Supernova Remnant
Gvaramadze, Vasilii
2000-10-01
A model of the Vela supernova remnant (SNR) based on a cavity explosion of a supernova (SN) star is proposed. It is suggested that the general structure of the remnant is determined by the interaction of the SN blast wave with a massive shell created by the SN progenitor (15-20 M_solar) star. A possible origin of the nebula of hard X-ray emission detected around the Vela pulsar is discussed.
Are young supernova remnants interacting with circumstellar gas
International Nuclear Information System (INIS)
Chevalier, R.A.
1982-01-01
The young remnants of galactic Type I supernovae (SN 1006, SN 1572, and SN 1604) appear to be interacting with moderately dense gas (n/sub O/> or =0.1 cm -3 ). If the gas in the ambient interstellar medium, the observations suggest that gas of this density is fairly pervasive. If the gas is circumstellar, there are important implications for the progenitors of Type I supernovae. A plausible density distribution for circumstellar gas is rhoinfinityr -2 . The expansion of a supernova into such a medium is examined and is compared with expansion into a uniform medium. The two cases can be distinguished on the basis of their density profiles and their rates of expansion. Currently available data factor the hypothesis of expansion in a uniform medium for all three Type I remnants; the evidence is the strongest for SN 1572 and the weakest for SN 1604. Further X-ray and radio observations of the galactic remnants and of extragalactic Type I supernovae should serve to test this hypothesis
THE DISTANCE TO NGC 1316 (FORNAX A) FROM OBSERVATIONS OF FOUR TYPE Ia SUPERNOVAE
International Nuclear Information System (INIS)
Stritzinger, Maximilian; Phillips, Mark M.; Boldt, Luis; Campillay, Abdo; Krzeminski, Wojtek; Morrell, Nidia; Salgado, Francisco; Roth, Miguel; Burns, Christopher R.; Persson, Sven E.; Freedman, Wendy L.; Madore, Barry F.; Folatelli, Gaston; Hamuy, Mario; Krisciunas, Kevin; Suntzeff, Nicholas B.; Kattner, ShiAnne; Contreras, Carlos
2010-01-01
The giant elliptical galaxy NGC 1316 (Fornax A) is a well-studied member of the Fornax Cluster and a prolific producer of Type Ia supernovae (SNe Ia), having hosted four observed events since 1980. Here, we present detailed optical- and near-infrared light curves of the spectroscopically normal SN 2006dd. These data are used, along with previously published photometry of the normal SN 1980N and SN 1981D, and the fast-declining, low-luminosity SN 2006mr, to compute independent estimates of the host reddening for each SN, and the distance to NGC 1316. From the three normal SNe, we find a distance of 17.8 ± 0.3 (random) ± 0.3 (systematic) Mpc for H o = 72. Distance moduli derived from the 'EBV' and Tripp methods give the values that are mutually consistent with 4%-8%. Moreover, the weighted means of the distance moduli for these three SNe for three methods agree to within 3%. This consistency is encouraging and supports the premise that Type Ia SNe are reliable distance indicators at the 5% precision level or better. On the other hand, the two methods used to estimate the distance of the fast-declining SN 2006mr both yield a distance to NGC 1316 which is 25%-30% larger. This disparity casts doubt on the suitability of fast-declining events for estimating extragalactic distances. Modest-to-negligible host galaxy reddening values are derived for all four SNe. Nevertheless, two of them (SN 2006dd and SN 2006mr) show strong Na I D interstellar lines in the host galaxy system. The strength of this absorption is completely inconsistent with the small reddening values derived from the SN light curves if the gas in NGC 1316 is typical of that found in the interstellar medium of the Milky Way. In addition, the equivalent width of the Na lines in SN 2006dd appears to have weakened significantly some 100-150 days after explosion.
SN 2012au: A GOLDEN LINK BETWEEN SUPERLUMINOUS SUPERNOVAE AND THEIR LOWER-LUMINOSITY COUNTERPARTS
International Nuclear Information System (INIS)
Milisavljevic, Dan; Soderberg, Alicia M.; Margutti, Raffaella; Drout, Maria R.; Marion, G. Howie; Sanders, Nathan E.; Lunnan, Ragnhild; Chornock, Ryan; Berger, Edo; Foley, Ryan J.; Challis, Pete; Kirshner, Robert P.; Dittmann, Jason; Bieryla, Allyson; Kamble, Atish; Chakraborti, Sayan; Hsiao, Eric Y.; Fesen, Robert A.; Parrent, Jerod T.; Levesque, Emily M.
2013-01-01
We present optical and near-infrared observations of SN 2012au, a slow-evolving supernova (SN) with properties that suggest a link between subsets of energetic and H-poor SNe and superluminous SNe. SN 2012au exhibited conspicuous Type-Ib-like He I lines and other absorption features at velocities reaching ≈2 × 10 4 km s –1 in its early spectra, and a broad light curve that peaked at M B = –18.1 mag. Models of these data indicate a large explosion kinetic energy of ∼10 52 erg and 56 Ni mass ejection of M Ni ≈ 0.3 M ☉ on par with SN 1998bw. SN 2012au's spectra almost one year after explosion show a blend of persistent Fe II P-Cyg absorptions and nebular emissions originating from two distinct velocity regions. These late-time emissions include strong [Fe II], [Ca II], [O I], Mg I], and Na I lines at velocities ∼> 4500 km s –1 , as well as O I and Mg I lines at noticeably smaller velocities ∼ –1 . Many of the late-time properties of SN 2012au are similar to the slow-evolving hypernovae SN 1997dq and SN 1997ef, and the superluminous SN 2007bi. Our observations suggest that a single explosion mechanism may unify all of these events that span –21 ∼ B ∼< –17 mag. The aspherical and possibly jetted explosion was most likely initiated by the core collapse of a massive progenitor star and created substantial high-density, low-velocity Ni-rich material.
Botticella, M. T.; Cappellaro, E.; Riello, M.; Greggio, L.; Benetti, S.; Patat, F.; Turatto, M.; Altavilla, G.; Pastorello, A.; Valenti, S.; Zampieri, L.; Harutyunyan, A.; Pignata, G.; Taubenberger, S.
2008-12-01
The rate of occurrence of supernovae (SNe) is linked to some of the basic ingredients of galaxy evolution, such as the star formation rate, the chemical enrichment and feedback processes. SN rates at intermediate redshift and their dependence on specific galaxy properties have been investigated in the Southern inTermediate Redshift ESO Supernova Search (STRESS). The rate of core collapse SNe (CC SNe) at a redshift of around 0.25 is found to be a factor two higher than the local value, whereas the SNe Ia rate remains almost constant. SN rates in red and blue galaxies were also measured and it was found that the SNe Ia rate seems to be constant in galaxies of different colour, whereas the CC SN rate seems to peak in blue galaxies, as in the local Universe.
Jerkstrand, A.; Ergon, M.; Smartt, S. J.; Fransson, C.; Sollerman, J.; Taubenberger, S.; Bersten, M.; Spyromilio, J.
2015-01-01
We investigate line formation processes in Type IIb supernovae (SNe) from 100 to 500 days post-explosion using spectral synthesis calculations. The modelling identifies the nuclear burning layers and physical mechanisms that produce the major emission lines, and the diagnostic potential of these. We compare the model calculations with data on the three best observed Type IIb SNe to-date - SN 1993J, SN 2008ax, and SN 2011dh. Oxygen nucleosynthesis depends sensitively on the main-sequence mass of the star and modelling of the [O I] λλ6300, 6364 lines constrains the progenitors of these three SNe to the MZAMS = 12-16 M⊙ range (ejected oxygen masses 0.3-0.9 M⊙), with SN 2011dh towards the lower end and SN 1993J towards the upper end of the range. The high ejecta masses from MZAMS ≳ 17 M⊙ progenitors give rise to brighter nebular phase emission lines than observed. Nucleosynthesis analysis thus supports a scenario of low-to-moderate mass progenitors for Type IIb SNe, and by implication an origin in binary systems. We demonstrate how oxygen and magnesium recombination lines may be combined to diagnose the magnesium mass in the SN ejecta. For SN 2011dh, a magnesium mass of 0.02-0.14 M⊙ is derived, which gives a Mg/O production ratio consistent with the solar value. Nitrogen left in the He envelope from CNO burning gives strong [N II] λλ6548, 6583 emission lines that dominate over Hα emission in our models. The hydrogen envelopes of Type IIb SNe are too small and dilute to produce any noticeable Hα emission or absorption after ~150 days, and nebular phase emission seen around 6550 Å is in many cases likely caused by [N II] λλ6548, 6583. Finally, the influence of radiative transport on the emergent line profiles is investigated. Significant line blocking in the metal core remains for several hundred days, which affects the emergent spectrum. These radiative transfer effects lead to early-time blueshifts of the emission line peaks, which gradually
Supernova light-curve fitters and dark energy
Energy Technology Data Exchange (ETDEWEB)
Bengochea, Gabriel R., E-mail: gabriel@iafe.uba.a [Instituto de Astronomia y Fisica del Espacio (IAFE), CC 67, Suc. 28, 1428 Buenos Aires (Argentina)
2011-01-24
We show that when a procedure is made to remove the tension between a supernova Ia (SN Ia) data set and observations from BAO and CMB, there might be the case where the same SN Ia set built with two different light-curve fitters behaves as two separate and distinct supernova sets, and the tension found by some authors between supernova sets actually could be due to tension or inconsistency between fitters. We also show that the information of the fitter used in an SN Ia data set could be relevant to determine whether phantom type models are favored or not when such a set is combined with the BAO/CMB joint parameter.
Supernova light-curve fitters and dark energy
International Nuclear Information System (INIS)
Bengochea, Gabriel R.
2011-01-01
We show that when a procedure is made to remove the tension between a supernova Ia (SN Ia) data set and observations from BAO and CMB, there might be the case where the same SN Ia set built with two different light-curve fitters behaves as two separate and distinct supernova sets, and the tension found by some authors between supernova sets actually could be due to tension or inconsistency between fitters. We also show that the information of the fitter used in an SN Ia data set could be relevant to determine whether phantom type models are favored or not when such a set is combined with the BAO/CMB joint parameter.
Estimating dust distances to Type Ia supernovae from colour excess time evolution
Bulla, M.; Goobar, A.; Amanullah, R.; Feindt, U.; Ferretti, R.
2018-01-01
We present a new technique to infer dust locations towards reddened Type Ia supernovae and to help discriminate between an interstellar and a circumstellar origin for the observed extinction. Using Monte Carlo simulations, we show that the time evolution of the light-curve shape and especially of the colour excess E(B - V) places strong constraints on the distance between dust and the supernova. We apply our approach to two highly reddened Type Ia supernovae for which dust distance estimates are available in the literature: SN 2006X and SN 2014J. For the former, we obtain a time-variable E(B - V) and from this derive a distance of 27.5^{+9.0}_{-4.9} or 22.1^{+6.0}_{-3.8} pc depending on whether dust properties typical of the Large Magellanic Cloud (LMC) or the Milky Way (MW) are used. For the latter, instead, we obtain a constant E(B - V) consistent with dust at distances larger than ∼50 and 38 pc for LMC- and MW-type dust, respectively. Values thus extracted are in excellent agreement with previous estimates for the two supernovae. Our findings suggest that dust responsible for the extinction towards these supernovae is likely to be located within interstellar clouds. We also discuss how other properties of reddened Type Ia supernovae - such as their peculiar extinction and polarization behaviour and the detection of variable, blue-shifted sodium features in some of these events - might be compatible with dust and gas at interstellar-scale distances.
Soft x-ray emission from the Lupus Loop and SN 1006 supernova remnants
International Nuclear Information System (INIS)
Winkler, P.F. Jr.; Hearn, D.R.; Richardson, J.A.; Behnken, J.M.
1979-01-01
X-ray maps of the Lupus region have been obtained in a raster scan observation from SAS 3. These show the Lupus Loop to be a faint, extended source of soft x-rays with a temperature about 2.5 x 10 6 K. The most prominent feature of the region is the A.D. 1006 supernova remnant, which is unexpectedly bright at 0.2--1.0 keV. One speculative interpretation of the low-energy flux from SN 1006 is as blackbody radiation from a hot neutron star
SUPERNOVA 1987A: A TEMPLATE TO LINK SUPERNOVAE TO THEIR REMNANTS
Energy Technology Data Exchange (ETDEWEB)
Orlando, S.; Miceli, M.; Pumo, M. L.; Bocchino, F., E-mail: orlando@astropa.inaf.it [INAF—Osservatorio Astronomico di Palermo “G.S. Vaiana”, Piazza del Parlamento 1, I-90134 Palermo (Italy)
2015-09-10
The emission of supernova remnants (SNRs) reflects the properties of both the progenitor supernovae (SNe) and the surrounding environment. The complex morphology of the remnants, however, hampers the disentanglement of the two contributions. Here, we aim at identifying the imprint of SN 1987A on the X-ray emission of its remnant and at constraining the structure of the environment surrounding the SN. We performed high-resolution hydrodynamic simulations describing SN 1987A soon after the core-collapse and the following three-dimensional expansion of its remnant between days 1 and 15,000 after the SN. We demonstrated that the physical model reproducing the main observables of SN 1987A during the first 250 days of evolution also reproduces the X-ray emission of the subsequent expanding remnant, thus bridging the gap between SNe and SNRs. By comparing model results with observations, we constrained the explosion energy in the range 1.2–1.4 × 10{sup 51} erg and the envelope mass in the range 15–17 M{sub ⊙}. We found that the shape of X-ray lightcurves and spectra at early epochs (<15 years) reflects the structure of outer ejecta: our model reproduces the observations if the outermost ejecta have a post-explosion radial profile of density approximated by a power law with index α = −8. At later epochs, the shapes of X-ray lightcurves and spectra reflect the density structure of the nebula around SN 1987A. This enabled us to ascertain the origin of the multi-thermal X-ray emission, disentangle the imprint of the SN on the remnant emission from the effects of the remnant interaction with the environment, and constrain the pre-supernova structure of the nebula.
SN 2015as: a low-luminosity Type IIb supernova without an early light-curve peak
Gangopadhyay, Anjasha; Misra, Kuntal; Pastorello, A.; Sahu, D. K.; Tomasella, L.; Tartaglia, L.; Singh, Mridweeka; Dastidar, Raya; Srivastav, S.; Ochner, P.; Brown, Peter J.; Anupama, G. C.; Benetti, S.; Cappellaro, E.; Kumar, Brajesh; Kumar, Brijesh; Pandey, S. B.
2018-05-01
We present results of the photometric (from 3 to 509 d post-explosion) and spectroscopic (up to 230 d post-explosion) monitoring campaign of the He-rich Type IIb supernova (SN) 2015as. The (B - V) colour evolution of SN 2015as closely resemble those of SN 2008ax, suggesting that SN 2015as belongs to the SN IIb subgroup that does not show the early, short-duration photometric peak. The light curve of SN 2015as reaches the B-band maximum about 22 d after the explosion, at an absolute magnitude of -16.82 ± 0.18 mag. At ˜75 d after the explosion, its spectrum transitions from that of a SN II to a SN Ib. P Cygni features due to He I lines appear at around 30 d after explosion, indicating that the progenitor of SN 2015as was partially stripped. For SN 2015as, we estimate a 56Ni mass of ˜0.08 M⊙ and ejecta mass of 1.1-2.2 M⊙, which are similar to the values inferred for SN 2008ax. The quasi-bolometric analytical light-curve modelling suggests that the progenitor of SN 2015as has a modest mass (˜0.1 M⊙), a nearly compact (˜0.05 × 1013 cm) H envelope on top of a dense, compact (˜2 × 1011 cm) and a more massive (˜1.2 M⊙) He core. The analysis of the nebular phase spectra indicates that ˜0.44 M⊙ of O is ejected in the explosion. The intensity ratio of the [Ca II]/[O I] nebular lines favours either a main-sequence progenitor mass of ˜15 M⊙ or a Wolf-Rayet star of 20 M⊙.
Supernova models with slow energy pumping and galactic supernova remnants
International Nuclear Information System (INIS)
Utrobin, V.P.
1978-01-01
The study of supernova (SN) models with slow energy pumping is continued. At maximum luminosity the main characteristics of a SN are shown to be independent of the initial structure of the model. However, they depend on the mass Msub(e) of the envelope, and on the intensity of energy pumping Lsub(epsilon), with an increase of Msub(e) leading qualitatively to the same changes in the SN parameters as a decrease in Lsub(epsilon). A simple relationship connecting the important SN parameters is obtained. From the inflection of the color index B-V curve, the possibility of deriving the characteristic time of energy pumping with intensity Lsub(epsilon) approximately 10 44 erg s -1 is pointed out. The comparison of the extragalactic type I SN observations with the results of calculations leads to the estimate of Msub(e) approximately 0.3-0.7 solar masses. An investigation of the galactic type I SN remnants is carried out. The estimate of Msub(e) approximately 0.2-0.3 solar masses is obtained for the remnants of supernovae SN 1006, SN 1572, and SN 1604. It completely fits the results for the extragalactic type I SNs. The total initial mass of SN 1604 presupernova was shown to be at least about 7 solar masses. It was established that the Crab nebula resulted from the outburst of a peculiar SN. The unique properties of such SNs, including SN 1054, are due to the low intensity of energy pumping (Lsub(epsilon) approximately 10 42 erg s -1 ). The mass of the envelope of the Crab nebula is evaluated to be Msub(e) approximately 0.7 solar masses. (Auth.)
SN 2012au: A GOLDEN LINK BETWEEN SUPERLUMINOUS SUPERNOVAE AND THEIR LOWER-LUMINOSITY COUNTERPARTS
Energy Technology Data Exchange (ETDEWEB)
Milisavljevic, Dan; Soderberg, Alicia M.; Margutti, Raffaella; Drout, Maria R.; Marion, G. Howie; Sanders, Nathan E.; Lunnan, Ragnhild; Chornock, Ryan; Berger, Edo; Foley, Ryan J.; Challis, Pete; Kirshner, Robert P.; Dittmann, Jason; Bieryla, Allyson; Kamble, Atish; Chakraborti, Sayan [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Hsiao, Eric Y. [Carnegie Observatories, Las Campanas Observatory, Colina El Pino, Casilla 601 (Chile); Fesen, Robert A.; Parrent, Jerod T. [6127 Wilder Lab, Department of Physics and Astronomy, Dartmouth College, Hanover, NH 03755 (United States); Levesque, Emily M., E-mail: dmilisav@cfa.harvard.edu [CASA, Department of Astrophysical and Planetary Sciences, University of Colorado, 389-UCB, Boulder, CO 80309 (United States); and others
2013-06-20
We present optical and near-infrared observations of SN 2012au, a slow-evolving supernova (SN) with properties that suggest a link between subsets of energetic and H-poor SNe and superluminous SNe. SN 2012au exhibited conspicuous Type-Ib-like He I lines and other absorption features at velocities reaching Almost-Equal-To 2 Multiplication-Sign 10{sup 4} km s{sup -1} in its early spectra, and a broad light curve that peaked at M{sub B} = -18.1 mag. Models of these data indicate a large explosion kinetic energy of {approx}10{sup 52} erg and {sup 56}Ni mass ejection of M{sub Ni} Almost-Equal-To 0.3 M{sub Sun} on par with SN 1998bw. SN 2012au's spectra almost one year after explosion show a blend of persistent Fe II P-Cyg absorptions and nebular emissions originating from two distinct velocity regions. These late-time emissions include strong [Fe II], [Ca II], [O I], Mg I], and Na I lines at velocities {approx}> 4500 km s{sup -1}, as well as O I and Mg I lines at noticeably smaller velocities {approx}< 2000 km s{sup -1}. Many of the late-time properties of SN 2012au are similar to the slow-evolving hypernovae SN 1997dq and SN 1997ef, and the superluminous SN 2007bi. Our observations suggest that a single explosion mechanism may unify all of these events that span -21 {approx}< M{sub B} {approx}< -17 mag. The aspherical and possibly jetted explosion was most likely initiated by the core collapse of a massive progenitor star and created substantial high-density, low-velocity Ni-rich material.
Nucleosynthesis and hydrodynamic instabilities in core collapse supernovae
International Nuclear Information System (INIS)
Kifonidis, K.
2001-01-01
Hydrodynamic instabilities are of crucial importance for the explosion of massive stars as core collapse supernovae, for the synthesis of the heavy elements, and for their injection into the interstellar medium. The processes hereby involved are studied by means of two-dimensional hydrodynamic simulations which follow all phases from shock revival to shock breakout through the photosphere of a massive star. The computed distributions of radioactive elements are compared to observational data of SN 1987 A and other supernovae. While we find good agreement of our models with observations of Type Ib supernovae, the high velocities of iron group elements observed in SN 1987 A cannot be reproduced. Possible reasons for this discrepancy are discussed. Hydrodynamic instabilities are of crucial importance for the explosion of massive stars as core collapse supernovae, for the synthesis of the heavy elements, and for their injection into the interstellar medium. The processes hereby involved are studied by means of two-dimensional hydrodynamic simulations which follow all phases from shock revival to shock breakout through the photosphere of a massive star. The computed distributions of radioactive elements are compared to observational data of SN 1987 A and other supernovae. While we find good agreement of our models with observations of Type Ib supernovae, the high velocities of iron group elements observed in SN 1987 A cannot be reproduced. Possible reasons for this discrepancy are discussed
Multi-dimensional simulations of the expanding supernova remnant of SN 1987A
Energy Technology Data Exchange (ETDEWEB)
Potter, T. M.; Staveley-Smith, L. [International center for Radio Astronomy Research (ICRAR) M468, The University of Western Australia, 35 Stirling Highway, Crawley, WA 6009 (Australia); Reville, B. [Center for Plasma Physics, Queen' s University Belfast, University Road, Belfast BT7 1NN (United Kingdom); Ng, C.-Y. [Department of Physics, The University of Hong Kong, Pokfulam Road (Hong Kong); Bicknell, G. V.; Sutherland, R. S. [Research School of Astronomy and Astrophysics, Australian National University, Canberra, ACT 0200 (Australia); Wagner, A. Y., E-mail: tobympotter@gmail.com [Center for Computational Sciences, Tsukuba University, Tsukuba, Ibaraki, 305-8577 (Japan)
2014-10-20
The expanding remnant from SN 1987A is an excellent laboratory for investigating the physics of supernovae explosions. There is still a large number of outstanding questions, such as the reason for the asymmetric radio morphology, the structure of the pre-supernova environment, and the efficiency of particle acceleration at the supernova shock. We explore these questions using three-dimensional simulations of the expanding remnant between days 820 and 10,000 after the supernova. We combine a hydrodynamical simulation with semi-analytic treatments of diffusive shock acceleration and magnetic field amplification to derive radio emission as part of an inverse problem. Simulations show that an asymmetric explosion, combined with magnetic field amplification at the expanding shock, is able to replicate the persistent one-sided radio morphology of the remnant. We use an asymmetric Truelove and McKee progenitor with an envelope mass of 10 M {sub ☉} and an energy of 1.5 × 10{sup 44} J. A termination shock in the progenitor's stellar wind at a distance of 0.''43-0.''51 provides a good fit to the turn on of radio emission around day 1200. For the H II region, a minimum distance of 0.''63 ± 0.''01 and maximum particle number density of (7.11 ± 1.78) × 10{sup 7} m{sup –3} produces a good fit to the evolving average radius and velocity of the expanding shocks from day 2000 to day 7000 after explosion. The model predicts a noticeable reduction, and possibly a temporary reversal, in the asymmetric radio morphology of the remnant after day 7000, when the forward shock left the eastern lobe of the equatorial ring.
RADIO EMISSION FROM SN 1994I IN NGC 5194 (M 51): THE BEST-STUDIED TYPE Ib/c RADIO SUPERNOVA
International Nuclear Information System (INIS)
Weiler, Kurt W.; Panagia, Nino; Stockdale, Christopher; Rupen, Michael; Sramek, Richard A.; Williams, Christopher L.
2011-01-01
We present the results of detailed monitoring of the radio emission from the Type Ic supernova SN 1994I from three days after optical discovery on 1994 March 31 until eight years later at age 2927 days on 2002 April 5. The data were mainly obtained using the Very Large Array at the five wavelengths of λλ1.3, 2.0, 3.6, 6.2, and 21 cm and from the Cambridge 5 km Ryle Telescope at λ2.0 cm. Two additional measurements were obtained at millimeter wavelengths. This data set represents the most complete, multifrequency radio observations ever obtained for a Type Ib/c supernova. The radio emission evolves regularly in both time and frequency and is well described by established supernova emission/absorption models. It is the first radio supernova with sufficient data to show that it is clearly dominated by the effects of synchrotron self-absorption at early times.
TYPE IIb SUPERNOVAE WITH COMPACT AND EXTENDED PROGENITORS
International Nuclear Information System (INIS)
Chevalier, Roger A.; Soderberg, Alicia M.
2010-01-01
The classic example of a Type IIb supernova is SN 1993J, which had a cool extended progenitor surrounded by a dense wind. There is evidence for another category of Type IIb supernova that has a more compact progenitor with a lower density, probably fast, wind. Distinguishing features of the compact category are weak optical emission from the shock heated envelope at early times, nonexistent or very weak H emission in the late nebular phase, rapidly evolving radio emission, rapid expansion of the radio shell, and expected nonthermal as opposed to thermal X-ray emission. Type IIb supernovae that have one or more of these features include SNe 1996cb, 2001ig, 2003bg, 2008ax, and 2008bo. All of these with sufficient radio data (the last four) show evidence for presupernova wind variability. We estimate a progenitor envelope radius ∼1 x 10 11 cm for SN 2008ax, a value consistent with a compact Wolf-Rayet progenitor. Supernovae in the SN 1993J extended category include SN 2001gd and probably the Cas A supernova. We suggest that the compact Type IIb events be designated Type cIIb and the extended ones Type eIIb. The H envelope mass dividing these categories is ∼0.1 M sun .
HOST GALAXIES OF TYPE Ia SUPERNOVAE FROM THE NEARBY SUPERNOVA FACTORY
International Nuclear Information System (INIS)
Childress, M.; Aldering, G.; Aragon, C.; Bailey, S.; Fakhouri, H. K.; Hsiao, E. Y.; Kim, A. G.; Loken, S.; Antilogus, P.; Bongard, S.; Canto, A.; Cellier-Holzem, F.; Guy, J.; Baltay, C.; Buton, C.; Kerschhaggl, M.; Kowalski, M.; Chotard, N.; Copin, Y.; Gangler, E.
2013-01-01
We present photometric and spectroscopic observations of galaxies hosting Type Ia supernovae (SNe Ia) observed by the Nearby Supernova Factory. Combining Galaxy Evolution Explorer (GALEX) UV data with optical and near-infrared photometry, we employ stellar population synthesis techniques to measure SN Ia host galaxy stellar masses, star formation rates (SFRs), and reddening due to dust. We reinforce the key role of GALEX UV data in deriving accurate estimates of galaxy SFRs and dust extinction. Optical spectra of SN Ia host galaxies are fitted simultaneously for their stellar continua and emission lines fluxes, from which we derive high-precision redshifts, gas-phase metallicities, and Hα-based SFRs. With these data we show that SN Ia host galaxies present tight agreement with the fiducial galaxy mass-metallicity relation from Sloan Digital Sky Survey (SDSS) for stellar masses log(M * /M ☉ ) > 8.5 where the relation is well defined. The star formation activity of SN Ia host galaxies is consistent with a sample of comparable SDSS field galaxies, though this comparison is limited by systematic uncertainties in SFR measurements. Our analysis indicates that SN Ia host galaxies are, on average, typical representatives of normal field galaxies.
SN 2014J at M82 - I. A middle-class Type Ia supernova by all spectroscopic metrics
Galbany, L.; Moreno-Raya, M. E.; Ruiz-Lapuente, P.; González Hernández, J. I.; Méndez, J.; Vallely, P.; Baron, E.; Domínguez, I.; Hamuy, M.; López-Sánchez, A. R.; Mollá, M.; Catalán, S.; Cooke, E. A.; Fariña, C.; Génova-Santos, R.; Karjalainen, R.; Lietzen, H.; McCormac, J.; Riddick, F. C.; Rubiño-Martín, J. A.; Skillen, I.; Tudor, V.; Vaduvescu, O.
2016-03-01
We present the intensive spectroscopic follow up of the Type Ia supernova (SN Ia) 2014J in the starburst galaxy M82. Twenty-seven optical spectra have been acquired from 2014 January 22 to September 1 with the Isaac Newton and William Herschel Telescopes. After correcting the observations for the recession velocity of M82 and for Milky Way and host galaxy extinction, we measured expansion velocities from spectral line blueshifts and pseudo-equivalent width of the strongest features in the spectra, which gives an idea on how elements are distributed within the ejecta. We position SN 2014J in the Benetti, Branch et al. and Wang et al. diagrams. These diagrams are based on properties of the Si II features and provide dynamical and chemical information about the SN ejecta. The nearby SN 2011fe, which showed little evidence for reddening in its host galaxy, is shown as a reference for comparisons. SN 2014J is a border-line object between the Core-normal and Broad-line groups, which corresponds to an intermediate position between low-velocity gradient and high-velocity gradient objects. SN 2014J follows the R(Si II)-Δm15 correlation, which confirms its classification as a relatively normal SN Ia. Our description of the SN Ia in terms of the evolution of the pseudo-equivalent width of various ions as well as the position in the various diagrams put this specific SN Ia into the overall sample of SN Ia.
Energy Technology Data Exchange (ETDEWEB)
Nicholl, M.; Berger, E.; Blanchard, P. K.; Challis, P.; Cowperthwaite, P. S. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Margutti, R. [Center for Cosmology and Particle Physics, New York University, 4 Washington Place, New York, NY 10003 (United States); Chornock, R. [Astrophysical Institute, Department of Physics and Astronomy, 251B Clippinger Lab, Ohio University, Athens, OH 45701 (United States); Jerkstrand, A.; Smartt, S. J.; Inserra, C.; Kankare, E.; Maguire, K. [Astrophysics Research Centre, School of Mathematics and Physics, Queens University Belfast, Belfast BT7 1NN (United Kingdom); Arcavi, I.; Hosseinzadeh, G.; Howell, D. A. [Las Cumbres Observatory Global Telescope, 6740 Cortona Drive, Suite 102, Goleta, CA 93111 (United States); Chambers, K. C.; Magnier, E. A. [Institute for Astronomy, University of Hawaii at Manoa, Honolulu, HI 96822 (United States); Chen, T.-W. [Max-Planck-Institut für Extraterrestrische Physik, Giessenbachstraße 1, D-85748, Garching (Germany); Gal-Yam, A. [Benoziyo Center for Astrophysics, Weizmann Institute of Science, Rehovot 76100 (Israel); Mazzali, P. A., E-mail: matt.nicholl@cfa.harvard.edu [Astrophysics Research Institute, Liverpool John Moores University, IC2, Liverpool Science Park, 146 Brownlow Hill, Liverpool L3 5RF (United Kingdom); and others
2016-09-10
We present nebular-phase imaging and spectroscopy for the hydrogen-poor superluminous supernova (SLSN) SN 2015bn, at redshift z = 0.1136, spanning +250–400 days after maximum light. The light curve exhibits a steepening in the decline rate from 1.4 mag (100 days){sup −1} to 1.7 mag (100 days){sup −1}, suggestive of a significant decrease in the opacity. This change is accompanied by a transition from a blue continuum superposed with photospheric absorption lines to a nebular spectrum dominated by emission lines of oxygen, calcium, and magnesium. There are no obvious signatures of circumstellar interaction or large {sup 56}Ni mass. We show that the spectrum at +400 days is virtually identical to a number of energetic SNe Ic such as SN 1997dq, SN 2012au, and SN 1998bw, indicating similar core conditions and strengthening the link between “hypernovae”/long gamma-ray bursts and SLSNe. A single explosion mechanism may unify these events that span absolute magnitudes of −22 < M {sub B} < −17. Both the light curve and spectrum of SN 2015bn are consistent with an engine-driven explosion ejecting 7–30 M {sub ⊙} of oxygen-dominated ejecta (for reasonable choices in temperature and opacity). A strong and relatively narrow O i λ 7774 line, seen in a number of these energetic events but not in normal supernovae, may point to an inner shell that is the signature of a central engine.
Energy Technology Data Exchange (ETDEWEB)
Dilday, Benjamin; /Rutgers U., Piscataway /Chicago U. /KICP, Chicago; Smith, Mathew; /Cape Town U., Dept. Math. /Portsmouth U.; Bassett, Bruce; /Cape Town U., Dept. Math. /South African Astron. Observ.; Becker, Andrew; /Washington U., Seattle, Astron. Dept.; Bender, Ralf; /Munich, Tech. U. /Munich U. Observ.; Castander, Francisco; /Barcelona, IEEC; Cinabro, David; /Wayne State U.; Filippenko, Alexei V.; /UC, Berkeley; Frieman, Joshua A.; /Chicago U. /Fermilab; Galbany, Lluis; /Barcelona, IFAE; Garnavich, Peter M.; /Notre Dame U. /Stockholm U., OKC /Stockholm U.
2010-01-01
We present a measurement of the volumetric Type Ia supernova (SN Ia) rate based on data from the Sloan Digital Sky Survey II (SDSS-II) Supernova Survey. The adopted sample of supernovae (SNe) includes 516 SNe Ia at redshift z {approx}< 0.3, of which 270 (52%) are spectroscopically identified as SNe Ia. The remaining 246 SNe Ia were identified through their light curves; 113 of these objects have spectroscopic redshifts from spectra of their host galaxy, and 133 have photometric redshifts estimated from the SN light curves. Based on consideration of 87 spectroscopically confirmed non-Ia SNe discovered by the SDSS-II SN Survey, we estimate that 2.04{sub -0.95}{sup +1.61}% of the photometric SNe Ia may be misidentified. The sample of SNe Ia used in this measurement represents an order of magnitude increase in the statistics for SN Ia rate measurements in the redshift range covered by the SDSS-II Supernova Survey. If we assume a SN Ia rate that is constant at low redshift (z < 0.15), then the SN observations can be used to infer a value of the SN rate of r{sub V} = (2.69{sub -0.30-0.01}{sup +0.34+0.21}) x 10{sup -5} SNe yr{sup -1} Mpc{sup -3} (H{sub 0}/(70 km s{sup -1} Mpc{sup -1})){sup 3} at a mean redshift of {approx} 0.12, based on 79 SNe Ia of which 72 are spectroscopically confirmed. However, the large sample of SNe Ia included in this study allows us to place constraints on the redshift dependence of the SN Ia rate based on the SDSS-II Supernova Survey data alone. Fitting a power-law model of the SN rate evolution, r{sub V} (z) = A{sub p} x ((1+z)/(1+z{sub 0})){sup {nu}}, over the redshift range 0.0 < z < 0.3 with z{sub 0} = 0.21, results in A{sub p} = (3.43{sub -0.15}{sup +0.15}) x 10{sup -5} SNe yr{sup -1} Mpc{sup -3} (H{sub 0}/(70 km s{sup -1} Mpc{sup -1})){sup 3} and {nu} = 2.04{sub -0.89}{sup +0.90}.
Energy Technology Data Exchange (ETDEWEB)
Milisavljevic, D.; Margutti, R.; Parrent, J. T.; Soderberg, A. M.; Sanders, N. E.; Kamble, A.; Chakraborti, S.; Drout, M. R.; Kirshner, R. P. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Fesen, R. A. [Department of Physics and Astronomy, Dartmouth College, 6127 Wilder Laboratory, Hanover, NH 03755 (United States); Mazzali, P. [Astrophysics Research Institute, Liverpool John Moores University, Liverpool L3 5RF (United Kingdom); Maeda, K. [Department of Astronomy, Kyoto University, Kitashirakawa-Oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Cenko, S. B. [Astrophysics Science Division, NASA Goddard Space Flight Center, Mail Code 661, Greenbelt, MD 20771 (United States); Silverman, J. M. [University of Texas at Austin, 1 University Station C1400, Austin, TX 78712-0259 (United States); Filippenko, A. V. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Pickering, T. E. [Southern African Large Telescope, P.O. Box 9, Observatory 7935, Cape Town (South Africa); Kawabata, K. [Hiroshima Astrophysical Science Center, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Hattori, T. [Subaru Telescope, National Astronomical Observatory of Japan, Hilo, HI 96720 (United States); Hsiao, E. Y. [Carnegie Observatories, Las Campanas Observatory, Colina El Pino, Casilla 601 (Chile); Stritzinger, M. D., E-mail: dmilisav@cfa.harvard.edu [Department of Physics and Astronomy, Aarhus University, Ny Munkegade, DK-8000 Aarhus C (Denmark); and others
2015-01-20
We present ultraviolet, optical, and near-infrared observations of SN 2012ap, a broad-lined Type Ic supernova in the galaxy NGC 1729 that produced a relativistic and rapidly decelerating outflow without a gamma-ray burst signature. Photometry and spectroscopy follow the flux evolution from –13 to +272 days past the B-band maximum of –17.4 ± 0.5 mag. The spectra are dominated by Fe II, O I, and Ca II absorption lines at ejecta velocities of v ≈ 20,000 km s{sup –1} that change slowly over time. Other spectral absorption lines are consistent with contributions from photospheric He I, and hydrogen may also be present at higher velocities (v ≳ 27,000 km s{sup –1}). We use these observations to estimate explosion properties and derive a total ejecta mass of ∼2.7 M {sub ☉}, a kinetic energy of ∼1.0 × 10{sup 52} erg, and a {sup 56}Ni mass of 0.1-0.2 M {sub ☉}. Nebular spectra (t > 200 days) exhibit an asymmetric double-peaked [O I] λλ6300, 6364 emission profile that we associate with absorption in the supernova interior, although toroidal ejecta geometry is an alternative explanation. SN 2012ap joins SN 2009bb as another exceptional supernova that shows evidence for a central engine (e.g., black hole accretion or magnetar) capable of launching a non-negligible portion of ejecta to relativistic velocities without a coincident gamma-ray burst detection. Defining attributes of their progenitor systems may be related to notable observed properties including environmental metallicities of Z ≳ Z {sub ☉}, moderate to high levels of host galaxy extinction (E(B – V) > 0.4 mag), detection of high-velocity helium at early epochs, and a high relative flux ratio of [Ca II]/[O I] >1 at nebular epochs. These events support the notion that jet activity at various energy scales may be present in a wide range of supernovae.
Milisavljevic, D.; Margutti, R.; Parrent, J. T.; Soderberg, A. M.; Fesen, R. A.; Mazzali, P.; Maeda, K.; Sanders, N. E.; Cenko, S. B.; Silverman, J. M.
2014-01-01
We present ultraviolet, optical, and near-infrared observations of SN2012ap, a broad-lined Type Ic supernova in the galaxy NGC 1729 that produced a relativistic and rapidly decelerating outflow without a gamma-ray burst signature. Photometry and spectroscopy follow the flux evolution from -13 to +272 days past the B-band maximum of -17.4 +/- 0.5 mag. The spectra are dominated by Fe II, O I, and Ca II absorption lines at ejecta velocities of v approx. 20,000 km s(exp. -1) that change slowly over time. Other spectral absorption lines are consistent with contributions from photospheric He I, and hydrogen may also be present at higher velocities (v approx. greater than 27,000 km s(exp. -1)). We use these observations to estimate explosion properties and derive a total ejecta mass of 2.7 Solar mass, a kinetic energy of 1.0×1052 erg, and a (56)Ni mass of 0.1-0.2 Solar mass. Nebular spectra (t > 200 d) exhibit an asymmetric double-peaked [O I] lambda lambda 6300, 6364 emission profile that we associate with absorption in the supernova interior, although toroidal ejecta geometry is an alternative explanation. SN2012ap joins SN2009bb as another exceptional supernova that shows evidence for a central engine (e.g., black-hole accretion or magnetar) capable of launching a non-negligible portion of ejecta to relativistic velocities without a coincident gamma-ray burst detection. Defining attributes of their progenitor systems may be related to notable properties including above-average environmental metallicities of Z approx. greater than Solar Z, moderate to high levels of host-galaxy extinction (E(B -V ) > 0.4 mag), detection of high-velocity helium at early epochs, and a high relative flux ratio of [Ca II]/[O I] > 1 at nebular epochs. These events support the notion that jet activity at various energy scales may be present in a wide range of supernovae.
Gravitational collapse and supernovae
International Nuclear Information System (INIS)
Lattimer, J.M.
1989-01-01
The collapse of the core of a massive star and the subsequent birth of a neutron star in a supernova explosion are discussed, and a model of the supernova mechanism is developed. The basic theory is then compared with the particular case of SN1987A, whose emitted neutrinos permitted the first direct test of the model. (author)
International Nuclear Information System (INIS)
Anon.
1990-01-01
In the first part of his in-depth article on the 1987 supernova, David Schramm of the University of Chicago and the NASA/Fermilab Astrophysics Centre reviewed the background to supernovae, the composition of massive stars and the optical history of SN 1987A, and speculated on what the 1987 remnant might be. In such a Type II supernova, gravitational pressure crushes the atoms of the star's interior producing neutron matter, or even a black hole, and releasing an intense burst of neutrinos. 1987 was the first time that physicists were equipped (but not entirely ready!) to intercept these particles, and in the second part of his article, David Schramm covers the remarkable new insights from the science of supernova neutrino astronomy, born on 23 February 1987
Stripped-envelope supernova SN 2004dk is now interacting with hydrogen-rich circumstellar material
Mauerhan, Jon C.; Filippenko, Alexei V.; Zheng, WeiKang; Brink, Thomas; Graham, Melissa L.; Shivvers, Isaac; Clubb, Kelsey
2018-05-01
The dominant mechanism and time scales over which stripped-envelope supernovae (SNe) progenitor stars shed their hydrogen envelopes are uncertain. Observations of Type Ib and Ic SNe at late phases could reveal the optical signatures of interaction with distant circumstellar material (CSM) providing important clues on the origin of the necessary pre-SN mass loss. We report deep late-time optical spectroscopy of the Type Ib explosion SN 2004dk 4684 days (13 years) after discovery. We detect strong Hα emission with an intermediate line width of ˜400 km s-1 and luminosity ˜2.5 × 1039 erg s-1, signaling that the SN blast wave has caught up with the hydrogen-rich CSM lost by the progenitor system. The line luminosity is the highest ever reported for a SN at this late stage. Prominent emission features of He I, Fe, and Ca are also detected. The spectral characteristics are consistent with CSM energized by the forward shock, and resemble the late-time spectra of the persistently interacting Type IIn SNe 2005ip and 1988Z. We suggest that the onset of interaction with H-rich CSM was associated with a previously reported radio rebrightening at ˜1700 days. The data indicate that the mode of pre-SN mass loss was a relatively slow dense wind that persisted millennia before the SN, followed by a short-lived Wolf-Rayet phase that preceded core-collapse and created a cavity within an extended distribution of CSM. We also present new spectra of SNe 2014C, PTF11iqb, and 2009ip, all of which also exhibit continued interaction with extended CSM distributions.
Chiotellis, A.; Kosenko, D.; Schure, K.M.; Vink, J.; Kaastra, J.S.
2013-01-01
The well-established Type Ia remnant of Tycho's supernova (SN 1572) reveals discrepant ambient medium-density estimates based on either the measured dynamics or the X-ray emission properties. This discrepancy can potentially be solved by assuming that the supernova remnant (SNR) shock initially
Energy Technology Data Exchange (ETDEWEB)
Möller, A. [Research School of Astronomy and Astrophysics, Australian National University, Canberra, ACT 2611 (Australia); Ruhlmann-Kleider, V.; Leloup, C.; Neveu, J.; Palanque-Delabrouille, N.; Rich, J. [Irfu, SPP, CEA Saclay, F-91191 Gif sur Yvette Cedex (France); Carlberg, R. [Department of Astronomy and Astrophysics, University of Toronto, 50 St. George Street, Toronto, ON M5S 3H8 (Canada); Lidman, C. [Australian Astronomical Observatory, North Ryde, NSW 2113 (Australia); Pritchet, C., E-mail: anais.moller@anu.edu.au, E-mail: vanina.ruhlmann-kleider@cea.fr, E-mail: clement.leloup@cea.fr, E-mail: jneveu@lal.in2p3.fr, E-mail: nathalie.palanque-delabrouille@cea.fr, E-mail: james.rich@cea.fr, E-mail: raymond.carlberg@utoronto.ca, E-mail: chris.lidman@aao.gov.au, E-mail: pritchet@uvic.ca [Department of Physics and Astronomy, University of Victoria, P.O. Box 3055, Victoria, BC V8W 3P6 (Canada)
2016-12-01
In the era of large astronomical surveys, photometric classification of supernovae (SNe) has become an important research field due to limited spectroscopic resources for candidate follow-up and classification. In this work, we present a method to photometrically classify type Ia supernovae based on machine learning with redshifts that are derived from the SN light-curves. This method is implemented on real data from the SNLS deferred pipeline, a purely photometric pipeline that identifies SNe Ia at high-redshifts (0.2 < z < 1.1). Our method consists of two stages: feature extraction (obtaining the SN redshift from photometry and estimating light-curve shape parameters) and machine learning classification. We study the performance of different algorithms such as Random Forest and Boosted Decision Trees. We evaluate the performance using SN simulations and real data from the first 3 years of the Supernova Legacy Survey (SNLS), which contains large spectroscopically and photometrically classified type Ia samples. Using the Area Under the Curve (AUC) metric, where perfect classification is given by 1, we find that our best-performing classifier (Extreme Gradient Boosting Decision Tree) has an AUC of 0.98.We show that it is possible to obtain a large photometrically selected type Ia SN sample with an estimated contamination of less than 5%. When applied to data from the first three years of SNLS, we obtain 529 events. We investigate the differences between classifying simulated SNe, and real SN survey data. In particular, we find that applying a thorough set of selection cuts to the SN sample is essential for good classification. This work demonstrates for the first time the feasibility of machine learning classification in a high- z SN survey with application to real SN data.
International Nuclear Information System (INIS)
Möller, A.; Ruhlmann-Kleider, V.; Leloup, C.; Neveu, J.; Palanque-Delabrouille, N.; Rich, J.; Carlberg, R.; Lidman, C.; Pritchet, C.
2016-01-01
In the era of large astronomical surveys, photometric classification of supernovae (SNe) has become an important research field due to limited spectroscopic resources for candidate follow-up and classification. In this work, we present a method to photometrically classify type Ia supernovae based on machine learning with redshifts that are derived from the SN light-curves. This method is implemented on real data from the SNLS deferred pipeline, a purely photometric pipeline that identifies SNe Ia at high-redshifts (0.2 < z < 1.1). Our method consists of two stages: feature extraction (obtaining the SN redshift from photometry and estimating light-curve shape parameters) and machine learning classification. We study the performance of different algorithms such as Random Forest and Boosted Decision Trees. We evaluate the performance using SN simulations and real data from the first 3 years of the Supernova Legacy Survey (SNLS), which contains large spectroscopically and photometrically classified type Ia samples. Using the Area Under the Curve (AUC) metric, where perfect classification is given by 1, we find that our best-performing classifier (Extreme Gradient Boosting Decision Tree) has an AUC of 0.98.We show that it is possible to obtain a large photometrically selected type Ia SN sample with an estimated contamination of less than 5%. When applied to data from the first three years of SNLS, we obtain 529 events. We investigate the differences between classifying simulated SNe, and real SN survey data. In particular, we find that applying a thorough set of selection cuts to the SN sample is essential for good classification. This work demonstrates for the first time the feasibility of machine learning classification in a high- z SN survey with application to real SN data.
Huang, F.; Wang, X.-F.; Hosseinzadeh, G.; Brown, P. J.; Mo, J.; Zhang, J.-J.; Zhang, K.-C.; Zhang, T.-M.; Howell, D.-A.; Arcavi, I.; McCully, C.; Valenti, S.; Rui, L.-M.; Song, H.; Xiang, D.-F.; Li, W.-X.; Lin, H.; Wang, L.-F.
2018-04-01
We present extensive ultraviolet (UV) and optical photometry, as well as dense optical spectroscopy, for type II Plateau (IIP) supernova SN 2016X that exploded in the nearby (˜15 Mpc) spiral galaxy UGC 08041. The observations span the period from 2 to 180 d after the explosion; in particular, the Swift UV data probably captured the signature of shock breakout associated with the explosion of SN 2016X. It shows very strong UV emission during the first week after explosion, with a contribution of ˜20-30 per cent to the bolometric luminosity (versus ≲15 per cent for normal SNe IIP). Moreover, we found that this supernova has an unusually long rise time of about 12.6 ± 0.5 d in the R band (versus ˜7.0 d for typical SNe IIP). The optical light curves and spectral evolution are quite similar to the fast-declining type IIP object SN 2013ej, except that SN 2016X has a relatively brighter tail. Based on the evolution of photospheric temperature as inferred from the Swift data in the early phase, we derive that the progenitor of SN 2016X has a radius of about 930 ± 70 R⊙. This large-size star is expected to be a red supergiant star with an initial mass of ≳19-20 M⊙ based on the mass-radius relation of the Galactic red supergiants, and it represents one of the most largest and massive progenitors found for SNe IIP.
SN 2013ej IN M74: A LUMINOUS AND FAST-DECLINING TYPE II-P SUPERNOVA
International Nuclear Information System (INIS)
Huang, Fang; Wang, Xiaofeng; Chen, Juncheng; Mo, Jun; Zhao, Xulin; Zhang, Jujia; Brown, Peter J.; Zampieri, Luca; Pumo, Maria Letizia; Zhang, Tianmeng
2015-01-01
We present extensive ultraviolet, optical, and near-infrared observations of the Type IIP supernova (SN IIP) 2013ej in the nearby spiral galaxy M74. The multicolor light curves, spanning from ∼8–185 days after explosion, show that it has a higher peak luminosity (i.e., M V ∼ −17.83 mag at maximum light), a faster post-peak decline, and a shorter plateau phase (i.e., ∼50 days) compared to the normal Type IIP SN 1999em. The mass of 56 Ni is estimated as 0.02 ± 0.01 M ⊙ from the radioactive tail of the bolometric light curve. The spectral evolution of SN 2013ej is similar to that of SN 2004et and SN 2007od, but shows a larger expansion velocity (i.e., v Fe ii ∼ 4600 km s −1 at t ∼ 50 days) and broader line profiles. In the nebular phase, the emission of the Hα line displays a double-peak structure, perhaps due to the asymmetric distribution of 56 Ni produced in the explosion. With the constraints from the main observables such as bolometric light curve, expansion velocity, and photospheric temperature of SN 2013ej, we performed hydrodynamical simulations of the explosion parameters, yielding the total explosion energy as ∼0.7× 10 51 erg, the radius of the progenitor as ∼600 R ⊙ , and the ejected mass as ∼10.6 M ⊙ . These results suggest that SN 2013ej likely arose from a red supergiant with a mass of 12–13 M ⊙ immediately before the explosion
Host galaxy spectra and consequences for supernova typing from the SDSS SN survey
Energy Technology Data Exchange (ETDEWEB)
Olmstead, Matthew D.; Brown, Peter J.; Brownstein, Joel R.; Dawson, Kyle S. [Department of Physics and Astronomy, University of Utah, Salt Lake City, UT 84112 (United States); Sako, Masao; Gupta, Ravi R. [Department of Physics and Astronomy, University of Pennsylvania, 209 South 33rd Street, Philadelphia, PA 19104 (United States); Bassett, Bruce; Kunz, Martin [African Institute for Mathematical Sciences, 6 Melrose Road, Muizenberg, 7945 (South Africa); Bizyaev, Dmitry; Brinkmann, J.; Brewington, Howard; Ebelke, Garrett L. [Apache Point Observatory, P.O. Box 59, Sunspot, NM 88349 (United States); Campbell, Heather [Institute of Astronomy, Madingley Road, Cambridge CB4 0HA (United Kingdom); D' Andrea, Chris B.; Lampeitl, Hubert [Institute of Cosmology and Gravitation, Dennis Sciama Building, University of Portsmouth, Portsmouth, PO1 3FX (United Kingdom); Frieman, Joshua A. [Center for Particle Astrophysics, Fermi National Accelerator Laboratory, P.O. Box 500, Batavia, IL 60510 (United States); Galbany, Lluís [Institut de Física d' Altes Energies, Universitat Autònoma de Barcelona, E-08193 Bellaterra (Barcelona) (Spain); Garnavich, Peter [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Hlozek, Renee [Department of Astrophysics, Peyton Hall, 4 Ivy Lane, Princeton, NJ 08544 (United States); Jha, Saurabh W., E-mail: olmstead@physics.utah.edu [Department of Physics and Astronomy, Rutgers, the State University of New Jersey, 136 Frelinghuysen Road, Piscataway, NJ 08854 (United States); and others
2014-04-01
We present the spectroscopy from 5254 galaxies that hosted supernovae (SNe) or other transient events in the Sloan Digital Sky Survey II (SDSS-II). Obtained during SDSS-I, SDSS-II, and the Baryon Oscillation Spectroscopic Survey, this sample represents the largest systematic, unbiased, magnitude limited spectroscopic survey of SN host galaxies. Using the host galaxy redshifts, we test the impact of photometric SN classification based on SDSS imaging data with and without using spectroscopic redshifts of the host galaxies. Following our suggested scheme, there are a total of 1166 photometrically classified SNe Ia when using a flat redshift prior and 1126 SNe Ia when the host spectroscopic redshift is assumed. For 1024 (87.8%) candidates classified as likely SNe Ia without redshift information, we find that the classification is unchanged when adding the host galaxy redshift. Using photometry from SDSS imaging data and the host galaxy spectra, we also report host galaxy properties for use in future analysis of SN astrophysics. Finally, we investigate the differences in the interpretation of the light curve properties with and without knowledge of the redshift. Without host galaxy redshifts, we find that SALT2 light curve fits are systematically biased toward lower photometric redshift estimates and redder colors in the limit of low signal-to-noise data. The general improvements in performance of the light curve fitter and the increased diversity of the host galaxy sample highlights the importance of host galaxy spectroscopy for current photometric SN surveys such as the Dark Energy Survey and future surveys such as the Large Synoptic Survey Telescope.
SN 2017dio: A Type-Ic Supernova Exploding in a Hydrogen-rich Circumstellar Medium
Kuncarayakti, Hanindyo; Maeda, Keiichi; Ashall, Christopher J.; Prentice, Simon J.; Mattila, Seppo; Kankare, Erkki; Fransson, Claes; Lundqvist, Peter; Pastorello, Andrea; Leloudas, Giorgos; Anderson, Joseph P.; Benetti, Stefano; Bersten, Melina C.; Cappellaro, Enrico; Cartier, Régis; Denneau, Larry; Della Valle, Massimo; Elias-Rosa, Nancy; Folatelli, Gastón; Fraser, Morgan; Galbany, Lluís; Gall, Christa; Gal-Yam, Avishay; Gutiérrez, Claudia P.; Hamanowicz, Aleksandra; Heinze, Ari; Inserra, Cosimo; Kangas, Tuomas; Mazzali, Paolo; Melandri, Andrea; Pignata, Giuliano; Rest, Armin; Reynolds, Thomas; Roy, Rupak; Smartt, Stephen J.; Smith, Ken W.; Sollerman, Jesper; Somero, Auni; Stalder, Brian; Stritzinger, Maximilian; Taddia, Francesco; Tomasella, Lina; Tonry, John; Weiland, Henry; Young, David R.
2018-02-01
SN 2017dio shows both spectral characteristics of a type-Ic supernova (SN) and signs of a hydrogen-rich circumstellar medium (CSM). Prominent, narrow emission lines of H and He are superposed on the continuum. Subsequent evolution revealed that the SN ejecta are interacting with the CSM. The initial SN Ic identification was confirmed by removing the CSM interaction component from the spectrum and comparing with known SNe Ic and, reversely, adding a CSM interaction component to the spectra of known SNe Ic and comparing them to SN 2017dio. Excellent agreement was obtained with both procedures, reinforcing the SN Ic classification. The light curve constrains the pre-interaction SN Ic peak absolute magnitude to be around {M}g=-17.6 mag. No evidence of significant extinction is found, ruling out a brighter luminosity required by an SN Ia classification. These pieces of evidence support the view that SN 2017dio is an SN Ic, and therefore the first firm case of an SN Ic with signatures of hydrogen-rich CSM in the early spectrum. The CSM is unlikely to have been shaped by steady-state stellar winds. The mass loss of the progenitor star must have been intense, \\dot{M}∼ 0.02{({ε }{{H}α }/0.01)}-1 ({v}{wind}/500 km s‑1) ({v}{shock}/10,000 km s‑1)‑3 M ⊙ yr‑1, peaking at a few decades before the SN. Such a high mass-loss rate might have been experienced by the progenitor through eruptions or binary stripping. Based on observations made with the NOT, operated by the Nordic Optical Telescope Scientific Association at the Observatorio del Roque de los Muchachos, La Palma, Spain, of the Instituto de Astrofisica de Canarias. This work is based (in part) on observations collected at the European Organisation for Astronomical Research in the Southern Hemisphere, Chile as part of PESSTO, (the Public ESO Spectroscopic Survey for Transient Objects Survey) ESO program 188.D-3003, 191.D-0935, 197.D-1075. Based on observations made with the Liverpool Telescope operated on the
Interacting supernovae and supernova impostors
Tartaglia, Leonardo
2016-02-01
Massive stars are thought to end their lives with spectacular explosions triggered by the gravitational collapse of their cores. Interacting supernovae are generally attributed to supernova explosions occurring in dense circumstellar media, generated through mass-loss which characterisie the late phases of the life of their progenitors. In the last two decades, several observational evidences revealed that mass-loss in massive stars may be related to violent eruptions involving their outer layers, such as the luminous blue variables. Giant eruptions of extragalactic luminous blue variables, similar to that observed in Eta Car in the 19th century, are usually labelled 'SN impostors', since they mimic the behaviour of genuine SNe, but are not the final act of the life of the progenitor stars. The mechanisms producing these outbursts are still not understood, although the increasing number of observed cases triggered the efforts of the astronomical community to find possible theoretical interpretations. More recently, a number of observational evidences suggested that also lower-mass stars can experience pre-supernova outbursts, hence becoming supernova impostors. Even more interestingly, there is growing evidence of a connection among massive stars, their outbursts and interacting supernovae. All of this inspired this research, which has been focused in particular on the characterisation of supernova impostors and the observational criteria that may allow us to safely discriminate them from interacting supernovae. Moreover, the discovery of peculiar transients, motivated us to explore the lowest range of stellar masses that may experience violent outbursts. Finally, the quest for the link among massive stars, their giant eruptions and interacting supernovae, led us to study the interacting supernova LSQ13zm, which possibly exploded a very short time after an LBV-like major outburst.
HIGH RESOLUTION 36 GHz IMAGING OF THE SUPERNOVA REMNANT OF SN 1987A
International Nuclear Information System (INIS)
Potter, T. M.; Staveley-Smith, L.; Zanardo, G.; Ng, C.-Y.; Gaensler, B. M.; Ball, Lewis; Kesteven, M. J.; Manchester, R. N.; Tzioumis, A. K.
2009-01-01
The aftermath of supernova (SN) 1987A continues to provide spectacular insights into the interaction between an SN blastwave and its circumstellar environment. We here present 36 GHz observations from the Australia Telescope Compact Array of the radio remnant of SN 1987A. These new images, taken in 2008 April and 2008 October, substantially extend the frequency range of an ongoing monitoring and imaging program conducted between 1.4 and 20 GHz. Our 36.2 GHz images have a diffraction-limited angular resolution of 0.''3-0.''4, which covers the gap between high resolution, low dynamic range VLBI images of the remnant and low resolution, high dynamic range images at frequencies between 1 and 20 GHz. The radio morphology of the remnant at 36 GHz is an elliptical ring with enhanced emission on the eastern and western sides, similar to that seen previously at lower frequencies. Model fits to the data in the Fourier domain show that the emitting region is consistent with a thick inclined torus of mean radius 0.''85, and a 2008 October flux density of 27 ± 6 mJy at 36.2 GHz. The spectral index for the remnant at this epoch, determined between 1.4 GHz and 36.2 GHz, is α = -0.83. There is tentative evidence for an unresolved central source with flatter spectral index.
Gall, C.; Stritzinger, M. D.; Ashall, C.; Baron, E.; Burns, C. R.; Hoeflich, P.; Hsiao, E. Y.; Mazzali, P. A.; Phillips, M. M.; Filippenko, A. V.; Anderson, J. P.; Benetti, S.; Brown, P. J.; Campillay, A.; Challis, P.; Contreras, C.; Elias de la Rosa, N.; Folatelli, G.; Foley, R. J.; Fraser, M.; Holmbo, S.; Marion, G. H.; Morrell, N.; Pan, Y.-C.; Pignata, G.; Suntzeff, N. B.; Taddia, F.; Robledo, S. Torres; Valenti, S.
2018-03-01
We present an analysis of ultraviolet (UV) to near-infrared observations of the fast-declining Type Ia supernovae (SNe Ia) 2007on and 2011iv, hosted by the Fornax cluster member NGC 1404. The B-band light curves of SN 2007on and SN 2011iv are characterised by Δm15 (B) decline-rate values of 1.96 mag and 1.77 mag, respectively. Although they have similar decline rates, their peak B- and H-band magnitudes differ by 0.60 mag and 0.35 mag, respectively. After correcting for the luminosity vs. decline rate and the luminosity vs. colour relations, the peak B-band and H-band light curves provide distances that differ by 14% and 9%, respectively. These findings serve as a cautionary tale for the use of transitional SNe Ia located in early-type hosts in the quest to measure cosmological parameters. Interestingly, even though SN 2011iv is brighter and bluer at early times, by three weeks past maximum and extending over several months, its B - V colour is 0.12 mag redder than that of SN 2007on. To reconcile this unusual behaviour, we turn to guidance from a suite of spherical one-dimensional Chandrasekhar-mass delayed-detonation explosion models. In this context, 56Ni production depends on both the so-called transition density and the central density of the progenitor white dwarf. To first order, the transition density drives the luminosity-width relation, while the central density is an important second-order parameter. Within this context, the differences in the B - V colour evolution along the Lira regime suggest that the progenitor of SN 2011iv had a higher central density than SN 2007on. The photometry tables are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/611/A58
SN 2013ej IN M74: A LUMINOUS AND FAST-DECLINING TYPE II-P SUPERNOVA
Energy Technology Data Exchange (ETDEWEB)
Huang, Fang [Department of Astronomy, Beijing Normal University, Beijing 100875 (China); Wang, Xiaofeng; Chen, Juncheng; Mo, Jun; Zhao, Xulin [Physics Department and Tsinghua Center for Astrophysics, Tsinghua University, Beijing 100084 (China); Zhang, Jujia [Yunnan Observatories, Chinese Academy of Sciences, Kunming 650011 (China); Brown, Peter J. [George P. and Cynthia Woods Mitchell Institute for Fundamental Physics and Astronomy, Texas A. and M. University, Department of Physics and Astronomy, 4242 TAMU, College Station, TX 77843 (United States); Zampieri, Luca [INAF-Osservatorio Astronomico di Padova, Vicolo dell’Osservatorio 5, I-35122 Padova (Italy); Pumo, Maria Letizia [INAF-Osservatorio Astronomico di Palermo “Giuseppe S. Vaiana,” Piazza del Parlamento 1, I-90134 Palermo (Italy); Zhang, Tianmeng, E-mail: huangfang@mail.bnu.edu.cn, E-mail: wang_xf@mail.tsinghua.edu.cn [Key Laboratory of Optical Astronomy, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China)
2015-07-01
We present extensive ultraviolet, optical, and near-infrared observations of the Type IIP supernova (SN IIP) 2013ej in the nearby spiral galaxy M74. The multicolor light curves, spanning from ∼8–185 days after explosion, show that it has a higher peak luminosity (i.e., M{sub V} ∼ −17.83 mag at maximum light), a faster post-peak decline, and a shorter plateau phase (i.e., ∼50 days) compared to the normal Type IIP SN 1999em. The mass of {sup 56}Ni is estimated as 0.02 ± 0.01 M{sub ⊙} from the radioactive tail of the bolometric light curve. The spectral evolution of SN 2013ej is similar to that of SN 2004et and SN 2007od, but shows a larger expansion velocity (i.e., v{sub Fe} {sub ii} ∼ 4600 km s{sup −1} at t ∼ 50 days) and broader line profiles. In the nebular phase, the emission of the Hα line displays a double-peak structure, perhaps due to the asymmetric distribution of {sup 56}Ni produced in the explosion. With the constraints from the main observables such as bolometric light curve, expansion velocity, and photospheric temperature of SN 2013ej, we performed hydrodynamical simulations of the explosion parameters, yielding the total explosion energy as ∼0.7× 10{sup 51} erg, the radius of the progenitor as ∼600 R{sub ⊙}, and the ejected mass as ∼10.6 M{sub ⊙}. These results suggest that SN 2013ej likely arose from a red supergiant with a mass of 12–13 M{sub ⊙} immediately before the explosion.
The All-Sky Automated Survey for Supernovae (ASAS-SN) Light Curve Server v1.0
Kochanek, C. S.; Shappee, B. J.; Stanek, K. Z.; Holoien, T. W.-S.; Thompson, Todd A.; Prieto, J. L.; Dong, Subo; Shields, J. V.; Will, D.; Britt, C.; Perzanowski, D.; Pojmański, G.
2017-10-01
The All-Sky Automated Survey for Supernovae (ASAS-SN) is working toward imaging the entire visible sky every night to a depth of V˜ 17 mag. The present data covers the sky and spans ˜2-5 years with ˜100-400 epochs of observation. The data should contain some ˜1 million variable sources, and the ultimate goal is to have a database of these observations publicly accessible. We describe here a first step, a simple but unprecedented web interface https://asas-sn.osu.edu/ that provides an up to date aperture photometry light curve for any user-selected sky coordinate. The V band photometry is obtained using a two-pixel (16.″0) radius aperture and is calibrated against the APASS catalog. Because the light curves are produced in real time, this web tool is relatively slow and can only be used for small samples of objects. However, it also imposes no selection bias on the part of the ASAS-SN team, allowing the user to obtain a light curve for any point on the celestial sphere. We present the tool, describe its capabilities, limitations, and known issues, and provide a few illustrative examples.
Summary of George Mason University SN1987A workshop
International Nuclear Information System (INIS)
van den Bergh, S.
1990-01-01
The author summaries studies of SN 1987A. This discussion focuses on how theories of core collapse in supernovae have been confirmed by observations of neutrinos produced by SN1987A and observations of the exponential tail of the light curve of SN1987A give strong support to the prediction that this phase of supernova light curves is powered by 56 Co decay
SN 2016coi/ASASSN-16fp: An example of residual helium in a type Ic supernova?
Prentice, S. J.; Ashall, C.; Mazzali, P. A.; Zhang, J.-J.; James, P. A.; Wang, X.-F.; Vinkó, J.; Percival, S.; Short, L.; Piascik, A.; Huang, F.; Mo, J.; Rui, L.-M.; Wang, J.-G.; Xiang, D.-F.; Xin, Y.-X.; Yi, W.-M.; Yu, X.-G.; Zhai, Q.; Zhang, T.-M.; Hosseinzadeh, G.; Howell, D. A.; McCully, C.; Valenti, S.; Cseh, B.; Hanyecz, O.; Kriskovics, L.; Pál, A.; Sárneczky, K.; Sódor, Á.; Szakáts, R.; Székely, P.; Varga-Verebélyi, E.; Vida, K.; Bradac, M.; Reichart, D. E.; Sand, D.; Tartaglia, L.
2018-05-01
The optical observations of Ic-4 supernova (SN) 2016coi/ASASSN-16fp, from ˜2 to ˜450 days after explosion, are presented along with analysis of its physical properties. The SN shows the broad lines associated with SNe Ic-3/4 but with a key difference. The early spectra display a strong absorption feature at ˜5400 Åwhich is not seen in other SNe Ic-3/4 at this epoch. This feature has been attributed to HeIin the literature. Spectral modelling of the SN in the early photospheric phase suggests the presence of residual He in a C/O dominated shell. However, the behaviour of the HeIlines is unusual when compared with He-rich SNe, showing relatively low velocities and weakening rather than strengthening over time. The SN is found to rise to peak ˜16 d after core-collapse reaching a bolometric luminosity of Lp ˜ 3 × 1042 erg s-1. Spectral models, including the nebular epoch, show that the SN ejected 2.5 - 4 M⊙of material, with ˜1.5 M⊙below 5000 km s-1, and with a kinetic energy of (4.5 - 7) × 1051 erg. The explosion synthesised ˜0.14 M⊙of 56Ni. There are significant uncertainties in E(B - V)host and the distance however, which will affect Lp and MNi. SN 2016coi exploded in a host similar to the Large Magellanic Cloud (LMC) and away from star-forming regions. The properties of the SN and the host-galaxy suggest that the progenitor had MZAMS of 23 - 28 M⊙and was stripped almost entirely down to its C/O core at explosion.
Rates and progenitors of type Ia supernovae
Energy Technology Data Exchange (ETDEWEB)
Wood-Vasey, William Michael [Univ. of California, Berkeley, CA (United States)
2004-01-01
The remarkable uniformity of Type Ia supernovae has allowed astronomers to use them as distance indicators to measure the properties and expansion history of the Universe. However, Type Ia supernovae exhibit intrinsic variation in both their spectra and observed brightness. The brightness variations have been approximately corrected by various methods, but there remain intrinsic variations that limit the statistical power of current and future observations of distant supernovae for cosmological purposes. There may be systematic effects in this residual variation that evolve with redshift and thus limit the cosmological power of SN Ia luminosity-distance experiments. To reduce these systematic uncertainties, we need a deeper understanding of the observed variations in Type Ia supernovae. Toward this end, the Nearby Supernova Factory has been designed to discover hundreds of Type Ia supernovae in a systematic and automated fashion and study them in detail. This project will observe these supernovae spectrophotometrically to provide the homogeneous high-quality data set necessary to improve the understanding and calibration of these vital cosmological yardsticks. From 1998 to 2003, in collaboration with the Near-Earth Asteroid Tracking group at the Jet Propulsion Laboratory, a systematic and automated searching program was conceived and executed using the computing facilities at Lawrence Berkeley National Laboratory and the National Energy Research Supercomputing Center. An automated search had never been attempted on this scale. A number of planned future large supernovae projects are predicated on the ability to find supernovae quickly, reliably, and efficiently in large datasets. A prototype run of the SNfactory search pipeline conducted from 2002 to 2003 discovered 83 SNe at a final rate of 12 SNe/month. A large, homogeneous search of this scale offers an excellent opportunity to measure the rate of Type Ia supernovae. This thesis presents a new method for
Rates and progenitors of type Ia supernovae
International Nuclear Information System (INIS)
Wood-Vasey, William Michael
2004-01-01
The remarkable uniformity of Type Ia supernovae has allowed astronomers to use them as distance indicators to measure the properties and expansion history of the Universe. However, Type Ia supernovae exhibit intrinsic variation in both their spectra and observed brightness. The brightness variations have been approximately corrected by various methods, but there remain intrinsic variations that limit the statistical power of current and future observations of distant supernovae for cosmological purposes. There may be systematic effects in this residual variation that evolve with redshift and thus limit the cosmological power of SN Ia luminosity-distance experiments. To reduce these systematic uncertainties, we need a deeper understanding of the observed variations in Type Ia supernovae. Toward this end, the Nearby Supernova Factory has been designed to discover hundreds of Type Ia supernovae in a systematic and automated fashion and study them in detail. This project will observe these supernovae spectrophotometrically to provide the homogeneous high-quality data set necessary to improve the understanding and calibration of these vital cosmological yardsticks. From 1998 to 2003, in collaboration with the Near-Earth Asteroid Tracking group at the Jet Propulsion Laboratory, a systematic and automated searching program was conceived and executed using the computing facilities at Lawrence Berkeley National Laboratory and the National Energy Research Supercomputing Center. An automated search had never been attempted on this scale. A number of planned future large supernovae projects are predicated on the ability to find supernovae quickly, reliably, and efficiently in large datasets. A prototype run of the SNfactory search pipeline conducted from 2002 to 2003 discovered 83 SNe at a final rate of 12 SNe/month. A large, homogeneous search of this scale offers an excellent opportunity to measure the rate of Type Ia supernovae. This thesis presents a new method for
SN 2010ay IS A LUMINOUS AND BROAD-LINED TYPE Ic SUPERNOVA WITHIN A LOW-METALLICITY HOST GALAXY
Energy Technology Data Exchange (ETDEWEB)
Sanders, N. E.; Soderberg, A. M.; Foley, R. J.; Chornock, R.; Chomiuk, L.; Berger, E. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Valenti, S.; Smartt, S.; Botticella, M. T. [Astrophysics Research Centre, School of Maths and Physics, Queen' s University, Belfast BT7 1NN (United Kingdom); Hurley, K. [Space Sciences Laboratory, University of California Berkeley, 7 Gauss Way, Berkeley, CA 94720 (United States); Barthelmy, S. D.; Gehrels, N.; Cline, T. [NASA Goddard Space Flight Center, Code 661, Greenbelt, MD 20771 (United States); Levesque, E. M. [CASA, Department of Astrophysical and Planetary Sciences, University of Colorado, 389-UCB, Boulder, CO 80309 (United States); Narayan, G. [Department of Physics, Harvard University, Cambridge, MA 02138 (United States); Briggs, M. S.; Connaughton, V. [CSPAR, University of Alabama in Huntsville, Huntsville, AL (United States); Terada, Y. [Department of Physics, Saitama University, Shimo-Okubo, Sakura-ku, Saitama-shi, Saitama 338-8570 (Japan); Golenetskii, S.; Mazets, E., E-mail: nsanders@cfa.harvard.edu [Ioffe Physico-Technical Institute, Laboratory for Experimental Astrophysics, 26 Polytekhnicheskaya, St. Petersburg 194021 (Russian Federation); and others
2012-09-10
We report on our serendipitous pre-discovery detection and follow-up observations of the broad-lined Type Ic supernova (SN Ic) 2010ay at z = 0.067 imaged by the Pan-STARRS1 3{pi} survey just {approx}4 days after explosion. The supernova (SN) had a peak luminosity, M{sub R} Almost-Equal-To -20.2 mag, significantly more luminous than known GRB-SNe and one of the most luminous SNe Ib/c ever discovered. The absorption velocity of SN 2010ay is v{sub Si} Almost-Equal-To 19 Multiplication-Sign 10{sup 3} km s{sup -1} at {approx}40 days after explosion, 2-5 times higher than other broad-lined SNe and similar to the GRB-SN 2010bh at comparable epochs. Moreover, the velocity declines {approx}2 times slower than other SNe Ic-BL and GRB-SNe. Assuming that the optical emission is powered by radioactive decay, the peak magnitude implies the synthesis of an unusually large mass of {sup 56}Ni, M{sub Ni} = 0.9 M{sub Sun }. Applying scaling relations to the light curve, we estimate a total ejecta mass, M{sub ej} Almost-Equal-To 4.7 M{sub Sun }, and total kinetic energy, E{sub K} Almost-Equal-To 11 Multiplication-Sign 10{sup 51} erg. The ratio of M{sub Ni} to M{sub ej} is {approx}2 times as large for SN 2010ay as typical GRB-SNe and may suggest an additional energy reservoir. The metallicity (log (O/H){sub PP04} + 12 = 8.19) of the explosion site within the host galaxy places SN 2010ay in the low-metallicity regime populated by GRB-SNe, and {approx}0.5(0.2) dex lower than that typically measured for the host environments of normal (broad-lined) SNe Ic. We constrain any gamma-ray emission with E{sub {gamma}} {approx}< 6 Multiplication-Sign 10{sup 48} erg (25-150 keV), and our deep radio follow-up observations with the Expanded Very Large Array rule out relativistic ejecta with energy E {approx}> 10{sup 48} erg. We therefore rule out the association of a relativistic outflow like those that accompanied SN 1998bw and traditional long-duration gamma-ray bursts (GRBs), but we place less
A Moderate Redshift Supernova Search Program
Adams, M. T.; Wheeler, J. C.; Ward, M.; Wren, W. R.; Schmidt, B. P.
1995-12-01
We report on a recently initiated supernova (SN) search program using the McDonald Observatory 0.76m telescope and Prime Focus Camera (PFC). This SN search program takes advantage of the PFC's 42.6 x 42.6 arcmin FOV to survey moderate redshift Abell clusters in single Kron-Cousins R-band images. Our scientific goal is to discover and provide quality BVRI photometric follow-up, to R \\ +21, for a significant SNe sample at 0.03 group (Perlmutter et al 1995, ApJ, 440, L41), and the High Redshift SN Search Team (Schmidt et al 1995, Aiguiblava NATO ASI Proceedings). The McDonald SN search program includes a sample of the Abell clusters used by Lauer and Postman (1994, ApJ, 425, 418) to analyze Local Group motion. SNe discovered in these clusters contribute to the resolution of the Local Group motion controversy. We present an overview of the McDonald Observatory supernova search program, and discuss recent results.
International Nuclear Information System (INIS)
Tinsley, B.M.
1975-01-01
A variety of empirical lines of evidence is assembled on the masses and stellar population types of stars that trigger supernova (SN) explosions. The main theoretical motivations are to determine whether type I supernovae (SN I) can have massive precursors, and whether there is an interval of stellar mass, between the masses of precursors of pulsars and white dwarfs, that is disrupted by carbon detonation. Statistical and other uncertainties in the empirical arguments are given particular attention, and are found to be more important than generally realized. Relatively secure conclusions include the following. Statistics of stellar birthrates, SN, pulsars, and SN remnants in the Galaxy show that SN II (or all SN) could arise from stars with masses greater than M/sub s/ where M/sub s/ approximately 49 to 12 M solar mass; the precursor mass range cannot be more closely defined from present data; nor can it be said whether all SN leave pulsars and/or extended radio remnants. Several methods of estimating the masses of stars that become white dwarfs are consistent with a lower limit, M/sub s/ greater than or equal to 5 M solar mass, so carbon detonation may indeed be avoided, although this conclusion is not secure. Studies of the properties of galaxies in which SN occur, and their distributions within galaxies, support the usual views that SN I have low-mass precursors (less than or equal to 5 M solar mass and typically less than or equal to 1 M solar mass) and SN II have massive precursors (greater than or equal to 5 M solar mass); the restriction of known SN II to Sc and Sb galaxies, to date, is shown to be consistent, statistically, with massive stars in other galaxies also dying as SN II. Possible implications of the peculiarities of some SN-producing galaxies are discussed. Suggestions are made for observational and theoretical studies that would help answer important remaining questions on the nature of SN precursors
New measurement of the period for the 4th ULX pulsar - the supernova impostor SN2010da in NGC 300
Grebenev, S. A.; Mereminskiy, I. A.
2018-01-01
Following the discovery (Atel #11158) of the new (fourth) ULX pulsar (in the peculiar supergiant X-ray binary known as the supernova impostor SN 2010da located in NGC 300, at a distance of 1.86 Mpc) we note that SWIFT/XRT observed this galaxy again on April 16, 2017, and detected the source still in a bright X-ray state.
Nearby Type Ia Supernova Follow-up at the Thacher Observatory
Swift, Jonathan; O'Neill, Katie; Kilpatrick, Charles; Foley, Ryan
2018-06-01
Type Ia supernovae (SN Ia) provide an effective way to study the expansion of the universe through analyses of their photometry and spectroscopy. The interpretation of high-redshift SN Ia is dependent on accurate characterization of nearby, low-redshift targets. To help build up samples of nearby SN Ia, the Thacher Observatory has begun a photometric follow-up program in 4 photometric bands. Here we present the observations and analysis of multi-band photometry for several recent supernovae as well as FLOYDS spectra from the Las Cumbres Observatory.
A trio of gamma-ray burst supernovae
DEFF Research Database (Denmark)
Cano, Z.; Ugarte Postigo, Antonio de; Pozanenko, A.
2014-01-01
We present optical and near-infrared (NIR) photometry for three gamma-ray burst supernovae (GRB-SNe): GRB 120729A, GRB 130215A / SN 2013ez and GRB 130831A / SN 2013fu. In the case of GRB 130215A / SN 2013ez, we also present optical spectroscopy at t-t0=16.1 d, which covers rest-frame 3000...
SLOW-SPEED SUPERNOVAE FROM THE PALOMAR TRANSIENT FACTORY: TWO CHANNELS
Energy Technology Data Exchange (ETDEWEB)
White, Christopher J. [Department of Astrophysical Sciences, Princeton University, 4 Ivy Lane, Princeton, NJ 08544 (United States); Kasliwal, Mansi M.; Piro, Anthony L. [The Observatories, Carnegie Institution for Science, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Nugent, Peter E. [Computational Cosmology Center, Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, CA 94720 (United States); Gal-Yam, Avishay; Ofek, Eran O.; Ben-Ami, Sagi [Benoziyo Center for Astrophysics, The Weizmann Institute of Science, Rehovot 76100 (Israel); Howell, D. Andrew [Department of Physics, University of California, Santa Barbara, Broida Hall, Mail Code 9530, Santa Barbara, CA 93106-9530 (United States); Sullivan, Mark [School of Physics and Astronomy, University of Southampton, Southampton SO17 1BJ (United Kingdom); Goobar, Ariel [The Oskar Klein Centre, Department of Physics, AlbaNova, Stockholm University, SE-106 91 Stockholm (Sweden); Bloom, Joshua S. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Kulkarni, Shrinivas R.; Cao, Yi [Cahill Center for Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Laher, Russ R.; Masci, Frank; Surace, Jason [Spitzer Science Center, California Institute of Technology, M/S 314-6, Pasadena, CA 91125 (United States); Cenko, S. Bradley [Astrophysics Science Division, NASA Goddard Space Flight Center, Mail Code 661, Greenbelt, MD 20771 (United States); Hook, Isobel M. [Department of Physics (Astrophysics), University of Oxford, Keble Road, Oxford OX1 3RH (United Kingdom); Jönsson, Jakob [Savantic AB, Rosenlundsgatan 50, SE-118 63 Stockholm (Sweden); Matheson, Thomas [National Optical Astronomy Observatory, Tucson, AZ 85719-4933 (United States); and others
2015-01-20
Since the discovery of the unusual prototype SN 2002cx, the eponymous class of Type I (hydrogen-poor) supernovae with low ejecta speeds has grown to include approximately two dozen members identified from several heterogeneous surveys, in some cases ambiguously. Here we present the results of a systematic study of 1077 Type I supernovae discovered by the Palomar Transient Factory, leading to nine new members of this peculiar class. Moreover, we find there are two distinct subclasses based on their spectroscopic, photometric, and host galaxy properties: ''SN 2002cx-like'' supernovae tend to be in later-type or more irregular hosts, have more varied and generally dimmer luminosities, have longer rise times, and lack a Ti II trough when compared to ''SN 2002es-like'' supernovae. None of our objects show helium, and we counter a previous claim of two such events. We also find that the occurrence rate of these transients relative to Type Ia supernovae is 5.6{sub −3.8}{sup +22}% (90% confidence), lower compared to earlier estimates. Combining our objects with the literature sample, we propose that these subclasses have two distinct physical origins.
In search of Mahutonga: a possible supernova recorded in Maori astronomical traditions?
Green, David A.; Orchiston, Wayne
Maori astronomical traditions refer to Mahutonga, which can be interpreted as a possible record of a southern supernova (SN) in or near Crux. A search for any known "young" supernova remnants in this region does not reveal any obvious candidate to associate with this possible supernova. Relaxing the positional constraint somewhat, the SN of A.D. 185 near a Centauri is nearby. If this is associated with Mahutonga, then the Maori term must be a relic of an earlier Proto-Polynesian record.
International Nuclear Information System (INIS)
Conley, A.; Carlberg, R. G.; Perrett, K. M.; Guy, J.; Regnault, N.; Astier, P.; Balland, C.; Hardin, D.; Pain, R.; Sullivan, M.; Hook, I. M.; Basa, S.; Fouchez, D.; Howell, D. A.; Palanque-Delabrouille, N.; Rich, J.; Ruhlmann-Kleider, V.; Pritchet, C. J.; Balam, D.; Baumont, S.
2011-01-01
We combine high-redshift Type Ia supernovae from the first three years of the Supernova Legacy Survey (SNLS) with other supernova (SN) samples, primarily at lower redshifts, to form a high-quality joint sample of 472 SNe (123 low-z, 93 SDSS, 242 SNLS, and 14 Hubble Space Telescope). SN data alone require cosmic acceleration at >99.999% confidence, including systematic effects. For the dark energy equation of state parameter (assumed constant out to at least z = 1.4) in a flat universe, we find w = -0.91 +0.16 -0.20 (stat) +0.07 -0.14 (sys) from SNe only, consistent with a cosmological constant. Our fits include a correction for the recently discovered relationship between host-galaxy mass and SN absolute brightness. We pay particular attention to systematic uncertainties, characterizing them using a systematic covariance matrix that incorporates the redshift dependence of these effects, as well as the shape-luminosity and color-luminosity relationships. Unlike previous work, we include the effects of systematic terms on the empirical light-curve models. The total systematic uncertainty is dominated by calibration terms. We describe how the systematic uncertainties can be reduced with soon to be available improved nearby and intermediate-redshift samples, particularly those calibrated onto USNO/SDSS-like systems.
Abundance Tomography of Type Ia Supernovae
International Nuclear Information System (INIS)
Stehle, M.; Mazzali, P.A.; Hillebrandt, W.
2005-01-01
An analysis of early time spectra of Type Ia Supernovae is presented. A new method to derive a detailed abundance distribution of the SN ejecta through comparison with synthetic spectra, called 'Abundance Tomography' is introduced and applied to the normal SN Ia 2002bo. Conclusions regarding the explosion mechanism are drawn
Supernova observations at McDonald Observatory
International Nuclear Information System (INIS)
Wheeler, J.C.
1984-01-01
The programs to obtain high quality spectra and photometry of supernovae at McDonald Observatory are reviewed. Spectra of recent Type I supernovae in NGC 3227, NGC 3625, and NGC 4419 are compared with those of SN 1981b in NGC 4536 to quantitatively illustrate both the homogeneity of Type I spectra at similar epochs and the differences in detail which will serve as a probe of the physical processes in the explosions. Spectra of the recent supernova in NGC 0991 give for the first time quantitative confirmation of a spectrally homogeneous, but distinct subclass of Type I supernovae which appears to be less luminous and to have lower excitation at maximum light than classical Type I supernovae
EARLY RADIO AND X-RAY OBSERVATIONS OF THE YOUNGEST NEARBY TYPE Ia SUPERNOVA PTF 11kly (SN 2011fe)
International Nuclear Information System (INIS)
Horesh, Assaf; Kulkarni, S. R.; Carpenter, John; Kasliwal, Mansi M.; Ofek, Eran O.; Fox, Derek B.; Quimby, Robert; Gal-Yam, Avishay; Cenko, S. Bradley; De Bruyn, A. G.; Kamble, Atish; Wijers, Ralph A. M. J.; Van der Horst, Alexander J.; Kouveliotou, Chryssa; Podsiadlowski, Philipp; Sullivan, Mark; Maguire, Kate; Howell, D. Andrew; Nugent, Peter E.; Gehrels, Neil
2012-01-01
On 2011 August 24 (UT) the Palomar Transient Factory (PTF) discovered PTF11kly (SN 2011fe), the youngest and most nearby Type Ia supernova (SN Ia) in decades. We followed this event up in the radio (centimeter and millimeter bands) and X-ray bands, starting about a day after the estimated explosion time. We present our analysis of the radio and X-ray observations, yielding the tightest constraints yet placed on the pre-explosion mass-loss rate from the progenitor system of this supernova. We find a robust limit of M-dot ∼ -8 (w/100 km s -1 ) M sun yr -1 from sensitive X-ray non-detections, as well as a similar limit from radio data, which depends, however, on assumptions about microphysical parameters. We discuss our results in the context of single-degenerate models for SNe Ia and find that our observations modestly disfavor symbiotic progenitor models involving a red giant donor, but cannot constrain systems accreting from main-sequence or sub-giant stars, including the popular supersoft channel. In view of the proximity of PTF11kly and the sensitivity of our prompt observations, we would have to wait for a long time (a decade or longer) in order to more meaningfully probe the circumstellar matter of SNe Ia.
Magnetorotational Explosions of Core-Collapse Supernovae
Directory of Open Access Journals (Sweden)
Gennady S. Bisnovatyi-Kogan
2014-12-01
Full Text Available Core-collapse supernovae are accompanied by formation of neutron stars. The gravitation energy is transformed into the energy of the explosion, observed as SN II, SN Ib,c type supernovae. We present results of 2-D MHD simulations, where the source of energy is rotation, and magnetic eld serves as a "transition belt" for the transformation of the rotation energy into the energy of the explosion. The toroidal part of the magnetic energy initially grows linearly with time due to dierential rotation. When the twisted toroidal component strongly exceeds the poloidal eld, magneto-rotational instability develops, leading to a drastic acceleration in the growth of magnetic energy. Finally, a fast MHD shock is formed, producing a supernova explosion. Mildly collimated jet is produced for dipole-like type of the initial field. At very high initial magnetic field no MRI development was found.
International Nuclear Information System (INIS)
Milisavljevic, D.; Margutti, R.; Kamble, A.; Patnaude, D. J.; Raymond, J. C.; Challis, P.; Drout, M. R.; Grindlay, J. E.; Kirshner, R. P.; Lunnan, R.; Miller, G. F.; Parrent, J. T.; Sanders, N. E.; Eldridge, J. J.; Fong, W.; Bietenholz, M.; Chornock, R.; Fransson, C.; Fesen, R. A.; Mackey, J.
2015-01-01
We present optical observations of supernova SN 2014C, which underwent an unprecedented slow metamorphosis from H-poor type Ib to H-rich type IIn over the course of one year. The observed spectroscopic evolution is consistent with the supernova having exploded in a cavity before encountering a massive shell of the progenitor star’s stripped hydrogen envelope. Possible origins for the circumstellar shell include a brief Wolf–Rayet fast wind phase that overtook a slower red supergiant wind, eruptive ejection, or confinement of circumstellar material by external influences of neighboring stars. An extended high velocity Hα absorption feature seen in near-maximum light spectra implies that the progenitor star was not completely stripped of hydrogen at the time of core collapse. Archival pre-explosion Subaru Telescope Suprime-Cam and Hubble Space Telescope Wide Field Planetary Camera 2 images of the region obtained in 2009 show a coincident source that is most likely a compact massive star cluster in NGC 7331 that hosted the progenitor system. By comparing the emission properties of the source with stellar population models that incorporate interacting binary stars we estimate the age of the host cluster to be 30–300 Myr, and favor ages closer to 30 Myr in light of relatively strong Hα emission. SN 2014C is the best observed member of a class of core-collapse supernovae that fill the gap between events that interact strongly with dense, nearby environments immediately after explosion and those that never show signs of interaction. Better understanding of the frequency and nature of this intermediate population can contribute valuable information about the poorly understood final stages of stellar evolution
Energy Technology Data Exchange (ETDEWEB)
Milisavljevic, D.; Margutti, R.; Kamble, A.; Patnaude, D. J.; Raymond, J. C.; Challis, P.; Drout, M. R.; Grindlay, J. E.; Kirshner, R. P.; Lunnan, R.; Miller, G. F.; Parrent, J. T.; Sanders, N. E. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA, 02138 (United States); Eldridge, J. J. [Department of Physics, University of Auckland, Private Bag 92019, Auckland (New Zealand); Fong, W. [Steward Observatory, University of Arizona, 933 N. Cherry Avenue, Tucson, AZ 85721 (United States); Bietenholz, M. [Hartebeesthoek Radio Observatory, P.O. Box 443, Krugersdorp 1740 (South Africa); Chornock, R. [Astrophysical Institute, Department of Physics and Astronomy, 251B Clippinger Lab, Ohio University, Athens, OH 45701 (United States); Fransson, C. [Oskar Klein Centre, Department of Astronomy, Stockholm University, AlbaNova, SE106 91 Stockholm (Sweden); Fesen, R. A. [Department of Physics and Astronomy, Dartmouth College, 6127 Wilder Lab, Hanover, NH 03755 (United States); Mackey, J., E-mail: dmilisav@cfa.harvard.edu [Argelander-Institut für Astronomie, Auf dem Hgel 71, D-53121 Bonn (Germany); and others
2015-12-20
We present optical observations of supernova SN 2014C, which underwent an unprecedented slow metamorphosis from H-poor type Ib to H-rich type IIn over the course of one year. The observed spectroscopic evolution is consistent with the supernova having exploded in a cavity before encountering a massive shell of the progenitor star’s stripped hydrogen envelope. Possible origins for the circumstellar shell include a brief Wolf–Rayet fast wind phase that overtook a slower red supergiant wind, eruptive ejection, or confinement of circumstellar material by external influences of neighboring stars. An extended high velocity Hα absorption feature seen in near-maximum light spectra implies that the progenitor star was not completely stripped of hydrogen at the time of core collapse. Archival pre-explosion Subaru Telescope Suprime-Cam and Hubble Space Telescope Wide Field Planetary Camera 2 images of the region obtained in 2009 show a coincident source that is most likely a compact massive star cluster in NGC 7331 that hosted the progenitor system. By comparing the emission properties of the source with stellar population models that incorporate interacting binary stars we estimate the age of the host cluster to be 30–300 Myr, and favor ages closer to 30 Myr in light of relatively strong Hα emission. SN 2014C is the best observed member of a class of core-collapse supernovae that fill the gap between events that interact strongly with dense, nearby environments immediately after explosion and those that never show signs of interaction. Better understanding of the frequency and nature of this intermediate population can contribute valuable information about the poorly understood final stages of stellar evolution.
International Nuclear Information System (INIS)
Colgate, S.A.
1981-01-01
The explosion of a star supernova occurs at the end of its evolution when the nuclear fuel in its core is almost, or completely, consumed. The star may explode due to a small residual thermonuclear detonation, type I SN or it may collapse, type I and type II SN leaving a neutron star remnant. The type I progenitor should be thought to be an old accreting white dwarf, 1.4 M/sub theta/, with a close companion star. A type II SN is thought to be a massive young star 6 to 10 M/sub theta/. The mechanism of explosion is still a challenge to our ability to model the most extreme conditions of matter and hydrodynamics that occur presently and excessively in the universe. 39 references
The Foundation Supernova Survey: motivation, design, implementation, and first data release
Foley, Ryan J.; Scolnic, Daniel; Rest, Armin; Jha, S. W.; Pan, Y.-C.; Riess, A. G.; Challis, P.; Chambers, K. C.; Coulter, D. A.; Dettman, K. G.; Foley, M. M.; Fox, O. D.; Huber, M. E.; Jones, D. O.; Kilpatrick, C. D.; Kirshner, R. P.; Schultz, A. S. B.; Siebert, M. R.; Flewelling, H. A.; Gibson, B.; Magnier, E. A.; Miller, J. A.; Primak, N.; Smartt, S. J.; Smith, K. W.; Wainscoat, R. J.; Waters, C.; Willman, M.
2018-03-01
The Foundation Supernova Survey aims to provide a large, high-fidelity, homogeneous, and precisely calibrated low-redshift Type Ia supernova (SN Ia) sample for cosmology. The calibration of the current low-redshift SN sample is the largest component of systematic uncertainties for SN cosmology, and new data are necessary to make progress. We present the motivation, survey design, observation strategy, implementation, and first results for the Foundation Supernova Survey. We are using the Pan-STARRS telescope to obtain photometry for up to 800 SNe Ia at z ≲ 0.1. This strategy has several unique advantages: (1) the Pan-STARRS system is a superbly calibrated telescopic system, (2) Pan-STARRS has observed 3/4 of the sky in grizyP1 making future template observations unnecessary, (3) we have a well-tested data-reduction pipeline, and (4) we have observed ˜3000 high-redshift SNe Ia on this system. Here, we present our initial sample of 225 SN Ia grizP1 light curves, of which 180 pass all criteria for inclusion in a cosmological sample. The Foundation Supernova Survey already contains more cosmologically useful SNe Ia than all other published low-redshift SN Ia samples combined. We expect that the systematic uncertainties for the Foundation Supernova Sample will be two to three times smaller than other low-redshift samples. We find that our cosmologically useful sample has an intrinsic scatter of 0.111 mag, smaller than other low-redshift samples. We perform detailed simulations showing that simply replacing the current low-redshift SN Ia sample with an equally sized Foundation sample will improve the precision on the dark energy equation-of-state parameter by 35 per cent, and the dark energy figure of merit by 72 per cent.
Neutron Star/supernova Remnant Associations
Gvaramadze, V. V.
We propose a new approach for studying the neutron star/supernova remnant associations, based on the idea that the (diffuse) supernova remnants (SNRs) can be products of an off-centred supernova (SN) explosion in a preexisting bubble created by the wind of a moving massive star. A cavity SN explosion of a moving star results in a considerable offset of the neutron star (NS) birth-place from the geometrical centre of the SNR. Therefore: a) the high transverse velocities inferred for a number of NSs (e.g. PSR B 1610-50, PSR B 1757-24, SGR 0525-66) through their association with SNRs can be reduced; b) the proper motion vector of a NS should not necessarily point away from the geometrical centre of the associated SNR. Taking into account of these two facts allow us to enlarge the circle of possible NS/SNR associations, and could significantly affect the results of previous studies of NS/SNR associations. The possibilities of our approach are illustrated with the example of the association between PSR B 1706-44 and SNR G 343.1-2.3. We show that this association could be real if both objects are the remnants of a SN exploded within a mushroom-like cavity (created by the SN progenitor wind breaking out of the parent molecular cloud and expanding into an intercloud medium of a much less density). We also show that the SN explosion sites in some middle-aged (shell-like) SNRs could be marked by (compact) nebulae of thermal X-ray emission. The possible detection of such nebulae within middle-aged SNRs could be used for the re-estimation of implied transverse velocities of known NSs or for the search of new stellar remnants possibly associated with these SNRs.
Probing Neutrino Mass Hierarchy with Supernova
International Nuclear Information System (INIS)
Chakraborty, Sovan
2013-01-01
The rise time of electron antineutrino lightcurve from a Galactic supernova (SN), observable at the IceCube Cherenkov detector, can provide signature of the neutrino mass hierarchy at “large” 1-3 leptonic mixing angle ϑ 13 . In the early accretion phase of the SN, the neutrino oscillations are nontrivial. Due to the matter suppression of collective effects at these early post bounce times, only the MSW resonances in the outer layers of the SN influence the neutrino flux. When the oscillations are taken into account, the signal in IceCube shows sufficiently fast rise time for the inverted mass hierarchy compared to the normal hierarchy. An investigation with an extensive set of stellar core-collapse simulations, provides both qualitative and quantitative robustness of these features. Thus opening another avenue to explore the neutrino mass hierarchy with the rise time of a supernova burst
Photometry of High-Redshift Gravitationally Lensed Type Ia Supernovae
Haynie, Annastasia
2018-01-01
Out of more than 1100 well-identified Type Ia Supernovae, only roughly 10 of them are at z> 1.5. High redshift supernovae are hard to detect but this is made easier by taking advantage of the effects of gravitational lensing, which magnifies objects in the background field of massive galaxy clusters. Supernova Nebra (z= ~1.8), among others, was discovered during observations taken as part of the RELICS survey, which focused on fields of view that experience strong gravitational lensing effects. SN Nebra, which sits behind galaxy cluster Abell 1763, is magnified and therefore appears closer and easier to see than with HST alone. Studying high-redshift supernovae like SN Nebra is an important step towards creating cosmological models that accurately describe the behavior of dark energy in the early Universe. Recent efforts have been focused on improving photometry and the building and fitting of preliminary light curves.
GAMMA RAYS FROM TYPE Ia SUPERNOVA SN 2014J
International Nuclear Information System (INIS)
Churazov, E.; Sunyaev, R.; Grebenev, S.; Isern, J.; Bikmaev, I.; Bravo, E.; Chugai, N.; Jean, P.; Knödlseder, J.; Lebrun, F.; Kuulkers, E.
2015-01-01
The whole set of INTEGRAL observations of Type Ia supernova SN 2014J, covering the period 19–162 days after the explosion, has been analyzed. For spectral fitting the data are split into early and late periods covering days 19–35 and 50–162, respectively, optimized for 56 Ni and 56 Co lines. As expected for the early period, much of the gamma-ray signal is confined to energies below ∼200 keV, while for the late period it is strongest above 400 keV. In particular, in the late period, 56 Co lines at 847 and 1248 keV are detected at 4.7σ and 4.3σ, respectively. The light curves in several representative energy bands are calculated for the entire period. The resulting spectra and light curves are compared with a subset of models. We confirm our previous finding that the gamma-ray data are broadly consistent with the expectations for canonical one-dimensional models, such as delayed detonation or deflagration models for a near-Chandrasekhar mass white dwarf. Late optical spectra (day 136 after the explosion) show rather symmetric Co and Fe line profiles, suggesting that, unless the viewing angle is special, the distribution of radioactive elements is symmetric in the ejecta
Host galaxies of type ia supernovae from the nearby supernova factory
Childress, Michael Joseph
Type Ia Supernovae (SNe Ia) are excellent distance indicators, yet the full details of the underlying physical mechanism giving rise to these dramatic stellar deaths remain unclear. As large samples of cosmological SNe Ia continue to be collected, the scatter in brightnesses of these events is equally affected by systematic errors as statistical. Thus we need to understand the physics of SNe Ia better, and in particular we must know more about the progenitors of these SNe so that we can derive better estimates for their true intrinsic brightnesses. The host galaxies of SNe Ia provide important indirect clues as to the nature of SN Ia progenitors. In this Thesis we utilize the host galaxies of SNe Ia discovered by the Nearby Supernova Factory (SNfactory) to pursue several key investigations into the nature of SN Ia progenitors and their effects on SN Ia brightnesses. We first examine the host galaxy of SN 2007if, an important member of the subclass of SNe Ia whose extreme brightnesses indicate a progenitor that exceeded the canonical Chandrasekhar-mass value presumed for normal SNe Ia, and show that the host galaxy of this SN is composed of very young stars and has extremely low metallicity, providing important constraints on progenitor scenarios for this SN. We then utilize the full sample of SNfactory host galaxy masses (measured from photometry) and metallicities (derived from optical spectroscopy) to examine several global properties of SN Ia progenitors: (i) we show that SN Ia hosts show tight agreement with the normal galaxy mass-metallicity relation; (ii) comparing the observed distribution of SN Ia host galaxy masses to a theoretical model that couples galaxy physics to the SN Ia delay time distribution (DTD), we show the power of the SN Ia host mass distribution in constraining the SN Ia DTD; and (iii) we show that the lack of ultra-low metallicities in the SNfactory SN Ia host sample gives provisional support for the theorized low-metallicity inhibition of
Direct Measurement of the Supernova Rate in Starburst Galaxies
Bregman, Jesse D.; Temi, Pasquale; Rank, David; DeVincenzi, Donald L. (Technical Monitor)
1999-01-01
Supernovae play a key role in the dynamics, structure, and chemical evolution of galaxies. The massive stars that end their lives as supernovae live for short times. Many are still associated with dusty star formation regions when they explode, making them difficult to observe at visible wavelengths. In active star forming regions (galactic nuclei and starburst regions), dust extintion is especially severe. Thus, determining the supernova rate in the active star forming regions of galaxies, where the supernova rate can be one or two orders of magnitude higher than the average, has proven to be difficult. From observations of SN1987A, we know that the [NiII] 6.63 micron emission line was the strongest line in the infrared spectrum for a period of a year and a half after the explosion. Since dust extintion is much less at 6.63 pm than at visible wavelengths (A(sub 6.63)/A(sub V) = 0.025), the NiII line can be used as a sensitive probe for the detection of recent supernovae. We have observed a sample of starburst galaxies at 6.63 micron using ISOCAM to search for the NiII emission line characteristic of recent supernovae. We did not detect any NiII line emission brighter than a 5sigma limit of 5 mJy. We can set upper limits to the supernova rate in our sample, scaled to the rate in M82, of less than 0.3 per year at the 90% confidence level using Bayesian methods. Assuming that a supernova would have a NiII with the same luminosity as observed in SN1987A, we find less than 0.09 and 0.15 per year at the 50% and 67% confidence levels. These rates are somewhat less if a more normal type II supernovae has a NiII line luminosity greater than the line in SN1987A.
International Nuclear Information System (INIS)
Kasen, Daniel Nathan
2004-01-01
Although we know that many supernovae are aspherical, the exact nature of their geometry is undetermined. Because all the supernovae we observe are too distant to be resolved, the ejecta structure can't be directly imaged, and asymmetry must be inferred from signatures in the spectral features and polarization of the supernova light. The empirical interpretation of this data, however, is rather limited--to learn more about the detailed supernova geometry, theoretical modeling must been undertaken. One expects the geometry to be closely tied to the explosion mechanism and the progenitor star system, both of which are still under debate. Studying the 3-dimensional structure of supernovae should therefore provide new break throughs in our understanding. The goal of this thesis is to advance new techniques for calculating radiative transfer in 3-dimensional expanding atmospheres, and use them to study the flux and polarization signatures of aspherical supernovae. We develop a 3-D Monte Carlo transfer code and use it to directly fit recent spectropolarimetric observations, as well as calculate the observable properties of detailed multi-dimensional hydrodynamical explosion simulations. While previous theoretical efforts have been restricted to ellipsoidal models, we study several more complicated configurations that are tied to specific physical scenarios. We explore clumpy and toroidal geometries in fitting the spectropolarimetry of the Type Ia supernova SN 2001el. We then calculate the observable consequences of a supernova that has been rendered asymmetric by crashing into a nearby companion star. Finally, we fit the spectrum of a peculiar and extraordinarily luminous Type Ic supernova. The results are brought to bear on three broader astrophysical questions: (1) What are the progenitors and the explosion processes of Type Ia supernovae? (2) What effect does asymmetry have on the observational diversity of Type Ia supernovae, and hence their use in cosmology? (3) And
VERY LATE PHOTOMETRY OF SN 2011fe
International Nuclear Information System (INIS)
Kerzendorf, W. E.; Taubenberger, S.; Seitenzahl, I. R.; Ruiter, A. J.
2014-01-01
The Type Ia supernova SN 2011fe is one of the closest supernovae of the past decades. Due to its proximity and low dust extinction, this object provides a very rare opportunity to study the extremely late time evolution (>900 days) of thermonuclear supernovae. In this Letter, we present our photometric data of SN 2011fe taken at an unprecedented late epoch of ≈930 days with GMOS-N mounted on the Gemini North telescope (g = 23.43 ± 0.28, r = 24.14 ± 0.14, i = 23.91 ± 0.18, and z = 23.90 ± 0.17) to study the energy production and retention in the ejecta of SN 2011fe. Together with previous measurements by other groups, our result suggests that the optical supernova light curve can still be explained by the full thermalization of the decay positrons of 56 Co. This is in spite of theoretical predicted effects (e.g., infrared catastrophe, positron escape, and dust) that advocate a substantial energy redistribution and/or loss via various processes that result in a more rapid dimming at these very late epochs
SN1987A's Twentieth Anniversary
2007-02-01
Looking back at 20 Years of Observations of this Supernova with ESO telescopes The unique supernova SN 1987A has been a bonanza for astrophysicists. It provided several observational 'firsts,' like the detection of neutrinos from an exploding star, the observation of the progenitor star on archival photographic plates, the signatures of a non-spherical explosion, the direct observation of the radioactive elements produced during the blast, observation of the formation of dust in the supernova, as well as the detection of circumstellar and interstellar material. ESO PR Photo 08a/07 ESO PR Photo 08a/07 SN1987A in the Large Magellanic Cloud Today, it is exactly twenty years since the explosion of Supernova 1987A in the Large Magellanic Cloud was first observed, at a distance of 163,000 light-years. It was the first naked-eye supernova to be seen for 383 years. Few events in modern astronomy have met with such an enthusiastic response by the scientists and now, after 20 years, it continues to be an extremely exciting object that is further studied by astronomers around the world, in particular using ESO's telescopes. When the first signs of Supernova 1987A, the first supernova of the year 1987, were noticed early on 24 February of that year, it was clear that this would be an unusual event. It was discovered by naked-eye and on a panoramic photographic plate taken with a 10-inch astrograph on Las Campanas in Chile by Oscar Duhalde and Ian Shelton, respectively. A few hours earlier, still on 23 February, two large underground detectors - in Japan and the USA - had registered the passage of high-energy neutrinos. Since SN 1987A exploded in the Large Magellanic Cloud (LMC), it was only accessible to telescopes in the Southern Hemisphere, more particularly in Australia, South Africa, and South America. In Chile, ESO's observatory at La Silla with its armada of telescopes with sizes between 0.5 and 3.6-m, played an important role. ESO PR Photo 08c/07 ESO PR Photo 08c/07 The
The ASAS-SN Catalog of Variable Stars I: The Serendipitous Survey
Jayasinghe, T.; Kochanek, C. S.; Stanek, K. Z.; Shappee, B. J.; Holoien, T. W.-S.; Thompson, Todd A.; Prieto, J. L.; Dong, Subo; Pawlak, M.; Shields, J. V.; Pojmanski, G.; Otero, S.; Britt, C. A.; Will, D.
2018-04-01
The All-Sky Automated Survey for Supernovae (ASAS-SN) is the first optical survey to routinely monitor the whole sky with a cadence of ˜2 - 3 days down to V≲ 17 mag. ASAS-SN has monitored the whole sky since 2014, collecting ˜100 - 500 epochs of observations per field. The V-band light curves for candidate variables identified during the search for supernovae are classified using a random forest classifier and visually verified. We present a catalog of 66,533 bright, new variable stars discovered during our search for supernovae, including 27,753 periodic variables and 38,780 irregular variables. V-band light curves for the ASAS-SN variables are available through the ASAS-SN variable stars database (https://asas-sn.osu.edu/variables). The database will begin to include the light curves of known variable stars in the near future along with the results for a systematic, all-sky variability survey.
Neutrinos from type-II supernovae and the neutrino-driven supernova mechanism
International Nuclear Information System (INIS)
Janka, H.T.
1996-01-01
Supernova 1987A has confirmed fundamental aspects of our theoretical view of type-II supernovae: Type-II supernovae are a consequence of the collapse of the iron core of a massive evolved star and lead to the formation of a neutron star or black hole. This picture is most strongly supported by the detection of electron antineutrinos in the IMB and Kamiokande II experiments in connection with SN 1987A. However, the mechanism causing the supernova explosion is not yet satisfactorily understood. In this paper the properties of the neutrino emission from supernovae and protoneutron stars will be reviewed; analytical estimates will be derived and results of numerical simulations will be shown. It will be demonstrated that the spectral distributions of the emitted neutrinos show clear and systematic discrepancies compared with thermal (black body-type) emission. This must be taken into account when neutrino observations from supernovae are to be interpreted, or when implications of the neutrino emission on nucleosynthesis processes in mantle and envelope of the progenitor star are to be investigated. Furthermore, the influence of neutrinos on the supernova dynamics will be discussed, in particular their crucial role in causing the explosion by Wilson's neutrino-driven delayed mechanism. Possible implications of convection inside the newly born neutron star and between surface and the supernova shock will be addressed and results of multi-dimensional simulations will be presented. (author) 7 figs., 1 tab., refs
Neutrinos from type-II supernovae and the neutrino-driven supernova mechanism
Energy Technology Data Exchange (ETDEWEB)
Janka, H T [Max-Planck-Institut fuer Astrophysik, Garching (Germany)
1996-11-01
Supernova 1987A has confirmed fundamental aspects of our theoretical view of type-II supernovae: Type-II supernovae are a consequence of the collapse of the iron core of a massive evolved star and lead to the formation of a neutron star or black hole. This picture is most strongly supported by the detection of electron antineutrinos in the IMB and Kamiokande II experiments in connection with SN 1987A. However, the mechanism causing the supernova explosion is not yet satisfactorily understood. In this paper the properties of the neutrino emission from supernovae and protoneutron stars will be reviewed; analytical estimates will be derived and results of numerical simulations will be shown. It will be demonstrated that the spectral distributions of the emitted neutrinos show clear and systematic discrepancies compared with thermal (black body-type) emission. This must be taken into account when neutrino observations from supernovae are to be interpreted, or when implications of the neutrino emission on nucleosynthesis processes in mantle and envelope of the progenitor star are to be investigated. Furthermore, the influence of neutrinos on the supernova dynamics will be discussed, in particular their crucial role in causing the explosion by Wilson`s neutrino-driven delayed mechanism. Possible implications of convection inside the newly born neutron star and between surface and the supernova shock will be addressed and results of multi-dimensional simulations will be presented. (author) 7 figs., 1 tab., refs.
Supernova neutrino detection in LZ
Khaitan, D.
2018-02-01
In the first 10 seconds of a core-collapse supernova, almost all of its progenitor's gravitational potential, O(1053 ergs), is carried away in the form of neutrinos. These neutrinos, with O(10 MeV) kinetic energy, can interact via coherent elastic neutrino-nucleus scattering (CEνNS) depositing O(1 keV) in detectors. In this work we describe the performances of low-background dark matter detectors, such as LUX-ZEPLIN (LZ), optimized for detecting low-energy depositions, in detecting these neutrino interactions. For instance, a 27 Msolar supernova at 10 kpc is expected to produce ~350 neutrino interactions in the 7-tonne liquid xenon active volume of LZ. Based on the LS220 EoS neutrino flux model for a SN, the Noble Element Simulation Technique (NEST), and predicted CEνNS cross-sections for xenon, to study energy deposition and detection of SN neutrinos in LZ. We simulate the response of the LZ data acquisition system (DAQ) and demonstrate its capability and limitations in handling this interaction rate. We present an overview of the LZ detector, focusing on the benefits of liquid xenon for supernova neutrino detection. We discuss energy deposition and detector response simulations and their results. We present an analysis technique to reconstruct the total number of neutrinos and the time of the supernova core bounce.
Mapping the Supernova-Rich Fireworks Galaxy NGC 6946
Patton, Locke; Levesque, Emily
2018-01-01
Supernovae (SNe) are the spectacularly violent deaths of evolved young massive stars, which expel a shock wave into the intergalactic medium that in turn can spark star formation and disperse heavy elements into their host galaxy. While a SN event can be classified by its spectral signature, determining the nature of a SN progenitor depends upon chance photometry taken prior to the event. By turning to the study of SN host environments and their surrounding interstellar medium within the unique and rare population of galaxies that have hosted three or more SN events within the last century, we are granted the opportunity to study the locations and environmental properties of stellar populations prone to supernova progenitor production. Using moderate-resolution optical slit spectra taken with the Apache Point Observatory 3.5m DIS spectrograph, our goal is to map metallicity, ionization parameter, and star formation rates using emission line diagnostic ratios across each SN-rich galaxy. Dubbed the “Fireworks Galaxy” at a distance of 5.6 ± 1.5 Mpc, NGC 6946 is of particular interest as it has uniquely produced ten core-collapse supernovae (CCSNe) and several other massive star transients within the last century. We present spatially-resolved metallicity and star formation rate (SFR) maps of NGC 6946, tracing fifty-five slit orientations which span the face of the galaxy and cover all CCSN host sites. Future work will include both stellar population synthesis modelling to determine stellar populations, ages, and SFR histories in NGC 6946 and a further expansion of this analysis to the other SN-rich host galaxies in our sample.
International Nuclear Information System (INIS)
Graur, O.; Rodney, S. A.; Riess, A. G.; Medezinski, E.; Maoz, D.; Jha, S. W.; Holoien, T. W.-S.; McCully, C.; Patel, B.; Postman, M.; Dahlen, T.; Strolger, L.-G.; Coe, D.; Bradley, L.; Koekemoer, A.; Benítez, N.; Molino, A.; Jouvel, S.; Nonino, M.; Balestra, I.
2014-01-01
We present the supernova (SN) sample and Type-Ia SN (SN Ia) rates from the Cluster Lensing And Supernova survey with Hubble (CLASH). Using the Advanced Camera for Surveys and the Wide Field Camera 3 on the Hubble Space Telescope (HST), we have imaged 25 galaxy-cluster fields and parallel fields of non-cluster galaxies. We report a sample of 27 SNe discovered in the parallel fields. Of these SNe, ∼13 are classified as SN Ia candidates, including four SN Ia candidates at redshifts z > 1.2. We measure volumetric SN Ia rates to redshift 1.8 and add the first upper limit on the SN Ia rate in the range 1.8 < z < 2.4. The results are consistent with the rates measured by the HST/GOODS and Subaru Deep Field SN surveys. We model these results together with previous measurements at z < 1 from the literature. The best-fitting SN Ia delay-time distribution (DTD; the distribution of times that elapse between a short burst of star formation and subsequent SN Ia explosions) is a power law with an index of −1.00 −0.06(0.10) +0.06(0.09) (statistical) −0.08 +0.12 (systematic), where the statistical uncertainty is a result of the 68% and 95% (in parentheses) statistical uncertainties reported for the various SN Ia rates (from this work and from the literature), and the systematic uncertainty reflects the range of possible cosmic star-formation histories. We also test DTD models produced by an assortment of published binary population synthesis (BPS) simulations. The shapes of all BPS double-degenerate DTDs are consistent with the volumetric SN Ia measurements, when the DTD models are scaled up by factors of 3-9. In contrast, all BPS single-degenerate DTDs are ruled out by the measurements at >99% significance level.
Mass extinctions and supernova explosions
Korschinek, Gunther
2016-01-01
A nearby supernova (SN) explosion could have negatively influenced life on Earth, maybe even been responsible for mass extinctions. Mass extinction poses a significant extinction of numerous species on Earth, as recorded in the paleontologic, paleoclimatic, and geological record of our planet. Depending on the distance between the Sun and the SN, different types of threats have to be considered, such as ozone depletion on Earth, causing increased exposure to the Sun's ultraviolet radiation, o...
The supernova-gamma-ray burst-jet connection.
Hjorth, Jens
2013-06-13
The observed association between supernovae and gamma-ray bursts represents a cornerstone in our understanding of the nature of gamma-ray bursts. The collapsar model provides a theoretical framework for this connection. A key element is the launch of a bipolar jet (seen as a gamma-ray burst). The resulting hot cocoon disrupts the star, whereas the (56)Ni produced gives rise to radioactive heating of the ejecta, seen as a supernova. In this discussion paper, I summarize the observational status of the supernova-gamma-ray burst connection in the context of the 'engine' picture of jet-driven supernovae and highlight SN 2012bz/GRB 120422A--with its luminous supernova but intermediate high-energy luminosity--as a possible transition object between low-luminosity and jet gamma-ray bursts. The jet channel for supernova explosions may provide new insights into supernova explosions in general.
DUST PRODUCTION AND PARTICLE ACCELERATION IN SUPERNOVA 1987A REVEALED WITH ALMA
Energy Technology Data Exchange (ETDEWEB)
Indebetouw, R.; Chevalier, R. [Department of Astronomy, University of Virginia, PO Box 400325, Charlottesville, VA 22904 (United States); Matsuura, M.; Barlow, M. J. [Department of Physics and Astronomy, University College London, Gower Street, London WC1E 6BT (United Kingdom); Dwek, E. [NASA Goddard Space Flight Center, 8800 Greenbelt Road, Greenbelt, MD 20771 (United States); Zanardo, G. [International Centre for Radio Astronomy Research (ICRAR), University of Western Australia, Crawley, WA 6009 (Australia); Baes, M. [Sterrenkundig Observatorium, Universiteit Gent, Krijgslaan 281 S9, B-9000 Gent (Belgium); Bouchet, P. [CEA-Saclay, F-91191 Gif-sur-Yvette (France); Burrows, D. N. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Clayton, G. C. [Department of Physics and Astronomy, Louisiana State University, Baton Rouge, LA 70803 (United States); Fransson, C.; Lundqvist, P. [Department of Astronomy and the Oskar Klein Centre, Stockholm University, AlbaNova, SE-106 91 Stockholm (Sweden); Gaensler, B. [Australian Research Council Centre of Excellence for All-sky Astrophysics (CAASTRO) (Australia); Kirshner, R. [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States); Lakićević, M. [Lennard-Jones Laboratories, Keele University, ST5 5BG (United Kingdom); Long, K. S.; Meixner, M. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Martí-Vidal, I. [Department of Earth and Space Sciences, Chalmers University of Technology, Onsala Space Observatory, SE-43992 Onsala (Sweden); Marcaide, J. [Universidad de Valencia, C/Dr. Moliner 50, E-46100 Burjassot (Spain); McCray, R., E-mail: remy@virginia.edu [Department of Astrophysical and Planetary Sciences, University of Colorado at Boulder, UCB 391, Boulder, CO 80309 (United States); and others
2014-02-10
Supernova (SN) explosions are crucial engines driving the evolution of galaxies by shock heating gas, increasing the metallicity, creating dust, and accelerating energetic particles. In 2012 we used the Atacama Large Millimeter/Submillimeter Array to observe SN 1987A, one of the best-observed supernovae since the invention of the telescope. We present spatially resolved images at 450 μm, 870 μm, 1.4 mm, and 2.8 mm, an important transition wavelength range. Longer wavelength emission is dominated by synchrotron radiation from shock-accelerated particles, shorter wavelengths by emission from the largest mass of dust measured in a supernova remnant (>0.2 M {sub ☉}). For the first time we show unambiguously that this dust has formed in the inner ejecta (the cold remnants of the exploded star's core). The dust emission is concentrated at the center of the remnant, so the dust has not yet been affected by the shocks. If a significant fraction survives, and if SN 1987A is typical, supernovae are important cosmological dust producers.
OPTICAL OBSERVATIONS OF THE TYPE IA SUPERNOVA SN 2011fe IN M101 FOR NEARLY 500 DAYS
Energy Technology Data Exchange (ETDEWEB)
Zhang, Kaicheng; Wang, Xiaofeng; Zhao, Xulin; Chen, Jia; Chen, Juncheng; Huang, Fang; Mo, Jun; Rui, Liming; Song, Hao; Sai, Hanna; Li, Wenxiong [Physics Department and Tsinghua Center for Astrophysics (THCA), Tsinghua University, Beijing, 100084 (China); Zhang, JuJia; Bai, Jinming [Yunnan Astronomical Observatory of China, Chinese Academy of Sciences, Kunming, 650011 (China); Zhang, Tianmeng; Wu, Chao [National Astronomical Observatory of China, Chinese Academy of Sciences, Beijing, 100012 (China); Ganeshalingam, Mohan; Li, Weidong; Filippenko, Alexei V.; Zheng, Weikang [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Wang, Lifan, E-mail: wang_xf@mail.tsinghua.edu.cn [Physics and Astronomy Department, Texas A and M University, College Station, TX 77843 (United States)
2016-03-20
We present well-sampled optical observations of the bright Type Ia supernova (SN Ia) SN 2011fe in M101. Our data, starting from ∼16 days before maximum light and extending to ∼463 days after maximum, provide an unprecedented time series of spectra and photometry for a normal SN Ia. Fitting the early-time rising light curve, we find that the luminosity evolution of SN 2011fe follows a t{sup n} law, with the index n being close to 2.0 in the VRI bands but slightly larger in the U and B bands. Combining the published ultraviolet (UV) and near-infrared (NIR) photometry, we derive the contribution of UV/NIR emission relative to the optical. SN 2011fe is found to have stronger UV emission and reaches its UV peak a few days earlier than other SNe Ia with similar Δm{sub 15}(B), suggestive of less trapping of high-energy photons in the ejecta. Moreover, the U-band light curve shows a notably faster decline at late phases (t ≈ 100–300 days), which also suggests that the ejecta may be relatively transparent to UV photons. These results favor the notion that SN 2011fe might have a progenitor system with relatively lower metallicity. On the other hand, the early-phase spectra exhibit prominent high-velocity features (HVFs) of O i λ7773 and the Ca ii NIR triplet, but only barely detectable in Si ii 6355. This difference can be caused by either an ionization/temperature effect or an abundance enhancement scenario for the formation of HVFs; it suggests that the photospheric temperature of SN 2011fe is intrinsically low, perhaps owing to incomplete burning during the explosion of the white dwarf.
International Nuclear Information System (INIS)
Wood-Vasey, W.M.; Aldering, G.; Lee, B.C.; Loken, S.; Nugent, P.; Perlmutter, S.; Siegrist, J.; Wang, L.; Antilogus, P.; Astier, P.; Hardin, D.; Pain, R.; Copin, Y.; Smadja, G.; Gangler, E.; Castera, A.; Adam, G.; Bacon, R.; Lemonnier, J.-P.; Pecontal, A.; Pecontal, E.; Kessler, R.
2004-01-01
The Nearby Supernova Factory (SNfactory) is an ambitious project to find and study in detail approximately 300 nearby Type Ia supernovae (SNe Ia) at redshifts 0.03 < z < 0.08. This program will provide an exceptional data set of well-studied SNe in the nearby smooth Hubble flow that can be used as calibration for the current and future programs designed to use SNe to measure the cosmological parameters. The first key ingredient for this program is a reliable supply of Hubble-flow SNe systematically discovered in unprecedented numbers using the same techniques as those used in distant SNe searches. In 2002, 35 SNe were found using our test-bed pipeline for automated SN search and discovery. The pipeline uses images from the asteroid search conducted by the Near Earth Asteroid Tracking group at JPL. Improvements in our subtraction techniques and analysis have allowed us to increase our effective SN discovery rate to ∼12 SNe/month in 2003
Hierarchical Models for Type Ia Supernova Light Curves in the Optical and Near Infrared
Mandel, Kaisey; Narayan, G.; Kirshner, R. P.
2011-01-01
I have constructed a comprehensive statistical model for Type Ia supernova optical and near infrared light curves. Since the near infrared light curves are excellent standard candles and are less sensitive to dust extinction and reddening, the combination of near infrared and optical data better constrains the host galaxy extinction and improves the precision of distance predictions to SN Ia. A hierarchical probabilistic model coherently accounts for multiple random and uncertain effects, including photometric error, intrinsic supernova light curve variations and correlations across phase and wavelength, dust extinction and reddening, peculiar velocity dispersion and distances. An improved BayeSN MCMC code is implemented for computing probabilistic inferences for individual supernovae and the SN Ia and host galaxy dust populations. I use this hierarchical model to analyze nearby Type Ia supernovae with optical and near infared data from the PAIRITEL, CfA3, and CSP samples and the literature. Using cross-validation to test the robustness of the model predictions, I find that the rms Hubble diagram scatter of predicted distance moduli is 0.11 mag for SN with optical and near infrared data versus 0.15 mag for SN with only optical data. Accounting for the dispersion expected from random peculiar velocities, the rms intrinsic prediction error is 0.08-0.10 mag for SN with both optical and near infrared light curves. I discuss results for the inferred intrinsic correlation structures of the optical-NIR SN Ia light curves and the host galaxy dust distribution captured by the hierarchical model. The continued observation and analysis of Type Ia SN in the optical and near infrared is important for improving their utility as precise and accurate cosmological distance indicators.
RAPIDLY DECAYING SUPERNOVA 2010X: A CANDIDATE '.Ia' EXPLOSION
International Nuclear Information System (INIS)
Kasliwal, Mansi M.; Kulkarni, S. R.; Quimby, Robert M.; Ofek, Eran O.; Gal-Yam, Avishay; Yaron, Ofer; Sternberg, Assaf; Arcavi, Iair; Nugent, Peter; Poznanski, Dovi; Jacobsen, Janet; Howell, D. Andrew; Sullivan, Mark; Rich, Douglas J.; Burke, Paul F.; Brimacombe, Joseph; Milisavljevic, Dan; Fesen, Robert; Bildsten, Lars; Shen, Ken
2010-01-01
We present the discovery, photometric, and spectroscopic follow-up observations of SN 2010X (PTF 10bhp). This supernova decays exponentially with τ d = 5 days and rivals the current recordholder in speed, SN 2002bj. SN 2010X peaks at M r = -17 mag and has mean velocities of 10,000 km s -1 . Our light curve modeling suggests a radioactivity-powered event and an ejecta mass of 0.16 M sun . If powered by Nickel, we show that the Nickel mass must be very small (∼0.02 M sun ) and that the supernova quickly becomes optically thin to γ-rays. Our spectral modeling suggests that SN 2010X and SN 2002bj have similar chemical compositions and that one of aluminum or helium is present. If aluminum is present, we speculate that this may be an accretion-induced collapse of an O-Ne-Mg white dwarf. If helium is present, all observables of SN 2010X are consistent with being a thermonuclear helium shell detonation on a white dwarf, a '.Ia' explosion. With the 1 day dynamic-cadence experiment on the Palomar Transient Factory, we expect to annually discover a few such events.
Astronomy in Denver: The polarization evolution of the luminous Type Ib SN 2012au
Hoffman, Jennifer L.; DeKlotz, Sophia; Cooper, Kevin; Slay, Hannah; Williams, George Grant; Supernova Spectropolarimetry Project (SNSPOL)
2018-06-01
We present an analysis of the spectropolarimetric behavior of the Type Ib SN 2012au over the first 315 days of its evolution. Our data were obtained by the Supernova Spectropolarimetry Project using the CCD Imaging/Spectropolarimeter (SPOL) at the 61" Kuiper, the 90" Bok, and the 6.5-m MMT telescopes. SN 2012au was a very energetic, luminous, and slowly evolving event that may represent an intermediate case between normal core-collapse supernovae and the enigmatic superluminous supernovae. Strong, time-variable line polarization signatures, particularly in the He Il λ5876 line, support previous hypotheses of an asymmetric explosion and allow us to trace detailed structures within the supernova ejecta as they change over time. We compare the polarimetric evolution of the continuum and emission lines in SN 2012au and compare its behavior with that of other bright and polarimetrically variable supernovae.
Pair production of helicity-flipped neutrinos in supernovae
Energy Technology Data Exchange (ETDEWEB)
Perez, A. (NASA/Fermilab Astrophysics Center, Fermi National Accelerator Laboratory, Box 500, Batavia, Illinois 60510-0500 (USA) Departamento de Fisica Teorica, Universidad de Valencia, 46100 Burjassot (Valencia) (Spain)); Gandhi, R. (Department of Physics and Astronomy, University of Arizona, Tucson, AZ (USA))
1990-04-15
We calculate the emissivity for the pair production of helicity-flipped neutrinos, in a way that can be used in supernova calculations. We also present some simple estimates which show that such a process can act as an efficient energy-loss mechanism in the shocked supernova core, and we use this fact to estimate neutrino mass limits from SN 1987A neutrino observations.
Energy Technology Data Exchange (ETDEWEB)
Kamble, Atish; Soderberg, Alicia M.; Margutti, Raffaella; Milisavljevic, Dan; Chakraborti, Sayan; Dittmann, Jason; Drout, Maria; Sanders, Nathan [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Chomiuk, Laura [Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States); Medvedev, Mikhail [The Department of Physics and Astronomy, University of Kansas, Lawrence, KS 66045 (United States); Chevalier, Roger [Department of Astronomy, University of Virginia, P.O. Box 400325, Charlottesville, VA 22904-4325 (United States); Chugai, Nikolai [Institute of Astronomy, Russian Academy of Sciences, Pyatnitskaya 48, 109017 Moscow (Russian Federation); Fransson, Claes [Department of Astronomy, The Oskar Klein Centre, Stockholm University, AlbaNova University Centre, SE-106 91 Stockholm (Sweden); Nakar, Ehud, E-mail: atish.vyas@gmail.com [Raymond and Beverly Sackler School of Physics and Astronomy, Tel Aviv University, Tel Aviv 69978 (Israel)
2014-12-10
We present extensive radio and X-ray observations of SN 2012au, an energetic, radio-luminous supernova of Type Ib that exhibits multi-wavelength properties bridging subsets of hydrogen-poor superluminous supernovae, hypernovae, and normal core-collapse supernovae. The observations closely follow models of synchrotron emission from a shock-heated circumburst medium that has a wind density profile (ρ∝r {sup –2}). We infer a sub-relativistic velocity for the shock wave v ≈ 0.2 c and a radius of r ≈ 1.4 × 10{sup 16}cm at 25 days after the estimated date of explosion. For a wind velocity of 1000 km s{sup –1}, we determine the mass-loss rate of the progenitor to be M-dot =3.6×10{sup −6} M{sub ⊙} yr{sup −1}, consistent with the estimates from X-ray observations. We estimate the total internal energy of the radio-emitting material to be E ≈ 10{sup 47} erg, which is intermediate to SN 1998bw and SN 2002ap. The evolution of the radio light curve of SN 2012au is in agreement with its interaction with a smoothly distributed circumburst medium and the absence of stellar shells ejected from previous outbursts out to r ≈ 10{sup 17} cm from the supernova site. We conclude that the bright radio emission from SN 2012au was not dissimilar from other core-collapse supernovae despite its extraordinary optical properties, and that the evolution of the SN 2012au progenitor star was relatively quiet, marked with a steady mass loss, during the final years preceding explosion.
Asymmetry of the envelope of supernova 1987A
Energy Technology Data Exchange (ETDEWEB)
Papaliolios, C.; Karovska, M.; Koechlin, L.; Nisenson, P.; Standley, C.; Heathcote, S.
1989-04-13
The supernova SN1987A in the Large Magellanic Cloud has been observed by high-angular-resolution speckle interferometry since 25 March (30 days after the explosion) with the 4-m telescope at the Cerro Tololo Interamerican Observatory. Data obtained on 25 March and 2 April 1987 revealed a second bright 'companion' source separated from the supernova by 60 milliarcseconds and less than three magnitudes fainter than the supernova. Measurements of the average diameter of the supernova envelope have been made from data recorded from March 1987 to April 1988. Here we present a more detailed analysis of these data, which shows that the expanding envelope is asymmetric. (author).
Asymmetry of the envelope of supernova 1987A
International Nuclear Information System (INIS)
Papaliolios, C.; Karovska, M.; Koechlin, L.; Nisenson, P.; Standley, C.; Heathcote, S.
1989-01-01
The supernova SN1987A in the Large Magellanic Cloud has been observed by high-angular-resolution speckle interferometry since 25 March (30 days after the explosion) with the 4-m telescope at the Cerro Tololo Interamerican Observatory. Data obtained on 25 March and 2 April 1987 revealed a second bright 'companion' source separated from the supernova by 60 milliarcseconds and less than three magnitudes fainter than the supernova. Measurements of the average diameter of the supernova envelope have been made from data recorded from March 1987 to April 1988. Here we present a more detailed analysis of these data, which shows that the expanding envelope is asymmetric. (author)
Positrons from supernova and the origin of the galactic-center positron-annihilation radiation
International Nuclear Information System (INIS)
Colgate, S.A.
1983-01-01
The emission of positrons from supernova ejecta is dicussed in terms of the galactic-center annihilation radiation. The positrons from the radioactive sequences 56 Ni→ 56 Co→ 56 Fe are the most numerous source from supernova. Only type I supernova will allow a significant fraction to escape the expanding ejecta. For a neutron star model of a type I SN a fraction 4 x 10 -3 of the escaped positron is enough to create the observed several year fluctuation of the annihilation radiation. The likelihood of this model is discussed in terms of other astrophysical evidence as well as the type I SN light curve
THE FIRST SYSTEMATIC STUDY OF TYPE Ibc SUPERNOVA MULTI-BAND LIGHT CURVES
International Nuclear Information System (INIS)
Drout, Maria R.; Soderberg, Alicia M.; Gal-Yam, Avishay; Arcavi, Iair; Green, Yoav; Cenko, S. Bradley; Fox, Derek B.; Leonard, Douglas C.; Sand, David J.; Moon, Dae-Sik
2011-01-01
We present detailed optical photometry for 25 Type Ibc supernovae (SNe Ibc) within d ≈ 150 Mpc obtained with the robotic Palomar 60 inch telescope in 2004-2007. This study represents the first uniform, systematic, and statistical sample of multi-band SNe Ibc light curves available to date. We correct the light curves for host galaxy extinction using a new technique based on the photometric color evolution, namely, we show that the (V – R) color of extinction-corrected SNe Ibc at Δt ≈ 10 days after V-band maximum is tightly distributed, ((V – R) V10 ) = 0.26 ± 0.06 mag. Using this technique, we find that SNe Ibc typically suffer from significant host galaxy extinction, (E(B – V)) ≈ 0.4 mag. A comparison of the extinction-corrected light curves for helium-rich (Type Ib) and helium-poor (Type Ic) SNe reveals that they are statistically indistinguishable, both in luminosity and decline rate. We report peak absolute magnitudes of (M R ) = –17.9 ± 0.9 mag and (M R ) = –18.3 ± 0.6 mag for SNe Ib and Ic, respectively. Focusing on the broad-lined (BL) SNe Ic, we find that they are more luminous than the normal SNe Ibc sample, (M R ) = –19.0 ± 1.1 mag, with a probability of only 1.6% that they are drawn from the same population of explosions. By comparing the peak absolute magnitudes of SNe Ic-BL with those inferred for local engine-driven explosions (GRB-SN 1998bw, XRF-SN 2006aj, and SN 2009bb) we find a 25% probability that relativistic SNe are drawn from the overall SNe Ic-BL population. Finally, we fit analytic models to the light curves to derive typical 56 Ni masses of M Ni ≈ 0.2 and 0.5 M ☉ for SNe Ibc and SNe Ic-BL, respectively. With reasonable assumptions for the photospheric velocities, we further extract kinetic energy and ejecta mass values of M ej ≈ 2 M ☉ and E K ≈ 10 51 erg for SNe Ibc, while for SNe Ic-BL we find higher values, M ej ≈ 5 M ☉ and E K ≈ 10 52 erg. We discuss the implications for the progenitors of SNe Ibc
THE MASSIVE PROGENITOR OF THE TYPE II-LINEAR SUPERNOVA 2009kr
International Nuclear Information System (INIS)
Elias-Rosa, Nancy; Van Dyk, Schuyler D.; Li Weidong; Miller, Adam A.; Silverman, Jeffrey M.; Ganeshalingam, Mohan; Filippenko, Alexei V.; Steele, Thea N.; Bloom, Joshua S.; Griffith, Christopher V.; Kleiser, Io K. W.; Boden, Andrew F.; Kasliwal, Mansi M.; Vinko, Jozsef; Cuillandre, Jean-Charles; Foley, Ryan J.
2010-01-01
We present early-time photometric and spectroscopic observations of supernova (SN) 2009kr in NGC 1832. We find that its properties to date support its classification as Type II-linear (SN II-L), a relatively rare subclass of core-collapse supernovae (SNe). We have also identified a candidate for the SN progenitor star through comparison of pre-explosion, archival images taken with WFPC2 on board the Hubble Space Telescope with SN images obtained using adaptive optics plus NIRC2 on the 10 m Keck-II telescope. Although the host galaxy's substantial distance (∼26 Mpc) results in large uncertainties in the relative astrometry, we find that if this candidate is indeed the progenitor, it is a highly luminous (M 0 V = -7.8 mag) yellow supergiant with initial mass ∼18-24 M sun . This would be the first time that an SN II-L progenitor has been directly identified. Its mass may be a bridge between the upper initial mass limit for the more common Type II-plateau SNe and the inferred initial mass estimate for one Type II-narrow SN.
OGLE-2013-SN-079: A LONELY SUPERNOVA CONSISTENT WITH A HELIUM SHELL DETONATION
International Nuclear Information System (INIS)
Inserra, C.; Sim, S. A.; Smartt, S. J.; Nicholl, M.; Jerkstrand, A.; Chen, T.-W.; Wyrzykowski, L.; Fraser, M.; Blagorodnova, N.; Campbell, H.; Shen, K. J.; Gal-Yam, A.; Howell, D. A.; Valenti, S.; Maguire, K.; Mazzali, P.; Bersier, D.; Taubenberger, S.; Benitez-Herrera, S.; Elias-Rosa, N.
2015-01-01
We present observational data for a peculiar supernova discovered by the OGLE-IV survey and followed by the Public ESO Spectroscopic Survey for Transient Objects. The inferred redshift of z = 0.07 implies an absolute magnitude in the rest-frame I-band of M I ∼ –17.6 mag. This places it in the luminosity range between normal Type Ia SNe and novae. Optical and near infrared spectroscopy reveal mostly Ti and Ca lines, and an unusually red color arising from strong depression of flux at rest wavelengths <5000 Å. To date, this is the only reported SN showing Ti-dominated spectra. The data are broadly consistent with existing models for the pure detonation of a helium shell around a low-mass CO white dwarf and ''double-detonation'' models that include a secondary detonation of a CO core following a primary detonation in an overlying helium shell
OGLE-2013-SN-079: A LONELY SUPERNOVA CONSISTENT WITH A HELIUM SHELL DETONATION
Energy Technology Data Exchange (ETDEWEB)
Inserra, C.; Sim, S. A.; Smartt, S. J.; Nicholl, M.; Jerkstrand, A.; Chen, T.-W. [Astrophysics Research Centre, School of Mathematics and Physics, Queens University Belfast, Belfast BT7 1NN (United Kingdom); Wyrzykowski, L. [University of Warsaw, Astronomical Observatory, Al. Ujazdowskie 400-478 Warszawa (Poland); Fraser, M.; Blagorodnova, N.; Campbell, H. [Institute of Astronomy, University of Cambridge, Madingley Road, CB3 0HA Cambridge (United Kingdom); Shen, K. J. [Department of Astronomy and Theoretical Astrophysics Center, University of California, Berkeley, CA 94720 (United States); Gal-Yam, A. [Benoziyo Center for Astrophysics, Weizmann Institute of Science, 76100 Rehovot (Israel); Howell, D. A.; Valenti, S. [Las Cumbres Observatory Global Telescope Network, 6740 Cortona Drive, Suite 102 Goleta, CA 93117 (United States); Maguire, K. [European Southern Observatory for Astronomical Research in the Southern Hemisphere (ESO), Karl-Schwarzschild-Str. 2, 85748 Garching b. Munchen (Germany); Mazzali, P.; Bersier, D. [Astrophysics Research Institute, Liverpool John Moores University, Liverpool (United Kingdom); Taubenberger, S.; Benitez-Herrera, S. [Max-Planck-Institut für Astrophysik, Karl-Schwarzschild-Str. 1, 85741 Garching (Germany); Elias-Rosa, N., E-mail: c.inserra@qub.ac.uk [INAF - Osservatorio Astronomico di Padova, Vicolo dell' Osservatorio 5, I-35122 Padova (Italy); and others
2015-01-20
We present observational data for a peculiar supernova discovered by the OGLE-IV survey and followed by the Public ESO Spectroscopic Survey for Transient Objects. The inferred redshift of z = 0.07 implies an absolute magnitude in the rest-frame I-band of M{sub I} ∼ –17.6 mag. This places it in the luminosity range between normal Type Ia SNe and novae. Optical and near infrared spectroscopy reveal mostly Ti and Ca lines, and an unusually red color arising from strong depression of flux at rest wavelengths <5000 Å. To date, this is the only reported SN showing Ti-dominated spectra. The data are broadly consistent with existing models for the pure detonation of a helium shell around a low-mass CO white dwarf and ''double-detonation'' models that include a secondary detonation of a CO core following a primary detonation in an overlying helium shell.
The cosmic transparency measured with Type Ia supernovae: implications for intergalactic dust
Goobar, Ariel; Dhawan, Suhail; Scolnic, Daniel
2018-04-01
Observations of high-redshift Type Ia supernovae (SNe Ia) are used to study the cosmic transparency at optical wavelengths. Assuming a flat ΛCDM cosmological model based on BAO and CMB results, redshift dependent deviations of SN Ia distances are used to constrain mechanisms that would dim light. The analysis is based on the most recent Pantheon SN compilation, for which there is a 0.03± 0.01 {(stat)} mag discrepancy in the distant supernova distance moduli relative to the ΛCDM model anchored by supernovae at z measurements can be modeled with a cosmic dust density Ω _IGM^dust = 8 \\cdot 10^{-5} (1+z)^{-1}, corresponding to an average attenuation of 2 . 10-5 mag Mpc-1 in V-band. Forthcoming SN Ia studies may provide a definitive measurement of the IGM dust properties, while still providing an unbiased estimate of cosmological parameters by introducing additional parameters in the global fits to the observations.
Pair production of helicity-flipped neutrinos in supernovae
Energy Technology Data Exchange (ETDEWEB)
Perez, A.; Gandhi, R.
1989-07-03
We calculate the emissivity for the pair production of helicity-flipped neutrinos, in a way that can be used in supernova calculations. We also present some simple estimates which show that such processes can act as an efficient energy-loss mechanism in the shocked supernova core, and we use this fact to extract neutrino mass limits from SN1987A neutrino observations. 24 refs., 2 figs.
Energy Technology Data Exchange (ETDEWEB)
Graur, Or [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States); Bianco, Federica B.; Huang, Shan; Modjaz, Maryam [CCPP, New York University, 4 Washington Place, New York, NY 10003 (United States); Shivvers, Isaac; Filippenko, Alexei V.; Li, Weidong [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Eldridge, J. J., E-mail: or.graur@cfa.harvard.edu [Department of Physics, University of Auckland, Private Bag 92019, Auckland (New Zealand)
2017-03-10
Most types of supernovae (SNe) have yet to be connected with their progenitor stellar systems. Here, we reanalyze the 10-year SN sample collected during 1998–2008 by the Lick Observatory Supernova Search (LOSS) in order to constrain the progenitors of SNe Ia and stripped-envelope SNe (SE SNe, i.e., SNe IIb, Ib, Ic, and broad-lined Ic). We matched the LOSS galaxy sample with spectroscopy from the Sloan Digital Sky Survey and measured SN rates as a function of galaxy stellar mass, specific star formation rate, and oxygen abundance (metallicity). We find significant correlations between the SN rates and all three galaxy properties. The SN Ia correlations are consistent with other measurements, as well as with our previous explanation of these measurements in the form of a combination of the SN Ia delay-time distribution and the correlation between galaxy mass and age. The ratio between the SE SN and SN II rates declines significantly in low-mass galaxies. This rules out single stars as SE SN progenitors, and is consistent with predictions from binary-system progenitor models. Using well-known galaxy scaling relations, any correlation between the rates and one of the galaxy properties examined here can be expressed as a correlation with the other two. These redundant correlations preclude us from establishing causality—that is, from ascertaining which of the galaxy properties (or their combination) is the physical driver for the difference between the SE SN and SN II rates. We outline several methods that have the potential to overcome this problem in future works.
Graur, O.; Rodney, S. A.; Maoz, D.; Riess, A. G.; Jha, S. W.; Postman, M.; Dahlen, T.; Holoien, T. W.-S.; McCully, C.; Patel, B.;
2014-01-01
We present the supernova (SN) sample and Type-Ia SN (SN Ia) rates from the Cluster Lensing And Supernova survey with Hubble (CLASH). Using the Advanced Camera for Surveys and the Wide Field Camera 3 on the Hubble Space Telescope (HST), we have imaged 25 galaxy-cluster fields and parallel fields of non-cluster galaxies. We report a sample of 27 SNe discovered in the parallel fields. Of these SNe, approximately 13 are classified as SN Ia candidates, including four SN Ia candidates at redshifts z greater than 1.2.We measure volumetric SN Ia rates to redshift 1.8 and add the first upper limit on the SN Ia rate in the range z greater than 1.8 and less than 2.4. The results are consistent with the rates measured by the HST/ GOODS and Subaru Deep Field SN surveys.We model these results together with previous measurements at z less than 1 from the literature. The best-fitting SN Ia delay-time distribution (DTD; the distribution of times that elapse between a short burst of star formation and subsequent SN Ia explosions) is a power law with an index of 1.00 (+0.06(0.09))/(-0.06(0.10)) (statistical) (+0.12/-0.08) (systematic), where the statistical uncertainty is a result of the 68% and 95% (in parentheses) statistical uncertainties reported for the various SN Ia rates (from this work and from the literature), and the systematic uncertainty reflects the range of possible cosmic star-formation histories. We also test DTD models produced by an assortment of published binary population synthesis (BPS) simulations. The shapes of all BPS double-degenerate DTDs are consistent with the volumetric SN Ia measurements, when the DTD models are scaled up by factors of 3-9. In contrast, all BPS single-degenerate DTDs are ruled out by the measurements at greater than 99% significance level.
Time-resolved Polarimetry of the Superluminous SN 2015bn with the Nordic Optical Telescope
DEFF Research Database (Denmark)
Leloudas, Giorgos; Maund, Justyn R.; Gal-Yam, Avishay
2017-01-01
We present imaging polarimetry of the superluminous supernova SN 2015bn, obtained over nine epochs between -20 and +46 days with the Nordic Optical Telescope. This was a nearby, slowly evolving Type I superluminous supernova that has been studied extensively and for which two epochs of spectropol......We present imaging polarimetry of the superluminous supernova SN 2015bn, obtained over nine epochs between -20 and +46 days with the Nordic Optical Telescope. This was a nearby, slowly evolving Type I superluminous supernova that has been studied extensively and for which two epochs...... of spectropolarimetry are also available. Based on field stars, we determine the interstellar polarization in the Galaxy to be negligible. The polarization of SN 2015bn shows a statistically significant increase during the last epochs, confirming previous findings. Our well-sampled imaging polarimetry series allows us...
International Nuclear Information System (INIS)
Childress, M. J.; Scalzo, R. A.; Sim, S. A.; Tucker, B. E.; Yuan, F.; Schmidt, B. P.; Cenko, S. B.; Filippenko, A. V.; Silverman, J. M.; Contreras, C.; Hsiao, E. Y.; Phillips, M.; Morrell, N.; Jha, S. W.; McCully, C.; Anderson, J. P.; De Jaeger, T.; Forster, F.; Benetti, S.; Bufano, F.
2013-01-01
We present 65 optical spectra of the Type Ia SN 2012fr, 33 of which were obtained before maximum light. At early times, SN 2012fr shows clear evidence of a high-velocity feature (HVF) in the Si II λ6355 line that can be cleanly decoupled from the lower velocity ''photospheric'' component. This Si II λ6355 HVF fades by phase –5; subsequently, the photospheric component exhibits a very narrow velocity width and remains at a nearly constant velocity of ∼12,000 km s –1 until at least five weeks after maximum brightness. The Ca II infrared triplet exhibits similar evidence for both a photospheric component at v ≈ 12,000 km s –1 with narrow line width and long velocity plateau, as well as an HVF beginning at v ≈ 31,000 km s –1 two weeks before maximum. SN 2012fr resides on the border between the ''shallow silicon'' and ''core-normal'' subclasses in the Branch et al. classification scheme, and on the border between normal and high-velocity Type Ia supernovae (SNe Ia) in the Wang et al. system. Though it is a clear member of the ''low velocity gradient'' group of SNe Ia and exhibits a very slow light-curve decline, it shows key dissimilarities with the overluminous SN 1991T or SN 1999aa subclasses of SNe Ia. SN 2012fr represents a well-observed SN Ia at the luminous end of the normal SN Ia distribution and a key transitional event between nominal spectroscopic subclasses of SNe Ia.
High energy emission of supernova sn 1987a. Cosmic rays acceleration in mixed shocks
International Nuclear Information System (INIS)
Lehoucq, Roland
1992-01-01
In its first part, this research thesis reports the study of the high energy emission of the sn 1987 supernova, based on a Monte Carlo simulation of the transfer of γ photons emitted during disintegration of radioactive elements (such as "5"6Ni, "5"6Co, "5"7Co and "4"4Ti) produced during the explosion. One of the studied problems is the late evolution (beyond 1200 days) of light curvature which is very different when it is powered by the radiation of a central object or by radioactivity. The second part reports the study of acceleration of cosmic rays in two-fluid shock waves in order to understand the different asymmetries noticed in hot spots of extragalactic radio-sources. This work comprises the resolution of structure equations of a shock made of a conventional fluid and a relativistic one, in presence or absence of a magnetic field [fr
Type Ia supernovae, standardizable candles, and gravity
Wright, Bill S.; Li, Baojiu
2018-04-01
Type Ia supernovae (SNe Ia) are generally accepted to act as standardizable candles, and their use in cosmology led to the first confirmation of the as yet unexplained accelerated cosmic expansion. Many of the theoretical models to explain the cosmic acceleration assume modifications to Einsteinian general relativity which accelerate the expansion, but the question of whether such modifications also affect the ability of SNe Ia to be standardizable candles has rarely been addressed. This paper is an attempt to answer this question. For this we adopt a semianalytical model to calculate SNe Ia light curves in non-standard gravity. We use this model to show that the average rescaled intrinsic peak luminosity—a quantity that is assumed to be constant with redshift in standard analyses of Type Ia supernova (SN Ia) cosmology data—depends on the strength of gravity in the supernova's local environment because the latter determines the Chandrasekhar mass—the mass of the SN Ia's white dwarf progenitor right before the explosion. This means that SNe Ia are no longer standardizable candles in scenarios where the strength of gravity evolves over time, and therefore the cosmology implied by the existing SN Ia data will be different when analysed in the context of such models. As an example, we show that the observational SN Ia cosmology data can be fitted with both a model where (ΩM,ΩΛ)=(0.62 ,0.38 ) and Newton's constant G varies as G (z )=G0(1 +z )-1/4 and the standard model where (ΩM,ΩΛ)=(0.3 ,0.7 ) and G is constant, when the Universe is assumed to be flat.
Neutrino properties and supernova SN1987a
International Nuclear Information System (INIS)
Nussinov, S.
1989-01-01
The use of SN1987a to indicate how limits on neutrino properties can be deduced from the observed neutrino signals is shown. Bounds on possible deviations from relativity are briefly considered. The possible evidence for a half-millisecond pulsar in the SN remnant and on speculative attempts at finding the same periodicity in the neutrino signal are commented on. 37 refs
International Nuclear Information System (INIS)
Schaeffer, R.
1987-03-01
SN 1987A was unique in many aspects. The most striking, undoubtedly, is its low luminosity, nearly two orders of magnitude below the expectations based on supernovae currently observed in external galaxies. The rise time of the optical emission, usually a few days, was for SN 1987A, of the order of a few hours. Also its surface temperature is surprisingly low, 5000K. The neutrino burst has been detected. It was observed twice, with a time difference of 5 hours, the second burst occurring within 3 hours of the onset of the optical signal. In this talk, I will discuss how these strange events fit with the theoretical models of supernova explosions, how they differ in some cases, and try to evaluate the degree of certainty -or uncertainty- of our present knowledge on how these extremely powerful star explosions occur
Generation of Cosmic rays in Historical Supernova Remnants
Directory of Open Access Journals (Sweden)
Sinitsyna V.Y.
2013-06-01
Full Text Available We present the results of observations of two types of Galactic supernova remnants with the SHALON mirror Cherenkov telescope of Tien-Shan high-mountain Observatory: the shell-type supernova remnants Tycho, Cas A and IC 443; plerions Crab Nebula, 3c58(SN1181 and Geminga (probably plerion. The experimental data have confirmed the prediction of the theory about the hadronic generation mechanism of very high energy (800 GeV - 100 TeV gamma-rays in Tycho's supernova remnant. The data obtainedsuggest that the very high energy gamma-ray emission in the objects being discussedis different in origin.
Things begin to happen around Supernova 1987A
1994-01-01
On 23 February 1994, it will be exactly seven years since the explosion of Supernova 1987A in the Large Magellanic Cloud [1] was first observed, at a distance of approx. 160,000 light-years. It was the first naked-eye supernova to be seen in almost four hundred years. Few events in modern astronomy have met with such an enthusiastic response by the scientists and this famous object has been under constant surveillance ever since. After several years of relative quiescence, things are now beginning to happen in the immediate neighbourhood of SN 1987A. Recent observations with the ESO 3.5 m New Technology Telescope (NTT) indicate that interaction between the stellar material which was ejected during the explosion and the surrounding ring-shaped nebulae has started. This signals the beginning of a more active phase during which the supernova is likely to display a number of new and interesting phenomena, never before observed. SEVEN YEARS IN THE LIFE OF A SUPERNOVA After brightening to maximum light at about magnitude 3 a few months after the explosion, the long period of steady fading which is typical for supernovae, set in by mid-1987. The matter ejected by the explosion took the form of an expanding fireball, which began to spread through the nearly empty space around the supernova with a velocity of almost 10,000 km/sec. As it cooled, the temperature and therefore the total brightness decreased and the supernova became fainter and fainter. At the present moment, the magnitude of SN 1987A is about 18.5, that is almost 2 million times fainter than it was at maximum. Various phenomena have been observed around SN 1987A during the past years. Already in early 1988, light echoes were seen as concentric, slowly expanding luminous circles; they represent the reflections of the explosion light flash in interstellar clouds inside the Large Magellanic Cloud, between the supernova and us. In 1989, high-resolution observations with the NTT showed an elliptical ``ring
Probing Late-Stage Stellar Evolution through Robotic Follow-Up of Nearby Supernovae
Hosseinzadeh, Griffin
2018-01-01
Many of the remaining uncertainties in stellar evolution can be addressed through immediate and long-term photometry and spectroscopy of supernovae. The early light curves of thermonuclear supernovae can contain information about the nature of the binary companion to the exploding white dwarf. Spectra of core-collapse supernovae can reveal material lost by massive stars in their final months to years. Thanks to a revolution in technology—robotic telescopes, high-speed internet, machine learning—we can now routinely discover supernovae within days of explosion and obtain well-sampled follow-up data for months and years. Here I present three major results from the Global Supernova Project at Las Cumbres Observatory that take advantage of these technological advances. (1) SN 2017cbv is a Type Ia supernova discovered within a day of explosion. Early photometry shows a bump in the U-band relative to previously observed Type Ia light curves, possibly indicating the presence of a nondegenerate binary companion. (2) SN 2016bkv is a low-luminosity Type IIP supernova also caught very young. Narrow emission lines in the earliest spectra indicate interaction between the ejecta and a dense shell of circumstellar material, previously observed only in the brightest Type IIP supernovae. (3) Type Ibn supernovae are a rare class that interact with hydrogen-free circumstellar material. An analysis of the largest-yet sample of this class has found that their light curves are much more homogeneous and faster-evolving than their hydrogen-rich counterparts, Type IIn supernovae, but that their maximum-light spectra are more diverse.
On neutron star/supernova remnant associations
Gvaramadze, V. V.
2000-01-01
It is pointed out that a cavity supernova (SN) explosion of a moving massive star could result in a significant offset of the neutron star (NS) birth-place from the geometrical centre of the supernova remnant (SNR). Therefore: a) the high implied transverse velocities of a number of NSs (e.g. PSR B1610-50, PSR B1757-24, SGR0525-66) could be reduced; b) the proper motion vector of a NS should not necessarily point away from the geometrical centre of the associated SNR; c) the circle of possibl...
The effect of peculiar velocities on supernova cosmology
DEFF Research Database (Denmark)
Davis, Tamara Maree; Hui, Lam; Frieman, Joshua A.
2011-01-01
We analyze the effect that peculiar velocities have on the cosmological inferences we make using luminosity distance indicators, such as Type Ia supernovae. In particular we study the corrections required to account for (1) our own motion, (2) correlations in galaxy motions, and (3) a possible lo...... when future surveys aim for percent-level accuracy and we recommend our statistical approach to down-weighting peculiar velocities as a more robust option than a sharp low-redshift cut....... local under- or overdensity. For all of these effects we present a case study showing the impact on the cosmology derived by the Sloan Digital Sky Survey-II Supernova Survey (SDSS-II SN Survey). Correcting supernova (SN) redshifts for the cosmic microwave background (CMB) dipole slightly overcorrects...... nearby SNe that share some of our local motion. We show that while neglecting the CMB dipole would cause a shift in the derived equation of state of ¿w ~ 0.04 (at fixed O m ), the additional local-motion correction is currently negligible (¿w
THE EFFECT OF HOST GALAXIES ON TYPE Ia SUPERNOVAE IN THE SDSS-II SUPERNOVA SURVEY
International Nuclear Information System (INIS)
Lampeitl, Hubert; Smith, Mathew; Nichol, Robert C.; Bassett, Bruce; Cinabro, David; Dilday, Benjamin; Jha, Saurabh W.; Foley, Ryan J.; Frieman, Joshua A.; Garnavich, Peter M.; Goobar, Ariel; Nordin, Jakob; Im, Myungshin; Marriner, John; Miquel, Ramon; Oestman, Linda; Riess, Adam G.; Sako, Masao; Schneider, Donald P.; Sollerman, Jesper
2010-01-01
We present an analysis of the host galaxy dependences of Type Ia Supernovae (SNe Ia) from the full three year sample of the SDSS-II Supernova Survey. We re-discover, to high significance, the strong correlation between host galaxy type and the width of the observed SN light curve, i.e., fainter, quickly declining SNe Ia favor passive host galaxies, while brighter, slowly declining Ia's favor star-forming galaxies. We also find evidence (at between 2σ and 3σ) that SNe Ia are ≅0.1 ± 0.04 mag brighter in passive host galaxies than in star-forming hosts, after the SN Ia light curves have been standardized using the light-curve shape and color variations. This difference in brightness is present in both the SALT2 and MCLS2k2 light-curve fitting methodologies. We see evidence for differences in the SN Ia color relationship between passive and star-forming host galaxies, e.g., for the MLCS2k2 technique, we see that SNe Ia in passive hosts favor a dust law of R V = 1.0 ± 0.2, while SNe Ia in star-forming hosts require R V = 1.8 +0.2 -0.4 . The significance of these trends depends on the range of SN colors considered. We demonstrate that these effects can be parameterized using the stellar mass of the host galaxy (with a confidence of >4σ) and including this extra parameter provides a better statistical fit to our data. Our results suggest that future cosmological analyses of SN Ia samples should include host galaxy information.
The Type Ia Supernova Rate in Radio and Infrared Galaxies from the CFHT Supernova Legacy Survey
Graham, M. L.; Pritchet, C. J.; Sullivan, M.; Howell, D. A.; Gwyn, S. D. J.; Astier, P.; Balland, C.; Basa, S.; Carlberg, R. G.; Conley, A.; Fouchez, D.; Guy, J.; Hardin, D.; Hook, I. M.; Pain, R.
2009-01-01
We have combined the large SN Ia database of the Canada-France-Hawaii Telescope Supernova Legacy Survey and catalogs of galaxies with photometric redshifts, VLA 1.4 GHz radio sources, and Spitzer infrared sources. We present eight SNe Ia in early-type host galaxies which have counterparts in the radio and infrared source catalogs. We find the SN Ia rate in subsets of radio and infrared early-type galaxies is ~1-5 times the rate in all early-type galaxies, and that any enhancement is always
Matching Supernovae to Galaxies
Kohler, Susanna
2016-12-01
developed a new automated algorithm for matching supernovae to their host galaxies. Their work builds on currently existing algorithms and makes use of information about the nearby galaxies, accounts for the uncertainty of the match, and even includes a machine learning component to improve the matching accuracy.Gupta and collaborators test their matching algorithm on catalogs of galaxies and simulated supernova events to quantify how well the algorithm is able to accurately recover the true hosts.Successful MatchingThe matching algorithms accuracy (purity) as a function of the true supernova-host separation, the supernova redshift, the true hosts brightness, and the true hosts size. [Gupta et al. 2016]The authors find that when the basic algorithm is run on catalog data, it matches supernovae to their hosts with 91% accuracy. Including the machine learning component, which is run after the initial matching algorithm, improves the accuracy of the matching to 97%.The encouraging results of this work which was intended as a proof of concept suggest that methods similar to this could prove very practical for tackling future survey data. And the method explored here has use beyond matching just supernovae to their host galaxies: it could also be applied to other extragalactic transients, such as gamma-ray bursts, tidal disruption events, or electromagnetic counterparts to gravitational-wave detections.CitationRavi R. Gupta et al 2016 AJ 152 154. doi:10.3847/0004-6256/152/6/154
Dong, Subo; Katz, Boaz; Kollmeier, Juna A.; Kushnir, Doron; Elias-Rosa, N.; Bose, Subhash; Morrell, Nidia; Prieto, J. L.; Chen, Ping; Kochanek, C. S.; Brandt, G. M.; Holoien, T. W.-S.; Gal-Yam, Avishay; Morales-Garoffolo, Antonia; Parker, Stuart; Phillips, M. M.; Piro, Anthony L.; Shappee, B. J.; Simon, Joshua D.; Stanek, K. Z.
2018-06-01
We present nebular-phase spectra of the Type Ia supernova (SN Ia) 2016brx, a member of the 1991bg-like subclass that lies at the faint end of the SN Ia luminosity function. Nebular spectra are available for only three other 1991bg-like SNe, and their Co line centers are all within ≲ 500 km/s of each other. In contrast, the nebular Co line center of SN 2016brx is blue-shifted by >1500 km/s compared to them and by ≈1200 km/s compared to the rest frame. This is a significant shift relative to the narrow nebular line velocity dispersion of ≲ 2000 km/s of these SNe. The large range of nebular line shifts implies that the 56Ni in the ejecta of SN 1991bg-like events is off-center by ˜1000 km/s rather than universally centrally confined as previously suggested. With the addition of SN 2016brx, the Co nebular line shapes of 1991bg-like objects appear to connect with the brighter SNe Ia that show double-peaked profiles, hinting at a continuous distribution of line profiles among SNe Ia. One class of models to produce both off-center and bi-modal 56Ni distributions is collisions of white dwarfs with unequal and equal masses.
New possibilities in supernova accretion phase from dense matter effect
Chakraborty, S.; Mirizzi, A.; Saviano, N.
2012-07-01
We carry out a detailed analysis of the supernova (SN) neutrino flavor evolution during the accretion phase (at post-bounce times tpb Mikheyev-Smirnov-Wolfenstein effect in the SN mantle and Earth matter effects, can reveal the neutrino mass hierarchy in the likely case that the mixing angle θ13 is not very small.
New prospects for detecting high-energy neutrinos from nearby supernovae
Murase, Kohta
2018-04-01
Neutrinos from supernovae (SNe) are crucial probes of explosive phenomena at the deaths of massive stars and neutrino physics. High-energy neutrinos are produced through hadronic processes by cosmic rays, which are accelerated during interaction between the supernova (SN) ejecta and circumstellar material (CSM). Recent observations of extragalactic SNe have revealed that a dense CSM is commonly expelled by the progenitor star. We provide new quantitative predictions of time-dependent high-energy neutrino emission from diverse types of SNe. We show that IceCube and KM3Net can detect ˜103 events from a SN II-P (and ˜3 ×105 events from a SN IIn) at a distance of 10 kpc. The new model also enables us to critically optimize the time window for dedicated searches for nearby SNe. A successful detection will give us a multienergy neutrino view of SN physics and new opportunities to study neutrino properties, as well as clues to the cosmic-ray origin. GeV-TeV neutrinos may also be seen by KM3Net, Hyper-Kamiokande, and PINGU.
Gvaramadze, V. V.
Most of middle-aged supernova remnants (SNRs) have a distorted and complicated appearance which cannot be explained in the framework of the Sedov-Taylor model. We consider three typical examples of such SNRs (Vela SNR, MSH15-52, G309.2-00.6) and show that their structure could be explained as a result of interaction of a supernova (SN) blast wave with the ambient medium preprocessed by the action of the SN progenitor's wind and ionized emission.
HOW TO FIND GRAVITATIONALLY LENSED TYPE Ia SUPERNOVAE
International Nuclear Information System (INIS)
Goldstein, Daniel A.; Nugent, Peter E.
2017-01-01
Type Ia supernovae (SNe Ia) that are multiply imaged by gravitational lensing can extend the SN Ia Hubble diagram to very high redshifts ( z ≳ 2), probe potential SN Ia evolution, and deliver high-precision constraints on H _0, w , and Ω_m via time delays. However, only one, iPTF16geu, has been found to date, and many more are needed to achieve these goals. To increase the multiply imaged SN Ia discovery rate, we present a simple algorithm for identifying gravitationally lensed SN Ia candidates in cadenced, wide-field optical imaging surveys. The technique is to look for supernovae that appear to be hosted by elliptical galaxies, but that have absolute magnitudes implied by the apparent hosts’ photometric redshifts that are far brighter than the absolute magnitudes of normal SNe Ia (the brightest type of supernovae found in elliptical galaxies). Importantly, this purely photometric method does not require the ability to resolve the lensed images for discovery. Active galactic nuclei, the primary sources of contamination that affect the method, can be controlled using catalog cross-matches and color cuts. Highly magnified core-collapse SNe will also be discovered as a byproduct of the method. Using a Monte Carlo simulation, we forecast that the Large Synoptic Survey Telescope can discover up to 500 multiply imaged SNe Ia using this technique in a 10 year z -band search, more than an order of magnitude improvement over previous estimates. We also predict that the Zwicky Transient Facility should find up to 10 multiply imaged SNe Ia using this technique in a 3 year R -band search—despite the fact that this survey will not resolve a single system.
DEFF Research Database (Denmark)
Contreras, Carlos; Phillips, M. M.; Burns, Christopher R.
2018-01-01
We present detailed ultraviolet, optical, and near-infrared light curves of the Type Ia supernova (SN) 2012fr, which exploded in the Fornax cluster member NGC 1365. These precise high-cadence light curves provide a dense coverage of the flux evolution from -12 to +140 days with respect to the epo...
SN 2013fs and SN 2013fr: exploring the circumstellar-material diversity in Type II supernovae
Bullivant, Christopher; Smith, Nathan; Williams, G. Grant; Mauerhan, Jon C.; Andrews, Jennifer E.; Fong, Wen-Fai; Bilinski, Christopher; Kilpatrick, Charles D.; Milne, Peter A.; Fox, Ori D.; Cenko, S. Bradley; Filippenko, Alexei V.; Zheng, WeiKang; Kelly, Patrick L.; Clubb, Kelsey I.
2018-05-01
We present photometry and spectroscopy of SN 2013fs and SN 2013fr in the first ˜100 d post-explosion. Both objects showed transient, relatively narrow H α emission lines characteristic of SNe IIn, but later resembled normal SNe II-P or SNe II-L, indicative of fleeting interaction with circumstellar material (CSM). SN 2013fs was discovered within 8 h of explosion; one of the earliest SNe discovered thus far. Its light curve exhibits a plateau, with spectra revealing strong CSM interaction at early times. It is a less luminous version of the transitional SN IIn PTF11iqb, further demonstrating a continuum of CSM interaction intensity between SNe II-P and SNe IIn. It requires dense CSM within 6.5 × 1014 cm of the progenitor, from a phase of advanced pre-SN mass loss beginning shortly before explosion. Spectropolarimetry of SN 2013fs shows little continuum polarization (˜0.5 per cent, consistent with zero), but noticeable line polarization during the plateau phase. SN 2013fr morphed from an SN IIn at early times to an SN II-L. After the first epoch, its narrow lines probably arose from host-galaxy emission, but the bright, narrow H α emission at early times may be intrinsic to the SN. As for SN 2013fs, this would point to a short-lived phase of strong CSM interaction if proven to be intrinsic, suggesting a continuum between SNe IIn and SNe II-L. It is a low-velocity SN II-L like SN 2009kr, but more luminous. SN 2013fr also developed an infrared excess at later times, due to warm CSM dust that requires a more sustained phase of strong pre-SN mass loss.
Thielemann, Friedrich-Karl; Isern, Jordi; Perego, Albino; von Ballmoos, Peter
2018-04-01
We present the status and open problems of nucleosynthesis in supernova explosions of both types, responsible for the production of the intermediate mass, Fe-group and heavier elements (with the exception of the main s-process). Constraints from observations can be provided through individual supernovae (SNe) or their remnants (e.g. via spectra and gamma-rays of decaying unstable isotopes) and through surface abundances of stars which witness the composition of the interstellar gas at their formation. With a changing fraction of elements heavier than He in these stars (known as metallicity) the evolution of the nucleosynthesis in galaxies over time can be determined. A complementary way, related to gamma-rays from radioactive decays, is the observation of positrons released in β+-decays, as e.g. from ^{26}Al, ^{44}Ti, ^{56,57}Ni and possibly further isotopes of their decay chains (in competition with the production of e+e- pairs in acceleration shocks from SN remnants, pulsars, magnetars or even of particle physics origin). We discuss (a) the role of the core-collapse supernova explosion mechanism for the composition of intermediate mass, Fe-group (and heavier?) ejecta, (b) the transition from neutron stars to black holes as the final result of the collapse of massive stars, and the relation of the latter to supernovae, faint supernovae, and gamma-ray bursts/hypernovae, (c) Type Ia supernovae and their nucleosynthesis (e.g. addressing the ^{55}Mn puzzle), plus (d) further constraints from galactic evolution, γ-ray and positron observations. This is complemented by the role of rare magneto-rotational supernovae (related to magnetars) in comparison with the nucleosynthesis of compact binary mergers, especially with respect to forming the heaviest r-process elements in galactic evolution.
The Influence of Host Galaxies in Type Ia Supernova Cosmology
Energy Technology Data Exchange (ETDEWEB)
Uddin, Syed A. [Purple Mountain Observatory, Chinese Academy of Sciences, Nanjing, Jiangshu (China); Mould, Jeremy [Centre for Astrophysics and Supercomputing, Swinburne University of Technology, Melbourne, VIC (Australia); Lidman, Chris; Zhang, Bonnie R. [Australian Research Council Centre of Excellence for All-sky Astrophysics (CAASTRO) (Australia); Ruhlmann-Kleider, Vanina, E-mail: saushuvo@gmail.com [CEA, Centre de Saclay, Irfu/SPP, F-91191 Gif-sur-Yvette, Paris (France)
2017-10-10
We use a sample of 1338 spectroscopically confirmed and photometrically classified Type Ia supernovae (SNe Ia) sourced from Carnegie Supernova Project, Center for Astrophysics Supernova Survey, Sloan Digital Sky Survey-II, and SuperNova Legacy Survey SN samples to examine the relationships between SNe Ia and the galaxies that host them. Our results provide confirmation with improved statistical significance that SNe Ia, after standardization, are on average more luminous in massive hosts (significance >5 σ ), and decline more rapidly in massive hosts (significance >9 σ ) and in hosts with low specific star formation rates (significance >8 σ ). We study the variation of these relationships with redshift and detect no evolution. We split SNe Ia into pairs of subsets that are based on the properties of the hosts and fit cosmological models to each subset. Including both systematic and statistical uncertainties, we do not find any significant shift in the best-fit cosmological parameters between the subsets. Among different SN Ia subsets, we find that SNe Ia in hosts with high specific star formation rates have the least intrinsic scatter ( σ {sub int} = 0.08 ± 0.01) in luminosity after standardization.
Supernova Cosmology in the Big Data Era
Kessler, Richard
Here we describe large "Big Data" Supernova (SN) Ia surveys, past and present, used to make precision measurements of cosmological parameters that describe the expansion history of the universe. In particular, we focus on surveys designed to measure the dark energy equation of state parameter w and its dependence on cosmic time. These large surveys have at least four photometric bands, and they use a rolling search strategy in which the same instrument is used for both discovery and photometric follow-up observations. These surveys include the Supernova Legacy Survey (SNLS), Sloan Digital Sky Survey II (SDSS-II), Pan-STARRS 1 (PS1), Dark Energy Survey (DES), and Large Synoptic Survey Telescope (LSST). We discuss the development of how systematic uncertainties are evaluated, and how methods to reduce them play a major role is designing new surveys. The key systematic effects that we discuss are (1) calibration, measuring the telescope efficiency in each filter band, (2) biases from a magnitude-limited survey and from the analysis, and (3) photometric SN classification for current surveys that don't have enough resources to spectroscopically confirm each SN candidate.
A MISSING-LINK IN THE SUPERNOVA–GRB CONNECTION: THE CASE OF SN 2012ap
Energy Technology Data Exchange (ETDEWEB)
Chakraborti, Sayan; Soderberg, Alicia; Kamble, Atish; Margutti, Raffaella; Milisavljevic, Dan; Dittmann, Jason [Institute for Theory and Computation, Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Chomiuk, Laura [Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States); Yadav, Naveen; Ray, Alak [Tata Institute of Fundamental Research, 1 Homi Bhabha Road, Mumbai 400005 (India); Hurley, Kevin [Space Sciences Laboratory, University of California, 7 Gauss Way, Berkeley, CA 94720 (United States); Bietenholz, Michael [Department of Physics and Astronomy, York University, 4700 Keele St., M3J 1P3 Ontario (Canada); Brunthaler, Andreas [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Pignata, Giuliano [Departamento de Ciencias Fisicas, Universidad Andres Bello, Avda. Republica 252, Santiago (Chile); Pian, Elena [Scuola Normale Superiore, Piazza Dei Cavalieri 7—I-56126 Pisa (Italy); Mazzali, Paolo [Liverpool John Moores University, IC2, 146 Brownlow Hill, Liverpool (United Kingdom); Fransson, Claes [Department of Astronomy, Stockholm University, AlbaNova, SE-106 91 Stockholm (Sweden); Bartel, Norbert [Hartebeesthoek Radio Astronomy Observatory, PO Box 443, Krugersdrop, 1740 (South Africa); Hamuy, Mario [Departamento de Astronoma, Universidad de Chile (Chile); Levesque, Emily [University of Colorado, C327A, Boulder, CO 80309 (United States); MacFadyen, Andrew, E-mail: schakraborti@fas.harvard.edu [New York University, 4 Washington Place, New York, NY 10003 (United States); and others
2015-06-01
Gamma-ray bursts (GRBs) are characterized by ultra-relativistic outflows, while supernovae are generally characterized by non-relativistic ejecta. GRB afterglows decelerate rapidly, usually within days, because their low-mass ejecta rapidly sweep up a comparatively larger mass of circumstellar material. However, supernovae with heavy ejecta can be in nearly free expansion for centuries. Supernovae were thought to have non-relativistic outflows except for a few relativistic ones accompanied by GRBs. This clear division was blurred by SN 2009bb, the first supernova with a relativistic outflow without an observed GRB. However, the ejecta from SN 2009bb was baryon loaded and in nearly free expansion for a year, unlike GRBs. We report the first supernova discovered without a GRB but with rapidly decelerating mildly relativistic ejecta, SN 2012ap. We discovered a bright and rapidly evolving radio counterpart driven by the circumstellar interaction of the relativistic ejecta. However, we did not find any coincident GRB with an isotropic fluence of more than one-sixth of the fluence from GRB 980425. This shows for the first time that central engines in SNe Ic, even without an observed GRB, can produce both relativistic and rapidly decelerating outflows like GRBs.
A MISSING-LINK IN THE SUPERNOVA–GRB CONNECTION: THE CASE OF SN 2012ap
International Nuclear Information System (INIS)
Chakraborti, Sayan; Soderberg, Alicia; Kamble, Atish; Margutti, Raffaella; Milisavljevic, Dan; Dittmann, Jason; Chomiuk, Laura; Yadav, Naveen; Ray, Alak; Hurley, Kevin; Bietenholz, Michael; Brunthaler, Andreas; Pignata, Giuliano; Pian, Elena; Mazzali, Paolo; Fransson, Claes; Bartel, Norbert; Hamuy, Mario; Levesque, Emily; MacFadyen, Andrew
2015-01-01
Gamma-ray bursts (GRBs) are characterized by ultra-relativistic outflows, while supernovae are generally characterized by non-relativistic ejecta. GRB afterglows decelerate rapidly, usually within days, because their low-mass ejecta rapidly sweep up a comparatively larger mass of circumstellar material. However, supernovae with heavy ejecta can be in nearly free expansion for centuries. Supernovae were thought to have non-relativistic outflows except for a few relativistic ones accompanied by GRBs. This clear division was blurred by SN 2009bb, the first supernova with a relativistic outflow without an observed GRB. However, the ejecta from SN 2009bb was baryon loaded and in nearly free expansion for a year, unlike GRBs. We report the first supernova discovered without a GRB but with rapidly decelerating mildly relativistic ejecta, SN 2012ap. We discovered a bright and rapidly evolving radio counterpart driven by the circumstellar interaction of the relativistic ejecta. However, we did not find any coincident GRB with an isotropic fluence of more than one-sixth of the fluence from GRB 980425. This shows for the first time that central engines in SNe Ic, even without an observed GRB, can produce both relativistic and rapidly decelerating outflows like GRBs
A GRB and Broad-lined Type Ic Supernova from a Single Central Engine
Barnes, Jennifer; Duffell, Paul C.; Liu, Yuqian; Modjaz, Maryam; Bianco, Federica B.; Kasen, Daniel; MacFadyen, Andrew I.
2018-06-01
Unusually high velocities (≳0.1c) and correspondingly high kinetic energies have been observed in a subset of Type Ic supernovae (so-called “broad-lined Ic” supernovae; SNe Ic-BL), prompting a search for a central engine model capable of generating such energetic explosions. A clue to the explosion mechanism may lie in the fact that all supernovae that accompany long-duration gamma-ray bursts (GRBs) belong to the SN Ic-BL class. Using a combination of two-dimensional relativistic hydrodynamics and radiation transport calculations, we demonstrate that the central engine responsible for long GRBs can also trigger an SN Ic-BL. We find that a reasonable GRB engine injected into a stripped Wolf–Rayet progenitor produces a relativistic jet with energy ∼1051 erg, as well as an SN whose synthetic light curves and spectra are fully consistent with observed SNe Ic-BL during the photospheric phase. As a result of the jet’s asymmetric energy injection, the SN spectra and light curves depend on viewing angle. The impact of viewing angle on the spectrum is particularly pronounced at early times, while the viewing-angle dependence for the light curves (∼10% variation in bolometric luminosity) persists throughout the photospheric phase.
Gamma-ray observations of supernovae SN1987A
International Nuclear Information System (INIS)
Souza, C.A.W.; Neri, J.A.C.F.; Jayanthi, U.B.
1988-01-01
Theoretical investigations of supernovae explosions predict a high emission of gamma rays (∼ 10 -2 photons.cm -2 .s -1 ) beginning around 300 days after explosion. A balloon-borne experiment was flown in October, 1987, to observe this emission. The payload carried 4 phoswich detectors of BGO/CsI and NaI/CsI with areas 169 cm 2 and 100 cm 2 , respectively. The detectors' sensitivity (for 10000 s at 3g/cm 3 with error bar of 3 σ) is about 10 -3 ∼ 10 -4 photons. cm -2 .s -1 at energies above 200 KeV. The detectors mounted on a stabilized platform observed the supernova for about 2 hours. The data are being analized for pulsations (≥ 0.5 ms) and gamma ray emission. Energy spectra and temporal analysis will be presented and discussed. (author) [pt
The discovery of the most distant known type Ia supernova at redshift 1.914
DEFF Research Database (Denmark)
Jones, Dennis; Rodney, S.A.; Riess, A.G.
2013-01-01
We present the discovery of a Type Ia supernova (SN) at redshift z = 1.914 from the CANDELS multi-cycle treasury program on the Hubble Space Telescope (HST). This SN was discovered in the infrared using the Wide-Field Camera 3, and it is the highest-redshift Type Ia SN yet observed. We classify t...
First-Year Spectroscopy for the SDSS-II Supernova Survey
Energy Technology Data Exchange (ETDEWEB)
Zheng, Chen; Romani, Roger W.; Sako, Masao; Marriner, John; Bassett, Bruce; Becker, Andrew; Choi, Changsu; Cinabro, David; DeJongh, Fritz; Depoy, Darren L.; Dilday, Ben; Doi, Mamoru; Frieman, Joshua A.; Garnavich, Peter M.; Hogan, Craig J.; Holtzman, Jon; Im, Myungshin; Jha, Saurabh; Kessler, Richard; Konishi, Kohki; Lampeitl, Hubert
2008-03-25
This paper presents spectroscopy of supernovae discovered in the first season of the Sloan Digital Sky Survey-II Supernova Survey. This program searches for and measures multi-band light curves of supernovae in the redshift range z = 0.05-0.4, complementing existing surveys at lower and higher redshifts. Our goal is to better characterize the supernova population, with a particular focus on SNe Ia, improving their utility as cosmological distance indicators and as probes of dark energy. Our supernova spectroscopy program features rapid-response observations using telescopes of a range of apertures, and provides confirmation of the supernova and host-galaxy types as well as precise redshifts. We describe here the target identification and prioritization, data reduction, redshift measurement, and classification of 129 SNe Ia, 16 spectroscopically probable SNe Ia, 7 SNe Ib/c, and 11 SNe II from the first season. We also describe our efforts to measure and remove the substantial host galaxy contamination existing in the majority of our SN spectra.
Prompt emission from tidal disruptions of white dwarfs by intermediate mass black holes
Directory of Open Access Journals (Sweden)
Laguna P.
2012-12-01
Full Text Available We present a qualitative picture of prompt emission from tidal disruptions of white dwarfs (WD by intermediate mass black holes (IMBH. The smaller size of an IMBH compared to a supermassive black hole and a smaller tidal radius of a WD disruption lead to a very fast event with high peak luminosity. Magnetic field is generated in situ following the tidal disruption, which leads to effective accretion. Since large-scale magnetic field is also produced, geometrically thick super-Eddington inflow leads to a relativistic jet. The dense jet possesses a photosphere, which emits quasi-thermal radiation in soft X-rays. The source can be classified as a long low-luminosity gamma-ray burst (ll-GRB. Tidal compression of a WD causes nuclear ignition, which is observable as an accompanying supernova. We suggest that GRB060218 and SN2006aj is such a pair of ll-GRB and supernova. We argue that in a flux-limited sample the disruptions of WDs by IMBHs are more frequent then the disruptions of other stars by IMBHs.
Discovery of a Supernova in HST imaging of the MACSJ0717 Frontier Field
Rodney, Steven A.; Lotz, Jennifer; Strolger, Louis-Gregory
2013-10-01
We report the discovery of a supernova (SN) in Hubble Space Telescope (HST) observations centered on the galaxy cluster MACSJ0717. It was discovered in the F814W (i) band of the Advanced Camera for Surveys (ACS), in observations that were collected as part of the ongoing HST Frontier Fields (HFF) program (PI:J.Lotz, HST PID 13498). The FrontierSN ID for this object is SN HFF13Zar (nicknamed "SN Zara").
Observed Type II supernova colours from the Carnegie Supernova Project-I
de Jaeger, T.; Anderson, J. P.; Galbany, L.; González-Gaitán, S.; Hamuy, M.; Phillips, M. M.; Stritzinger, M. D.; Contreras, C.; Folatelli, G.; Gutiérrez, C. P.; Hsiao, E. Y.; Morrell, N.; Suntzeff, N. B.; Dessart, L.; Filippenko, A. V.
2018-06-01
We present a study of observed Type II supernova (SN II) colours using optical/near-infrared photometric data from the Carnegie Supernovae Project-I. We analyse four colours (B - V, u - g, g - r, and g - Y) and find that SN II colour curves can be described by two linear regimes during the photospheric phase. The first (s1, colour) is steeper and has a median duration of ˜40 d. The second, shallower slope (s2, colour) lasts until the end of the `plateau' (˜80 d). The two slopes correlate in the sense that steeper initial colour curves also imply steeper colour curves at later phases. As suggested by recent studies, SNe II form a continuous population of objects from the colour point of view as well. We investigate correlations between the observed colours and a range of photometric and spectroscopic parameters including the absolute magnitude, the V-band light-curve slopes, and metal-line strengths. We find that less luminous SNe II appear redder, a trend that we argue is not driven by uncorrected host-galaxy reddening. While there is significant dispersion, we find evidence that redder SNe II (mainly at early epochs) display stronger metal-line equivalent widths. Host-galaxy reddening does not appear to be a dominant parameter, neither driving observed trends nor dominating the dispersion in observed colours. Intrinsic SN II colours are most probably dominated by photospheric temperature differences, with progenitor metallicity possibly playing a minor role. Such temperature differences could be related to differences in progenitor radius, together with the presence or absence of circumstellar material close to the progenitor stars.
HOW TO FIND GRAVITATIONALLY LENSED TYPE Ia SUPERNOVAE
Energy Technology Data Exchange (ETDEWEB)
Goldstein, Daniel A.; Nugent, Peter E. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States)
2017-01-01
Type Ia supernovae (SNe Ia) that are multiply imaged by gravitational lensing can extend the SN Ia Hubble diagram to very high redshifts ( z ≳ 2), probe potential SN Ia evolution, and deliver high-precision constraints on H {sub 0}, w , and Ω{sub m} via time delays. However, only one, iPTF16geu, has been found to date, and many more are needed to achieve these goals. To increase the multiply imaged SN Ia discovery rate, we present a simple algorithm for identifying gravitationally lensed SN Ia candidates in cadenced, wide-field optical imaging surveys. The technique is to look for supernovae that appear to be hosted by elliptical galaxies, but that have absolute magnitudes implied by the apparent hosts’ photometric redshifts that are far brighter than the absolute magnitudes of normal SNe Ia (the brightest type of supernovae found in elliptical galaxies). Importantly, this purely photometric method does not require the ability to resolve the lensed images for discovery. Active galactic nuclei, the primary sources of contamination that affect the method, can be controlled using catalog cross-matches and color cuts. Highly magnified core-collapse SNe will also be discovered as a byproduct of the method. Using a Monte Carlo simulation, we forecast that the Large Synoptic Survey Telescope can discover up to 500 multiply imaged SNe Ia using this technique in a 10 year z -band search, more than an order of magnitude improvement over previous estimates. We also predict that the Zwicky Transient Facility should find up to 10 multiply imaged SNe Ia using this technique in a 3 year R -band search—despite the fact that this survey will not resolve a single system.
Observational and theoretical spectra of supernovae
Wheeler, J. Craig; Swartz, Douglas A.; Harkness, Robert P.
1993-05-01
Progress in nuclear astrophysics by means of quantitative supernova spectroscopy is discussed with special concentration on type Ia, Ib and Ic and on SN 1987A. Spectral calculations continue to support an exploding C/O white dwarf as the best model of a SN Ia. Deflagration model W7 produces good maximum light spectra of SN Ia and seems to have a better composition distribution compared to delayed detonation models, but proper treatment of opacity remains a problem and the physical basis of SN Ia explosions is still not completely understood. All models for SN Ia predict large quantities of 56Co in the ejecta, but it is not clear that observations confirm this. Although the evolutionary origin of SN Ia remains uncertain, there is recent evidence that transfer of hydrogen in a binary system may be involved, as long suspected. There has been progress in comparing dynamical models with the optical/IR spectra of SN 1987A. The evolution of the [OI] λλ6300, 6364 feature and the presence of strong persistent HeI λ10 830 indicate that both the envelope and core material contribute substantially to the formation of emission lines in the nebular phase and that neither the core nor the envelope can be neglected. Blending with nearby hydrogen lines may affect both of these spectral features, thereby complicating the analysis of the lines. The effects of continuum transfer and photoionization have been included and are under study. The discrepancies between theoretical and observed spectra are due primarily to the one-dimensional hydrodynamic models. The spectral data are not consistent with the high density ``spike'' (in radial coordinate) of the core material that is predicted by all such models. Analysis of the light curves of SN Ib and SN Ic supernovae implies that there are significant differences in their physical properties. Some SN Ib have considerably more ejecta mass than SN Ic events. SN Ib require He-rich atmospheres to produce the observed strong optical lines of
Constraints on high-energy neutrino emission from SN 2008D
Abbasi, R.; Abdou, Y.; Abu-Zayyad, T.; Adams, J.; Aguilar, J.A.; Ahlers, M.; Andeen, K.; Auffenberg, J.; Bai, X.; Baker, M.; Barwick, S.W.; Bay, R.; Alba, J.L.B.; Beattie, K.; Beatty, J.J.; Bechet, S.; Becker, J.K.; Becker, K.H.; Benabderrahmane, M.L.; BenZvi, S.; Berdermann, J.; Berghaus, P.; Berley, D.; Bernardini, E.; Bertrand, D.; Besson, D.Z.; Bissok, M.; Blaufuss, E.; Blumenthal, J.; Boersma, D.J.; Bohm, C.; Bose, D.; Boser, S.; Botner, O.; Braun, J.; Buitink, S.; Carson, M.; Chirkin, D.; Christy, B.; Clem, J.; Clevermann, F.; Cohen, S.; Colnard, C.; Cowen, D.F.; D'Agostino, M.V.; Danninger, M.; Davis, J.C.; Clercq, C. De; Demirors, L.; Depaepe, O.; Descamps, F.; Desiati, P.; Vries-Uiterweerd, G. de; DeYoung, T.; Diaz-Velez, J.C.; Dierckxsens, M.; Dreyer, J.; Dumm, J.P.; Duvoort, M.R.; Ehrlich, R.; Eisch, J.; Ellsworth, R.W.; Engdegard, O.; Euler, S.; Evenson, P.A.; Fadiran, O.; Fazely, A.R.; Fedynitch, A.; Feusels, T.; Filimonov, K.; Finley, C.; Foerster, M.M.; Fox, B.D.; Franckowiak, A.; Franke, R.; Gaisser, T.K.; Gallagher, J.; Geisler, M.; Gerhardt, L.; Gladstone, L.; Glusenkamp, T.; Goldschmidt, A.; Goodman, J.A.; Grant, D.; Griesel, T.; Gross, A.; Grullon, S.; Gurtner, M.; Ha, C.; Hallgren, A.; Halzen, F.; Han, K.; Hanson, K.; Helbing, K.; Herquet, P.; Hickford, S.; Hill, G.C.; Hoffman, K.D.; Homeier, A.; Hoshina, K.; Lafebre, S.J.; et al.,
2011-01-01
SN 2008D, a core collapse supernova at a distance of 27 Mpc, was serendipitously discovered by the Swift satellite through an associated X-ray flash. Core collapse supernovae have been observed in association with long gamma-ray bursts and X-ray flashes and a physical connection is widely assumed.
Levan, A.J.; Tanvir, N. R.; Fruchter, A. S.; Hjorth, J.; Pian, E.; Mazzali, P.; Hounsell, R. A.; Perley, D. A.; Cano, Z.; Graham, J.;
2014-01-01
We present Hubble Space Telescope (HST) observations of the exceptionally bright and luminous Swift gamma-ray burst, GRB 130427A. At z=0.34 this burst affords an excellent opportunity to study the supernova and host galaxy associated with an intrinsically extremely luminous burst (E(sub iso) greater than 10(exp 54) erg): more luminous than any previous GRB with a spectroscopically associated supernova. We use the combination of the image quality, UV capability and and invariant PSF of HST to provide the best possible separation of the afterglow, host and supernova contributions to the observed light approximately 17 rest-frame days after the burst utilising a host subtraction spectrum obtained 1 year later. Advanced Camera for Surveys (ACS) grism observations show that the associated supernova, SN 2013cq, has an overall spectral shape and luminosity similar to SN 1998bw (with a photospheric velocity, vph approximately 15,000 kilometers per second). The positions of the bluer features are better matched by the higher velocity SN 2010bh (vph approximately 30,000 kilometers per second), but SN 2010bh (vph approximately 30,000 kilometers per second but this SN is significantly fainter, and fails to reproduce the overall spectral shape, perhaps indicative of velocity structure in the ejecta. We find that the burst originated approximately 4 kpc from the nucleus of a moderately star forming (1 Solar Mass yr(exp-1)), possibly interacting disc galaxy. The absolute magnitude, physical size and morphology of this galaxy, as well as the location of the GRB within it are also strikingly similar to those of GRB980425SN 1998bw. The similarity of supernovae and environment from both the most luminous and least luminous GRBs suggests broadly similar progenitor stars can create GRBs across six orders of magnitude in isotropic energy.
Supernova 2010as: the lowest-velocity member of a family of flat-velocity type IIb supernovae
Energy Technology Data Exchange (ETDEWEB)
Folatelli, Gastón; Bersten, Melina C.; Nomoto, Ken' ichi [Kavli Institute for the Physics and Mathematics of the Universe (WPI), The University of Tokyo, Kashiwa, Chiba 277-8583 (Japan); Kuncarayakti, Hanindyo; Hamuy, Mario [Departamento de Astronomía, Universidad de Chile, Casilla 36-D, Santiago (Chile); Olivares Estay, Felipe; Pignata, Giuliano [Departamento de Ciencias Fisicas, Universidad Andres Bello, Avda. Republica 252, Santiago (Chile); Anderson, Joseph P. [European Southern Observatory, Alonso de Cordova 3107, Vitacura, Santiago (Chile); Holmbo, Simon; Stritzinger, Maximilian [Department of Physics and Astronomy, Aarhus University, Ny Munkegade 120, DK-8000 Aarhus C (Denmark); Maeda, Keiichi [Department of Astronomy, Kyoto University, Kitashirakawa-Oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Morrell, Nidia; Contreras, Carlos; Phillips, Mark M. [Las Campanas Observatory, Carnegie Observatories, Casilla 601, La Serena (Chile); Förster, Francisco [Center for Mathematical Modelling, Universidad de Chile, Avenida Blanco Encalada 2120 Piso 7, Santiago (Chile); Prieto, José Luis [Department of Astrophysical Sciences, Princeton University, 4 Ivy Lane, Peyton Hall, Princeton, NJ 08544 (United States); Valenti, Stefano [Las Cumbres Observatory Global Telescope Network, 6740 Cortona Drive, Suite 102, Goleta, CA 93117 (United States); Afonso, Paulo; Altenmüller, Konrad; Elliott, Jonny, E-mail: gaston.folatelli@ipmu.jp [Max-Planck-Institut für extraterrestrische Physik, Giessenbachstraße 1, D-85740 Garching (Germany); and others
2014-09-01
We present extensive optical and near-infrared photometric and spectroscopic observations of the stripped-envelope supernova SN 2010as. Spectroscopic peculiarities such as initially weak helium features and low expansion velocities with a nearly flat evolution place this object in the small family of events previously identified as transitional Type Ib/c supernovae (SNe). There is ubiquitous evidence of hydrogen, albeit weak, in this family of SNe, indicating that they are in fact a peculiar kind of Type IIb SNe that we name 'flat-velocity' Type IIb. The flat-velocity evolution—which occurs at different levels between 6000 and 8000 km s{sup –1} for different SNe—suggests the presence of a dense shell in the ejecta. Despite the spectroscopic similarities, these objects show surprisingly diverse luminosities. We discuss the possible physical or geometrical unification picture for such diversity. Using archival Hubble Space Telescope images, we associate SN 2010as with a massive cluster and derive a progenitor age of ≈6 Myr, assuming a single star-formation burst, which is compatible with a Wolf-Rayet progenitor. Our hydrodynamical modeling, on the contrary, indicates that the pre-explosion mass was relatively low, ≈4 M {sub ☉}. The seeming contradiction between a young age and low pre-SN mass may be solved by a massive interacting binary progenitor.
The 20th anniversary of SN1987A
Energy Technology Data Exchange (ETDEWEB)
Suzuki, A [KEK, High Energy Accelerator Research Organization, Oho 1-1, Tsukuba, Ibaragi, 305-0801 (Japan)], E-mail: atsuto.suzuki@kek.jp
2008-07-15
Observation of a neutrino burst from the supernova, SN1987A opened a new window of observational astronomy by neutrinos. And the history showed that the SN1987A neutrino burst observation was the vanguard of successive discoveries of neutrino properties by Super-Kamiokande, SNO, K2K, KamLAND and so on. On the occasion of the SN1987A 20th anniversary, the backstage story up to the discovery of the SN1987A neutrino bursts is summarized, tracing the Kamiokande log-note and including the IMB, LSD and Baksan data.
The cosmic transparency measured with Type Ia supernovae: implications for intergalactic dust
Goobar, Ariel; Dhawan, Suhail; Scolnic, Daniel
2018-06-01
Observations of high-redshift Type Ia supernovae (SNe Ia) are used to study the cosmic transparency at optical wavelengths. Assuming a flat Λ cold dark matter (ΛCDM) cosmological model based on baryon acoustic oscillations and cosmic microwave background measurements, redshift dependent deviations of SN Ia distances are used to constrain mechanisms that would dim light. The analysis is based on the most recent Pantheon SN compilation, for which there is a 0.03 ± 0.01 {({stat})} mag discrepancy in the distant supernova distance moduli relative to the ΛCDM model anchored by supernovae at z < 0.05. While there are known systematic uncertainties that combined could explain the observed offset, here we entertain the possibility that the discrepancy may instead be explained by scattering of supernova light in the intergalactic medium (IGM). We focus on two effects: Compton scattering by free electrons and extinction by dust in the IGM. We find that if the discrepancy is entirely due to dimming by dust, the measurements can be modelled with a cosmic dust density Ω _IGM^dust = 8 × 10^{-5} (1+z)^{-1}, corresponding to an average attenuation of 2 × 10-5 mag Mpc-1 in V band. Forthcoming SN Ia studies may provide a definitive measurement of the IGM dust properties, while still providing an unbiased estimate of cosmological parameters by introducing additional parameters in the global fits to the observations.
International Nuclear Information System (INIS)
Zheng, WeiKang; Filippenko, Alexei V.; Nugent, Peter E.; Graham, Melissa; Kelly, Patrick L.; Fox, Ori D.; Shivvers, Isaac; Clubb, Kelsey I.; Li, Weidong; Silverman, Jeffrey M.; Howie Marion, G.; Kasen, Daniel; Wang, Xiaofeng; Valenti, Stefano; Howell, D. Andrew; Ciabattari, Fabrizio; Cenko, S. Bradley; Balam, Dave; Hsiao, Eric; Sand, David
2013-01-01
The Type Ia supernova (SN Ia) 2013dy in NGC 7250 (d ≈ 13.7 Mpc) was discovered by the Lick Observatory Supernova Search. Combined with a prediscovery detection by the Italian Supernova Search Project, we are able to constrain the first-light time of SN 2013dy to be only 0.10 ± 0.05 days (2.4 ± 1.2 hr) before the first detection. This makes SN 2013dy the earliest known detection of an SN Ia. We infer an upper limit on the radius of the progenitor star of R 0 ≲ 0.25 R ☉ , consistent with that of a white dwarf. The light curve exhibits a broken power law with exponents of 0.88 and then 1.80. A spectrum taken 1.63 days after first light reveals a C II absorption line comparable in strength to Si II. This is the strongest C II feature ever detected in a normal SN Ia, suggesting that the progenitor star had significant unburned material. The C II line in SN 2013dy weakens rapidly and is undetected in a spectrum 7 days later, indicating that C II is detectable for only a very short time in some SNe Ia. SN 2013dy reached a B-band maximum of M B = –18.72 ± 0.03 mag ∼17.7 days after first light
Energy Technology Data Exchange (ETDEWEB)
Zheng, WeiKang; Filippenko, Alexei V.; Nugent, Peter E.; Graham, Melissa; Kelly, Patrick L.; Fox, Ori D.; Shivvers, Isaac; Clubb, Kelsey I.; Li, Weidong [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Silverman, Jeffrey M.; Howie Marion, G. [Department of Astronomy, University of Texas, Austin, TX 78712 (United States); Kasen, Daniel [Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Wang, Xiaofeng [Department of Physics, Tsinghua University, Beijing 100084 (China); Valenti, Stefano; Howell, D. Andrew [Las Cumbres Observatory Global Telescope Network, 6740 Cortona Drive, Suite 102, Santa Barbara, CA 93117 (United States); Ciabattari, Fabrizio [Monte Agliale Observatory, Borgo a Mozzano, Lucca, I-55023 Italy (Italy); Cenko, S. Bradley [Astrophysics Science Division, NASA Goddard Space Flight Center, Mail Code 661, Greenbelt, MD 20771 (United States); Balam, Dave [Dominion Astrophysical Observatory, Herzberg Institute of Astrophysics, National Research Council of Canada, 5071 West Saanich Road, Victoria, BC V9E 2E7 (Canada); Hsiao, Eric [Carnegie Observatories, Las Campanas Observatory, Colina El Pino, Casilla 601 (Chile); Sand, David, E-mail: zwk@astro.berkeley.edu [Physics Department, Texas Tech University, Lubbock, TX 79409 (United States); and others
2013-11-20
The Type Ia supernova (SN Ia) 2013dy in NGC 7250 (d ≈ 13.7 Mpc) was discovered by the Lick Observatory Supernova Search. Combined with a prediscovery detection by the Italian Supernova Search Project, we are able to constrain the first-light time of SN 2013dy to be only 0.10 ± 0.05 days (2.4 ± 1.2 hr) before the first detection. This makes SN 2013dy the earliest known detection of an SN Ia. We infer an upper limit on the radius of the progenitor star of R {sub 0} ≲ 0.25 R {sub ☉}, consistent with that of a white dwarf. The light curve exhibits a broken power law with exponents of 0.88 and then 1.80. A spectrum taken 1.63 days after first light reveals a C II absorption line comparable in strength to Si II. This is the strongest C II feature ever detected in a normal SN Ia, suggesting that the progenitor star had significant unburned material. The C II line in SN 2013dy weakens rapidly and is undetected in a spectrum 7 days later, indicating that C II is detectable for only a very short time in some SNe Ia. SN 2013dy reached a B-band maximum of M{sub B} = –18.72 ± 0.03 mag ∼17.7 days after first light.
Energy Technology Data Exchange (ETDEWEB)
Galbany, Lluis [Institut de Fisica d' Altes Energies (IFAE), Barcelona (Spain); et al.
2012-08-20
We use type-Ia supernovae (SNe Ia) discovered by the SDSS-II SN Survey to search for dependencies between SN Ia properties and the projected distance to the host galaxy center, using the distance as a proxy for local galaxy properties (local star-formation rate, local metallicity, etc.). The sample consists of almost 200 spectroscopically or photometrically confirmed SNe Ia at redshifts below 0.25. The sample is split into two groups depending on the morphology of the host galaxy. We fit light-curves using both MLCS2k2 and SALT2, and determine color (AV, c) and light-curve shape (delta, x1) parameters for each SN Ia, as well as its residual in the Hubble diagram. We then correlate these parameters with both the physical and the normalized distances to the center of the host galaxy and look for trends in the mean values and scatters of these parameters with increasing distance. The most significant (at the 4-sigma level) finding is that the average fitted AV from MLCS2k2 and c from SALT2 decrease with the projected distance for SNe Ia in spiral galaxies. We also find indications that SNe in elliptical galaxies tend to have narrower light-curves if they explode at larger distances, although this may be due to selection effects in our sample. We do not find strong correlations between the residuals of the distance moduli with respect to the Hubble flow and the galactocentric distances, which indicates a limited correlation between SN magnitudes after standardization and local host metallicity.
Binary progenitors of supernovae
Trimble, V.
1984-12-01
Among the massive stars that are expected to produce Type II, hydrogen-rich supernovae, the presence of a close companion can increase the main sequence mass needed to yield a collapsing core. In addition, due to mass transfer from the primary to the secondary, the companion enhances the stripping of the stellar hydrogen envelope produced by single star winds and thereby makes it harder for the star to give rise to a typical SN II light curve. Among the less massive stars that may be the basis for Type I, hydrogen-free supernovae, a close companion could be an innocent bystander to carbon detonation/deflagration in the primary. It may alternatively be a vital participant which transfers material to a white dwarf primary and drives it to explosive conditions.
Dynamics of supernova remnants in the Galactic centre.
Bortolas, E.; Mapelli, M.; Spera, M.
The Galactic centre (GC) is a unique place to study the extreme dynamical processes occurring near a super-massive black hole (SMBH). Here we simulate a large set of binaries orbiting the SMBH while the primary member undergoes a supernova (SN) explosion, in order to study the impact of SN kicks on the orbits of stars and dark remnants in the GC. We find that SN explosions are efficient in scattering neutron stars and other light stars on new (mostly eccentric) orbits, while black holes (BHs) tend to retain memory of the orbit of their progenitor star. SN kicks are thus unable to eject BHs from the GC: a cusp of dark remnants may be lurking in the central parsec of our Galaxy.
The Incredibly Long-Lived SN 2005ip
Fox, Ori
2016-10-01
Type IIn supernovae (SNe IIn) are defined by their relatively narrow spectral line features associated with a dense circumstellar medium (CSM) formed by the progenitor star. The nature of the progenitor and mass loss remains relatively unknown. Shock interaction with the dense CSM can often result in significant UV emission for several years post-explosion, thereby probing the CSM characteristics, progenitor mass loss history and, ultimately, the progenitor itself. The Type IIn SN 2005ip proves to be one of the most interesting and well-studied targets within this subclass. Compared to all other supernovae, SN 2005ip is the most luminous for its age. Now more than 11 years post-explosion, the SN has released >10^51 erg throughout its lifetime as the forward shock continues to collide with a dense CSM. Here we propose HST/STIS-MAMA UV observations of SN 2005ip to investigate the massive CSM. When accounting for the shock travel time, these observations will probe material lost from the progenitor more than 1000 years prior to the explosion. We already have a single HST/STIS spectrum of SN 2005ip from 2014, which was obtained while the shock was still within a higher mass regime. With just 5 orbits, a second spectrum will allow us to directly trace the evolution of the CSM and produce new constraints on the pre-SN mass-loss history. Coinciding with Cycle 24's UV Initiative, this program offers new insight regarding both the progenitor and explosion characteristics of the SN IIn subclass.
International Nuclear Information System (INIS)
Riess, Adam G.; Nugent, Peter E.; Schmidt, Brian P.; Tonry, John; Dickinson, Mark; Gilliland, Ronald L.; Thompson, Rodger I.; Budavari, Tamas; Casertano, Stefano; Evans, Aaron S.; Filippenko, Alexei V.; Livio, Mario; Sanders, David B.; Shapley, Alice E.; Spinrad, Hyron; Steidel, Charles C.; Stern, Daniel; Surace, Jason; Veilleux, Sylvain
2001-01-01
We present photometric observations of an apparent Type Ia supernova (SN Ia) at a redshift of approximately 1.7, the farthest SN observed to date. The supernova, SN 1997, was discovered in a repeat observation by the Hubble Space Telescope (HST) of the Hubble Deep Field-North (HDF-N), and serendipitously monitored with NICMOS on HST throughout the Thompson et al. GTO campaign. The SN type can be determined from the host galaxy type: an evolved, red elliptical lacking enough recent star formation to provide a significant population of core-collapse supernovae. The classification is further supported by diagnostics available from the observed colors and temporal behavior of the SN, both of which match a typical SN Ia. The photometric record of the SN includes a dozen flux measurements in the I, J, and H bands spanning 35 days in the observed frame. The redshift derived from the SN photometry, z = 1:7 plus or minus 0:1, is in excellent agreement with the redshift estimate of z = 1:65 plus or minus 0.15 derived from the U-300B-450 V-606 I-814 J-110 J-125 H-160 H-165 K s photometry of the galaxy. Optical and near-infrared spectra of the host provide a very tentative spectroscopic redshift of 1.755. Fits to observations of the SN provide constraints for the redshift-distance relation of SNe Ia and a powerful test of the current accelerating Universe hypothesis. The apparent SN brightness is consistent with that expected in the decelerating phase of the preferred cosmological model, Omega M approximately equal to 1/3;Omega Lambda approximately equal to 2/3. It is inconsistent with grey dust or simple luminosity evolution, candidate astrophysical effects which could mimic previous evidence for an accelerating Universe from SNeIa at z approximately equal to 0.5. We consider several sources of potential systematic error including gravitational lensing, supernova misclassification, sample selection bias, and luminosity calibration errors. Currently, none of these effects
Energy Technology Data Exchange (ETDEWEB)
Hoang, Thiem, E-mail: thiemhoang@kasi.re.kr [Korea Astronomy and Space Science Institute 776, Daedeokdae-ro, Yuseong-gu, Daejeon 34055 (Korea, Republic of); Canadian Institute for Theoretical Astrophysics, University of Toronto, 60 St. George Street, Toronto, ON M5S 3H8 (Canada); Institute of Theoretical Physics, Goethe Universität Frankfurt, D-60438 Frankfurt am Main (Germany)
2017-02-10
Recent photometric and polarimetric observations of Type Ia supernovae (SNe Ia) show unusually low total-to-selective extinction ratios ( R {sub V} < 2) and wavelengths of maximum polarization ( λ{sub max} < 0.4 μ m) for several SNe Ia, which indicates peculiar properties of interstellar (IS) dust in the SN-hosted galaxies and/or the presence of circumstellar (CS) dust. In this paper, we use an inversion technique to infer the best-fit grain size distribution and the alignment function of interstellar grains along the lines of sight toward four SNe Ia with anomalous extinction and polarization data (SN 1986G, SN 2006X, SN 2008fp, and SN 2014J). We find that to reproduce low values of R{sub V}, a significant enhancement in the mass of small grains of radius a < 0.1 μ m is required. For SN 2014J, a simultaneous fit to its observed extinction and polarization is unsuccessful if all the data are attributed to IS dust (model 1), but a good fit is obtained when accounting for the contribution of CS dust (model 2). For SN 2008fp, our best-fit results for model 1 show that in order to reproduce an extreme value of λ{sub max} ∼ 0.15 μ m, small silicate grains must be aligned as efficiently as big grains. For this case, we suggest that strong radiation from the SN can induce efficient alignment of small grains in a nearby intervening molecular cloud via the radiative torque (RAT) mechanism. The resulting time dependence polarization from this RAT alignment model can be tested by observing at ultraviolet wavelengths.
No Escape from the Supernova! Magnetic Imprisonment of Dusty Pinballs by a Supernova Remnant arXiv
Fry, Brian J.; Ellis, John R.
Motivated by recent measurements of deposits of $^{60}$Fe on the ocean floor and the lunar surface, we model the transport of dust grains containing $^{60}$Fe from a near-Earth (i.e., within 100 pc) supernova (SN). We inject dust grains into the environment of a SN remnant (SNR) and trace their trajectories using a magnetohydrodynamic description. We assume the interstellar medium (ISM) magnetic fields are turbulent, and are amplified by the SNR shock, while the SN wind and ejecta fields are negligible. We examine the various influences on the dust grains within the SNR to determine when/if the dust decouples from the plasma, how much it is sputtered, and where within the SNR the dust grains are located. We find that Rayleigh-Taylor instabilities are important for dust survival, as they influence the location of the SN's reverse shock. We find that the presence of a magnetic field within the shocked ISM material limits the passage of SN dust grains, with the field either reflecting or trapping the grains with...
The VLT Measures the Shape of a Type Ia Supernova
2003-08-01
1448 and SN 2001el (DSS and NTT/EMMI). PR Photo 24b/03 : Optical spectrum of SN 2001el and fractional polarisation (VLT/FORS) Supernova explosions and cosmic distances During Type Ia supernova events, remnants of stars with an initial mass of up to a few times that of the Sun (so-called "white dwarf stars") explode, leaving nothing behind but a rapidly expanding cloud of "stardust". Type Ia supernovae are apparently quite similar to one another. This provides them a very useful role as "standard candles" that can be used to measure cosmic distances. Their peak brightness rivals that of their parent galaxy, hence qualifying them as prime cosmic yardsticks. Astronomers have exploited this fortunate circumstance to study the expansion history of our Universe. They recently arrived at the fundamental conclusion that the Universe is expanding at an accelerating rate, cf. ESO PR 21/98, December 1998 (see also the Supernova Acceleration Probe web page). The explosion of a white dwarf star In the most widely accepted models of Type Ia supernovae the pre-explosion white dwarf star orbits a solar-like companion star, completing a revolution every few hours. Due to the close interaction, the companion star continuously loses mass, part of which is picked up (in astronomical terminology: "accreted") by the white dwarf. A white dwarf represents the penultimate stage of a solar-type star. The nuclear reactor in its core has run out of fuel a long time ago and is now inactive. However, at some point the mounting weight of the accumulating material will have increased the pressure inside the white dwarf so much that the nuclear ashes in there will ignite and start burning into even heavier elements. This process very quickly becomes uncontrolled and the entire star is blown to pieces in a dramatic event. An extremely hot fireball is seen that often outshines the host galaxy. The shape of the explosion Although all supernovae of Type Ia have quite similar properties, it has never been
Probing Dark Energy via Neutrino and Supernova Observatories
Energy Technology Data Exchange (ETDEWEB)
Hall, Lawrence; Hall, Lawrence J.; Murayama, Hitoshi; Papucci, Michele; Perez, Gilad
2006-07-10
A novel method for extracting cosmological evolution parameters is proposed, using a probe other than light: future observations of the diffuse anti-neutrino flux emitted from core-collapse supernovae (SNe), combined with the SN rate extracted from future SN surveys. The relic SN neutrino differential flux can be extracted by using future neutrino detectors such as Gadolinium-enriched, megaton, water detectors or 100-kiloton detectors of liquid Argon or liquid scintillator. The core-collapse SN rate can be reconstructed from direct observation of SN explosions using future precision observatories. Our method, by itself, cannot compete with the accuracy of the optical-based measurements but may serve as an important consistency check as well as a source of complementary information. The proposal does not require construction of a dedicated experiment, but rather relies on future experiments proposed for other purposes.
Probing Dark Energy via Neutrino and Supernova Observatories
International Nuclear Information System (INIS)
Hall, Lawrence; Hall, Lawrence J.; Murayama, Hitoshi; Papucci, Michele; Perez, Gilad
2006-01-01
A novel method for extracting cosmological evolution parameters is proposed, using a probe other than light: future observations of the diffuse anti-neutrino flux emitted from core-collapse supernovae (SNe), combined with the SN rate extracted from future SN surveys. The relic SN neutrino differential flux can be extracted by using future neutrino detectors such as Gadolinium-enriched, megaton, water detectors or 100-kiloton detectors of liquid Argon or liquid scintillator. The core-collapse SN rate can be reconstructed from direct observation of SN explosions using future precision observatories. Our method, by itself, cannot compete with the accuracy of the optical-based measurements but may serve as an important consistency check as well as a source of complementary information. The proposal does not require construction of a dedicated experiment, but rather relies on future experiments proposed for other purposes
Radio Supernovae: Circum-Stellar Investigation (C.S.I.) of Supernova Progenitor Stars
2009-02-24
years initiated by K. W. Weiler, N. Panagia, and R. A. Sramek. The VLA observing programs have detected dozens of new radio SNe. After discovery , the...analysis of the recent VLA data appears to support this discovery , reporting an inversion of the spectral index at higher 6 Figure 4 Left, the VLA light...formation of pulsar wind-nebula in other SN observations where VLBI measurements are not feasible. 3 The Future of Radio Supernovae Current observing
Spallation reactions in shock waves at supernova explosions and related problems
Energy Technology Data Exchange (ETDEWEB)
Ustinova, G. K., E-mail: ustinova@dubna.net.ru [RAS, V.I. Vernadsky Institute of Geochemistry and Analytical Chemistry (Russian Federation)
2013-05-15
The isotopic anomalies of some extinct radionuclides testify to the outburst of a nearby supernova just before the collapse of the protosolar nebula, and to the fact that the supernova was Sn Ia, i.e. the carbon-detonation supernova. A key role of spallation reactions in the formation of isotopic anomalies in the primordial matter of the Solar System is revealed. It is conditioned by the diffusive acceleration of particles in the explosive shock waves, which leads to the amplification of rigidity of the energy spectrum of particles and its enrichment with heavier ions. The quantitative calculations of such isotopic anomalies of many elements are presented. It is well-grounded that the anomalous Xe-HL in meteoritic nanodiamonds was formed simultaneously with nanodiamonds themselves during the shock wave propagation at the Sn Ia explosion. The possible effects of shock wave fractionation of noble gases in the atmosphere of planets are considered. The origin of light elements Li, Be and B in spallation reactions, predicted by Fowler in the middle of the last century, is argued. All the investigated isotopic anomalies give the evidence for the extremely high magnetohydrodynamics (MHD) conditions at the initial stage of free expansion of the explosive shock wave from Sn Ia, which can be essential in solution of the problem of origin of cosmic rays. The specific iron-enriched matter of Sn Ia and its MHD-separation in turbulent processes must be taking into account in the models of origin of the Solar System.
A MEASUREMENT OF THE RATE OF TYPE Ia SUPERNOVAE IN GALAXY CLUSTERS FROM THE SDSS-II SUPERNOVA SURVEY
International Nuclear Information System (INIS)
Dilday, Benjamin; Jha, Saurabh W.; Bassett, Bruce; Becker, Andrew; Bender, Ralf; Hopp, Ulrich; Castander, Francisco; Cinabro, David; Frieman, Joshua A.; Galbany, LluIs; Miquel, Ramon; Garnavich, Peter; Goobar, Ariel; Ihara, Yutaka; Kessler, Richard; Lampeitl, Hubert; Nichol, Robert C.; Marriner, John; Molla, Mercedes
2010-01-01
We present measurements of the Type Ia supernova (SN) rate in galaxy clusters based on data from the Sloan Digital Sky Survey-II (SDSS-II) Supernova Survey. The cluster SN Ia rate is determined from 9 SN events in a set of 71 C4 clusters at z ≤ 0.17 and 27 SN events in 492 maxBCG clusters at 0.1 ≤ z ≤ 0.3. We find values for the cluster SN Ia rate of (0.37 +0.17+0.01 -0.12-0.01 ) SNur h 2 and (0.55 +0.13+0.02 -0.11-0.01 ) SNur h 2 (SNux = 10 -12 L -1 xsun yr -1 ) in C4 and maxBCG clusters, respectively, where the quoted errors are statistical and systematic, respectively. The SN rate for early-type galaxies is found to be (0.31 +0.18+0.01 -0.12-0.01 ) SNur h 2 and (0.49 +0.15+0.02 -0.11-0.01 ) SNur h 2 in C4 and maxBCG clusters, respectively. The SN rate for the brightest cluster galaxies (BCG) is found to be (2.04 +1.99+0.07 -1.11-0.04 ) SNur h 2 and (0.36 +0.84+0.01 -0.30-0.01 ) SNur h 2 in C4 and maxBCG clusters, respectively. The ratio of the SN Ia rate in cluster early-type galaxies to that of the SN Ia rate in field early-type galaxies is 1.94 +1.31+0.043 -0.91-0.015 and 3.02 +1.31+0.062 -1.03-0.048 , for C4 and maxBCG clusters, respectively. The SN rate in galaxy clusters as a function of redshift, which probes the late time SN Ia delay distribution, shows only weak dependence on redshift. Combining our current measurements with previous measurements, we fit the cluster SN Ia rate data to a linear function of redshift, and find r L = [(0.49 +0.15 -0.14 )+(0.91 +0.85 -0.81 ) x z] SNuB h 2 . A comparison of the radial distribution of SNe in cluster to field early-type galaxies shows possible evidence for an enhancement of the SN rate in the cores of cluster early-type galaxies. With an observation of at most three hostless, intra-cluster SNe Ia, we estimate the fraction of cluster SNe that are hostless to be (9.4 +8.3 -5.1 )%.
Dark Matter Ignition of Type Ia Supernovae.
Bramante, Joseph
2015-10-02
Recent studies of low redshift type Ia supernovae (SN Ia) indicate that half explode from less than Chandrasekhar mass white dwarfs, implying ignition must proceed from something besides the canonical criticality of Chandrasekhar mass SN Ia progenitors. We show that 1-100 PeV mass asymmetric dark matter, with imminently detectable nucleon scattering interactions, can accumulate to the point of self-gravitation in a white dwarf and collapse, shedding gravitational potential energy by scattering off nuclei, thereby heating the white dwarf and igniting the flame front that precedes SN Ia. We combine data on SN Ia masses with data on the ages of SN Ia-adjacent stars. This combination reveals a 2.8σ inverse correlation between SN Ia masses and ignition ages, which could result from increased capture of dark matter in 1.4 vs 1.1 solar mass white dwarfs. Future studies of SN Ia in galactic centers will provide additional tests of dark-matter-induced type Ia ignition. Remarkably, both bosonic and fermionic SN Ia-igniting dark matter also resolve the missing pulsar problem by forming black holes in ≳10 Myr old pulsars at the center of the Milky Way.
Absolute-magnitude distributions of supernovae
Energy Technology Data Exchange (ETDEWEB)
Richardson, Dean; Wright, John [Department of Physics, Xavier University of Louisiana, New Orleans, LA 70125 (United States); Jenkins III, Robert L. [Applied Physics Department, Richard Stockton College, Galloway, NJ 08205 (United States); Maddox, Larry, E-mail: drichar7@xula.edu [Department of Chemistry and Physics, Southeastern Louisiana University, Hammond, LA 70402 (United States)
2014-05-01
The absolute-magnitude distributions of seven supernova (SN) types are presented. The data used here were primarily taken from the Asiago Supernova Catalogue, but were supplemented with additional data. We accounted for both foreground and host-galaxy extinction. A bootstrap method is used to correct the samples for Malmquist bias. Separately, we generate volume-limited samples, restricted to events within 100 Mpc. We find that the superluminous events (M{sub B} < –21) make up only about 0.1% of all SNe in the bias-corrected sample. The subluminous events (M{sub B} > –15) make up about 3%. The normal Ia distribution was the brightest with a mean absolute blue magnitude of –19.25. The IIP distribution was the dimmest at –16.75.
International Nuclear Information System (INIS)
Martínez-Rodríguez, Héctor; Badenes, Carles; Andrews, Brett; Yamaguchi, Hiroya; Bravo, Eduardo; Timmes, F. X.; Miles, Broxton J.; Townsley, Dean M.; Piro, Anthony L.; Mori, Hideyuki; Park, Sangwook
2017-01-01
The physical process whereby a carbon–oxygen white dwarf explodes as a Type Ia supernova (SN Ia) remains highly uncertain. The degree of neutronization in SN Ia ejecta holds clues to this process because it depends on the mass and the metallicity of the stellar progenitor, and on the thermodynamic history prior to the explosion. We report on a new method to determine ejecta neutronization using Ca and S lines in the X-ray spectra of Type Ia supernova remnants (SNRs). Applying this method to Suzaku data of Tycho, Kepler , 3C 397, and G337.2−0.7 in the Milky Way, and N103B in the Large Magellanic Cloud, we find that the neutronization of the ejecta in N103B is comparable to that of Tycho and Kepler , which suggests that progenitor metallicity is not the only source of neutronization in SNe Ia. We then use a grid of SN Ia explosion models to infer the metallicities of the stellar progenitors of our SNRs. The implied metallicities of 3C 397, G337.2−0.7, and N103B are major outliers compared to the local stellar metallicity distribution functions, indicating that progenitor metallicity can be ruled out as the origin of neutronization for these SNRs. Although the relationship between ejecta neutronization and equivalent progenitor metallicity is subject to uncertainties stemming from the 12 C + 16 O reaction rate, which affects the Ca/S mass ratio, our main results are not sensitive to these details.
Energy Technology Data Exchange (ETDEWEB)
Martínez-Rodríguez, Héctor; Badenes, Carles; Andrews, Brett [Department of Physics and Astronomy and Pittsburgh Particle Physics, Astrophysics and Cosmology Center (PITT PACC), University of Pittsburgh, 3941 O’Hara Street, Pittsburgh, PA 15260 (United States); Yamaguchi, Hiroya [NASA Goddard Space Flight Center, Code 662, Greenbelt, MD 20771 (United States); Bravo, Eduardo [E.T.S. Arquitectura del Vallès, Universitat Politècnica de Catalunya, Carrer Pere Serra 1-15, E-08173 Sant Cugat del Vallès (Spain); Timmes, F. X. [The Joint Institute for Nuclear Astrophysics (United States); Miles, Broxton J.; Townsley, Dean M. [Department of Physics and Astronomy, University of Alabama, Tuscaloosa, AL (United States); Piro, Anthony L. [Carnegie Observatories, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Mori, Hideyuki [CRESST and X-ray Astrophysics Laboratory, NASA Goddard Space Flight Center, Code 602, Greenbelt, MD 20771 (United States); Park, Sangwook, E-mail: hector.mr@pitt.edu [Department of Physics, University of Texas at Arlington, Box 19059, Arlington, TX 76019 (United States)
2017-07-01
The physical process whereby a carbon–oxygen white dwarf explodes as a Type Ia supernova (SN Ia) remains highly uncertain. The degree of neutronization in SN Ia ejecta holds clues to this process because it depends on the mass and the metallicity of the stellar progenitor, and on the thermodynamic history prior to the explosion. We report on a new method to determine ejecta neutronization using Ca and S lines in the X-ray spectra of Type Ia supernova remnants (SNRs). Applying this method to Suzaku data of Tycho, Kepler , 3C 397, and G337.2−0.7 in the Milky Way, and N103B in the Large Magellanic Cloud, we find that the neutronization of the ejecta in N103B is comparable to that of Tycho and Kepler , which suggests that progenitor metallicity is not the only source of neutronization in SNe Ia. We then use a grid of SN Ia explosion models to infer the metallicities of the stellar progenitors of our SNRs. The implied metallicities of 3C 397, G337.2−0.7, and N103B are major outliers compared to the local stellar metallicity distribution functions, indicating that progenitor metallicity can be ruled out as the origin of neutronization for these SNRs. Although the relationship between ejecta neutronization and equivalent progenitor metallicity is subject to uncertainties stemming from the {sup 12}C + {sup 16}O reaction rate, which affects the Ca/S mass ratio, our main results are not sensitive to these details.
International Nuclear Information System (INIS)
Woosley, S.E.; Pinto, P.A.; Weaver, T.A.
1988-01-01
Several critical issues recently raised by observations of SN 1987A are addressed. These include: the evolution of the pre-supernova star, why it was blue, what its composition and core structure were; the detailed isotopic composition of the ejecta; why and to what extent the supernova composition was mixed in velocity space; the interpretation of recently observed infrared lines, especially their profiles and the existence of red-shifted 'wings'; and what has become of the neutron star. 64 refs., 14 figs., 1 tab
HET LRS2 Observations of Halpha in Old Hydrogen-deficient Supernovae
Wheeler, J. Craig Craig; Pooley, David A.; Vinko, Jozsef; Szalai, Tamas; Marion, Howie H.; Sand, David J.; McQueen, Phillip; Silverman, Jeffrey M.
2017-06-01
For 3 years, we have been using narrow-band filters with the DIAFI imager on the HJS 2.7 m telescope to search for evidence that hydrogen-deficient supernovae undergo delayed collision with previously ejected circumstellar material and associated excitation of Halpha (see abstract by Pooley et al.). A powerful method to determine whether detected Halpha flux is from an HII region or a supernova is to obtain spectra; broad lines (> 1000 km/s) will be a certain indicator of a supernova. We have observed about 20 events that ranged in age from about 1000 days to nearly 80 years for which we have detected Halpha in the vicinity of the supernova. So far, only SN 2014C showed the broad H that is concrete evidence of ongoing circumstellar interaction. One interesting aspect revealed by the spectra is that we often pick up the two [N II] lines that typically accompany H in H II regions. Our spectra of SN 2008ha did not show these [N II] lines. The absence of the [N II] lines might be a clue to circumstellar interaction in conditions where the shock had slowed to a point where the H is not detectably broadened.
Primordial black holes survive SN lensing constraints
García-Bellido, Juan; Clesse, Sébastien; Fleury, Pierre
2018-06-01
It has been claimed in [arxiv:1712.02240] that massive primordial black holes (PBH) cannot constitute all of the dark matter (DM), because their gravitational-lensing imprint on the Hubble diagram of type Ia supernovae (SN) would be incompatible with present observations. In this note, we critically review those constraints and find several caveats on the analysis. First of all, the constraints on the fraction α of PBH in matter seem to be driven by a very restrictive choice of priors on the cosmological parameters. In particular, the degeneracy between Ωm and α was ignored and thus, by fixing Ωm, transferred the constraining power of SN magnitudes to α. Furthermore, by considering more realistic physical sizes for the type-Ia supernovae, we find an effect on the SN lensing magnification distribution that leads to significantly looser constraints. Moreover, considering a wide mass spectrum of PBH, such as a lognormal distribution, further softens the constraints from SN lensing. Finally, we find that the fraction of PBH that could constitute DM today is bounded by fPBH < 1 . 09(1 . 38) , for JLA (Union 2.1) catalogs, and thus it is perfectly compatible with an all-PBH dark matter scenario in the LIGO band.
REAL-TIME ANALYSIS AND SELECTION BIASES IN THE SUPERNOVA LEGACY SURVEY
International Nuclear Information System (INIS)
Perrett, K.; Conley, A.; Carlberg, R.; Balam, D.; Hook, I. M.; Sullivan, M.; Pritchet, C.; Astier, P.; Balland, C.; Guy, J.; Hardin, D.; Pain, R.; Regnault, N.; Basa, S.; Fouchez, D.; Howell, D. A.
2010-01-01
The Supernova Legacy Survey (SNLS) has produced a high-quality, homogeneous sample of Type Ia supernovae (SNe Ia) out to redshifts greater than z = 1. In its first four years of full operation (to 2007 June), the SNLS discovered more than 3000 transient candidates, 373 of which have been spectroscopically confirmed as SNe Ia. Use of these SNe Ia in precision cosmology critically depends on an analysis of the observational biases incurred in the SNLS survey due to the incomplete sampling of the underlying SN Ia population. This paper describes our real-time supernova detection and analysis procedures, and uses detailed Monte Carlo simulations to examine the effects of Malmquist bias and spectroscopic sampling. Such sampling effects are found to become apparent at z ∼ 0.6, with a significant shift in the average magnitude of the spectroscopically confirmed SN Ia sample toward brighter values for z ∼> 0.75. We describe our approach to correct for these selection biases in our three-year SNLS cosmological analysis (SNLS3) and present a breakdown of the systematic uncertainties involved.
The CHilean Automatic Supernova sEarch (CHASE)
Pignata, G.; Maza, J.; Hamuy, M.; Antezana, R.; Gonzales, L.
2009-05-01
One of the most important challenges in modern cosmology will be to figure out the origin of the dark energy, to measure its equation of state and the time rate with which it changes (described by parameters w and w'). The measurement of these parameters will require high levels of accuracy in the Supernova (SN) Type Ia distances and various sources of systematic error such as reddening corrections and possible evolution in the SNcharacteristics which could couple with redshift and mimic the cosmological signal of interest. Fortunately, these concerns can be fully addressed through the comprehensive study of SNe in the local (z < 0.05) universe. Although Type II plateau SNe are not as luminous as SNe Ia, they afford two important, independent routes to cosmological distances using the Expanding Photosphere Method and the Standardized Candle Method. To assess the performance of these techniques a nearby sample of Type II SNe is necessary. With the purpose of addressing these issues the Millennium Center for Supernova Studies (MCSS) is teaming up with the Carnegie Supernova Project (CSP) to carry out an optical and near infrared (photometry, spectroscopy and polarimetry) follow up of nearby SNe. Unfortunately, the majority of the SNe observed by the MCSS and the CSP are discovered by searches carried out from the northern hemisphere. This entails a number of observational difficulties, in particular, it reduces the number of SNe for which the follow-up starts at very early epochs. The aim of the CHASE project is to remove this search bias by discovering young Southern SNe that will be extensively observed by the MCSS and the CSP. In the first nine-months of operation, CHASE has discovered two SNe: SN007oc (CBET 1114) and SN007pl (CBET 1130), thus demonstrating the feasibility of the survey.
PTF 12gzk—A rapidly declining, high-velocity type Ic radio supernova
Energy Technology Data Exchange (ETDEWEB)
Horesh, Assaf; Kulkarni, Shrinivas R. [Cahill Center for Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Corsi, Alessandra [Department of Physics, The George Washington University, 725 21st Street, NW, Washington, DC 20052 (United States); Frail, Dale A. [National Radio Astronomy Observatory, P.O. Box 0, Socorro, NM 87801 (United States); Cenko, S. Bradley [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Ben-Ami, Sagi; Gal-Yam, Avishay; Yaron, Ofer; Arcavi, Iair; Ofek, Eran O. [Department of Particle Physics and Astrophysics, The Weizmann Institute of Science, Rehovot 76100 (Israel); Kasliwal, Mansi M. [Carnegie Institution for Science, Department of Terrestrial Magnetism, 5241 Broad Branch Road, Washington, DC 20008 (United States)
2013-11-20
Only a few cases of Type Ic supernovae (SNe) with high-velocity ejecta (≥0.2 c) have been discovered and studied. Here, we present our analysis of radio and X-ray observations of the Type Ic SN PTF 12gzk. The radio emission declined less than 10 days after explosion, suggesting SN ejecta expanding at high velocity (∼0.3 c). The radio data also indicate that the density of the circumstellar material (CSM) around the supernova is lower by a factor of ∼10 than the CSM around normal Type Ic SNe. PTF 12gzk may therefore be an intermediate event between a 'normal' SN Ic and a gamma-ray-burst-SN-like event. Our observations of this rapidly declining radio SN at a distance of 58 Mpc demonstrates the potential to detect many additional radio SNe, given the new capabilities of the Very Large Array (improved sensitivity and dynamic scheduling), which are currently missed, leading to a biased view of radio SNe Ic. Early optical discovery followed by rapid radio observations would provide a full description of the ejecta velocity distribution and CSM densities around stripped massive star explosions as well as strong clues about the nature of their progenitor stars.
PTF 12gzk—A rapidly declining, high-velocity type Ic radio supernova
International Nuclear Information System (INIS)
Horesh, Assaf; Kulkarni, Shrinivas R.; Corsi, Alessandra; Frail, Dale A.; Cenko, S. Bradley; Ben-Ami, Sagi; Gal-Yam, Avishay; Yaron, Ofer; Arcavi, Iair; Ofek, Eran O.; Kasliwal, Mansi M.
2013-01-01
Only a few cases of Type Ic supernovae (SNe) with high-velocity ejecta (≥0.2 c) have been discovered and studied. Here, we present our analysis of radio and X-ray observations of the Type Ic SN PTF 12gzk. The radio emission declined less than 10 days after explosion, suggesting SN ejecta expanding at high velocity (∼0.3 c). The radio data also indicate that the density of the circumstellar material (CSM) around the supernova is lower by a factor of ∼10 than the CSM around normal Type Ic SNe. PTF 12gzk may therefore be an intermediate event between a 'normal' SN Ic and a gamma-ray-burst-SN-like event. Our observations of this rapidly declining radio SN at a distance of 58 Mpc demonstrates the potential to detect many additional radio SNe, given the new capabilities of the Very Large Array (improved sensitivity and dynamic scheduling), which are currently missed, leading to a biased view of radio SNe Ic. Early optical discovery followed by rapid radio observations would provide a full description of the ejecta velocity distribution and CSM densities around stripped massive star explosions as well as strong clues about the nature of their progenitor stars.
RAPIDLY RISING TRANSIENTS IN THE SUPERNOVA—SUPERLUMINOUS SUPERNOVA GAP
Energy Technology Data Exchange (ETDEWEB)
Arcavi, Iair; Howell, D. Andrew [Las Cumbres Observatory Global Telescope, 6740 Cortona Dr., Suite 102, Goleta, CA 93111 (United States); Wolf, William M. [Department of Physics, University of California, Santa Barbara, CA 93106 (United States); Bildsten, Lars; McCully, Curtis; Valenti, Stefano [Kavli Institute for Theoretical Physics, University of California, Santa Barbara, CA 93106 (United States); Leloudas, Giorgos; Gal-Yam, Avishay; Katz, Boaz [Department of Particle Physics and Astrophysics, The Weizmann Institute of Science, Rehovot, 76100 (Israel); Hardin, Delphine; Astier, Pierre; Balland, Cristophe [LPNHE, CNRS-IN2P3 and University of Paris VI and VII, F-75005 Paris (France); Prajs, Szymon; Sullivan, Mark [School of Physics and Astronomy, University of Southampton, Southampton, SO17 1BJ (United Kingdom); Perley, Daniel A. [Dark Cosmology Centre, Niels Bohr Institute, University of Copenhagen, Juliane Maries Vej 30, DK-2100 Copenhagen (Denmark); Svirski, Gilad [Racah Institute for Physics, The Hebrew University, Jerusalem 91904 (Israel); Cenko, S. Bradley [Astrophysics Science Division, NASA Goddard Space Flight Center, Mail Code 661, Greenbelt, MD 20771 (United States); Lidman, Chris [Australian Astronomical Observatory, P.O. Box 915, North Ryde, NSW 1670 (Australia); Carlberg, Ray G. [Department of Astronomy and Astrophysics, University of Toronto, 50 St. George Street, Toronto, ON M5S 3H8 (Canada); Conley, Alex, E-mail: iarcavi@lcogt.net [Center for Astrophysics and Space Astronomy, University of Colorado, 389 UCB, Boulder, CO 80309-389 (United States); and others
2016-03-01
We present observations of four rapidly rising (t{sub rise} ≈ 10 days) transients with peak luminosities between those of supernovae (SNe) and superluminous SNe (M{sub peak} ≈ −20)—one discovered and followed by the Palomar Transient Factory (PTF) and three by the Supernova Legacy Survey. The light curves resemble those of SN 2011kl, recently shown to be associated with an ultra-long-duration gamma-ray burst (GRB), though no GRB was seen to accompany our SNe. The rapid rise to a luminous peak places these events in a unique part of SN phase space, challenging standard SN emission mechanisms. Spectra of the PTF event formally classify it as an SN II due to broad Hα emission, but an unusual absorption feature, which can be interpreted as either high velocity Hα (though deeper than in previously known cases) or Si ii (as seen in SNe Ia), is also observed. We find that existing models of white dwarf detonations, CSM interaction, shock breakout in a wind (or steeper CSM), and magnetar spin down cannot readily explain the observations. We consider the possibility that a “Type 1.5 SN” scenario could be the origin of our events. More detailed models for these kinds of transients and more constraining observations of future such events should help to better determine their nature.
Colorful Investigations of Supernovae for WFIRST-AFTA
Foley, Ryan
Type Ia supernovae (SNe Ia) are extremely good probes of dark energy, and WFIRST-AFTA is particularly well suited to make the best SN distance measurements possible. For conservative assumptions, the WFIRST SN survey is projected to have twice the impact as its other probes. Considering that Euclid will only have a minimal SN survey, but strong programs for other dark energy probes, the WFIRST SN survey is especially unique and important. With an initial simulation of the WFIRST-AFTA survey, we have determined that the largest statistical and systematic uncertainties are related to SN color. SN distances strongly depend on the precise measurement of SN colors since we must make a dust extinction correction that depends on the observed color. The details of how the correction is applied and the possibility that the correction evolves with redshift combine with potential calibration systematics to limit the current effectiveness of the SN component of WFIRST-AFTA. Here, we propose to support two graduate students to (1) investigate how intrinsic color variations will impact WFIRST-AFTA systematic uncertainties, (2) determine improved methods for reducing the systematic uncertainties related to SN color, and (3) simulate survey strategies incorporating our results to obtain the highest dark energy figure of merit (DE-FoM).
A TYPE Ia SUPERNOVA AT REDSHIFT 1.55 IN HUBBLE SPACE TELESCOPE INFRARED OBSERVATIONS FROM CANDELS
International Nuclear Information System (INIS)
Rodney, Steven A.; Riess, Adam G.; Jones, David O.; Dahlen, Tomas; Ferguson, Henry C.; Casertano, Stefano; Grogin, Norman A.; Strolger, Louis-Gregory; Hjorth, Jens; Frederiksen, Teddy F.; Weiner, Benjamin J.; Mobasher, Bahram; Challis, Peter; Kirshner, Robert P.; Faber, S. M.; Filippenko, Alexei V.; Garnavich, Peter; Hayden, Brian; Graur, Or; Jha, Saurabh W.
2012-01-01
We report the discovery of a Type Ia supernova (SN Ia) at redshift z = 1.55 with the infrared detector of the Wide Field Camera 3 (WFC3-IR) on the Hubble Space Telescope (HST). This object was discovered in CANDELS imaging data of the Hubble Ultra Deep Field and followed as part of the CANDELS+CLASH Supernova project, comprising the SN search components from those two HST multi-cycle treasury programs. This is the highest redshift SN Ia with direct spectroscopic evidence for classification. It is also the first SN Ia at z > 1 found and followed in the infrared, providing a full light curve in rest-frame optical bands. The classification and redshift are securely defined from a combination of multi-band and multi-epoch photometry of the SN, ground-based spectroscopy of the host galaxy, and WFC3-IR grism spectroscopy of both the SN and host. This object is the first of a projected sample at z > 1.5 that will be discovered by the CANDELS and CLASH programs. The full CANDELS+CLASH SN Ia sample will enable unique tests for evolutionary effects that could arise due to differences in SN Ia progenitor systems as a function of redshift. This high-z sample will also allow measurement of the SN Ia rate out to z ≈ 2, providing a complementary constraint on SN Ia progenitor models.
A New Method to Constrain Supernova Fractions Using X-ray Observations of Clusters of Galaxies
Bulbul, Esra; Smith, Randall K.; Loewenstein, Michael
2012-01-01
Supernova (SN) explosions enrich the intracluster medium (ICM) both by creating and dispersing metals. We introduce a method to measure the number of SNe and relative contribution of Type Ia supernovae (SNe Ia) and core-collapse supernovae (SNe cc) by directly fitting X-ray spectral observations. The method has been implemented as an XSPEC model called snapec. snapec utilizes a single-temperature thermal plasma code (apec) to model the spectral emission based on metal abundances calculated using the latest SN yields from SN Ia and SN cc explosion models. This approach provides a self-consistent single set of uncertainties on the total number of SN explosions and relative fraction of SN types in the ICM over the cluster lifetime by directly allowing these parameters to be determined by SN yields provided by simulations. We apply our approach to XMM-Newton European Photon Imaging Camera (EPIC), Reflection Grating Spectrometer (RGS), and 200 ks simulated Astro-H observations of a cooling flow cluster, A3112.We find that various sets of SN yields present in the literature produce an acceptable fit to the EPIC and RGS spectra of A3112. We infer that 30.3% plus or minus 5.4% to 37.1% plus or minus 7.1% of the total SN explosions are SNe Ia, and the total number of SN explosions required to create the observed metals is in the range of (1.06 plus or minus 0.34) x 10(exp 9), to (1.28 plus or minus 0.43) x 10(exp 9), fromsnapec fits to RGS spectra. These values may be compared to the enrichment expected based on well-established empirically measured SN rates per star formed. The proportions of SNe Ia and SNe cc inferred to have enriched the ICM in the inner 52 kiloparsecs of A3112 is consistent with these specific rates, if one applies a correction for the metals locked up in stars. At the same time, the inferred level of SN enrichment corresponds to a star-to-gas mass ratio that is several times greater than the 10% estimated globally for clusters in the A3112 mass range.
Signatures of the neutrino mass hierarchy in supernova neutrinos
International Nuclear Information System (INIS)
Chiu, S.H.; Huang, Chu-Ching; Lai, Kwang-Chang
2015-01-01
The undetermined neutrino mass hierarchy may leave an observable imprint on the neutrino fluxes from a core-collapse supernova (SN). The interpretation of the observables, however, is subject to the uncertain SN models and the flavor conversion mechanism of neutrinos in a SN. We attempt to propose a qualitative interpretation of the expected neutrino events at terrestrial detectors, focusing on the accretion phase of the neutrino burst. The flavor conversions due to neutrino self-interaction, the MSW effect, and the Earth regeneration effect are incorporated in the calculation. It leads to several distinct scenarios that are identified by the neutrino mass hierarchies and the collective flavor transitions. Consequences resulting from the variation of incident angles and SN models are also discussed
Two transitional type Ia supernovae located in the Fornax cluster member NGC 1404
DEFF Research Database (Denmark)
Gall, C.; Stritzinger, M. D.; Ashall, C.
2018-01-01
We present an analysis of ultraviolet (UV) to near-infrared observations of the fast-declining Type Ia supernovae (SNe Ia) 2007on and 2011iv, hosted by the Fornax cluster member NGC 1404. The B-band light curves of SN 2007on and SN 2011iv are characterised by Delta m(15)(B) decline-rate values of...
A Type II Supernova Hubble diagram from the CSP-I, SDSS-II, and SNLS surveys
de Jaeger, T.; González-Gaitán, S.; Hamuy, M.; Galbany, L.; Anderson, J. P.; Phillips, M. M.; Stritzinger, M. D.; Carlberg, R. G.; Sullivan, M.; Gutiérrez, C. P.; Hook, I. M.; Howell, D. Andrew; Hsiao, E. Y.; Kuncarayakti, H.; Ruhlmann-Kleider, V.
2016-01-01
The coming era of large photometric wide-field surveys will increase the detection rate of supernovae by orders of magnitude. Such numbers will restrict spectroscopic follow-up in the vast majority of cases, and hence new methods based solely on photometric data must be developed. Here, we construct a complete Hubble diagram of Type II supernovae (SNe II) combining data from three different samples: the Carnegie Supernova Project-I, the Sloan Digital Sky Survey II SN, and th...
THE RISE OF SN 2014J IN THE NEARBY GALAXY M82
International Nuclear Information System (INIS)
Goobar, A.; Johansson, J.; Amanullah, R.; Ferretti, R.; Cao, Y.; Perley, D. A.; Tendulkar, S. P.; Kasliwal, M. M.; Nugent, P. E.; Harris, C.; Gal-Yam, A.; Ofek, E. O.; Dennefeld, M.; Valenti, S.; Arcavi, I.; Banerjee, D. P. K.; Venkataraman, V.; Joshi, V.; Ashok, N. M.; Cenko, S. B.
2014-01-01
We report on the discovery of SN 2014J in the nearby galaxy M82. Given its proximity, it offers the best opportunity to date to study a thermonuclear supernova (SN) over a wide range of the electromagnetic spectrum. Optical, near-IR, and mid-IR observations on the rising light curve, orchestrated by the intermediate Palomar Transient Factory, show that SN 2014J is a spectroscopically normal Type Ia supernova (SN Ia), albeit exhibiting high-velocity features in its spectrum and heavily reddened by dust in the host galaxy. Our earliest detections start just hours after the fitted time of explosion. We use high-resolution optical spectroscopy to analyze the dense intervening material and do not detect any evolution in the resolved absorption features during the light curve rise. Similar to other highly reddened SNe Ia, a low value of total-to-selective extinction, R V ≲ 2, provides the best match to our observations. We also study pre-explosion optical and near-IR images from Hubble Space Telescope with special emphasis on the sources nearest to the SN location
The Data Release of the Sloan Digital Sky Survey-II Supernova Survey
Sako, Masao; Bassett, Bruce; Becker, Andrew C.; Brown, Peter J.; Campbell, Heather; Wolf, Rachel; Cinabro, David; D’Andrea, Chris B.; Dawson, Kyle S.; DeJongh, Fritz; Depoy, Darren L.; Dilday, Ben; Doi, Mamoru; Filippenko, Alexei V.; Fischer, John A.; Foley, Ryan J.; Frieman, Joshua A.; Galbany, Lluis; Garnavich, Peter M.; Goobar, Ariel; Gupta, Ravi R.; Hill, Gary J.; Hayden, Brian T.; Hlozek, Renée; Holtzman, Jon A.; Hopp, Ulrich; Jha, Saurabh W.; Kessler, Richard; Kollatschny, Wolfram; Leloudas, Giorgos; Marriner, John; Marshall, Jennifer L.; Miquel, Ramon; Morokuma, Tomoki; Mosher, Jennifer; Nichol, Robert C.; Nordin, Jakob; Olmstead, Matthew D.; Östman, Linda; Prieto, Jose L.; Richmond, Michael; Romani, Roger W.; Sollerman, Jesper; Stritzinger, Max; Schneider, Donald P.; Smith, Mathew; Wheeler, J. Craig; Yasuda, Naoki; Zheng, Chen
2018-06-01
This paper describes the data release of the Sloan Digital Sky Survey-II (SDSS-II) Supernova Survey conducted between 2005 and 2007. Light curves, spectra, classifications, and ancillary data are presented for 10,258 variable and transient sources discovered through repeat ugriz imaging of SDSS Stripe 82, a 300 deg2 area along the celestial equator. This data release is comprised of all transient sources brighter than r ≃ 22.5 mag with no history of variability prior to 2004. Dedicated spectroscopic observations were performed on a subset of 889 transients, as well as spectra for thousands of transient host galaxies using the SDSS-III BOSS spectrographs. Photometric classifications are provided for the candidates with good multi-color light curves that were not observed spectroscopically, using host galaxy redshift information when available. From these observations, 4607 transients are either spectroscopically confirmed, or likely to be, supernovae, making this the largest sample of supernova candidates ever compiled. We present a new method for SN host-galaxy identification and derive host-galaxy properties including stellar masses, star formation rates, and the average stellar population ages from our SDSS multi-band photometry. We derive SALT2 distance moduli for a total of 1364 SN Ia with spectroscopic redshifts as well as photometric redshifts for a further 624 purely photometric SN Ia candidates. Using the spectroscopically confirmed subset of the three-year SDSS-II SN Ia sample and assuming a flat ΛCDM cosmology, we determine Ω M = 0.315 ± 0.093 (statistical error only) and detect a non-zero cosmological constant at 5.7σ.
The Data Release of the Sloan Digital Sky Survey-II Supernova Survey
Energy Technology Data Exchange (ETDEWEB)
Sako, Masao; et al.
2014-01-14
This paper describes the data release of the Sloan Digital Sky Survey-II (SDSS-II) Supernova Survey conducted between 2005 and 2007. Light curves, spectra, classifications, and ancillary data are presented for 10,258 variable and transient sources discovered through repeat ugriz imaging of SDSS Stripe 82, a 300 deg2 area along the celestial equator. This data release is comprised of all transient sources brighter than r~22.5 mag with no history of variability prior to 2004. Dedicated spectroscopic observations were performed on a subset of 889 transients, as well as spectra for thousands of transient host galaxies using the SDSS-III BOSS spectrographs. Photometric classifications are provided for the candidates with good multi-color light curves that were not observed spectroscopically. From these observations, 4607 transients are either spectroscopically confirmed, or likely to be, supernovae, making this the largest sample of supernova candidates ever compiled. We present a new method for SN host-galaxy identification and derive host-galaxy properties including stellar masses, star-formation rates, and the average stellar population ages from our SDSS multi-band photometry. We derive SALT2 distance moduli for a total of 1443 SN Ia with spectroscopic redshifts as well as photometric redshifts for a further 677 purely-photometric SN Ia candidates. Using the spectroscopically confirmed subset of the three-year SDSS-II SN Ia sample and assuming a flat Lambda-CDM cosmology, we determine Omega_M = 0.315 +/- 0.093 (statistical error only) and detect a non-zero cosmological constant at 5.7 sigmas.
Supernovae from Wolf-Rayet stars
International Nuclear Information System (INIS)
Schaeffer, R.
1986-01-01
Wolf-Rayet stars are known to originate from the most massive stars. Under the assumption that these stripped stars explode at the end of their evolution through the same instability mechanism as type II supernovae, we calculate their light curve. The latter is found to be quite similar to the typical SN I light curves but is fainter by about 2 magnitudes. A detailed study of its shape leads to identify the WR supernovae with the SNIp (or SNIb) subclass. The more massive WR stars should explode via the e + e - pair production mechanism, with negligible 56 Ni formation. Their rather dim light curve is predicted to have a ∼ 2 month plateau and afterwards a very sharp decline. A delayed manifestation of such an event might be the Cas A remnant
Gamma-ray observations of SN1987A
International Nuclear Information System (INIS)
Figueiredo, N.; Villela, T.; Jayanthi, U.B.; Souza, C.A.W.; Neri, J.A.C.F.; Cestal, R.C.; Martinez, M.L.
1990-01-01
This paper reports that on February 23, 1987, a Supernova (SN 1987A) was discovered in the Large Magellanic Cloud, a neighbor irregular galaxy only 55 kpc away. For the first time it was possible to observe a supernova whose progenitor star was known. This may also be the first time that it will be possible to prove the theoretical hypothesis that neutron stars are a consequence of a supernova explosion. The main peculiar characteristic of this supernova is that the progenitor star was a blue supergiant instead of a red supergiant as thy are generally believed to be. It was known as Sk -69 degrees 202, a 15-solar-mass star, spectral type B3I. Two hypothesis were invoked to explain such unexpected progenitor: the low metallicity of the LMC or large mass loss during the stage of red supergiant
VizieR Online Data Catalog: Lick Observatory Supernova Search (LOSS) revisited (Graur+, 2017)
Graur, O.; Bianco, F. B.; Huang, S.; Modjaz, M.; Shivvers, I.; Filippenko, A. V.; Li, W.; Eldridge, J. J.
2017-10-01
Most types of supernovae (SNe) have yet to be connected with their progenitor stellar systems. Here, we reanalyze the 10-year SN sample collected during 1998-2008 by the Lick Observatory Supernova Search (LOSS; see Leaman+, 2011, J/MNRAS/412/1419) in order to constrain the progenitors of SNe Ia and stripped-envelope SNe (SE SNe, i.e., SNe IIb, Ib, Ic, and broad-lined Ic). We matched the LOSS galaxy sample with spectroscopy from the Sloan Digital Sky Survey (SDSS) and measured SN rates as a function of galaxy stellar mass, specific star formation rate, and oxygen abundance (metallicity). We find significant correlations between the SN rates and all three galaxy properties. The SN Ia correlations are consistent with other measurements, as well as with our previous explanation of these measurements in the form of a combination of the SN Ia delay-time distribution and the correlation between galaxy mass and age. The ratio between the SE SN and SN II rates declines significantly in low-mass galaxies. This rules out single stars as SE SN progenitors, and is consistent with predictions from binary-system progenitor models. Using well-known galaxy scaling relations, any correlation between the rates and one of the galaxy properties examined here can be expressed as a correlation with the other two. These redundant correlations preclude us from establishing causality-that is, from ascertaining which of the galaxy properties (or their combination) is the physical driver for the difference between the SE SN and SN II rates. We outline several methods that have the potential to overcome this problem in future works. (7 data files).
A Measurement of the Rate of Type Ia Supernovae in Galaxy Clusters from the SDSS-II Supernova Survey
Energy Technology Data Exchange (ETDEWEB)
Dilday, Benjamin; /Rutgers U., Piscataway /Chicago U. /KICP, Chicago; Bassett, Bruce; /Cape Town U., Dept. Math. /South African Astron. Observ.; Becker, Andrew; /Washington U., Seattle, Astron. Dept.; Bender, Ralf; /Munich, Tech. U. /Munich U. Observ.; Castander, Francisco; /Barcelona, IEEC; Cinabro, David; /Wayne State U.; Frieman, Joshua A.; /Chicago U. /Fermilab; Galbany, Lluis; /Barcelona, IFAE; Garnavich, Peter; /Notre Dame U.; Goobar, Ariel; /Stockholm U., OKC /Stockholm U.; Hopp, Ulrich; /Munich, Tech. U. /Munich U. Observ. /Tokyo U.
2010-03-01
We present measurements of the Type Ia supernova (SN) rate in galaxy clusters based on data from the Sloan Digital Sky Survey-II (SDSS-II) Supernova Survey. The cluster SN Ia rate is determined from 9 SN events in a set of 71 C4 clusters at z {le} 0.17 and 27 SN events in 492 maxBCG clusters at 0.1 {le} z {le} 0.3. We find values for the cluster SN Ia rate of (0.37{sub -0.12-0.01}{sup +0.17+0.01}) SNur h{sup 2} and (0.55{sub -0.11-0.01}{sup +0.13+0.02}) SNur h{sup 2} (SNux = 10{sup -12}L{sub x{circle_dot}}{sup -1} yr{sup -1}) in C4 and maxBCG clusters, respectively, where the quoted errors are statistical and systematic, respectively. The SN rate for early-type galaxies is found to be (0.31{sub -0.12-0.01}{sup +0.18+0.01}) SNur h{sup 2} and (0.49{sub -0.11-0.01}{sup +0.15+0.02}) SNur h{sup 2} in C4 and maxBCG clusters, respectively. The SN rate for the brightest cluster galaxies (BCG) is found to be (2.04{sub -1.11-0.04}{sup +1.99+0.07}) SNur h{sup 2} and (0.36{sub -0.30-0.01}{sup +0.84+0.01}) SNur h{sup 2} in C4 and maxBCG clusters, respectively. The ratio of the SN Ia rate in cluster early-type galaxies to that of the SN Ia rate in field early-type galaxies is 1.94{sub -0.91-0.015}{sup +1.31+0.043} and 3.02{sub -1.03-0.048}{sup +1.31+0.062}, for C4 and maxBCG clusters, respectively. The SN rate in galaxy clusters as a function of redshift, which probes the late time SN Ia delay distribution, shows only weak dependence on redshift. Combining our current measurements with previous measurements, we fit the cluster SN Ia rate data to a linear function of redshift, and find r{sub L} = [(0.49{sub -0.14}{sup +0.15}) + (0.91{sub -0.81}{sup +0.85}) x z] SNuB h{sup 2}. A comparison of the radial distribution of SNe in cluster to field early-type galaxies shows possible evidence for an enhancement of the SN rate in the cores of cluster early-type galaxies. With an observation of at most 3 hostless, intra-cluster SNe Ia, we estimate the fraction of cluster SNe that are
The Story of Supernova “Refsdal” Told by Muse
Grillo, C.; Karman, W.; Suyu, S. H.; Rosati, P.; Balestra, I.; Mercurio, A.; Lombardi, M.; Treu, T.; Caminha, G. B.; Halkola, A.; Rodney, S. A.; Gavazzi, R.; Caputi, K. I.
2016-01-01
We present Multi Unit Spectroscopic Explorer (MUSE) observations in the core of the Hubble Frontier Fields (HFF) galaxy cluster MACS J1149.5+2223, where the first magnified and spatially resolved multiple images of supernova (SN) "Refsdal" at redshift 1.489 were detected. Thanks to a Director's
Multicolour modelling of SN 2013dx associated with GRB 130702A★
Volnova, A. A.; Pruzhinskaya, M. V.; Pozanenko, A. S.; Blinnikov, S. I.; Minaev, P. Yu.; Burkhonov, O. A.; Chernenko, A. M.; Ehgamberdiev, Sh. A.; Inasaridze, R.; Jelinek, M.; Khorunzhev, G. A.; Klunko, E. V.; Krugly, Yu. N.; Mazaeva, E. D.; Rumyantsev, V. V.; Volvach, A. E.
2017-05-01
We present optical observations of SN 2013dx, related to the Fermi burst GRB 130702A, which occurred at red shift z = 0.145. It is the second-best sampled gamma-ray burst (GRB)/supernova (SN) after SN 1998bw. The observational light curves contain more than 280 data points in the uBgrRiz filters until 88 d after the burst, and the data were collected from our observational collaboration (Maidanak Observatory, Abastumani Observatory, Crimean Astrophysical Observatory, Mondy Observatory, National Observatory of Turkey and Observatorio del Roque de los Muchachos) and from the literature. We model numerically the multicolour light curves using the one-dimensional radiation hydrodynamical code stella, previously widely implemented for modelling typical non-GRB SNe. The best-fitting model has the following parameters: pre-SN star mass M = 25 M⊙; mass of the compact remnant MCR = 6 M⊙; total energy of the outburst Eoburst = 3.5 × 1052 erg; pre-supernova star radius R = 100 R⊙; M_^{56Ni} = 0.2 M_{⊙}, which is totally mixed through the ejecta; MO = 16.6 M⊙; MSi = 1.2 M⊙ and MFe = 1.2 M⊙, and the radiative efficiency of the SN is 0.1 per cent.
Evidence for nearby supernova explosions
International Nuclear Information System (INIS)
Benitez, Narciso; Maiz-Apellaniz, Jesus; Canelles, Matilde
2002-01-01
Supernova (SN) explosions are one of the most energetic--and potentially lethal--phenomena in the Universe. We show that the Scorpius-Centaurus OB association, a group of young stars currently located at ∼130 pc from the Sun, has generated 20 SN explosions during the last 11 Myr, some of them probably as close as 40 pc to our planet. The deposition on Earth of 60 Fe atoms produced by these explosions can explain the recent measurements of an excess of this isotope in deep ocean crust samples. We propose that ∼2 Myr ago, one of the SNe exploded close enough to Earth to seriously damage the ozone layer, provoking or contributing to the Pliocene-Pleistocene boundary marine extinction
[O I] λλ6300, 6364 IN THE NEBULAR SPECTRUM OF A SUBLUMINOUS TYPE Ia SUPERNOVA
International Nuclear Information System (INIS)
Taubenberger, S.; Kromer, M.; Hillebrandt, W.; Pakmor, R.; Pignata, G.; Maeda, K.; Hachinger, S.; Leibundgut, B.
2013-01-01
In this Letter, a late-phase spectrum of SN 2010lp, a subluminous Type Ia supernova (SN Ia), is presented and analyzed. As in 1991bg-like SNe Ia at comparable epochs, the spectrum is characterized by relatively broad [Fe II] and [Ca II] emission lines. However, instead of narrow [Fe III] and [Co III] lines that dominate the emission from the innermost regions of 1991bg-like supernovae (SNe), SN 2010lp shows [O I] λλ6300, 6364 emission, usually associated with core-collapse SNe and never previously observed in a subluminous thermonuclear explosion. The [O I] feature has a complex profile with two strong, narrow emission peaks. This suggests that oxygen is distributed in a non-spherical region close to the center of the ejecta, severely challenging most thermonuclear explosion models discussed in the literature. We conclude that, given these constraints, violent mergers are presently the most promising scenario to explain SN 2010lp
Optical photometry and spectroscopy of the low-luminosity, broad-lined Ic supernova iPTF15dld
DEFF Research Database (Denmark)
Pian, E.; Tomasella, L.; Cappellaro, E.
2017-01-01
Core-collapse stripped-envelope supernova (SN) explosions reflect the diversity of physical parameters and evolutionary paths of their massive star progenitors. We have observed the Type Ic SN iPTF15dld (z = 0.047), reported by the Palomar Transient Factory. Spectra were taken starting 20 rest-frame...
A HIGH-RESOLUTION SPECTROSCOPIC SEARCH FOR THE REMAINING DONOR FOR TYCHO'S SUPERNOVA
International Nuclear Information System (INIS)
Kerzendorf, Wolfgang E.; Yong, David; Schmidt, Brian P.; Murphy, Simon J.; Bessell, Michael S.; Simon, Joshua D.; Jeffery, C. Simon; Anderson, Jay; Podsiadlowski, Philipp; Gal-Yam, Avishay; Silverman, Jeffrey M.; Filippenko, Alexei V.; Nomoto, Ken'ichi; Venn, Kim A.; Foley, Ryan J.
2013-01-01
In this paper, we report on our analysis using Hubble Space Telescope astrometry and Keck-I HIRES spectroscopy of the central six stars of Tycho's supernova remnant (SN 1572). With these data, we measured the proper motions, radial velocities, rotational velocities, and chemical abundances of these objects. Regarding the chemical abundances, we do not confirm the unusually high [Ni/Fe] ratio previously reported for Tycho-G. Rather, we find that for all metrics in all stars, none exhibit the characteristics expected from traditional Type Ia supernova single-degenerate-scenario calculations. The only possible exception is Tycho-B, a rare, metal-poor A-type star; however, we are unable to find a suitable scenario for it. Thus, we suggest that SN 1572 cannot be explained by the standard single-degenerate model
The Type IIP SN 2005ay: An Extensive Study From UltraViolet To Near-IR
Bufano, F. M.; Turatto, M.; Zampieri, L.; Gal-Yam, A.
2006-08-01
Several supernova types are thought to explode via the gravitational collapse of the core of massive stars at the end of their lifetimes. The great observational diversity has not been fully understood even if it clearly involves the progenitor masses and configurations at the time of explosion. These Supernovae, called Core Collapse Supernovae (CC SNe), are expected to dominate the counts of SNe observed at high redshifts and to be the only observable probe of the first generation stars (Pop III). Recently indicated as reliable distance indicators (Hamuy 02, Pastorello `03), CC SNe are objects of great interest but significantly less studied in comparison with the Termonuclear ones. With the aim to understand better the reasons of the heterogeneous behaviour , we have started an extensive study of the properties of SN II with different observational features (luminosity, velocity, etc..). Here we present the last results on our first observed target, SN2005ay, a Type IIP supernova observed in an extended way from the Ultraviolet wavelengths, provided by the GALEX , to the Optical and near-IR , obtained with IISP (Italian Intensive Supernova Program).
Discovery of a Supernova Explosion at Half the Age of the Universe and its Cosmological Implications
Perlmutter, S.; Aldering, G.; Della Valle, M.; Deustua, S.; Ellis, R. S.; Fabbro, S.; Fruchter, A.; Goldhaber, G.; Goobar, A.; Groom, D. E.; Hook, I. M.; Kim, A. G.; Kim, M. Y.; Knop, R. A.; Lidman, C.; McMahon, R. G.; Nugent, P.; Pain, R.; Panagia, N.; Pennypacker, C. R.; Ruiz-Lapuente, P.; Schaefer, B.; Walton, N.
1997-12-16
The ultimate fate of the universe, infinite expansion or a big crunch, can be determined by measuring the redshifts, apparent brightnesses, and intrinsic luminosities of very distant supernovae. Recent developments have provided tools that make such a program practicable: (1) Studies of relatively nearby Type la supernovae (SNe la) have shown that their intrinsic luminosities can be accurately determined; (2) New research techniques have made it possible to schedule the discovery and follow-up observations of distant supernovae, producing well over 50 very distant (z = 0.3-0.7) SNe Ia to date. These distant supernovae provide a record of changes in the expansion rate over the past several billion years. By making precise measurements of supernovae at still greater distances, and thus extending this expansion history back far enough in time, we can even distinguish the slowing caused by the gravitational attraction of the universe's mass density {Omega}{sub M} from the effect of a possibly inflationary pressure caused by a cosmological constant {Lambda}. We report here the first such measurements, with our discovery of a Type Ia supernova (SN 1997ap) at z = 0.83. Measurements at the Keck II 10-m telescope make this the most distant spectroscopically confirmed supernova. Over two months of photometry of SN 1997ap with the Hubble Space Telescope and ground-based telescopes, when combined with previous measurements of nearer SNe la, suggests that we may live in a low mass-density universe. Further supernovae at comparable distances are currently scheduled for ground and space-based observations.
Dependence on supernovae light-curve processing in void models
Energy Technology Data Exchange (ETDEWEB)
Bengochea, Gabriel R., E-mail: gabriel@iafe.uba.ar [Instituto de Astronomía y Física del Espacio (IAFE), UBA-CONICET, CC 67, Suc. 28, 1428 Buenos Aires (Argentina); De Rossi, Maria E., E-mail: derossi@iafe.uba.ar [Instituto de Astronomía y Física del Espacio (IAFE), UBA-CONICET, CC 67, Suc. 28, 1428 Buenos Aires (Argentina); Departamento de Física, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires (Argentina)
2014-06-02
In this work, we show that when supernova Ia (SN Ia) data sets are used to put constraints on the free parameters of inhomogeneous models, certain extra information regarding the light-curve fitter used in the supernovae Ia luminosity fluxes processing should be taken into account. We found that the size of the void as well as other parameters of these models might be suffering extra degenerations or additional systematic errors due to the fitter. A recent proposal to relieve the tension between the results from Planck satellite and SNe Ia is re-analyzed in the framework of these subjects.
Constraints on the electron-neutrino mass from the supernova data
International Nuclear Information System (INIS)
Abbott, L.F.; Walker, T.P.
1988-01-01
The energy versus time of arrival pattern of neutrinos from SN1987A is sensitive to a neutrino mass, m ν , of order a few eV. To disentangle constraints on m ν , from the data, a theory of supernova emission is necessary. We recall the present status of this theory and approximate its predictions in two diffusion models: One designed to reflect the present supernova lore, the other devised to pessimize, within reason, the consequent upper limits on m ν . We discuss the model dependence and statistical significance of our results, as well as the experimental uncertainties and caveats to which they are subject. We adress the question, do the supernova results supercede the present laboratory limits on m ν ? (orig.)
PISCO: The PMAS/PPak Integral-field Supernova Hosts Compilation
Galbany, L.; Anderson, J. P.; Sánchez, S. F.; Kuncarayakti, H.; Pedraz, S.; González-Gaitán, S.; Stanishev, V.; Domínguez, I.; Moreno-Raya, M. E.; Wood-Vasey, W. M.; Mourão, A. M.; Ponder, K. A.; Badenes, C.; Mollá, M.; López-Sánchez, A. R.; Rosales-Ortega, F. F.; Vílchez, J. M.; García-Benito, R.; Marino, R. A.
2018-03-01
We present the PMAS/PPak Integral-field Supernova hosts COmpilation (PISCO), which comprises integral field spectroscopy (IFS) of 232 supernova (SN) host galaxies that hosted 272 SNe, observed over several semesters with the 3.5 m telescope at the Calar Alto Observatory (CAHA). PISCO is the largest collection of SN host galaxies observed with wide-field IFS, totaling 466,347 individual spectra covering a typical spatial resolution of ∼380 pc. Focused studies regarding specific SN Ia-related topics will be published elsewhere; this paper aims to present the properties of the SN environments, using stellar population (SP) synthesis, and the gas-phase interstellar medium, providing additional results separating stripped-envelope SNe into their subtypes. With 11,270 H II regions detected in all galaxies, we present for the first time a statistical analysis of H II regions, which puts H II regions that have hosted SNe in context with all other star-forming clumps within their galaxies. SNe Ic are associated with environments that are more metal-rich and have higher EW(Hα) and higher star formation rate within their host galaxies than the mean of all H II regions detected within each host. This in contrast to SNe IIb, which occur in environments that are very different compared to other core-collapse SNe types. We find two clear components of young and old SPs at SNe IIn locations. We find that SNe II fast decliners tend to explode at locations where the ΣSFR is more intense. Finally, we outline how a future dedicated IFS survey of galaxies in parallel to an untargeted SN search would overcome the biases in current environmental studies.
Posttraumatski stresni poremećaj
Glavaš, Vlatko
2017-01-01
Ritam života današnjeg čovjeka ubrzan je i mnogi ne obraćaju pažnju na vlastito psihološko stanje. Posljedica toga je nakupljanje traumatskih ili stresnih događaja u ljudima. Stres ili trauma tumači se kao događaj izvan uobičajenog ljudskog iskustva. Jedan oblik bolesti koji se u vezi s time javlja je posttraumatski stresni poremećaj (PTSP). PTSP zahvaća oboljelu osobu u cjelini djelujući na sve aspekte razvoja osobe, odnosno biološke, psihološke i socijalne aspekte. Na biološkom p...
Rayleigh-Taylor mixing in supernova experiments
International Nuclear Information System (INIS)
Swisher, N. C.; Abarzhi, S. I.; Kuranz, C. C.; Arnett, D.; Hurricane, O.; Remington, B. A.; Robey, H. F.
2015-01-01
We report a scrupulous analysis of data in supernova experiments that are conducted at high power laser facilities in order to study core-collapse supernova SN1987A. Parameters of the experimental system are properly scaled to investigate the interaction of a blast-wave with helium-hydrogen interface, and the induced Rayleigh-Taylor instability and Rayleigh-Taylor mixing of the denser and lighter fluids with time-dependent acceleration. We analyze all available experimental images of the Rayleigh-Taylor flow in supernova experiments and measure delicate features of the interfacial dynamics. A new scaling is identified for calibration of experimental data to enable their accurate analysis and comparisons. By properly accounting for the imprint of the experimental conditions, the data set size and statistics are substantially increased. New theoretical solutions are reported to describe asymptotic dynamics of Rayleigh-Taylor flow with time-dependent acceleration by applying theoretical analysis that considers symmetries and momentum transport. Good qualitative and quantitative agreement is achieved of the experimental data with the theory and simulations. Our study indicates that in supernova experiments Rayleigh-Taylor flow is in the mixing regime, the interface amplitude contributes substantially to the characteristic length scale for energy dissipation; Rayleigh-Taylor mixing keeps order
DISAPPEARANCE OF THE PROGENITOR OF SUPERNOVA iPTF13bvn
Energy Technology Data Exchange (ETDEWEB)
Folatelli, Gastón; Bersten, Melina C. [Facultad de Ciencias Astronómicas y Geofísicas, Universidad Nacional de La Plata, Instituto de Astrofísica de La Plata (IALP), CONICET, Paseo del Bosque S/N, B1900FWA La Plata (Argentina); Van Dyk, Schuyler D. [IPAC/Caltech, Mailcode 100-22, Pasadena, CA 91125 (United States); Kuncarayakti, Hanindyo; Pignata, Giuliano; Hamuy, Mario [Millennium Institute of Astrophysics (MAS), Santiago (Chile); Maeda, Keiichi; Nomoto, Ken’ichi; Quimby, Robert M. [Kavli Institute for the Physics and Mathematics of the Universe (WPI), The University of Tokyo, Kashiwa, Chiba 277-8583 (Japan); Zheng, WeiKang; Filippenko, Alexei V.; Clubb, Kelsey I. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Smith, Nathan [Steward Observatory, University of Arizona, 933 N. Cherry Avenue, Tucson, AZ 85721 (United States); Elias-Rosa, Nancy [INAF-Osservatorio Astronomico di Padova, Vicolo dell’Osservatorio 5, I-35122 Padova (Italy); Foley, Ryan J. [Astronomy Department, University of Illinois at Urbana-Champaign, 1002 W. Green Street, Urbana, IL 61801 (United States); Miller, Adam A., E-mail: gaston.folatelli@ipmu.jp [Jet Propulsion Laboratory, 4800 Oak Grove Drive, MS 169-506, Pasadena, CA 91109 (United States)
2016-07-10
Supernova (SN) iPTF13bvn in NGC 5806 was the first Type Ib SN to have been tentatively associated with a progenitor in pre-explosion images. We performed deep ultraviolet (UV) and optical Hubble Space Telescope observations of the SN site ∼740 days after explosion. We detect an object in the optical bands that is fainter than the pre-explosion object. This dimming is likely not produced by dust absorption in the ejecta; thus, our finding confirms the connection of the progenitor candidate with the SN. The object in our data is likely dominated by the fading SN, implying that the pre-SN flux is mostly due to the progenitor. We compare our revised pre-SN photometry with previously proposed models. Although binary progenitors are favored, models need to be refined. In particular, to comply with our deep UV detection limit, any companion star must be less luminous than a late-O star or substantially obscured by newly formed dust. A definitive progenitor characterization will require further observations to disentangle the contribution of a much fainter SN and its environment.
Ti-44 Gamma-Ray Emission Lines from SN1987A Reveal an Asymmetric Explosion
Boggs, S. E.; Harrison, F. A.; Miyasaka, H.; Grefenstette, B. W.; Zoglauer, A.; Fryer, C. L.; Reynolds, S. P.; Alexander, D. M.; An, H.; Barret, D.;
2015-01-01
In core-collapse supernovae, titanium-44 (Ti-44) is produced in the innermost ejecta, in the layer of material directly on top of the newly formed compact object. As such, it provides a direct probe of the supernova engine. Observations of supernova 1987A (SN1987A) have resolved the 67.87- and 78.32-kilo-electron volt emission lines from decay of Ti-44 produced in the supernova explosion. These lines are narrow and redshifted with a Doppler velocity of 700 kilometers per second, direct evidence of large-scale asymmetry in the explosion.
44Ti gamma-ray emission lines from SN1987A reveal an asymmetric explosion
DEFF Research Database (Denmark)
Boggs, S. E.; Harrison, F. A.; Miyasaka, H.
2015-01-01
In core-collapse supernovae, titanium-44 (44Ti) is produced in the innermost ejecta, in the layer of material directly on top of the newly formed compact object. As such, it provides a direct probe of the supernova engine. Observations of supernova 1987A (SN1987A) have resolved the 67.87- and 78.......32–kilo–electron volt emission lines from decay of 44Ti produced in the supernova explosion. These lines are narrow and redshifted with a Doppler velocity of ~700 kilometers per second, direct evidence of large-scale asymmetry in the explosion....
The nebular spectra of the transitional Type Ia Supernovae 2007on and 2011iv
DEFF Research Database (Denmark)
Mazzali, P. A.; Ashall, C.; Pian, E.
2018-01-01
The nebular-epoch spectrum of the rapidly declining, 'transitional' Type Ia supernova (SN) 2007on showed double emission peaks, which have been interpreted as indicating that the SN was the result of the direct collision of two white dwarfs. The spectrum can be reproduced using two distinct...... be expected for the bolometric luminosity of the SN. This is the case for both SNe 2007on and 2011iv, also a transitional SN Ia that exploded in the same elliptical galaxy, NGC1404. Although SN 2011iv does not show double-peaked emission line profiles, the width of its emission lines is such that a two...
Accurate weak lensing of standard candles. II. Measuring σ8 with supernovae
Quartin, Miguel; Marra, Valerio; Amendola, Luca
2014-01-01
Soon the number of type Ia supernova (SN) measurements should exceed 100 000. Understanding the effect of weak lensing by matter structures on the supernova brightness will then be more important than ever. Although SN lensing is usually seen as a source of systematic noise, we will show that it can be in fact turned into signal. More precisely, the non-Gaussianity introduced by lensing in the SN Hubble diagram dispersion depends rather sensitively on the amplitude σ8 of the matter power spectrum. By exploiting this relation, we are able to predict constraints on σ8 of 7% (3%) for a catalog of 100 000 (500 000) SNe of average magnitude error 0.12, without having to assume that such intrinsic dispersion and its redshift evolution are known a priori. The intrinsic dispersion has been assumed to be Gaussian; possible intrinsic non-Gaussianities in the data set (due to the SN themselves and/or to other transients) could be potentially dealt with by means of additional nuisance parameters describing higher moments of the intrinsic dispersion distribution function. This method is independent of and complementary to the standard methods based on cosmic microwave background, cosmic shear, or cluster abundance observables.
A surge of light at the birth of a supernova
Bersten, M. C.; Folatelli, G.; García, F.; van Dyk, S. D.; Benvenuto, O. G.; Orellana, M.; Buso, V.; Sánchez, J. L.; Tanaka, M.; Maeda, K.; Filippenko, A. V.; Zheng, W.; Brink, T. G.; Cenko, S. B.; de Jaeger, T.; Kumar, S.; Moriya, T. J.; Nomoto, K.; Perley, D. A.; Shivvers, I.; Smith, N.
2018-02-01
It is difficult to establish the properties of massive stars that explode as supernovae. The electromagnetic emission during the first minutes to hours after the emergence of the shock from the stellar surface conveys important information about the final evolution and structure of the exploding star. However, the unpredictable nature of supernova events hinders the detection of this brief initial phase. Here we report the serendipitous discovery of a newly born, normal type IIb supernova (SN 2016gkg), which reveals a rapid brightening at optical wavelengths of about 40 magnitudes per day. The very frequent sampling of the observations allowed us to study in detail the outermost structure of the progenitor of the supernova and the physics of the emergence of the shock. We develop hydrodynamical models of the explosion that naturally account for the complete evolution of the supernova over distinct phases regulated by different physical processes. This result suggests that it is appropriate to decouple the treatment of the shock propagation from the unknown mechanism that triggers the explosion.
Ultraviolet Detection of the Binary Companion to the Type IIb SN 2001ig
Ryder, Stuart D.; Van Dyk, Schuyler D.; Fox, Ori D.; Zapartas, Emmanouil; de Mink, Selma E.; Smith, Nathan; Brunsden, Emily; Azalee Bostroem, K.; Filippenko, Alexei V.; Shivvers, Isaac; Zheng, WeiKang
2018-03-01
We present HST/WFC3 ultraviolet imaging in the F275W and F336W bands of the Type IIb SN 2001ig at an age of more than 14 years. A clear point source is detected at the site of the explosion, with m F275W = 25.39 ± 0.10 and m F336W = 25.88 ± 0.13 mag. Despite weak constraints on both the distance to the host galaxy NGC 7424 and the line-of-sight reddening to the supernova, this source matches the characteristics of an early B-type main-sequence star with 19,000 GMOS optical spectrum at an age of 6 years reveals a narrow He II λ4686 emission line, indicative of continuing interaction with a dense circumstellar medium at large radii from the progenitor. We review our findings on SN 2001ig in the context of binary evolution channels for stripped-envelope supernovae. Owing to the uncrowded nature of its environment in the ultraviolet, this study of SN 2001ig represents one of the cleanest detections to date of a surviving binary companion to a Type IIb supernova.
Type Ia supernovae yielding distances with 3-4% precision
Energy Technology Data Exchange (ETDEWEB)
Kelly, Patrick L. [Univ. of California, Berkeley, CA (United States); Filippenko, Alexei V. [Univ. of California, Berkeley, CA (United States); Burke, David L. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Hicken, Malcolm [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA (United States); Ganeshalingam, Mohan [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Zheng, Weikang [Univ. of California, Berkeley, CA (United States)
2015-01-26
The luminosities of Type Ia supernovae (SN), the thermonuclear explosions of white dwarf stars, vary systematically with their intrinsic color and light-curve decline rate. These relationships have been used to calibrate their luminosities to within ~0.14–0.20 mag from broadband optical light curves, yielding individual distances accurate to ~7–10%. Here we identify a subset of SN Ia that erupt in environments having high ultraviolet surface brightness and star-formation surface density. When we apply a steep model extinction law, these SN can be calibrated to within ~0.065–0.075 mag, corresponding to ~3–4% in distance — the best yet with SN Ia by a substantial margin. The small scatter suggests that variations in only one or two progenitor properties account for their light-curve-width/color/luminosity relation.
Gravitational lensing of the SNLS supernovae
International Nuclear Information System (INIS)
Kronborg, T.
2011-01-01
Type Ia supernovae have become an essential tool of modern observational cosmology. By studying the distance-redshift relation of a large number of supernovae, the nature of dark energy can be unveiled. Distances to Type Ia SNe are however affected by gravitational lensing which can induce systematic effects in the measurement of cosmology. The majority of the supernovae is slightly de-magnified whereas a small fraction is significantly magnified due to the mass distribution along the line of sight. This causes naturally an additional dispersion in the observed magnitudes. There are two different ways to estimate the magnification of a supernova. A first method consists in comparing the supernova luminosity, which is measured to about 15% precision, to the mean SN luminosity at the same redshift. Another estimate can be obtained from predicting the magnification induced by the foreground matter density modeled from the measurements of the luminosity of the galaxies with an initial prior on the mass-luminosity relation of the galaxies. A correlation between these 2 estimates will make it possible to tune the initially used mass-luminosity relation resulting in an independent measurement of the dark matter clustering based on the luminosity of SNe Ia. Evidently, this measurement depends crucially on the detection of this correlation also referred to as the lensing signal. This thesis is dedicated to the measurement of the lensing signal in the SNLS 3-year sample. (author)
Radio emission from Supernovae and High Precision Astrometry
Perez-Torres, M. A.
1999-11-01
corrections, agree well within one standard deviation. In summary, our astrometric results demonstrate the feasibility of using phase-delay difference techniques (single-frequency or dual-frequency) for sources separated by as far as 15(deg) on the sky. This opens the avenue for the extension of the technique on a global scale with the aim of building up a quasi-inertial reference frame (of submilliarcsecond accuracy) based on extragalactic radio sources. The second part of this thesis is devoted to the study of the radio emission of the Type II supernova SN 1993J, whose relative proximity (it exploded in the Galaxy M81, at a distance of 10 million of light-years) has allowed us to observe it with VLBI at different radio frequency bands since June 1993. This radio supernova is the best studied one so far and thus a perfect laboratory to test supernova radio emission models. Early VLBI observations of this supernova by our group allowed us to discover the shell structure of SN 1993J--likely common to all supernovae--the youngest ever discovered in a supernova. Subsequently, our VLBI observations showed SN 1993J to be self-similarly expanding and, more recently, we used our VLBI observations at 3.6 and 6 cm in the period 6 through 42 months after explosion to show that the supernova expansion is decelerating, its size following a power-law with time (R t^m; m=0.86 +- 0.02). Our measurement of the expansion index yields estimates of the density of both supernova ejecta and circumstellar material in standard supernova explosion models. In particular, the density of the circumstellar material seems to be following a power-law less steep than usual (rhocs r^{-s}, with s approx. 1.66 instead of the standard s=2). Our VLBI observations also showed that the supernova radio emission comes from a shell of width 30% of the outer radius. In this thesis, we describe a numerical code that simulates synchrotron radio emission from a supernova. We assume that the supernova is self
On Neutron Star/Supernova Remnant Association
Gvaramadze, V. V.
It is pointed out that a cavity supernova (SN) explosion of a moving massive star could result in a significant offset of the neutron star (NS) birth-place from the geometrical centre of the supernova remnant (SNR). Therefore: a) the high implied transverse velocities of a number of NSs (e.g. PSR B1610-50, PSR B1706-44, PSR B1757-24, SGR 0526-66) could be reduced; b) the proper motion vector of a NS should not necessarily point away from the geometrical centre of the associated SNR; c) the circle of possible NS/SNR associations could be enlarged. An observational test is discussed, which could provide a determination of the true birth-places of NSs associated with middle-aged SNRs, and thereby provide more reliable estimates of their transverse velocities.
METALLICITY IN THE GRB 100316D/SN 2010bh HOST COMPLEX
International Nuclear Information System (INIS)
Levesque, Emily M.; Berger, Edo; Soderberg, Alicia M.; Chornock, Ryan
2011-01-01
The recent long-duration GRB 100316D, associated with supernova SN 2010bh and detected by Swift, is one of the nearest gamma-ray burst (GRB)-supernovae (SNe) ever observed (z = 0.059). This provides us with a unique opportunity to study the explosion environment on ∼kpc scale in relation to the host galaxy complex. Here we present spatially resolved spectrophotometry of the host galaxy, focusing on both the explosion site and the brightest star-forming regions. Using these data, we extract the spatial profiles of the relevant emission features (Hα, Hβ, [O III]λ5007, and [N II]λ6584) and use these profiles to examine variations in metallicity and star formation rate (SFR) as a function of position in the host galaxy. We conclude that GRB 100316D/SN2010bh occurred in a low-metallicity host galaxy, and that the GRB-SN explosion site corresponds to the region with the lowest metallicity and highest SFR sampled by our observations.
Host Galaxy Spectra and Consequences for SN Typing from the SDSS SN Survey
Energy Technology Data Exchange (ETDEWEB)
Olmstead, Matthew D.; Brown, Peter J.; Sako, Masao; Bassett, Bruce; Bizyaev, Dmitry; Brinkmann, J.; Brownstein, Joel R.; Brewington, Howard; Campbell, Heather; D’Andrea, Chris B.; Dawson, Kyle S.; Ebelke, Garrett L.; Frieman, Joshua A.; Galbany, Lluís; Garnavich, Peter; Gupta, Ravi R.; Hlozek, Renee; Jha, Saurabh W.; Kunz, Martin; Lampeitl, Hubert; Malanushenko, Elena; Malanushenko, Viktor; Marriner, John; Miquel, Ramon; Montero-Dorta, Antonio D.; Nichol, Robert C.; Oravetz, Daniel J.; Pan, Kaike; Schneider, Donald P.; Simmons, Audrey E.; Smith, Mathew; Snedden, Stephanie A.
2014-03-06
We present the spectroscopy from 5254 galaxies that hosted supernovae (SNe) or other transient events in the Sloan Digital Sky Survey II (SDSS-II). Obtained during SDSS-I, SDSS-II, and the Baryon Oscillation Spectroscopic Survey (BOSS), this sample represents the largest systematic, unbiased, magnitude limited spectroscopic survey of supernova (SN) host galaxies. Using the host galaxy redshifts, we test the impact of photometric SN classification based on SDSS imaging data with and without using spectroscopic redshifts of the host galaxies. Following our suggested scheme, there are a total of 1166 photometrically classified SNe Ia when using a flat redshift prior and 1126 SNe Ia when the host spectroscopic redshift is assumed. For 1024 (87.8%) candidates classified as likely SNe Ia without redshift information, we find that the classification is unchanged when adding the host galaxy redshift. Using photometry from SDSS imaging data and the host galaxy spectra, we also report host galaxy properties for use in future nalysis of SN astrophysics. Finally, we investigate the differences in the interpretation of the light curve properties with and without knowledge of the redshift. When using the SALT2 light curve fitter, we find a 21% increase in the number of fits that converge when using the spectroscopic redshift. Without host galaxy redshifts, we find that SALT2 light curve fits are systematically biased towards lower photometric redshift estimates and redder colors in the limit of low signal-to-noise data. The general improvements in performance of the light curve fitter and the increased diversity of the host galaxy sample highlights the importance of host galaxy spectroscopy for current photometric SN surveys such as the Dark Energy Survey and future surveys such as the Large Synoptic Survey Telescope.
CIRCUMSTELLAR SHELLS IN ABSORPTION IN TYPE Ia SUPERNOVAE
International Nuclear Information System (INIS)
Borkowski, Kazimierz J.; Blondin, John M.; Reynolds, Stephen P.
2009-01-01
Progenitors of Type Ia supernovae (SNe) have been predicted to modify their ambient circumstellar (CSM) and interstellar environments through the action of their powerful winds. While there is X-ray and optical evidence for circumstellar interaction in several remnants of Type Ia SNe, widespread evidence for such interaction in Type Ia SNe themselves has been lacking. We consider prospects for the detection of CSM shells that have been predicted to be common around Type Ia SNe. Such shells are most easily detected in Na I absorption lines. Variable (declining) absorption is expected to occur soon after the explosion, primarily during the SN rise time, for shells located within ∼1-10 pc of a SN. The distance of the shell from the SN can be determined by measuring the timescale for line variability.
ASAS-SN Discovery of a Possible Galactic Nova ASASSN-18ix
Stanek, K. Z.; Kochanek, C. S.; Shields, J. V.; Thompson, T. A.; Chomiuk, L.; Strader, J.; Shappee, B. J.; Holoien, T. W.-S.; Prieto, J. L.; Dong, Subo; Stritzinger, M.
2018-04-01
During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from multiple ASAS-SN telescopes, we detect a new bright transient source, possibly a classical nova, but it might also be a young, large amplitude outburst of a cataclysmic variable Object RA (J2000) DEC (J2000) Gal l (deg) Gal b (deg) Disc.
Could a nearby supernova explosion have caused a mass extinction?
Ellis, Jonathan Richard
1995-01-01
We examine the possibility that a nearby supernova explosion could have caused one or more of the mass extinctions identified by palaeontologists. We discuss the likely rate of such events in the light of the recent identification of Geminga as a supernova remnant less than 100 pc away and the discovery of a millisecond pulsar about 150 pc away, and observations of SN 1987A. The fluxes of $\\gamma$ radiation and charged cosmic rays on the Earth are estimated, and their effects on the Earth's ozone layer discussed. A supernova explosion of the order of 10 pc away could be expected every few hundred million years, and could destroy the ozone layer for hundreds of years, letting in potentially lethal solar ultraviolet radiation. In addition to effects on land ecology, this could entail mass destruction of plankton and reef communities, with disastrous consequences for marine life as well. A supernova extinction should be distinguishable from a meteorite impact such as the one that presumably killed the dinosaurs.
Revisiting the SN1987A gamma-ray limit on ultralight axion-like particles
International Nuclear Information System (INIS)
Payez, Alexandre; Ringwald, Andreas; Evoli, Carmelo; Mirizzi, Alessandro; Fischer, Tobias; Giannotti, Maurizio
2014-10-01
We revise the bound from the supernova SN1987A on the coupling of ultralight axion-like particles (ALPs) to photons. In a core-collapse supernova, ALPs would be emitted via the Primakoff process, and eventually convert into gamma rays in the magnetic field of the Milky Way. The lack of a gamma-ray signal in the GRS instrument of the SMM satellite in coincidence with the observation of the neutrinos emitted from SN1987A therefore provides a strong bound on their coupling to photons. Due to the large uncertainty associated with the current bound, we revise this argument, based on state-of-the-art physical inputs both for the supernova models and for the Milky-Way magnetic field. Furthermore, we provide major amendments, such as the consistent treatment of nucleon-degeneracy effects and of the reduction of the nuclear masses in the hot and dense nuclear medium of the supernova. With these improvements, we obtain a new upper limit on the photon-ALP coupling: g aγ -12 GeV -1 , for m a -10 eV, and we also give its dependence at larger ALP masses m a . Moreover, we discuss how much the Fermi-LAT satellite experiment could improve this bound, should a close-enough supernova explode in the near future.
Impacto ambiental de los remanentes de supernova
Dubner, G. M.
2015-08-01
The explosion of a supernovae (SN) represents the sudden injection of about ergs of thermal and mechanical energy in a small region of space, causing the formation of powerful shock waves that propagate through the interstellar medium at speeds of several thousands of km/s. These waves sweep, compress and heat the interstellar material that they encounter, forming the supernova remnants. Their evolution over thousands of years change forever, irreversibly, not only the physical but also the chemical properties of a vast region of space that can span hundreds of parsecs. This contribution briefly analyzes the impact of these explosions, discussing the relevance of some phenomena usually associated with SNe and their remnants in the light of recent theoretical and observational results.
Matter suppression of collective SN neutrino oscillations and stability analysis
International Nuclear Information System (INIS)
Saviano, N.; Chakraborty, S.; Mirizzi, A.
2014-01-01
We perform a detailed analysis of the supernova (SN) neutrino flavor evolution during the early time accretion phase (post-bounce time t pb ≤ 500 ms), characterizing the ν signal by recent SN hydrodynamics simulations. We find that collective oscillations induced the ν-ν interactions in the deepest SN regions are suppressed by trajectory-dependent 'multi-angle' effects associated with the dense ordinary matter. We confirm this result with a linearized stability analysis of the neutrino equations of motion in presence of realistic neutrino energy with angle distributions. (authors)
Calibrating the Type Ia Supernova Distance Scale Using Surface Brightness Fluctuations
Potter, Cicely; Jensen, Joseph B.; Blakeslee, John; Milne, Peter; Garnavich, Peter M.; Brown, Peter
2018-06-01
We have observed 20 supernova host galaxies with HST WFC3/IR in the F110W filter, and prepared the data for Surface Brightness Fluctuation (SBF) distance measurements. The purpose of this study is to determine if there are any discrepancies between the SBF distance scale and the type-Ia SN distance scale, for which local calibrators are scarce. We have now measured SBF magnitudes to all early-type galaxies that have hosted SN Ia within 80 Mpc for which SBF measurements are possible. SBF is the only distance measurement technique with statistical uncertainties comparable to SN Ia that can be applied to galaxies out to 80 Mpc.
Time-resolved Polarimetry of the Superluminous SN 2015bn with the Nordic Optical Telescope
Energy Technology Data Exchange (ETDEWEB)
Leloudas, Giorgos; Gal-Yam, Avishay [Department of Particle Physics and Astrophysics, Weizmann Institute of Science, Rehovot 7610001 (Israel); Maund, Justyn R. [The Department of Physics and Astronomy, University of Sheffield, Hicks Building, Hounsfield Road, Sheffield S3 7RH (United Kingdom); Pursimo, Tapio [Nordic Optical Telescope, Apartado 474, E-38700 Santa Cruz de La Palma, Santa Cruz de Tenerife (Spain); Hsiao, Eric [Department of Physics, Florida State University, Tallahassee, FL 32306 (United States); Malesani, Daniele; De Ugarte Postigo, Antonio [Dark Cosmology Centre, Niels Bohr Institute, University of Copenhagen, Juliane Maries vej 30, DK-2100 Copenhagen (Denmark); Patat, Ferdinando [European Southern Observatory, Karl-Schwarzschild-Strasse 2, D-85748 Garching (Germany); Sollerman, Jesper [The Oskar Klein Centre, Department of Astronomy, Stockholm University, AlbaNova, SE-10691 Stockholm (Sweden); Stritzinger, Maximilian D. [Department of Physics and Astronomy, Aarhus University, Ny Munkegade 120, DK-8000 Aarhus C (Denmark); Wheeler, J. Craig [Department of Astronomy, University of Texas at Austin, Austin, TX 78712 (United States)
2017-03-01
We present imaging polarimetry of the superluminous supernova SN 2015bn, obtained over nine epochs between −20 and +46 days with the Nordic Optical Telescope. This was a nearby, slowly evolving Type I superluminous supernova that has been studied extensively and for which two epochs of spectropolarimetry are also available. Based on field stars, we determine the interstellar polarization in the Galaxy to be negligible. The polarization of SN 2015bn shows a statistically significant increase during the last epochs, confirming previous findings. Our well-sampled imaging polarimetry series allows us to determine that this increase (from ∼0.54% to ≳1.10%) coincides in time with rapid changes that took place in the optical spectrum. We conclude that the supernova underwent a “phase transition” at around +20 days, when the photospheric emission shifted from an outer layer, dominated by natal C and O, to a more aspherical inner core, dominated by freshly nucleosynthesized material. This two-layered model might account for the characteristic appearance and properties of Type I superluminous supernovae.
PHOTOMETRIC SUPERNOVA COSMOLOGY WITH BEAMS AND SDSS-II
Energy Technology Data Exchange (ETDEWEB)
Hlozek, Renee [Oxford Astrophysics, Department of Physics, University of Oxford, Keble Road, Oxford, OX1 3RH (United Kingdom); Kunz, Martin [Department de physique theorique, Universite de Geneve, 30, quai Ernest-Ansermet, CH-1211 Geneve 4 (Switzerland); Bassett, Bruce; Smith, Mat; Newling, James [African Institute for Mathematical Sciences, 68 Melrose Road, Muizenberg 7945 (South Africa); Varughese, Melvin [Department of Mathematics and Applied Mathematics, University of Cape Town, Rondebosch, Cape Town, 7700 (South Africa); Kessler, Rick; Frieman, Joshua [The Kavli Institute for Cosmological Physics, The University of Chicago, 933 East 56th Street, Chicago, IL 60637 (United States); Bernstein, Joseph P.; Kuhlmann, Steve; Marriner, John [Argonne National Laboratory, 9700 South Cass Avenue, Argonne, IL 60439 (United States); Campbell, Heather; Lampeitl, Hubert; Nichol, Robert C. [Institute of Cosmology and Gravitation, Dennis Sciama Building Burnaby Road Portsmouth PO1 3FX (United Kingdom); Dilday, Ben [Las Cumbres Observatory Global Telescope Network, 6740 Cortona Drive, Suite 102, Goleta, CA 93117 (United States); Falck, Bridget; Riess, Adam G. [Department of Physics and Astronomy, Johns Hopkins University, 3400 North Charles Street, Baltimore, MD 21218 (United States); Sako, Masao [Department of Physics and Astronomy, University of Pennsylvania, 203 South 33rd Street, Philadelphia, PA 19104 (United States); Schneider, Donald P., E-mail: rhlozek@astro.princeton.edu [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States)
2012-06-20
Supernova (SN) cosmology without spectroscopic confirmation is an exciting new frontier, which we address here with the Bayesian Estimation Applied to Multiple Species (BEAMS) algorithm and the full three years of data from the Sloan Digital Sky Survey II Supernova Survey (SDSS-II SN). BEAMS is a Bayesian framework for using data from multiple species in statistical inference when one has the probability that each data point belongs to a given species, corresponding in this context to different types of SNe with their probabilities derived from their multi-band light curves. We run the BEAMS algorithm on both Gaussian and more realistic SNANA simulations with of order 10{sup 4} SNe, testing the algorithm against various pitfalls one might expect in the new and somewhat uncharted territory of photometric SN cosmology. We compare the performance of BEAMS to that of both mock spectroscopic surveys and photometric samples that have been cut using typical selection criteria. The latter typically either are biased due to contamination or have significantly larger contours in the cosmological parameters due to small data sets. We then apply BEAMS to the 792 SDSS-II photometric SNe with host spectroscopic redshifts. In this case, BEAMS reduces the area of the {Omega}{sub m}, {Omega}{sub {Lambda}} contours by a factor of three relative to the case where only spectroscopically confirmed data are used (297 SNe). In the case of flatness, the constraints obtained on the matter density applying BEAMS to the photometric SDSS-II data are {Omega}{sup BEAMS}{sub m} = 0.194 {+-} 0.07. This illustrates the potential power of BEAMS for future large photometric SN surveys such as Large Synoptic Survey Telescope.
PHOTOMETRIC SUPERNOVA COSMOLOGY WITH BEAMS AND SDSS-II
International Nuclear Information System (INIS)
Hlozek, Renée; Kunz, Martin; Bassett, Bruce; Smith, Mat; Newling, James; Varughese, Melvin; Kessler, Rick; Frieman, Joshua; Bernstein, Joseph P.; Kuhlmann, Steve; Marriner, John; Campbell, Heather; Lampeitl, Hubert; Nichol, Robert C.; Dilday, Ben; Falck, Bridget; Riess, Adam G.; Sako, Masao; Schneider, Donald P.
2012-01-01
Supernova (SN) cosmology without spectroscopic confirmation is an exciting new frontier, which we address here with the Bayesian Estimation Applied to Multiple Species (BEAMS) algorithm and the full three years of data from the Sloan Digital Sky Survey II Supernova Survey (SDSS-II SN). BEAMS is a Bayesian framework for using data from multiple species in statistical inference when one has the probability that each data point belongs to a given species, corresponding in this context to different types of SNe with their probabilities derived from their multi-band light curves. We run the BEAMS algorithm on both Gaussian and more realistic SNANA simulations with of order 10 4 SNe, testing the algorithm against various pitfalls one might expect in the new and somewhat uncharted territory of photometric SN cosmology. We compare the performance of BEAMS to that of both mock spectroscopic surveys and photometric samples that have been cut using typical selection criteria. The latter typically either are biased due to contamination or have significantly larger contours in the cosmological parameters due to small data sets. We then apply BEAMS to the 792 SDSS-II photometric SNe with host spectroscopic redshifts. In this case, BEAMS reduces the area of the Ω m , Ω Λ contours by a factor of three relative to the case where only spectroscopically confirmed data are used (297 SNe). In the case of flatness, the constraints obtained on the matter density applying BEAMS to the photometric SDSS-II data are Ω BEAMS m = 0.194 ± 0.07. This illustrates the potential power of BEAMS for future large photometric SN surveys such as Large Synoptic Survey Telescope.
The Origin and Evolution of the Infrared Light Curve of SN2010jl
Dwek, Eli; Sarangi, Arkaprabha; Arendt, Richard; Fox, Ori; Kallman, Timothy; Kazanas, Demosthenes
2018-01-01
SN2010jl is a luminous core-collapse supernova (CCSN) of Type IIn that is surrounded by a dense circumstellar medium (CSM). The supernova (SN) luminosity vastly exceeds the available power from radiactive elements in the ejecta, and is powered by the interaction of the SN shock wave with the ambient medium. Upper limits on the UV and near-IR (NIR) emission from pre-explosion images of the region suggest that any progenitor star was hidden by pre-existing CSM dust. After day ~80, the SN spectrum shows the development of an IR excess above the extrapolated UVO emission arising from the shocked CSM. This IR component is attributed to thermal emission from dust.After day ~300, the light curve exhibits a rise in the NIR luminosity, concurrent with a steep decline at UVO wavelengths. Ruling out any possible contribution of SN-condensed dust to the IR light curve, we show that the early IR emission arises from the pre-existing CSM dust that survived the flash of radiation from the shock breakout. The late IR emission arises from newly-formed CSM dust that condensed in the cooling dust-free postshock gas of the advancing SN shock wave. Our analysis presents the first detailed modeling of dust formation in a cooling postshock environment, and provides important insights into the interaction of the SN shock wave with the CSM.
X-RAY EMISSION FROM SN 2004dj: A TALE OF TWO SHOCKS
Energy Technology Data Exchange (ETDEWEB)
Chakraborti, Sayan; Yadav, Naveen; Ray, Alak [Tata Institute of Fundamental Research, 1 Homi Bhabha Road, Colaba, Mumbai 400 005 (India); Smith, Randall [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Chandra, Poonam [Department of Physics, Royal Military College of Canada, Kingston, ON K7K 7B4 (Canada); Pooley, David, E-mail: schakraborti@fas.harvard.edu [Department of Physics, Sam Houston State University, Huntsville, TX (United States)
2012-12-20
Type IIP (Plateau) supernovae are the most commonly observed variety of core-collapse events. They have been detected in a wide range of wavelengths from radio, through optical to X-rays. The standard picture of a Type IIP supernova has the blastwave interacting with the progenitor's circumstellar matter to produce a hot region bounded by a forward and a reverse shock. This region is thought to be responsible for most of the X-ray and radio emission from these objects. Yet the origin of X-rays from these supernovae is not well understood quantitatively. The relative contributions of particle acceleration and magnetic field amplification in generating the X-ray and radio emission need to be determined. In this work, we analyze archival Chandra observations of SN 2004dj, one of the nearest supernovae since SN 1987A, along with published radio and optical information. We determine the pre-explosion mass-loss rate, blastwave velocity, electron acceleration, and magnetic field amplification efficiencies. We find that a greater fraction of the thermal energy goes into accelerating electrons than into amplifying magnetic fields. We conclude that the X-ray emission arises out of a combination of inverse Compton scattering by non-thermal electrons accelerated in the forward shock and thermal emission from supernova ejecta heated by the reverse shock.
International Nuclear Information System (INIS)
Badenes, Carles; Harris, Jason; Zaritsky, Dennis; Prieto, Jose L.
2009-01-01
We use the star formation history (SFH) map of the Large Magellanic Cloud recently published by Harris and Zaritsky to study the sites of the eight smallest (and presumably youngest) supernova remnants (SNRs) in the Cloud: SN 1987A, N158A, N49, and N63A (core collapse remnants), 0509 - 67.5, 0519 - 69.0, N103B, and DEM L71 (Type Ia remnants). The local SFHs provide unique insights into the nature of the supernova (SN) progenitors, which we compare with the properties of the SN explosions derived from the remnants themselves and from SN light echoes. We find that all the core collapse SNe that we have studied are associated with vigorous star formation (SF) in the recent past. In the case of SN 1987A, the time of the last peak of SF (12 Myr) matches the lifetime of a star with the known mass of its blue supergiant progenitor (∼20 M sun ). More recent peaks of SF can lead to SNe with more massive progenitors, which opens the possibility of a Type Ib/c origin for SNRs N158A and N63A. Stars more massive than 21.5 M sun are very scarce around SNR N49, implying that the magnetar SGR 0526 - 66 in this SNR was either formed elsewhere or came from a progenitor with a mass well below the 30M sun threshold suggested in the literature. Three of our four Ia SNRs are associated with old, metal-poor stellar populations. This includes SNR 0509 - 67.5, which is known to have been originated by an extremely bright Type Ia event, and yet is located very far away from any sites of recent SF, in a population with a mean age of 7.9 Gyr. The Type Ia SNR N103B, on the other hand, is associated with recent SF, and might have had a relatively younger and more massive progenitor with substantial mass loss before the explosion. We discuss these results in the context of our present understanding of core collapse and Type Ia SN progenitors.
Two Years and Five Images of Supernova Refsdal
Kelly, Patrick
2017-01-01
In 1964, Sjur Refsdal hypothesized that a supernova (SN) whose light takes multiple paths to reach us around a strong gravitational lens could be used as a highly powerful probe. For such a system, the time delays between the images of the SN should depend sensitively on the cosmic expansion rate and the distribution of matter within the lens. I will present observations of the first strongly lensed SN resolved into multiple images, which was found in near-infrared imaging taken in early November 2014 with the Hubble Space Telescope (HST). SN `Refsdal' appeared in an Einstein cross configuration around an early-type galaxy in the MACS J1149.6+2223 cluster (z=0.54), and its light curve and spectrum are broadly similar to those of the peculiar and well-studied SN 1987A. Models of the cluster potential predicted that the SN would reappear within two years in a different image of its spiral host galaxy (z=1.49) closer to the cluster's center. In early December 2015, we detected the new image of the SN with the HST, and we anticipate being able to measure its relative time delay with a 1-2% precision, providing a rare test of blind model predictions.
Velocity Dispersion of Ionized Gas and Multiple Supernova Explosions
Directory of Open Access Journals (Sweden)
Vasiliev E. O.
2015-06-01
Full Text Available We use 3D numerical simulations to study the evolution of the Hα intensity and velocity dispersion for single and multiple supernova (SN explosions. We find that the IHα– σ diagram obtained for simulated gas flows is similar in shape to that observed in dwarf galaxies. We conclude that colliding SN shells with significant difference in age are responsible for high velocity dispersion that reaches up to ≳ 100 km s−1. Such a high velocity dispersion could be hardly obtained for a single SN remnant. Peaks of velocity dispersion in the IHα– σ diagram may correspond to several isolated or merged SN remnants with moderately different ages. Degrading the spatial resolution in the Hα intensity and velocity dispersion maps makes the simulated IHα– σ diagrams close to those observed in dwarf galaxies not only in shape, but also quantitatively.
Could there be a hole in type Ia supernovae?
International Nuclear Information System (INIS)
Kasen, Daniel; Nugent, Peter; Thomas, R.C.; Wang, Lifan
2004-01-01
In the favored progenitor scenario, Type Ia supernovae (SNe Ia) arise from a white dwarf accreting material from a non-degenerate companion star. Soon after the white dwarf explodes, the ejected supernova material engulfs the companion star; two-dimensional hydrodynamical simulations by Marietta et al. (2001) show that, in the interaction, the companion star carves out a conical hole of opening angle 30-40 degrees in the supernova ejecta. In this paper we use multi-dimensional Monte Carlo radiative transfer calculations to explore the observable consequences of an ejecta-hole asymmetry. We calculate the variation of the spectrum, luminosity, and polarization with viewing angle for the aspherical supernova near maximum light. We find that the supernova looks normal from almost all viewing angles except when one looks almost directly down the hole. In the latter case, one sees into the deeper, hotter layers of ejecta. The supernova is relatively brighter and has a peculiar spectrum characterized by more highly ionized species, weaker absorption features, and lower absorption velocities. The spectrum viewed down the hole is comparable to the class of SN 1991T-like supernovae. We consider how the ejecta-hole asymmetry may explain the current spectropolarimetric observations of SNe Ia, and suggest a few observational signatures of the geometry. Finally, we discuss the variety currently seen in observed SNe Ia and how an ejecta-hole asymmetry may fit in as one of several possible sources of diversity
NASA's Swift Satellite Catches First Supernova in The Act of Exploding
2008-05-01
GREENBELT, Md.- Thanks to a fortuitous observation with NASA’s Swift satellite, astronomers for the first time have caught a star in the act of exploding. Astronomers have previously observed thousands of stellar explosions, known as supernovae, but they have always seen them after the fireworks were well underway. "For years we have dreamed of seeing a star just as it was exploding, but actually finding one is a once in a lifetime event," says team leader Alicia Soderberg, a Hubble and Carnegie-Princeton Fellow at Princeton University in Princeton, N.J. "This newly born supernova is going to be the Rosetta stone of supernova studies for years to come." A typical supernova occurs when the core of a massive star runs out of nuclear fuel and collapses under its own gravity to form an ultradense object known as a neutron star. The newborn neutron star compresses and then rebounds, triggering a shock wave that plows through the star’s gaseous outer layers and blows the star to smithereens. Astronomers thought for nearly four decades that this shock "break-out" will produce bright X-ray emission lasting a few minutes. X-ray Image X-ray Images But until this discovery, astronomers have never observed this signal. Instead, they have observed supernovae brightening days or weeks later, when the expanding shell of debris is energized by the decay of radioactive elements forged in the explosion. "Seeing the shock break-out in X-rays can give a direct view of the exploding star in the last minutes of its life and also provide a signpost to which astronomers can quickly point their telescopes to watch the explosion unfold," says Edo Berger, a Carnegie-Princeton Fellow at Princeton University. Soderberg's discovery of the first shock breakout can be attributed to luck and Swift's unique design. On January 9, 2008, Soderberg and Berger were using Swift to observe a supernova known as SN 2007uy in the spiral galaxy NGC 2770, located 90 million light-years from Earth in the
Stellar Firework in a Whirlwind
2007-09-01
VLT Image of Supernova in Beautiful Spiral Galaxy NGC 1288 Stars do not like to be alone. Indeed, most stars are members of a binary system, in which two stars circle around each other in an apparently never-ending cosmic ballet. But sometimes, things can go wrong. When the dancing stars are too close to each other, one of them can start devouring its partner. If the vampire star is a white dwarf - a burned-out star that was once like our Sun - this greed can lead to a cosmic catastrophe: the white dwarf explodes as a Type Ia supernova. In July 2006, ESO's Very Large Telescope took images of such a stellar firework in the galaxy NGC 1288. The supernova - designated SN 2006dr - was at its peak brightness, shining as bright as the entire galaxy itself, bearing witness to the amount of energy released. ESO PR Photo 39/07 ESO PR Photo 39/07 SN 2006dr in NGC 1288 NGC 1288 is a rather spectacular spiral galaxy, seen almost face-on and showing multiple spiral arms pirouetting around the centre. Bearing a strong resemblance to the beautiful spiral galaxy NGC 1232, it is located 200 million light-years away from our home Galaxy, the Milky Way. Two main arms emerge from the central regions and then progressively split into other arms when moving further away. A small bar of stars and gas runs across the centre of the galaxy. The first images of NGC 1288, obtained during the commissioning period of the FORS instrument on ESO's VLT in 1998, were of such high quality that they have allowed astronomers [1] to carry out a quantitative analysis of the morphology of the galaxy. They found that NGC 1288 is most probably surrounded by a large dark matter halo. The appearance and number of spiral arms are indeed directly related to the amount of dark matter in the galaxy's halo. The supernova was first spotted by amateur astronomer Berto Monard. On the night of 17 July 2006, Monard used his 30-cm telescope in the suburbs of Pretoria in South Africa and discovered the supernova as an
Photon Dispersion in a Supernova Core
Kopf, A.; Raffelt, G.
1997-01-01
While the photon forward-scattering amplitude on free magnetic dipoles (e.g. free neutrons) vanishes, the nucleon magnetic moments still contribute significantly to the photon dispersion relation in a supernova (SN) core where the nucleon spins are not free due to their interaction. We study the frequency dependence of the relevant spin susceptibility in a toy model with only neutrons which interact by one-pion exchange. Our approach amounts to calculating the photon absorption rate from the ...
International Nuclear Information System (INIS)
Graham, M. L.; Pritchet, C. J.; Balam, D.; Fabbro, S.; Sullivan, M.; Hook, I. M.; Howell, D. A.; Gwyn, S. D. J.; Astier, P.; Balland, C.; Guy, J.; Hardin, D.; Pain, R.; Regnault, N.; Basa, S.; Carlberg, R. G.; Perrett, K.; Conley, A.; Fouchez, D.; Rich, J.
2010-01-01
We have combined the large SN Ia database of the Canada-France-Hawaii Telescope Supernova Legacy Survey and catalogs of galaxies with photometric redshifts, Very Large Array 1.4 GHz radio sources, and Spitzer infrared sources. We present eight SNe Ia in early-type host galaxies which have counterparts in the radio and infrared source catalogs. We find the SN Ia rate in subsets of radio and infrared early-type galaxies is ∼1-5 times the rate in all early-type galaxies, and that any enhancement is always ∼<2σ. Rates in these subsets are consistent with predictions of the two-component 'A+B' SN Ia rate model. Since infrared properties of radio SN Ia hosts indicate dust-obscured star formation, we incorporate infrared star formation rates into the 'A+B' model. We also show the properties of SNe Ia in radio and infrared galaxies suggest the hosts contain dust and support a continuum of delay time distributions (DTDs) for SNe Ia, although other DTDs cannot be ruled out based on our data.
A HIGH-RESOLUTION SPECTROSCOPIC SEARCH FOR THE REMAINING DONOR FOR TYCHO'S SUPERNOVA
Energy Technology Data Exchange (ETDEWEB)
Kerzendorf, Wolfgang E.; Yong, David; Schmidt, Brian P.; Murphy, Simon J.; Bessell, Michael S. [Research School of Astronomy and Astrophysics, Mount Stromlo Observatory, Cotter Road, Weston Creek, ACT 2611 (Australia); Simon, Joshua D. [Observatories of the Carnegie Institution for Science, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Jeffery, C. Simon [Armagh Observatory, College Hill, Armagh BT61 9DG (United Kingdom); Anderson, Jay [Space Telescope Science Institute, Baltimore, MD 21218 (United States); Podsiadlowski, Philipp [Department of Astrophysics, University of Oxford, Oxford, OX1 3RH (United Kingdom); Gal-Yam, Avishay [Benoziyo Center for Astrophysics, Faculty of Physics, Weizmann Institute of Science, Rehovot 76100 (Israel); Silverman, Jeffrey M.; Filippenko, Alexei V. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Nomoto, Ken' ichi [Kavli Institute for the Physics and Mathematics of the Universe, University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8583 (Japan); Venn, Kim A. [Department of Physics and Astronomy, University of Victoria, Elliott Building, 3800 Finnerty Road, Victoria, BC V8P 5C2 (Canada); Foley, Ryan J., E-mail: wkerzend@mso.anu.edu.au [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)
2013-09-10
In this paper, we report on our analysis using Hubble Space Telescope astrometry and Keck-I HIRES spectroscopy of the central six stars of Tycho's supernova remnant (SN 1572). With these data, we measured the proper motions, radial velocities, rotational velocities, and chemical abundances of these objects. Regarding the chemical abundances, we do not confirm the unusually high [Ni/Fe] ratio previously reported for Tycho-G. Rather, we find that for all metrics in all stars, none exhibit the characteristics expected from traditional Type Ia supernova single-degenerate-scenario calculations. The only possible exception is Tycho-B, a rare, metal-poor A-type star; however, we are unable to find a suitable scenario for it. Thus, we suggest that SN 1572 cannot be explained by the standard single-degenerate model.
Circumstellar matter and the nature of the SN1987A progenitor star
International Nuclear Information System (INIS)
Chevalier, R.A.; Fransson, C.
1987-01-01
The radio observations of the supernova SN1987A can be interpreted in terms of its interaction with circumstellar matter. The early turn-on of the radio emission implies a relatively low density circumstellar medium. The optical properties of the supernova imply that the progenitor star had a smaller radius than that of a typical type II supernova progenitor. The mass loss properties are consistent with this hypothesis. The authors predict the thermal X-ray luminosity of the supernova, and note that it is below the current upper limit. A bright infrared dust echo is not expected. Weak ultraviolet emission lines from circumstellar gas may be visible. Although the circumstellar density is low, it is possible that the progenitor star did lose a substantial fraction of its mass prior to the supernova explosion. (author)
Energy Technology Data Exchange (ETDEWEB)
Reynoso, Estela M. [Instituto de Astronomia y Fisica del Espacio (IAFE), C. C. 67, Suc. 28, 1428 Buenos Aires (Argentina); Hughes, John P. [Department of Physics and Astronomy, Rutgers University, Piscataway, NJ 08854-8019 (United States); Moffett, David A., E-mail: ereynoso@iafe.uba.ar, E-mail: jph@physics.rutgers.edu, E-mail: david.moffett@furman.edu [Department of Physics, Furman University, Greenville, SC 29613 (United States)
2013-04-15
Radio polarization observations provide essential information on the degree of order and orientation of magnetic fields, which themselves play a key role in the particle acceleration processes that take place in supernova remnants (SNRs). Here we present a radio polarization study of SN 1006, based on combined Very Large Array and Australia Telescope Compact Array observations at 20 cm that resulted in sensitive images with an angular resolution of 10 arcsec. The fractional polarization in the two bright radio and X-ray lobes of the SNR is measured to be 0.17, while in the southeastern sector, where the radio and non-thermal X-ray emission are much weaker, the polarization fraction reaches a value of 0.6 {+-} 0.2, close to the theoretical limit of 0.7. We interpret this result as evidence of a disordered, turbulent magnetic field in the lobes, where particle acceleration is believed to be efficient, and a highly ordered field in the southeast, where the acceleration efficiency has been shown to be very low. Utilizing the frequency coverage of our observations, an average rotation measure of {approx}12 rad m{sup -2} is determined from the combined data set, which is then used to obtain the intrinsic direction of the magnetic field vectors. While the orientation of magnetic field vectors across the SNR shell appear to be radial, a large fraction of the magnetic vectors lie parallel to the Galactic plane. Along the highly polarized southeastern rim, the field is aligned tangent to the shock, and therefore also nearly parallel to the Galactic plane. These results strongly suggest that the ambient field surrounding SN 1006 is aligned with this direction (i.e., from northeast to southwest) and that the bright lobes are due to a polar cap geometry. Our study establishes that the most efficient particle acceleration and generation of magnetic turbulence in SN 1006 is attained for shocks in which the magnetic field direction and shock normal are quasi-parallel, while
International Nuclear Information System (INIS)
Reynoso, Estela M.; Hughes, John P.; Moffett, David A.
2013-01-01
Radio polarization observations provide essential information on the degree of order and orientation of magnetic fields, which themselves play a key role in the particle acceleration processes that take place in supernova remnants (SNRs). Here we present a radio polarization study of SN 1006, based on combined Very Large Array and Australia Telescope Compact Array observations at 20 cm that resulted in sensitive images with an angular resolution of 10 arcsec. The fractional polarization in the two bright radio and X-ray lobes of the SNR is measured to be 0.17, while in the southeastern sector, where the radio and non-thermal X-ray emission are much weaker, the polarization fraction reaches a value of 0.6 ± 0.2, close to the theoretical limit of 0.7. We interpret this result as evidence of a disordered, turbulent magnetic field in the lobes, where particle acceleration is believed to be efficient, and a highly ordered field in the southeast, where the acceleration efficiency has been shown to be very low. Utilizing the frequency coverage of our observations, an average rotation measure of ∼12 rad m –2 is determined from the combined data set, which is then used to obtain the intrinsic direction of the magnetic field vectors. While the orientation of magnetic field vectors across the SNR shell appear to be radial, a large fraction of the magnetic vectors lie parallel to the Galactic plane. Along the highly polarized southeastern rim, the field is aligned tangent to the shock, and therefore also nearly parallel to the Galactic plane. These results strongly suggest that the ambient field surrounding SN 1006 is aligned with this direction (i.e., from northeast to southwest) and that the bright lobes are due to a polar cap geometry. Our study establishes that the most efficient particle acceleration and generation of magnetic turbulence in SN 1006 is attained for shocks in which the magnetic field direction and shock normal are quasi-parallel, while inefficient
The Host Galaxies of Type Ia Supernovae Discovered by the Palomar Transient Factory
Pan, Y.-C.; Sullivan, M.; McGuire, K.; Hook, I. M.; Nugent, P. E.; Howell, D. A.; Arcavi, I.; Botyanszki, J.; Cenko, Stephen Bradley; DeRose, J.
2013-01-01
We present spectroscopic observations of the host galaxies of 82 low-redshift type Ia supernovae (SNe Ia) discovered by the Palomar Transient Factory (PTF). We determine star-formation rates, gas-phase stellar metallicities, and stellar masses and ages of these objects. As expected, strong correlations between the SN Ia light-curve width (stretch) and the host age mass metallicity are found: fainter, faster-declining events tend to be hosted by older massive metal-rich galaxies. There is some evidence that redder SNe Ia explode in higher metallicity galaxies, but we found no relation between the SN colour and host galaxy extinction based on the Balmer decrement, suggesting that the colour variation of these SNe does not primarily arise from this source. SNe Ia in higher-mass metallicity galaxies also appear brighter after stretch colour corrections than their counterparts in lower mass hosts, and the stronger correlation is with gas-phase metallicity suggesting this may be the more important variable. We also compared the host stellar mass distribution to that in galaxy targeted SN surveys and the high-redshift untargeted Supernova Legacy Survey (SNLS). SNLS has many more low mass galaxies, while the targeted searches have fewer. This can be explained by an evolution in the galaxy stellar mass function, coupled with a SN delay-time distribution proportional to t1. Finally, we found no significant difference in the mass--metallicity relation of our SN Ia hosts compared to field galaxies, suggesting any metallicity effect on the SN Ia rate is small.
Identifying the neutrino mass hierarchy with supernova neutrinos
International Nuclear Information System (INIS)
Tomas, Ricard
2006-01-01
We review how a high-statistics observation of the neutrino signal from a future galactic core-collapse supernova (SN) may be used to discriminate between different neutrino mixing scenarios. We discuss two complementary methods that allow for the positive identification of the mass hierarchy without knowledge of the emitted neutrino fluxes, provided that the 13-mixing angle is large, sin 2 θ 13 -5 . These two approaches are the observation of modulations in the neutrino spectra by Earth matter effects or by the passage of shock waves through the SN envelope. If the value of the 13-mixing angle is unknown, using additionally the information encoded in the prompt neutronization ν e burst-a robust feature found in all modern SN simulations-can be sufficient to fix both the neutrino hierarchy and to decide whether θ 13 is 'small' or 'large'
Taddia, F.; Sollerman, J.; Fremling, C.; Karamehmetoglu, E.; Quimby, R. M.; Gal-Yam, A.; Yaron, O.; Kasliwal, M. M.; Kulkarni, S. R.; Nugent, P. E.; Smadja, G.; Tao, C.
2018-01-01
Aims: We study PTF11mnb, a He-poor supernova (SN) whose light curves resemble those of SN 2005bf, a peculiar double-peaked stripped-envelope (SE) SN, until the declining phase after the main peak. We investigate the mechanism powering its light curve and the nature of its progenitor star. Methods: Optical photometry and spectroscopy of PTF11mnb are presented. We compared light curves, colors and spectral properties to those of SN 2005bf and normal SE SNe. We built a bolometric light curve and modeled this light curve with the SuperNova Explosion Code (SNEC) hydrodynamical code explosion of a MESA progenitor star and semi-analytic models. Results: The light curve of PTF11mnb turns out to be similar to that of SN 2005bf until 50 d when the main (secondary) peaks occur at -18.5 mag. The early peak occurs at 20 d and is about 1.0 mag fainter. After the main peak, the decline rate of PTF11mnb is remarkably slower than what was observed in SN 2005bf, and it traces well the 56Co decay rate. The spectra of PTF11mnb reveal a SN Ic and have no traces of He unlike in the case of SN Ib 2005bf, although they have velocities comparable to those of SN 2005bf. The whole evolution of the bolometric light curve is well reproduced by the explosion of a massive (Mej = 7.8 M⊙), He-poor star characterized by a double-peaked 56Ni distribution, a total 56Ni mass of 0.59 M⊙, and an explosion energy of 2.2 × 1051 erg. Alternatively, a normal SN Ib/c explosion (M(56Ni) = 0.11 M⊙, EK = 0.2 × 1051 erg, Mej = 1 M⊙) can power the first peak while a magnetar, with a magnetic field characterized by B = 5.0 × 1014 G, and a rotation period of P = 18.1 ms, provides energy for the main peak. The early g-band light curve can be fit with a shock-breakout cooling tail or an extended envelope model from which a radius of at least 30 R⊙ is obtained. Conclusions: We presented a scenario where PTF11mnb was the explosion of a massive, He-poor star, characterized by a double-peaked 56Ni
First SN Discoveries from the Dark Energy Survey
Abbott, T.; Abdalla, F.; Achitouv, I.; Ahn, E.; Aldering, G.; Allam, S.; Alonso, D.; Amara, A.; Annis, J.; Antonik, M.; Aragon-Salamanca, A.; Armstrong, R.; Ashall, C.; Asorey, J.; Bacon, D.; Balbinot, E.; Banerji, M.; Barbary, K.; Barkhouse, W.; Baruah, L.; Bauer, A.; Bechtol, K.; Becker, M.; Bender, R.; Benoist, C.; Benoit-Levy, A.; Bernardi, M.; Bernstein, G.; Bernstein, J. P.; Bernstein, R.; Bertin, E.; Beynon, E.; Bhattacharya, S.; Biesiadzinski, T.; Biswas, R.; Blake, C.; Bloom, J. S.; Bocquet, S.; Brandt, C.; Bridle, S.; Brooks, D.; Brown, P. J.; Brunner, R.; Buckley-Geer, E.; Burke, D.; Burkert, A.; Busha, M.; Campa, J.; Campbell, H.; Cane, R.; Capozzi, D.; Carlstrom, J.; Carnero Rosell, A.; Carollo, M.; Carrasco-Kind, M.; Carretero, J.; Carter, M.; Casas, R.; Castander, F. J.; Chen, Y.; Chiu, I.; Chue, C.; Clampitt, J.; Clerkin, L.; Cohn, J.; Colless, M.; Copeland, E.; Covarrubias, R. A.; Crittenden, R.; Crocce, M.; Cunha, C.; da Costa, L.; d'Andrea, C.; Das, S.; Das, R.; Davis, T. M.; Deb, S.; DePoy, D.; Derylo, G.; Desai, S.; de Simoni, F.; Devlin, M.; Diehl, H. T.; Dietrich, J.; Dodelson, S.; Doel, P.; Dolag, K.; Efstathiou, G.; Eifler, T.; Erickson, B.; Eriksen, M.; Estrada, J.; Etherington, J.; Evrard, A.; Farrens, S.; Fausti Neto, A.; Fernandez, E.; Ferreira, P. C.; Finley, D.; Fischer, J. A.; Flaugher, B.; Fosalba, P.; Frieman, J.; Furlanetto, C.; Garcia-Bellido, J.; Gaztanaga, E.; Gelman, M.; Gerdes, D.; Giannantonio, T.; Gilhool, S.; Gill, M.; Gladders, M.; Gladney, L.; Glazebrook, K.; Gray, M.; Gruen, D.; Gruendl, R.; Gupta, R.; Gutierrez, G.; Habib, S.; Hall, E.; Hansen, S.; Hao, J.; Heitmann, K.; Helsby, J.; Henderson, R.; Hennig, C.; High, W.; Hirsch, M.; Hoffmann, K.; Holhjem, K.; Honscheid, K.; Host, O.; Hoyle, B.; Hu, W.; Huff, E.; Huterer, D.; Jain, B.; James, D.; Jarvis, M.; Jarvis, M. J.; Jeltema, T.; Johnson, M.; Jouvel, S.; Kacprzak, T.; Karliner, I.; Katsaros, J.; Kent, S.; Kessler, R.; Kim, A.; Kim-Vy, T.; King, L.; Kirk, D.; Kochanek, C.; Kopp, M.; Koppenhoefer, J.; Kovacs, E.; Krause, E.; Kravtsov, A.; Kron, R.; Kuehn, K.; Kuemmel, M.; Kuhlmann, S.; Kunder, A.; Kuropatkin, N.; Kwan, J.; Lahav, O.; Leistedt, B.; Levi, M.; Lewis, P.; Liddle, A.; Lidman, C.; Lilly, S.; Lin, H.; Liu, J.; Lopez-Arenillas, C.; Lorenzon, W.; LoVerde, M.; Ma, Z.; Maartens, R.; Maccrann, N.; Macri, L.; Maia, M.; Makler, M.; Manera, M.; Maraston, C.; March, M.; Markovic, K.; Marriner, J.; Marshall, J.; Marshall, S.; Martini, P.; Marti Sanahuja, P.; Mayers, J.; McKay, T.; McMahon, R.; Melchior, P.; Merritt, K. W.; Merson, A.; Miller, C.; Miquel, R.; Mohr, J.; Moore, T.; Mortonson, M.; Mosher, J.; Mould, J.; Mukherjee, P.; Neilsen, E.; Ngeow, C.; Nichol, R.; Nidever, D.; Nord, B.; Nugent, P.; Ogando, R.; Old, L.; Olsen, J.; Ostrovski, F.; Paech, K.; Papadopoulos, A.; Papovich, C.; Patton, K.; Peacock, J.; Pellegrini, P. S. S.; Peoples, J.; Percival, W.; Perlmutter, S.; Petravick, D.; Plazas, A.; Ponce, R.; Poole, G.; Pope, A.; Refregier, A.; Reyes, R.; Ricker, P.; Roe, N.; Romer, K.; Roodman, A.; Rooney, P.; Ross, A.; Rowe, B.; Rozo, E.; Rykoff, E.; Sabiu, C.; Saglia, R.; Sako, M.; Sanchez, A.; Sanchez, C.; Sanchez, E.; Sanchez, J.; Santiago, B.; Saro, A.; Scarpine, V.; Schindler, R.; Schmidt, B. P.; Schmitt, R. L.; Schubnell, M.; Seitz, S.; Senger, R.; Sevilla, I.; Sharp, R.; Sheldon, E.; Sheth, R.; Smith, R. C.; Smith, M.; Snigula, J.; Soares-Santos, M.; Sobreira, F.; Song, J.; Soumagnac, M.; Spinka, H.; Stebbins, A.; Stoughton, C.; Suchyta, E.; Suhada, R.; Sullivan, M.; Sun, F.; Suntzeff, N.; Sutherland, W.; Swanson, M. E. C.; Sypniewski, A. J.; Szepietowski, R.; Talaga, R.; Tarle, G.; Tarrant, E.; Balan, S. Thaithara; Thaler, J.; Thomas, D.; Thomas, R. C.; Tucker, D.; Uddin, S. A.; Ural, S.; Vikram, V.; Voigt, L.; Walker, A. R.; Walker, T.; Wechsler, R.; Weinberg, D.; Weller, J.; Wester, W.; Wetzstein, M.; White, M.; Wilcox, H.; Wilman, D.; Yanny, B.; Young, J.; Zablocki, A.; Zenteno, A.; Zhang, Y.; Zuntz, J.
2012-12-01
The Dark Energy Survey (DES) report the discovery of the first set of supernovae (SN) from the project. Images were observed as part of the DES Science Verification phase using the newly-installed 570-Megapixel Dark Energy Camera on the CTIO Blanco 4-m telescope by observers J. Annis, E. Buckley-Geer, and H. Lin. SN observations are planned throughout the observing campaign on a regular cadence of 4-6 days in each of the ten 3-deg2 fields in the DES griz filters.
Rayleigh-Taylor instability and mixing in SN 1987A
International Nuclear Information System (INIS)
Ebisuzaki, T.; Shigeyama, T.; Nomoto, K.
1989-01-01
The stability of the supernova ejecta is compared with the Rayleigh-Taylor instability for a realistic model of SN 1987A. A linear analysis indicates that the layers around the composition interface between the hydrogen-rich and helium zones, and become Rayleigh-Taylor unstable between the helium and metal zones. In these layers, the pressure increases outward because of deceleration due to the reverse shock which forms when the blast shock hits the massive hydrogen-rich envelope. On the contrary, the density steeply decreases outward because of the preexisting nuclear burning shell. Then, these layers undergo the Raleigh-Taylor instability because of the opposite signs of the pressure and density gradients. The estimated growth rate is larger than the expansion rate of the supernova. The Rayleigh-Taylor instability near the composition interface is likely to induce mixing, which has been strongly suggested from observations of SN 1987A. 25 refs
A Deep Search with HST for Late Time Supernova Signatures in the Hosts of XRF 011030 and XRF 020427
Patel, Sandeep; Kouveliotou, Chryssa; Levan, Andrew; Fruchter, Andrew; Rol, Evert; Rhoads, James; Gorosabel, Javier; Ramirez-Ruiz, Enrico; Hjorth, Jens; Wijers, Ralph
2004-01-01
X-ray Flashes (XRFs), are, like Gamma-Ray Bursts (GRBs) thought to signal the collapse of massive stars in distant galaxies. Many models posit that the isotropic equivalent energies of XRFs are lower than those for GRBs, such that they are visible hom a reduced range of distances when compared with GRBs. Here we present the results of two epoch Hubble Space Telescope imaging of two XRFs. These images taken approximately 45 and 200 days post bust reveal no evidence for an associated supernova in either case. Supernovae such as SN 1998bw would have been visible out to z approximately 1.5 in each case, while faint supernovae such as SN 2002ap would be visible to z approximately 1. At these distances the bursts would not fit the observed correlations between E(sub p) and E(sub iso) and would have required extremely luminous X-ray afterglows. We conclude that should these XRFs reside at low redshift, it is necessary either that their line of sight is heavily extinguished, or that XRFs, unlike GRBs do not have temporally coincident supernovae.
Radioactive Iron Rain: Transporting $^{60}$Fe in Supernova Dust to the Ocean Floor
Fry, Brian J.; Ellis, John R.
2016-01-01
Several searches have found evidence of $^{60}$Fe deposition, presumably from a near-Earth supernova (SN), with concentrations that vary in different locations on Earth. This paper examines various influences on the path of interstellar dust carrying $^{60}$Fe from a SN through the heliosphere, with the aim of estimating the final global distribution on the ocean floor. We study the influences of magnetic fields, angle of arrival, wind and ocean cycling of SN material on the concentrations at different locations. We find that the passage of SN material through the mesosphere/lower thermosphere (MLT) is the greatest influence on the final global distribution, with ocean cycling causing lesser alteration as the SN material sinks to the ocean floor. SN distance estimates in previous works that assumed a uniform distribution are a good approximation. Including the effects on surface distributions, we estimate a distance of $46^{+10}_{-6}$ pc for a $8-10 \\ M_{\\odot}$ SN progenitor. This is consistent with a SN occ...
EVOLVING TO TYPE Ia SUPERNOVAE WITH SHORT DELAY TIMES
International Nuclear Information System (INIS)
Wang Bo; Chen Xuefei; Han Zhanwen; Meng Xiangcun
2009-01-01
The single-degenerate model is currently a favorable progenitor model for Type Ia supernovae (SNe Ia). Recent investigations on the white dwarf (WD) + He star channel of the single-degenerate model imply that this channel is noteworthy for producing SNe Ia. In this paper, we studied SN Ia birthrates and delay times of this channel via a detailed binary population synthesis approach. We found that the Galactic SN Ia birthrate from the WD + He star channel is ∼0.3 x 10 -3 yr -1 according to our standard model, and that this channel can explain SNe Ia with short delay times (∼4.5 x 10 7 -1.4 x 10 8 yr). Meanwhile, these WD + He star systems may be related to the young supersoft X-ray sources prior to SN Ia explosions.
Bear, Ealeal; Soker, Noam
2018-04-01
We find that the remnant of supernova (SN) 1987A shares some morphological features with four supernova remnants (SNRs) that have signatures of shaping by jets, and from that we strengthen the claim that jets played a crucial role in the explosion of SN 1987A. Some of the morphological features appear also in planetary nebulae (PNe) where jets are observed. The clumpy ejecta bring us to support the claim that the jittering jets explosion mechanism can account for the structure of the remnant of SN 1987A, i.e., SNR 1987A. We conduct a preliminary attempt to quantify the fluctuations in the angular momentum of the mass that is accreted on to the newly born neutron star via an accretion disk or belt. The accretion disk/belt launches the jets that explode core collapse supernovae (CCSNe). The relaxation time of the accretion disk/belt is comparable to the duration of a typical jet-launching episode in the jittering jets explosion mechanism, and hence the disk/belt has no time to relax. We suggest that this might explain two unequal opposite jets that later lead to unequal sides of the elongated structures in some SNRs of CCSNe. We reiterate our earlier call for a paradigm shift from neutrino-driven explosion to a jet-driven explosion of CCSNe.
Miao, Ting; Wan, Zixuan; Sun, Lina; Li, Xiaoni; Xing, Lili; Bai, Yucen; Wang, Fang; Yang, Hongsheng
2017-10-01
Remodeling of extracellular matrix (ECM) regulated by matrix metalloproteinases (MMPs) is essential for tissue regeneration. In the present study, we used immunohistochemistry (IHC) techniques against ECM components to reveal changes of ECM during intestine regeneration of Apostichopus japonicus. The expression of collagen I and laminin reduced apparently from the eviscerated intestine, while fibronectin exhibited continuous expression in all regeneration stages observed. Meanwhile, we cloned two MMP genes from A. japonicus by RACE PCR. The full-length cDNA of ajMMP-2 like is 2733bp and contains a predicted open reading frame (ORF) of 1716bp encoding 572 amino acids. The full-length cDNA of ajMMP-16 like is 2705bp and contains an ORF of 1452bp encoding 484 amino acids. The predicted protein sequences of each MMP contain two conserved domains, ZnMc_MMP and HX. Homology and phylogenetic analysis revealed that ajMMP-2 like and ajMMP-16 like share high sequence similarity with MMP-2 and MMP-16 from Strongylocentrotus purpuratus, respectively. Then we investigated spatio-temporal expression of ajMMP-2 like and ajMMP-16 like during different regeneration stages by qRT-PCR and IHC. The expression pattern of them showed a roughly opposite trend from that of ECM components. According to our results, a fibronectin-dominate temporary matrix is created in intestine regeneration, and it might provide structural integrity for matrix and promote cell movement. We also hypothesize that ajMMP-2 like and ajMMP-16 like could accelerate cell migration and regulate interaction between ECM components and growth factors. This work provides new evidence of ECM and MMPs involvement in sea cucumber regeneration. Copyright © 2017 Elsevier Inc. All rights reserved.
The Effect of Neutrino Oscillations on Supernova Light Element Synthesis
International Nuclear Information System (INIS)
Yoshida, Takashi; Kajino, Toshitaka; Yokomakura, Hidekazu; Kimura, Keiichi; Takamura, Akira; Hartmann, Dieter H.
2006-01-01
We investigate light element synthesis through the ν-process during supernova explosions considering neutrino oscillations and investigate the dependence of 7Li and 11B yields on neutrino oscillation parameters mass hierarchy and θ13. The adopted supernova explosion model for explosive nucleosynthesis corresponds to SN 1987A. The 7Li and 11B yields increase by about factors of 1.9 and 1.3 in the case of normal mass hierarchy and adiabatic 13-mixing resonance compared with the case without neutrino oscillations. In the case of inverted mass hierarchy or nonadiabatic 13-mixing resonance, the increase in 7Li and 11B yields is much smaller. Astronomical observations of 7Li/11B ratio in stars formed in regions strongly affected by prior generations of supernovae would constrain mass hierarchy and the range of θ13
Botticella, M. T.
We performed the Southern inTermediate Redshift ESO Supernova Search (STRESS), a survey specifically designed to measure the rate of both SNe Ia and CC SNe, in order to obtain a direct comparison of the high redshift and local rates and to investigate the dependence of the rates on specific galaxy properties, most notably their colour. We found that the type Ia SN rate, at mean redshift z = 0.3, is 0.22+0.10+0.16-0.08-0.14 h270 SNu, while the CC SN rate, at z = 0.21, is 0.82+0.31+0.300.24-0.26 h270 SNu. The quoted errors are the statistical and systematic uncertainties. With respect to the local value, the CC SN rate at z = 0.2 is higher by a factor of ˜ 2, whereas the type Ia SN rate remains almost constant. We also measured the SN rates in the red and blue galaxies and found that the SN Ia rate seems to be constant in galaxies of different colour, whereas the CC SN rate seems to peak in blue galaxies, as in the local Universe. Finally we exploited the link between SFH and SN rates to predict the evolutionary behaviour of the SN rates and compare it with the path indicated by observations.
Revisiting the SN1987A gamma-ray limit on ultralight axion-like particles
Energy Technology Data Exchange (ETDEWEB)
Payez, Alexandre; Ringwald, Andreas [Theory group, Deutsches Elektronen-Synchrotron DESY, Notkestraße 85, D-22607 Hamburg (Germany); Evoli, Carmelo; Mirizzi, Alessandro [II. Institut für Theoretische Physik, Universität Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Fischer, Tobias [Institute for Theoretical Physics, University of Wroc\\law, Pl. M. Borna 9, 50-204 Wroc\\law (Poland); Giannotti, Maurizio, E-mail: alexandre.payez@desy.de, E-mail: carmelo.evoli@desy.de, E-mail: fischer@ift.uni.wroc.pl, E-mail: mgiannotti@barry.edu, E-mail: alessandro.mirizzi@desy.de, E-mail: andreas.ringwald@desy.de [Physical Sciences, Barry University, 11300 NE 2nd Ave., Miami Shores, FL 33161 (United States)
2015-02-01
We revise the bound from the supernova SN1987A on the coupling of ultralight axion-like particles (ALPs) to photons. In a core-collapse supernova, ALPs would be emitted via the Primakoff process, and eventually convert into gamma rays in the magnetic field of the Milky Way. The lack of a gamma-ray signal in the GRS instrument of the SMM satellite in coincidence with the observation of the neutrinos emitted from SN1987A therefore provides a strong bound on their coupling to photons. Due to the large uncertainty associated with the current bound, we revise this argument, based on state-of-the-art physical inputs both for the supernova models and for the Milky-Way magnetic field. Furthermore, we provide major amendments, such as the consistent treatment of nucleon-degeneracy effects and of the reduction of the nuclear masses in the hot and dense nuclear medium of the supernova. With these improvements, we obtain a new upper limit on the photon-ALP coupling: g{sub aγ} ∼< 5.3 × 10{sup -12} GeV{sup -1}, for m{sub a} ∼< 4.4 × 10{sup -10} eV, and we also give its dependence at larger ALP masses m{sub a}. Moreover, we discuss how much the Fermi-LAT satellite experiment could improve this bound, should a close-enough supernova explode in the near future.
X-ray emission from reverse-shocked ejecta in supernova remnants
Cioffi, Denis F.; Mckee, Christopher F.
1990-01-01
A simple physical model of the dynamics of a young supernova remnant is used to derive a straightforward kinematical description of the reverse shock. With suitable approximations, formulae can then be developed to give the X-ray emission of the reverse-shocked ejecta. The results are found to agree favorably with observations of SN1006.
High-energy γ-ray observations of SN 1987A
International Nuclear Information System (INIS)
Sood, R.K.; Thomas, J.A.; Waldron, L.; Manchanda, R.K.; Rochester, G.K.; Sumner, T.J.; Frye, G.; Jenkins, T.; Koga, R.; Ubertini, P.; Bazzano, A.; La Padula, C.; Staubert, R.; Kendziorra, E.
1988-01-01
SN 1987A has been observed with a combined high energy γ-ray (50-500 MeV) and hard X-ray (15-50 keV) payload during a balloon flight on 5 April 1988 from Alice Springs, Australia. The γ-ray observations, along with our earlier ones on 19 April 1987 are the only such observations of the supernova to date. The γ-ray detector characteristics are described. The preliminary results of the recent flight and their implications in terms of the known supernova parameters are discussed. 17 refs., 6 figs
An Analysis of the Peculiar Type IIn Supernova 1995N
Baird, M. D.; Garnavich, P. M.; Schlegel, E. M.; Challis, P. M.; Kirshner, R. P.
1998-12-01
SN 1995N is a peculiar type IIn supernova. Spectroscopic and photometric data for this analysis were gathered between May 10, 1995 (two days after discovery) and July 18, 1998. A total of twenty two photometric images and eight spectra were obtained at the FLWO and MMTO. The photometric data show a broad maximum at R=17.0 occurred in late October, 1995, followed by a very slow decline at a rate of 2.39 millimag-day(-1) for R and 1.37 millimag-day(-1) for V. The R decay rate corresponds to a half life of 315 days, which is much longer than that of (56) Co. The spectra show broad hydrogen (1500 km/s FWHM) and oxygen (10000 km/s FWZI) emission features along with many unresolved emission lines. Some of the more interesting narrow lines identified correspond to high ionization states for iron such as Fe VII and Fe X which indicate temperatures as high as 10(6) degrees K. These high ionization states, the X-ray detection by Lewin et al. (1996, IAUC 6445) and the slow photometric decay suggest that SN 1995N is powered by a shock propagating through a dense circumstellar environment. From the earliest observations the energy output appears dominated by the interaction and not by radioactivity, implying that the progenitor exploded well before the discovery of SN 1995N. The situation may be similar to SN 1987A, where the rise in emission from a circumstellar interaction is only now beginning and is expected to peak some 15 years after the supernova explosion.
A Type II Supernova Hubble Diagram from the CSP-I, SDSS-II, and SNLS Surveys
de Jaeger, T.; González-Gaitán, S.; Hamuy, M.; Galbany, L.; Anderson, J. P.; Phillips, M. M.; Stritzinger, M. D.; Carlberg, R. G.; Sullivan, M.; Gutiérrez, C. P.; Hook, I. M.; Howell, D. Andrew; Hsiao, E. Y.; Kuncarayakti, H.; Ruhlmann-Kleider, V.; Folatelli, G.; Pritchet, C.; Basa, S.
2017-02-01
The coming era of large photometric wide-field surveys will increase the detection rate of supernovae by orders of magnitude. Such numbers will restrict spectroscopic follow-up in the vast majority of cases, and hence new methods based solely on photometric data must be developed. Here, we construct a complete Hubble diagram of Type II supernovae (SNe II) combining data from three different samples: the Carnegie Supernova Project-I, the Sloan Digital Sky Survey II SN, and the Supernova Legacy Survey. Applying the Photometric Color Method (PCM) to 73 SNe II with a redshift range of 0.01-0.5 and with no spectral information, we derive an intrinsic dispersion of 0.35 mag. A comparison with the Standard Candle Method (SCM) using 61 SNe II is also performed and an intrinsic dispersion in the Hubble diagram of 0.27 mag, I.e., 13% in distance uncertainties, is derived. Due to the lack of good statistics at higher redshifts for both methods, only weak constraints on the cosmological parameters are obtained. However, assuming a flat universe and using the PCM, we derive the universe’s matter density: {{{Ω }}}m={0.32}-0.21+0.30 providing a new independent evidence for dark energy at the level of two sigma. This paper includes data gathered with the 6.5 m Magellan Telescopes, with the du Pont and Swope telescopes located at Las Campanas Observatory, Chile; and the Gemini Observatory, Cerro Pachon, Chile (Gemini Program N-2005A-Q-11, GN-2005B-Q-7, GN-2006A-Q-7, GS-2005A-Q-11, GS-2005B-Q-6, and GS-2008B-Q-56). Based on observations collected at the European Organization for Astronomical Research in the Southern Hemisphere, Chile (ESO Programmes 076.A-0156,078.D-0048, 080.A-0516, and 082.A-0526).
The need for accurate redshifts in supernova cosmology
Energy Technology Data Exchange (ETDEWEB)
Calcino, Josh; Davis, Tamara, E-mail: j.calcino@uq.edu.au, E-mail: tamarad@physics.uq.edu.au [The School of Mathematics and Physics, University of Queensland, Cooper Road, Brisbane (Australia)
2017-01-01
Recent papers have shown that a small systematic redshift shift (Δ z ∼ 10{sup −5}) in measurements of type Ia supernovae can cause a significant bias (∼1%) in the recovery of cosmological parameters. Such a redshift shift could be caused, for example, by a gravitational redshift due to the density of our local environment. The sensitivity of supernova data to redshift shifts means supernovae make excellent probes of inhomogeneities. We therefore invert the analysis, and try to diagnose the nature of our local gravitational environment by fitting for Δ z as an extra free parameter alongside the usual cosmological parameters. Using the Joint Light-curve SN Ia dataset we find the best fit includes a systematic redshift shift of Δ z = (2.6{sup +2.7}{sub −2.8}) × 10{sup −4}. This is a larger shift than would be expected due to gravitational redshifts in a standard Λ-Cold Dark Matter universe (though still consistent with zero), and would correspond to a monopole Doppler shift of about 100 km s{sup −1} moving away from the Milky-Way. However, since most supernova measurements are made to a redshift precision of no better than 10{sup −3}, it is possible that a systematic error smaller than the statistical error remains in the data and is responsible for the shift; or that it is an insignificant statistical fluctuation. We find that when Δ z is included as a free parameter while fitting to the JLA SN Ia data, the constraints on the matter density shifts to Ω {sub m} = 0.313{sup +0.042}{sub −0.040}, bringing it into better agreement with the CMB cosmological parameter constraints from Planck. A positive Δ z ∼ 2.6×10{sup −4} would also cause us to overestimate the supernova measurement of Hubble's constant by Δ H {sub 0} ∼ 1 kms{sup −1}Mpc{sup −1}. However this overestimation should diminish as one increases the low-redshift cutoff, and this is not seen in the most recent data.
Broad-lined Supernova 2016coi with a Helium Envelope
Energy Technology Data Exchange (ETDEWEB)
Yamanaka, Masayuki [Department of Physics, Faculty of Science and Engineering, Konan University, Okamoto, Kobe, Hyogo 658-8501 (Japan); Nakaoka, Tatsuya; Kawabata, Miho [Department of Physical Science, Hiroshima University, Kagamiyama 1-3-1, Higashi-Hiroshima 739-8526 (Japan); Tanaka, Masaomi [National Astronomical Observatory of Japan, National Institutes of Natural Sciences, Osawa, Mitaka, Tokyo 181-8588 (Japan); Maeda, Keiichi [Department of Astronomy, Graduate School of Science, Kyoto University, Sakyo-ku, Kyoto 606-8502 (Japan); Honda, Satoshi; Hosoya, Kensuke; Karita, Mayu; Morihana, Kumiko [Nishi-Harima Astronomical Observatory, Center for Astronomy, University of Hyogo, 407-2 Nishigaichi, Sayo-cho, Sayo, Hyogo 679-5313 (Japan); Hanayama, Hidekazu [Ishigakijima Astronomical Observatory, National Astronomical Observatory of Japan, National Institutes of Natural Sciences, 1024-1 Arakawa, Ishigaki, Okinawa 907-0024 (Japan); Morokuma, Tomoki [Institute of Astronomy, Graduate School of Science, The University of Tokyo, 2-21-1 Osawa, Mitaka, Tokyo 181-0015 (Japan); Imai, Masataka [Department of Cosmosciences, Graduate School of Science, Hokkaido University, Kita 10 Nishi8, Kita-ku, Sapporo 060-0810 (Japan); Kinugasa, Kenzo [Nobeyama Radio Observatory, National Astronomical Observatory of Japan, National Institutes of Natural Sciences, 462-2 Nobeyama, Minamimaki, Minamisaku, Nagano 384-1305 (Japan); Murata, Katsuhiro L. [Department of Astrophysics, Nagoya University, Chikusa-ku, Nagoya 464-8602 (Japan); Nishimori, Takefumi; Gima, Hirotaka; Ito, Ayano; Morikawa, Yuto; Murakami, Kotone [Graduate School of Science and Engineering, Kagoshima University, 1-21-35 Korimoto, Kagoshima 890-0065 (Japan); Hashimoto, Osamu, E-mail: yamanaka@center.konan-u.ac.jp [Gunma Astronomical Observatory, Takayama, Gunma 377-0702 (Japan); and others
2017-03-01
We present the early-phase spectra and the light curves of the broad-lined (BL) supernova (SN) 2016coi from t = 7 to 67 days after the estimated explosion date. This SN was initially reported as a BL Type SN Ic (SN Ic-BL). However, we found that spectra up to t = 12 days exhibited the He i λ 5876, λ 6678, and λ 7065 absorption lines. We show that the smoothed and blueshifted spectra of normal SNe Ib are remarkably similar to the observed spectrum of SN 2016coi. The line velocities of SN 2016coi were similar to those of SNe Ic-BL and significantly faster than those of SNe Ib. Analyses of the line velocity and light curve suggest that the kinetic energy and the total ejecta mass of SN 2016coi are similar to those of SNe Ic-BL. Together with BL SNe 2009bb and 2012ap, for which the detection of He i was also reported, these SNe could be transitional objects between SNe Ic-BL and SNe Ib, and be classified as BL Type “Ib” SNe (SNe “Ib”-BL). Our work demonstrates the diversity of the outermost layer in BL SNe, which should be related to the variety of the evolutionary paths.
A hydrodynamical model of Kepler's supernova remnant constrained by x-ray spectra
International Nuclear Information System (INIS)
Ballet, J.; Arnaud, M.; Rothinfluo, R.; Chieze, J.P.; Magne, B.
1988-01-01
The remnant of the historical supernova observed by Kepler in 1604 was recently observed in x-rays by the EXOSAT satellite up to 10 keV. A strong Fe K emission line around 6.5 keV is readily apparent in the spectrum. From an analysis of the light curve of the SN, reconstructed from historical descriptions, a previous study proposed to classify it as type I. Standard models of SN I based on carbon deflagration of white dwarf predict the synthesis of about 0.5 M circle of iron in the ejecta. Observing the iron line is a crucial check for such models. It has been argued that the light curve of Sn II-L is very similar to that of SN I and that the original observations are compatible with either type. In view of this uncertainty the authors have run a hydrodynamics-ionization code for both SN II and SN I remnants
Astronomy. ASASSN-15lh: A highly super-luminous supernova.
Dong, Subo; Shappee, B J; Prieto, J L; Jha, S W; Stanek, K Z; Holoien, T W-S; Kochanek, C S; Thompson, T A; Morrell, N; Thompson, I B; Basu, U; Beacom, J F; Bersier, D; Brimacombe, J; Brown, J S; Bufano, F; Chen, Ping; Conseil, E; Danilet, A B; Falco, E; Grupe, D; Kiyota, S; Masi, G; Nicholls, B; Olivares E, F; Pignata, G; Pojmanski, G; Simonian, G V; Szczygiel, D M; Woźniak, P R
2016-01-15
We report the discovery of ASASSN-15lh (SN 2015L), which we interpret as the most luminous supernova yet found. At redshift z = 0.2326, ASASSN-15lh reached an absolute magnitude of Mu ,AB = -23.5 ± 0.1 and bolometric luminosity Lbol = (2.2 ± 0.2) × 10(45) ergs s(-1), which is more than twice as luminous as any previously known supernova. It has several major features characteristic of the hydrogen-poor super-luminous supernovae (SLSNe-I), whose energy sources and progenitors are currently poorly understood. In contrast to most previously known SLSNe-I that reside in star-forming dwarf galaxies, ASASSN-15lh appears to be hosted by a luminous galaxy (MK ≈ -25.5) with little star formation. In the 4 months since first detection, ASASSN-15lh radiated (1.1 ± 0.2) × 10(52) ergs, challenging the magnetar model for its engine. Copyright © 2016, American Association for the Advancement of Science.
DEFF Research Database (Denmark)
Ofek, Eran O.; Zoglauer, Andreas; Boggs, Steven E.
2014-01-01
Some supernovae (SNe) may be powered by the interaction of the SN ejecta with a large amount of circumstellar matter (CSM). However, quantitative estimates of the CSM mass around such SNe are missing when the CSM material is optically thick. Specifically, current estimators are sensitive to uncer......Some supernovae (SNe) may be powered by the interaction of the SN ejecta with a large amount of circumstellar matter (CSM). However, quantitative estimates of the CSM mass around such SNe are missing when the CSM material is optically thick. Specifically, current estimators are sensitive...
Interacting Supernovae: Types IIn and Ibn
Smith, Nathan
Supernovae that show evidence of strong shock interaction between their ejecta and pre-existing slower circumstellar material (CSM) constitute an interesting, diverse, and still poorly understood category of explosive transients. The chief reason they are extremely interesting is because they tell us that in a subset of stellar deaths, the progenitor star becomes wildly unstable in the years, decades, or centuries before explosion. This is something that has not been included in standard stellar evolution models but may significantly change the end product and yield of that evolution and complicates our attempts to map SNe to their progenitors. Another reason they are interesting is because CSM interaction is an efficient engine for making bright transients, allowing superluminous transients to arise from normal SN explosion energy, and transients of normal supernova luminosity to arise from sub-energetic explosions or low radioactivity yield. CSM interaction shrouds the fast ejecta in bright shock emission, obscuring our view of the underlying explosion, and the radiation hydrodynamics is challenging to model. The CSM interaction may also be highly nonspherical, perhaps linked to binary interaction in the progenitor system. In some cases, these complications make it difficult to tell the difference between a core-collapse and thermonuclear explosion or to discern between a nonterminal eruption, failed supernova, or weak supernova. Efforts to uncover the physical parameters of individual events and connections to progenitor stars make this a rapidly evolving topic that challenges paradigms of stellar evolution.
THE AGES OF TYPE Ia SUPERNOVA PROGENITORS
International Nuclear Information System (INIS)
Brandt, Timothy D.; Aubourg, Eric; Strauss, Michael A.; Tojeiro, Rita; Heavens, Alan; Jimenez, Raul
2010-01-01
Using light curves and host galaxy spectra of 101 Type Ia supernovae (SNe Ia) with redshift z ∼ 2.4 Gyr. We find that each channel contributes roughly half of the Type Ia rate in our reference sample. We also construct the average spectra of high-stretch and low-stretch SN Ia host galaxies, and find that the difference of these spectra looks like a main-sequence B star with nebular emission lines indicative of star formation. This supports our finding that there are two populations of SNe Ia, and indicates that the progenitors of high-stretch supernovae are at the least associated with very recent star formation in the last few tens of Myr. Our results provide valuable constraints for models of Type Ia progenitors and may help improve the calibration of SNe Ia as standard candles.
THE MORPHOLOGY AND DYNAMICS OF JET-DRIVEN SUPERNOVA REMNANTS: THE CASE OF W49B
Energy Technology Data Exchange (ETDEWEB)
González-Casanova, Diego F.; De Colle, Fabio [Instituto de Ciencias Nucleares, Universidad Nacional Autónoma de México, A. P. 70-543, 04510 D. F. (Mexico); Ramirez-Ruiz, Enrico [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Lopez, Laura A. [MIT-Kavli Institute for Astrophysics and Space Research, 77 Massachusetts Avenue, 37-664H, Cambridge, MA 02139 (United States)
2014-02-01
The circumstellar medium (CSM) of a massive star is modified by its winds before a supernova (SN) explosion occurs, and thus the evolution of the resulting supernova remnant (SNR) is influenced by both the geometry of the explosion as well as the complex structure of the CSM. Motivated by recent work suggesting the SNR W49B was a jet-driven SN expanding in a complex CSM, we explore how the dynamics and the metal distributions in a jet-driven explosion are modified by the interaction with the surrounding environment. In particular, we perform hydrodynamical calculations to study the dynamics and explosive nucleosynthesis of a jet-driven SN triggered by the collapse of a 25 M {sub ☉} Wolf-Rayet star and its subsequent interaction with the CSM up to several hundred years following the explosion. We find that although the CSM has small-scale effects on the structure of the SNR, the overall morphology and abundance patterns are reflective of the initial asymmetry of the SN explosion. Thus, we predict that jet-driven SNRs, such as W49B, should be identifiable based on morphology and abundance patterns at ages up to several hundred years, even if they expand into a complex CSM environment.
Asymmetric Explosion of Type Ia Supernovae and Their Observational Signatures
International Nuclear Information System (INIS)
Maeda, Keiichi
2010-01-01
The nature of Type Ia supernova (SN Ia) explosions has not yet been clarified, despite their importance in astrophysics and cosmology. Recent theoretical investigations suggest that asymmetric distribution of initial thermonuclear sparks may be a key in the SN Ia explosion mechanism. In this paper, the first observational evidence of the asymmetry in SN Ia explosions is presented: We have found that late-time nebular spectra of various SNe Ia show a diversity in wavelengths of emission lines. This feature is inconsistent with any spherically symmetric explosion models, and indicates that the innermost region, a likely product of the deflagration wave propagation, shows an off-set with respect to the explosion center. The diversity in the emission-line wavelengths could naturally be explained by a combination of different viewing angles.
No Collective Neutrino Flavor Conversions during the Supernova Accretion Phase
Chakraborty, Sovan; Fischer, Tobias; Mirizzi, Alessandro; Saviano, Ninetta; Tomàs, Ricard
2011-10-01
We perform a dedicated study of the supernova (SN) neutrino flavor evolution during the accretion phase, using results from recent neutrino radiation hydrodynamics simulations. In contrast to what was expected in the presence of only neutrino-neutrino interactions, we find that the multiangle effects associated with the dense ordinary matter suppress collective oscillations. The matter suppression implies that neutrino oscillations will start outside the neutrino decoupling region and therefore will have a negligible impact on the neutrino heating and the explosion dynamics. Furthermore, the possible detection of the next galactic SN neutrino signal from the accretion phase, based on the usual Mikheyev-Smirnov-Wolfenstein effect in the SN mantle and Earth matter effects, can reveal the neutrino mass hierarchy in the case that the mixing angle θ13 is not very small.
CfA3: 185 TYPE Ia SUPERNOVA LIGHT CURVES FROM THE CfA
International Nuclear Information System (INIS)
Hicken, Malcolm; Challis, Peter; Kirshner, Robert P.; Bakos, Gaspar; Berlind, Perry; Brown, Warren R.; Caldwell, Nelson; Calkins, Mike; Cho, Richard; Contreras, Maria; Jha, Saurabh; Matheson, Tom; Modjaz, Maryam; Rest, Armin; Michael Wood-Vasey, W.; Barton, Elizabeth J.; Bragg, Ann; Briceno, Cesar; Ciupik, Larry; Dendy, Kristi-Concannon
2009-01-01
We present multiband photometry of 185 type-Ia supernovae (SNe Ia), with over 11,500 observations. These were acquired between 2001 and 2008 at the F. L. Whipple Observatory of the Harvard-Smithsonian Center for Astrophysics (CfA). This sample contains the largest number of homogeneously observed and reduced nearby SNe Ia (z ∼< 0.08) published to date. It more than doubles the nearby sample, bringing SN Ia cosmology to the point where systematic uncertainties dominate. Our natural system photometry has a precision of ∼<0.02 mag in BVRIr'i' and ∼<0.04 mag in U for points brighter than 17.5 mag. We also estimate a systematic uncertainty of 0.03 mag in our SN Ia standard system BVRIr'i' photometry and 0.07 mag for U. Comparisons of our standard system photometry with published SN Ia light curves and comparison stars, where available for the same SN, reveal agreement at the level of a few hundredths mag in most cases. We find that 1991bg-like SNe Ia are sufficiently distinct from other SNe Ia in their color and light-curve-shape/luminosity relation that they should be treated separately in light-curve/distance fitter training samples. The CfA3 sample will contribute to the development of better light-curve/distance fitters, particularly in the few dozen cases where near-infrared photometry has been obtained and, together, can help disentangle host-galaxy reddening from intrinsic supernova color, reducing the systematic uncertainty in SN Ia distances due to dust.
International Nuclear Information System (INIS)
Ofek, E. O.; Gal-Yam, A.; Yaron, O.; Arcavi, I.; Fox, D.; Cenko, S. B.; Filippenko, A. V.; Bloom, J. S.; Sullivan, M.; Gnat, O.; Frail, D. A.; Horesh, A.; Kulkarni, S. R.; Corsi, A.; Quimby, R. M.; Gehrels, N.; Nugent, P. E.; Kasliwal, M. M.; Bildsten, L.; Poznanski, D.
2013-01-01
The optical light curve of some supernovae (SNe) may be powered by the outward diffusion of the energy deposited by the explosion shock (the so-called shock breakout) in optically thick (τ ∼> 30) circumstellar matter (CSM). Recently, it was shown that the radiation-mediated and radiation-dominated shock in an optically thick wind must transform into a collisionless shock and can produce hard X-rays. The X-rays are expected to peak at late times, relative to maximum visible light. Here we report on a search, using Swift/XRT and Chandra, for X-ray emission from 28 SNe that belong to classes whose progenitors are suspected to be embedded in dense CSM. Our sample includes 19 Type IIn SNe, one Type Ibn SN, and eight hydrogen-poor superluminous SNe (SLSN-I such as SN 2005ap). Two SNe (SN 2006jc and SN 2010jl) have X-ray properties that are roughly consistent with the expectation for X-rays from a collisionless shock in optically thick CSM. However, the X-ray emission from SN 2006jc can also be explained as originating in an optically thin region. Thus, we propose that the optical light curve of SN 2010jl is powered by shock breakout in CSM. We suggest that two other events (SN 2010al and SN 2011ht) were too X-ray bright during the SN maximum optical light to be explained by the shock-breakout model. We conclude that the light curves of some, but not all, SNe IIn/Ibn are powered by shock breakout in CSM. For the rest of the SNe in our sample, including all of the SLSN-I events, our X-ray limits are not deep enough and were typically obtained too early (i.e., near the SN maximum light) for definitive conclusions about their nature. Late-time X-ray observations are required in order to further test whether these SNe are indeed embedded in dense CSM. We review the conditions required for a shock breakout in a wind profile. We argue that the timescale, relative to maximum light, for the SN to peak in X-rays is a probe of the column density and the density profile above the
Detecting First Supernovae with JWST
Regos, Eniko; FLARE
2018-01-01
We have applied for a JWST ERS First Transients Survey, FLARE to answer empirically how the Universe made its first stars. To quest the epoch of reionization we target what happened to these first stars by observing the most luminous events, supernovae. These transients provide direct constraints on star formation rates and the initial mass function.These very rare events can be reached by JWST at 27 mag AB in 2 micron and 4.4 micron over a field of 0.1 square degree visited multiple times each year.The survey may detect massive Pop III SNe at redshifts up to 10, pinpointing the redshift of first stars, a key scientific goal of JWST.We explore all models of star formation history (derived from UV luminosity densities and IR data), DTD, top heavy IMF of early, low metallicity stars, and normalizations to data of SN Ia, II rates (SNLS, CLASH, CANDELS, SDSS, SVISS), as well as SLSN (ROTSE, SNLS) to estimate the expected SN rates as function of redshift.Population synthesis of double degenerate and single degenerate scenarios of SN Ia shows that the shape of the DTD is rather insensitive to the assumptions (common envelope prescription and metallicities, or retention efficiency of accreted H to white dwarf core and mass transfer rate).Indeed GOODS High z SN Ia rates imply substantial delay in their progenitor model, and Hubble Higher z SN search constrains delay time distribution models as well.SLSN (I, II /H/ and extreme rare pulsational pair instability) are magnetars (ULGRB) in high local star formation rate, faint, low metallicity galaxies.
Revisiting the SN1987A gamma-ray limit on ultralight axion-like particles
Energy Technology Data Exchange (ETDEWEB)
Payez, Alexandre; Ringwald, Andreas [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany). Theory Group; Evoli, Carmelo; Mirizzi, Alessandro [Hamburg Univ. (Germany). 2. Inst. fuer Theoretische Physik; Fischer, Tobias [Wroclaw Univ. (Poland). Inst. for Theoretical Physics; Giannotti, Maurizio [Barry Univ., Miami Shores, FL (United States). Physical Sciences
2014-10-15
We revise the bound from the supernova SN1987A on the coupling of ultralight axion-like particles (ALPs) to photons. In a core-collapse supernova, ALPs would be emitted via the Primakoff process, and eventually convert into gamma rays in the magnetic field of the Milky Way. The lack of a gamma-ray signal in the GRS instrument of the SMM satellite in coincidence with the observation of the neutrinos emitted from SN1987A therefore provides a strong bound on their coupling to photons. Due to the large uncertainty associated with the current bound, we revise this argument, based on state-of-the-art physical inputs both for the supernova models and for the Milky-Way magnetic field. Furthermore, we provide major amendments, such as the consistent treatment of nucleon-degeneracy effects and of the reduction of the nuclear masses in the hot and dense nuclear medium of the supernova. With these improvements, we obtain a new upper limit on the photon-ALP coupling: g{sub aγ}
THE HOST GALAXY OF THE SUPER-LUMINOUS SN 2010gx AND LIMITS ON EXPLOSIVE 56Ni PRODUCTION
International Nuclear Information System (INIS)
Chen, Ting-Wan; Smartt, Stephen J.; Kotak, Rubina; McCrum, Matt; Fraser, Morgan; Bresolin, Fabio; Kudritzki, Rolf-Peter; Pastorello, Andrea; Valenti, Stefano
2013-01-01
Super-luminous supernovae have a tendency to occur in faint host galaxies which are likely to have low mass and low metallicity. While these extremely luminous explosions have been observed from z = 0.1 to 1.55, the closest explosions allow more detailed investigations of their host galaxies. We present a detailed analysis of the host galaxy of SN 2010gx (z = 0.23), one of the best studied super-luminous type Ic supernovae. The host is a dwarf galaxy (M g = –17.42 ± 0.17) with a high specific star formation rate. It has a remarkably low metallicity of 12 + log (O/H) = 7.5 ± 0.1 dex as determined from the detection of the [O III] λ4363 line. This is the first reliable metallicity determination of a super-luminous stripped-envelope supernova host. We collected deep multi-epoch imaging with Gemini + GMOS between 240 and 560 days after explosion to search for any sign of radioactive 56 Ni, which might provide further insights on the explosion mechanism and the progenitor's nature. We reach griz magnitudes of m AB ∼ 26, but do not detect SN 2010gx at these epochs. The limit implies that any 56 Ni production was similar to or below that of SN 1998bw (a luminous type Ic SN that produced around 0.4 M ☉ of 56 Ni). The low volumetric rates of these supernovae (∼10 –4 of the core-collapse population) could be qualitatively matched if the explosion mechanism requires a combination of low-metallicity (below 0.2 Z ☉ ), high progenitor mass (>60 M ☉ ) and high rotation rate (fastest 10% of rotators).
An Empirical Fitting Method for Type Ia Supernova Light Curves: A Case Study of SN 2011fe
Energy Technology Data Exchange (ETDEWEB)
Zheng, WeiKang; Filippenko, Alexei V., E-mail: zwk@astro.berkeley.edu [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States)
2017-03-20
We present a new empirical fitting method for the optical light curves of Type Ia supernovae (SNe Ia). We find that a variant broken-power-law function provides a good fit, with the simple assumption that the optical emission is approximately the blackbody emission of the expanding fireball. This function is mathematically analytic and is derived directly from the photospheric velocity evolution. When deriving the function, we assume that both the blackbody temperature and photospheric velocity are constant, but the final function is able to accommodate these changes during the fitting procedure. Applying it to the case study of SN 2011fe gives a surprisingly good fit that can describe the light curves from the first-light time to a few weeks after peak brightness, as well as over a large range of fluxes (∼5 mag, and even ∼7 mag in the g band). Since SNe Ia share similar light-curve shapes, this fitting method has the potential to fit most other SNe Ia and characterize their properties in large statistical samples such as those already gathered and in the near future as new facilities become available.
TIME VARIATION OF AV AND RV FOR TYPE Ia SUPERNOVAE BEHIND INTERSTELLAR DUST
Huang, Xiaosheng; Biederman, M.; Herger, B.; Aldering, G. S.
2014-01-01
TIME VARIATION OF AV AND RV FOR TYPE Ia SUPERNOVAE BEHIND NON-UNIFORM INTERSTELLAR DUST ABSTRACT We investigate the time variation of the visual extinction, AV, and the total-to-selective extinction ratio, RV, resulting from interstellar dust in front of an expanding photospheric disk of a type Ia supernova (SN Ia). We simulate interstellar dust clouds according to a power law power spectrum and produce extinction maps that either follow a pseudo-Gaussian distribution or a lognormal distribution. The RV maps are produced through a correlation between AV and RV. With maps of AV and RV generated in each case (pseudo-Gaussian and lognormal), we then compute the effective AV and RV for a SN as its photospheric disk expands behind the dust screen. We find for a small percentage of SNe the AV and RV values can vary by a large factor from day to day in the first 40 days after explosion.
X-ray emission of the hot gas and of accelerated particles in supernova remnants
International Nuclear Information System (INIS)
Acero, F.
2008-09-01
The current observations seem to support the theory that the shock wave of supernova remnants accelerate electrons (representing about 1% of cosmic rays) of the interstellar medium up to energies of about 10 15 eV. However there is still no solid evidence that supernova remnants also accelerate protons (major component of cosmic rays). The X-ray observations of those supernova remnants with the satellite XMM-Newton can provide crucial information on the acceleration mechanisms and on this population of accelerated particles. This thesis presents the X-ray analysis of the supernova remnants RX J1713.7-3946 and SN 1006 for which it has been shown that they accelerate electrons efficiently. As a result, these objects are very good targets to compare the theoretical models of acceleration to the observation. For the first object, I constructed through new XMM-Newton observations, the first high-angular resolution mosaic of the entire supernova remnant. I then compared the X- and gamma-ray emission of this object in order to understand the nature of the gamma-ray emission. This spectral and morphological comparison allowed me to discuss the two possible origins of the gamma-ray radiation (issued by electrons or by protons). For SN 1006, I studied the density of the ambient medium in which the shock wave propagates. This density is a key parameter for the hydrodynamical evolution of the remnant and for studying a future gamma-ray emission. The study of X-ray emission of the gas heated by the shock wave allowed me to better estimate of the value of the density so far poorly constrained for this object. (author)
HOST GALAXY IDENTIFICATION FOR SUPERNOVA SURVEYS
Energy Technology Data Exchange (ETDEWEB)
Gupta, Ravi R.; Kuhlmann, Steve; Kovacs, Eve; Spinka, Harold; Kessler, Richard; Goldstein, Daniel A.; Liotine, Camille; Pomian, Katarzyna; D’Andrea, Chris B.; Sullivan, Mark; Carretero, Jorge; Castander, Francisco J.; Nichol, Robert C.; Finley, David A.; Fischer, John A.; Foley, Ryan J.; Kim, Alex G.; Papadopoulos, Andreas; Sako, Masao; Scolnic, Daniel M.; Smith, Mathew; Tucker, Brad E.; Uddin, Syed; Wolf, Rachel C.; Yuan, Fang; Abbott, Tim M. C.; Abdalla, Filipe B.; Benoit-Lévy, Aurélien; Bertin, Emmanuel; Brooks, David; Rosell, Aurelio Carnero; Kind, Matias Carrasco; Cunha, Carlos E.; Costa, Luiz N. da; Desai, Shantanu; Doel, Peter; Eifler, Tim F.; Evrard, August E.; Flaugher, Brenna; Fosalba, Pablo; Gaztañaga, Enrique; Gruen, Daniel; Gruendl, Robert; James, David J.; Kuehn, Kyler; Kuropatkin, Nikolay; Maia, Marcio A. G.; Marshall, Jennifer L.; Miquel, Ramon; Plazas, Andrés A.; Romer, A. Kathy; Sánchez, Eusebio; Schubnell, Michael; Sevilla-Noarbe, Ignacio; Sobreira, Flávia; Suchyta, Eric; Swanson, Molly E. C.; Tarle, Gregory; Walker, Alistair R.; Wester, William
2016-11-08
Host galaxy identification is a crucial step for modern supernova (SN) surveys such as the Dark Energy Survey and the Large Synoptic Survey Telescope, which will discover SNe by the thousands. Spectroscopic resources are limited, and so in the absence of real-time SN spectra these surveys must rely on host galaxy spectra to obtain accurate redshifts for the Hubble diagram and to improve photometric classification of SNe. In addition, SN luminosities are known to correlate with host-galaxy properties. Therefore, reliable identification of host galaxies is essential for cosmology and SN science. We simulate SN events and their locations within their host galaxies to develop and test methods for matching SNe to their hosts. We use both real and simulated galaxy catalog data from the Advanced Camera for Surveys General Catalog and MICECATv2.0, respectively. We also incorporate "hostless" SNe residing in undetected faint hosts into our analysis, with an assumed hostless rate of 5%. Our fully automated algorithm is run on catalog data and matches SNe to their hosts with 91% accuracy. We find that including a machine learning component, run after the initial matching algorithm, improves the accuracy (purity) of the matching to 97% with a 2% cost in efficiency (true positive rate). Although the exact results are dependent on the details of the survey and the galaxy catalogs used, the method of identifying host galaxies we outline here can be applied to any transient survey.
HOST GALAXY IDENTIFICATION FOR SUPERNOVA SURVEYS
Energy Technology Data Exchange (ETDEWEB)
Gupta, Ravi R.; Kuhlmann, Steve; Kovacs, Eve; Spinka, Harold; Liotine, Camille; Pomian, Katarzyna [Argonne National Laboratory, 9700 South Cass Avenue, Lemont, IL 60439 (United States); Kessler, Richard; Scolnic, Daniel M. [Kavli Institute for Cosmological Physics, University of Chicago, Chicago, IL 60637 (United States); Goldstein, Daniel A. [Department of Astronomy, University of California, Berkeley, 501 Campbell Hall #3411, Berkeley, CA 94720 (United States); D’Andrea, Chris B.; Nichol, Robert C.; Papadopoulos, Andreas [Institute of Cosmology and Gravitation, University of Portsmouth, Portsmouth, PO1 3FX (United Kingdom); Sullivan, Mark [Department of Physics and Astronomy, University of Southampton, Southampton, SO17 1BJ (United Kingdom); Carretero, Jorge; Castander, Francisco J. [Institut de Ciències de l’Espai, IEEC-CSIC, Campus UAB, Carrer de Can Magrans, s/n, E-08193 Bellaterra, Barcelona (Spain); Finley, David A. [Fermi National Accelerator Laboratory, P.O. Box 500, Batavia, IL 60510 (United States); Fischer, John A.; Sako, Masao [Department of Physics and Astronomy, University of Pennsylvania, 209 South 33rd Street, Philadelphia, PA 19104 (United States); Foley, Ryan J. [Department of Astronomy, University of Illinois, 1002 W. Green Street, Urbana, IL 61801 (United States); Kim, Alex G., E-mail: raviryan@gmail.com [Physics Division, Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, CA 94720 (United States); and others
2016-12-01
Host galaxy identification is a crucial step for modern supernova (SN) surveys such as the Dark Energy Survey and the Large Synoptic Survey Telescope, which will discover SNe by the thousands. Spectroscopic resources are limited, and so in the absence of real-time SN spectra these surveys must rely on host galaxy spectra to obtain accurate redshifts for the Hubble diagram and to improve photometric classification of SNe. In addition, SN luminosities are known to correlate with host-galaxy properties. Therefore, reliable identification of host galaxies is essential for cosmology and SN science. We simulate SN events and their locations within their host galaxies to develop and test methods for matching SNe to their hosts. We use both real and simulated galaxy catalog data from the Advanced Camera for Surveys General Catalog and MICECATv2.0, respectively. We also incorporate “hostless” SNe residing in undetected faint hosts into our analysis, with an assumed hostless rate of 5%. Our fully automated algorithm is run on catalog data and matches SNe to their hosts with 91% accuracy. We find that including a machine learning component, run after the initial matching algorithm, improves the accuracy (purity) of the matching to 97% with a 2% cost in efficiency (true positive rate). Although the exact results are dependent on the details of the survey and the galaxy catalogs used, the method of identifying host galaxies we outline here can be applied to any transient survey.
TYPE Ia SUPERNOVA LIGHT CURVE INFERENCE: HIERARCHICAL MODELS IN THE OPTICAL AND NEAR-INFRARED
International Nuclear Information System (INIS)
Mandel, Kaisey S.; Narayan, Gautham; Kirshner, Robert P.
2011-01-01
We have constructed a comprehensive statistical model for Type Ia supernova (SN Ia) light curves spanning optical through near-infrared (NIR) data. A hierarchical framework coherently models multiple random and uncertain effects, including intrinsic supernova (SN) light curve covariances, dust extinction and reddening, and distances. An improved BAYESN Markov Chain Monte Carlo code computes probabilistic inferences for the hierarchical model by sampling the global probability density of parameters describing individual SNe and the population. We have applied this hierarchical model to optical and NIR data of 127 SNe Ia from PAIRITEL, CfA3, Carnegie Supernova Project, and the literature. We find an apparent population correlation between the host galaxy extinction A V and the ratio of total-to-selective dust absorption R V . For SNe with low dust extinction, A V ∼ V ∼ 2.5-2.9, while at high extinctions, A V ∼> 1, low values of R V < 2 are favored. The NIR luminosities are excellent standard candles and are less sensitive to dust extinction. They exhibit low correlation with optical peak luminosities, and thus provide independent information on distances. The combination of NIR and optical data constrains the dust extinction and improves the predictive precision of individual SN Ia distances by about 60%. Using cross-validation, we estimate an rms distance modulus prediction error of 0.11 mag for SNe with optical and NIR data versus 0.15 mag for SNe with optical data alone. Continued study of SNe Ia in the NIR is important for improving their utility as precise and accurate cosmological distance indicators.
TYPE Ia SUPERNOVA LIGHT-CURVE INFERENCE: HIERARCHICAL BAYESIAN ANALYSIS IN THE NEAR-INFRARED
International Nuclear Information System (INIS)
Mandel, Kaisey S.; Friedman, Andrew S.; Kirshner, Robert P.; Wood-Vasey, W. Michael
2009-01-01
We present a comprehensive statistical analysis of the properties of Type Ia supernova (SN Ia) light curves in the near-infrared using recent data from Peters Automated InfraRed Imaging TELescope and the literature. We construct a hierarchical Bayesian framework, incorporating several uncertainties including photometric error, peculiar velocities, dust extinction, and intrinsic variations, for principled and coherent statistical inference. SN Ia light-curve inferences are drawn from the global posterior probability of parameters describing both individual supernovae and the population conditioned on the entire SN Ia NIR data set. The logical structure of the hierarchical model is represented by a directed acyclic graph. Fully Bayesian analysis of the model and data is enabled by an efficient Markov Chain Monte Carlo algorithm exploiting the conditional probabilistic structure using Gibbs sampling. We apply this framework to the JHK s SN Ia light-curve data. A new light-curve model captures the observed J-band light-curve shape variations. The marginal intrinsic variances in peak absolute magnitudes are σ(M J ) = 0.17 ± 0.03, σ(M H ) = 0.11 ± 0.03, and σ(M Ks ) = 0.19 ± 0.04. We describe the first quantitative evidence for correlations between the NIR absolute magnitudes and J-band light-curve shapes, and demonstrate their utility for distance estimation. The average residual in the Hubble diagram for the training set SNe at cz > 2000kms -1 is 0.10 mag. The new application of bootstrap cross-validation to SN Ia light-curve inference tests the sensitivity of the statistical model fit to the finite sample and estimates the prediction error at 0.15 mag. These results demonstrate that SN Ia NIR light curves are as effective as corrected optical light curves, and, because they are less vulnerable to dust absorption, they have great potential as precise and accurate cosmological distance indicators.
Narrowband Hα Imaging of Old Hydrogen-deficient Supernovae
Pooley, David A.; Vinko, Jozsef; Silverman, Jeffrey M.; Wheeler, J. Craig Craig; Szalai, Tamas; MacQueen, Phillip; Marion, Howie H.; Sárneczky, Krisztián
2017-06-01
We report results from our long-term observational survey aimed at discovering late-time interaction between the ejecta of hydrogen-deficient Type I supernovae and the hydrogen-rich envelope expelled from the progenitor star several decades to centuries before explosion. The expelled envelope, moving with a velocity of ˜10-100 km/s, is expected to be caught up by the fast-moving SN ejecta several years to decades after explosion depending on the history of the mass-loss process acting in the progenitor star prior to explosion. The collision between the SN ejecta and the circumstellar envelope results in net emission in the Balmer-lines, especially in Hα. For the past three years, we have been using the Direct Imaging Auxiliary Functions Instrument (DIAFI) on the 2.7m Harlan J. Smith Telescope at McDonald Observatory to look for signs of late-time Hα emission in older Type Ia/Ibc/IIb SNe having hydrogen-poor ejecta, via narrow-band imaging. Continuum-subtracted Hα emission has been detected for 13 point sources: 9 SN Ibc, 1 SN IIb and 3 SN Ia events. Thirty-eight SN sites were observed on at least two epochs, from which three objects (SN 1985F, SN 2005kl, SN 2012fh) showed significant temporal variation in the strength of their Hα emission in our DIAFI data. This suggests that the variable emission is probably not due to nearby HII regions, and hence is an important additional hint that ejecta-CSM interaction may take place in these systems. Moreover, we successfully detected the late-time Hα emission from the Type Ib SN 2014C, which was recently discovered as a strongly interacting SN in other wavebands.
SHOCK BREAKOUT IN TYPE II PLATEAU SUPERNOVAE: PROSPECTS FOR HIGH-REDSHIFT SUPERNOVA SURVEYS
International Nuclear Information System (INIS)
Tominaga, N.; Morokuma, T.; Blinnikov, S. I.; Nomoto, K.; Baklanov, P.; Sorokina, E. I.
2011-01-01
Shock breakout is the brightest radiative phenomenon in a supernova (SN) but is difficult to be observed owing to the short duration and X-ray/ultraviolet (UV)-peaked spectra. After the first observation from the rising phase reported in 2008, its observability at high redshift is attracting enormous attention. We perform multigroup radiation hydrodynamics calculations of explosions for evolutionary presupernova models with various main-sequence masses M MS , metallicities Z, and explosion energies E. We present multicolor light curves of shock breakouts in Type II plateau SNe, being the most frequent core-collapse SNe, and predict apparent multicolor light curves of shock breakout at various redshifts z. We derive the observable SN rate and reachable redshift as functions of filter x and limiting magnitude m x,lim by taking into account an initial mass function, cosmic star formation history, intergalactic absorption, and host galaxy extinction. We propose a realistic survey strategy optimized for shock breakout. For example, the g'-band observable SN rate for m g',lim = 27.5 mag is 3.3 SNe deg -2 day -1 and half of them are located at z ≥ 1.2. It is clear that the shock breakout is a beneficial clue for probing high-z core-collapse SNe. We also establish ways to identify shock breakout and constrain SN properties from the observations of shock breakout, brightness, timescale, and color. We emphasize that the multicolor observations in blue optical bands with ∼hour intervals, preferably over ≥2 continuous nights, are essential to efficiently detect, identify, and interpret shock breakout.
Could a nearby supernova explosion have caused a mass extinction?
Ellis, J; Schramm, D N
1995-01-03
We examine the possibility that a nearby supernova explosion could have caused one or more of the mass extinctions identified by paleontologists. We discuss the possible rate of such events in the light of the recent suggested identification of Geminga as a supernova remnant less than 100 parsec (pc) away and the discovery of a millisecond pulsar about 150 pc away and observations of SN 1987A. The fluxes of gamma-radiation and charged cosmic rays on the Earth are estimated, and their effects on the Earth's ozone layer are discussed. A supernova explosion of the order of 10 pc away could be expected as often as every few hundred million years and could destroy the ozone layer for hundreds of years, letting in potentially lethal solar ultraviolet radiation. In addition to effects on land ecology, this could entail mass destruction of plankton and reef communities, with disastrous consequences for marine life as well. A supernova extinction should be distinguishable from a meteorite impact such as the one that presumably killed the dinosaurs at the "KT boundary." The recent argument that the KT event was exceedingly large and thus quite rare supports the need for other catastrophic events.
THE HIGH-METALLICITY EXPLOSION ENVIRONMENT OF THE RELATIVISTIC SUPERNOVA 2009bb
International Nuclear Information System (INIS)
Levesque, E. M.; Kewley, L. J.; Soderberg, A. M.; Foley, R. J.; Berger, E.; Torres, M. A. P.; Challis, P.; Kirshner, R. P.; Copete, A.; Chakraborti, S.; Ray, A.; Barthelmy, S. D.; Bietenholz, M. F.; Chandra, P.; Chaplin, V.; Connaughton, V.; Chevalier, R. A.; Fox, O.; Chugai, N.; Fransson, C.
2010-01-01
We investigate the environment of the nearby (d ∼ 40 Mpc) broad-lined Type Ic supernova (SN) 2009bb. This event was observed to produce a relativistic outflow likely powered by a central accreting compact object. While such a phenomenon was previously observed only in long-duration gamma-ray bursts (LGRBs), no LGRB was detected in association with SN 2009bb. Using an optical spectrum of the SN 2009bb explosion site, we determine a variety of interstellar medium properties for the host environment, including metallicity, young stellar population age, and star formation rate. We compare the SN explosion site properties to observations of LGRB and broad-lined SN Ic host environments on optical emission line ratio diagnostic diagrams. Based on these analyses, we find that the SN 2009bb explosion site has a metallicity between 1.7 Z sun and 3.5 Z sun , in agreement with other broad-lined SN Ic host environments and at odds with the low-redshift LGRB host environments and recently proposed maximum metallicity limits for relativistic explosions. We consider the implications of these findings and the impact that SN 2009bb's unusual explosive properties and environment have on our understanding of the key physical ingredient that enables some SNe to produce a relativistic outflow.
Defining photometric peculiar type Ia supernovae
Energy Technology Data Exchange (ETDEWEB)
González-Gaitán, S.; Pignata, G.; Förster, F.; Gutiérrez, C. P.; Bufano, F.; Galbany, L.; Hamuy, M.; De Jaeger, T. [Millennium Institute of Astrophysics, Casilla 36-D, Santiago (Chile); Hsiao, E. Y.; Phillips, M. M. [Carnegie Observatories, Las Campanas Observatory, Casilla 601, La Serena (Chile); Folatelli, G. [Kavli Institute for the Physics and Mathematics of the Universe, the University of Tokyo, Kashiwa 277-8583 (Kavli IPMU, WPI) (Japan); Anderson, J. P., E-mail: sgonzale@das.uchile.cl [European Southern Observatory, Alonso de Córdova 3107, Casilla 19, Santiago (Chile)
2014-11-10
We present a new photometric identification technique for SN 1991bg-like type Ia supernovae (SNe Ia), i.e., objects with light curve characteristics such as later primary maxima and the absence of a secondary peak in redder filters. This method is capable of selecting this sub-group from the normal type Ia population. Furthermore, we find that recently identified peculiar sub-types such as SNe Iax and super-Chandrasekhar SNe Ia have photometric characteristics similar to 91bg-like SNe Ia, namely, the absence of secondary maxima and shoulders at longer wavelengths, and can also be classified with our technique. The similarity of these different SN Ia sub-groups perhaps suggests common physical conditions. This typing methodology permits the photometric identification of peculiar SNe Ia in large upcoming wide-field surveys either to study them further or to obtain a pure sample of normal SNe Ia for cosmological studies.
Dado, Shlomo; De Rújula, A; Plaga, Rainer
2008-01-01
It has been argued that the observational limits on a supernova (SN) associated with GRB 060614 convincingly exclude a SN akin to SN 1998bw as its originator and provide evidence for a new class of long-duration GRBs. We discuss this issue in the contexts of indirect "redshift estimators" and of the fireball and cannonball models of GRBs. The latter explains the unusual properties of GRB 060614: at its debated but favored low redshift (0.125), they are predicted, as opposed to exceptional, if the associated core-collapse SN is of a recently discovered, very faint type. We take the occasion to discuss the association between GRBs and SNe.
THE ULTRAVIOLET BRIGHTEST TYPE Ia SUPERNOVA 2011de
International Nuclear Information System (INIS)
Brown, Peter J.
2014-01-01
We present and discuss the ultraviolet (UV)/optical photometric light curves and absolute magnitudes of the Type Ia supernova (SN Ia) 2011de from the Swift Ultraviolet/Optical Telescope. We find it to be the UV brightest SN Ia yet observed—more than a factor of 10 brighter than normal SNe Ia in the mid-ultraviolet. We find that the UV/optical brightness and broad light curve evolution can be modeled with additional flux from the shock of the ejecta hitting a relatively large red giant companion separated by 6 × 10 13 cm. However, the post-maximum behavior of other UV-bright SNe Ia can also be modeled in a similar manner, including objects with UV spectroscopy or pre-maximum photometry which is inconsistent with this model. This suggests that similar UV luminosities can be intrinsic or caused by other forms of shock interaction. The high velocities reported for SN 2011de make it distinct from the UV-bright ''super-Chandrasekhar'' SNe Ia and the NUV-blue group of normal SNe Ia. SN 2011de is an extreme example of the UV variations in SNe Ia
A relativistic type Ibc supernova without a detected gamma-ray burst.
Soderberg, A M; Chakraborti, S; Pignata, G; Chevalier, R A; Chandra, P; Ray, A; Wieringa, M H; Copete, A; Chaplin, V; Connaughton, V; Barthelmy, S D; Bietenholz, M F; Chugai, N; Stritzinger, M D; Hamuy, M; Fransson, C; Fox, O; Levesque, E M; Grindlay, J E; Challis, P; Foley, R J; Kirshner, R P; Milne, P A; Torres, M A P
2010-01-28
Long duration gamma-ray bursts (GRBs) mark the explosive death of some massive stars and are a rare sub-class of type Ibc supernovae. They are distinguished by the production of an energetic and collimated relativistic outflow powered by a central engine (an accreting black hole or neutron star). Observationally, this outflow is manifested in the pulse of gamma-rays and a long-lived radio afterglow. Until now, central-engine-driven supernovae have been discovered exclusively through their gamma-ray emission, yet it is expected that a larger population goes undetected because of limited satellite sensitivity or beaming of the collimated emission away from our line of sight. In this framework, the recovery of undetected GRBs may be possible through radio searches for type Ibc supernovae with relativistic outflows. Here we report the discovery of luminous radio emission from the seemingly ordinary type Ibc SN 2009bb, which requires a substantial relativistic outflow powered by a central engine. A comparison with our radio survey of type Ibc supernovae reveals that the fraction harbouring central engines is low, about one per cent, measured independently from, but consistent with, the inferred rate of nearby GRBs. Independently, a second mildly relativistic supernova has been reported.
A relativistic type Ibc supernova without a detected γ-ray burst
Soderberg, A. M.; Chakraborti, S.; Pignata, G.; Chevalier, R. A.; Chandra, P.; Ray, A.; Wieringa, M. H.; Copete, A.; Chaplin, V.; Connaughton, V.; Barthelmy, S. D.; Bietenholz, M. F.; Chugai, N.; Stritzinger, M. D.; Hamuy, M.; Fransson, C.; Fox, O.; Levesque, E. M.; Grindlay, J. E.; Challis, P.; Foley, R. J.; Kirshner, R. P.; Milne, P. A.; Torres, M. A. P.
2010-01-01
Long duration γ-ray bursts (GRBs) mark the explosive death of some massive stars and are a rare sub-class of type Ibc supernovae. They are distinguished by the production of an energetic and collimated relativistic outflow powered by a central engine (an accreting black hole or neutron star). Observationally, this outflow is manifested in the pulse of γ-rays and a long-lived radio afterglow. Until now, central-engine-driven supernovae have been discovered exclusively through their γ-ray emission, yet it is expected that a larger population goes undetected because of limited satellite sensitivity or beaming of the collimated emission away from our line of sight. In this framework, the recovery of undetected GRBs may be possible through radio searches for type Ibc supernovae with relativistic outflows. Here we report the discovery of luminous radio emission from the seemingly ordinary type Ibc SN 2009bb, which requires a substantial relativistic outflow powered by a central engine. A comparison with our radio survey of type Ibc supernovae reveals that the fraction harbouring central engines is low, about one per cent, measured independently from, but consistent with, the inferred rate of nearby GRBs. Independently, a second mildly relativistic supernova has been reported.
A SPECTROSCOPICALLY NORMAL TYPE Ic SUPERNOVA FROM A VERY MASSIVE PROGENITOR
International Nuclear Information System (INIS)
Valenti, Stefano; Pastorello, Andrea; Benetti, Stefano; Cappellaro, Enrico; Tomasella, Lina; Turatto, Massimo; Taubenberger, Stefan; Aramyan, Levon; Botticella, Maria Teresa; Fraser, Morgan; Smartt, Stephen J.; Magill, Lindsay; Kotak, Rubina; Wright, Darryl E.; Elias-Rosa, Nancy; Ergon, Mattias; Sollerman, Jesper; Magnier, Eugene; Price, Paul A.
2012-01-01
We present observations of the Type Ic supernova (SN Ic) 2011bm spanning a period of about one year. The data establish that SN 2011bm is a spectroscopically normal SN Ic with moderately low ejecta velocities and with a very slow spectroscopic and photometric evolution (more than twice as slow as SN 1998bw). The Pan-STARRS1 retrospective detection shows that the rise time from explosion to peak was ∼40 days in the R band. Through an analysis of the light curve and the spectral sequence, we estimate a kinetic energy of ∼7-17 foe and a total ejected mass of ∼7-17 M ☉ , 5-10 M ☉ of which is oxygen and 0.6-0.7 M ☉ is 56 Ni. The physical parameters obtained for SN 2011bm suggest that its progenitor was a massive star of initial mass 30-50 M ☉ . The profile of the forbidden oxygen lines in the nebular spectra shows no evidence of a bi-polar geometry in the ejected material.
Levan, Andrew; Patel, Sandeep; Kouveliotou, Chryssa; Fruchter, Andrew; Rhoads, James; Rol, Evert; Ramirez-Ruiz, Enrico; Gorosabel, Javier; Hiorth, Jens; Wijers, Ralph
2005-01-01
X-ray flashes (XRFs) are, like gamma-ray bursts (GRBs), thought to signal the collapse of massive stars in distant galaxies. Many models posit that the isotropic equivalent energies of XRFs are lower than those for GRBs, such that they are visible fiom a reduced range of distances when compared with GRBs. Here we present the results of two-epoch Hubble Space Telescope imaging of two XRFs. These images, taken approximately 45 and 200 days postburst, reveal no evidence of an associated supernova in either case. Supernovae such as SN 1998bw would have been visible out to z approximately 1.5 in each case, while fainter supernovae such as SN 2002ap would have been visible to z approximately 1. If the XRFs lie at such large distances, their energies would not fit the observed correlation between the GRB peak energy and isotropic energy release (E(sub p) proportional to E(sub iso)(sup 1/2), in which soft bursts are less energetic. We conclude that, should these XRFs reside at low redshifts (z less than 0.6), either their line of sight is heavily extinguished, they are associated with extremely faint supernovae, or, unlike GRBs, these XRFs do not have temporally coincident supernovae.
No evidence for an early seventeenth-century Indian sighting of Kepler's supernova (SN1604)
van Gent, R. H.
2013-03-01
In a recent paper in this journal, Sule et al. (2011) argued that an early 17th-century Indian mural of the constellation Sagittarius with a dragon-headed tail indicated that the bright supernova of 1604 was also sighted by Indian astronomers. In this paper it will be shown that this identification is based on a misunderstanding of traditional Islamic astrological iconography and that the claim that the mural represents an early 17th-century Indian sighting of the supernova of 1604 has to be rejected.
A Massive Shell of Supernova-formed Dust in SNR G54.1+0.3
Energy Technology Data Exchange (ETDEWEB)
Temim, Tea [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Dwek, Eli; Arendt, Richard G. [Observational Cosmology Lab, Code 665, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Borkowski, Kazimierz J.; Reynolds, Stephen P. [North Carolina State University, Raleigh, NC 27695 (United States); Slane, Patrick; Raymond, John C. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Gelfand, Joseph D. [New York University, Abu Dhabi (United Arab Emirates)
2017-02-10
While theoretical models of dust condensation predict that most refractory elements produced in core-collapse supernovae (SNe) efficiently condense into dust, a large quantity of dust has so far only been observed in SN 1987A. We present an analysis of observations from the Spitzer Space Telescope , Herschel Space Observatory , Stratospheric Observatory for Infrared Astronomy, and AKARI of the infrared shell surrounding the pulsar wind nebula in the supernova remnant G54.1+0.3. We attribute a distinctive spectral feature at 21 μ m to a magnesium silicate grain species that has been invoked in modeling the ejecta-condensed dust in Cas A, which exhibits the same spectral signature. If this species is responsible for producing the observed spectral feature and accounts for a significant fraction of the observed infrared continuum, we find that it would be the dominant constituent of the dust in G54.1+0.3, with possible secondary contributions from other compositions, such as carbon, silicate, or alumina grains. The total mass of SN-formed dust required by this model is at least 0.3 M {sub ⊙}. We discuss how these results may be affected by varying dust grain properties and self-consistent grain heating models. The spatial distribution of the dust mass and temperature in G54.1+0.3 confirms the scenario in which the SN-formed dust has not yet been processed by the SN reverse shock and is being heated by stars belonging to a cluster in which the SN progenitor exploded. The dust mass and composition suggest a progenitor mass of 16–27 M {sub ⊙} and imply a high dust condensation efficiency, similar to that found for Cas A and SN 1987A. The study provides another example of significant dust formation in a Type IIP SN explosion and sheds light on the properties of pristine SN-condensed dust.
Circumstellar X-ray Emission from SN1978K
Schlegel, Eric M.; Colbert, E.; Petre, R.
1995-02-01
We present the X-ray light curve in the 0.2 2.4 keV band based on fiveROSAT observations of SN1978K in NGC 1313. The X-ray emission is believed to arise from the interaction of the reverse shock and the expanding debris from the supernova. The reverse shock becomes established after the outgoing shock runs into circumstellar matter.
The Hubble Constant from SN Refsdal
Vega-Ferrero, J.; Diego, J. M.; Miranda, V.; Bernstein, G. M.
2018-02-01
Hubble Space Telescope observations from 2015 December 11 detected the expected fifth counter-image of supernova (SN) Refsdal at z = 1.49. In this Letter, we compare the time-delay predictions from numerous models with the measured value derived by Kelly et al. from very early data in the light curve of the SN Refsdal and find a best value for {H}0={64}-11+9 {km} {{{s}}}-1 {{Mpc}}-1 (68% CL), in excellent agreement with predictions from cosmic microwave background and recent weak lensing data + baryon acoustic oscillations + Big Bang nucleosynthesis (from the DES Collaboration). This is the first constraint on H 0 derived from time delays between multiple-lensed SN images, and the first with a galaxy cluster lens, subject to systematic effects different from other time-delay H 0 estimates. Additional time-delay measurements from new multiply imaged SNe will allow derivation of competitive constraints on H 0.
Gal-Yam, Avishay; Maoz, Dan; Guhathakurta, Puragra; Filippenko, Alexei V.
2007-01-01
We describe the Wise Observatory Optical Transient Search (WOOTS), a survey for supernovae (SNe) and other variable and transient objects in the fields of redshift 0.06-0.2 Abell galaxy clusters. We present the survey design and data-analysis procedures, and our object detection and follow-up strategies. We have obtained follow-up spectroscopy for all viable SN candidates, and present the resulting SN sample here. Out of the 12 SNe we have discovered, seven are associated with our target clus...
Extending Supernova Spectral Templates for Next Generation Space Telescope Observations
Roberts-Pierel, Justin; Rodney, Steven A.; Steven Rodney
2018-01-01
Widely used empirical supernova (SN) Spectral Energy Distributions (SEDs) have not historically extended meaningfully into the ultraviolet (UV), or the infrared (IR). However, both are critical for current and future aspects of SN research including UV spectra as probes of poorly understood SN Ia physical properties, and expanding our view of the universe with high-redshift James Webb Space Telescope (JWST) IR observations. We therefore present a comprehensive set of SN SED templates that have been extended into the UV and IR, as well as an open-source software package written in Python that enables a user to generate their own extrapolated SEDs. We have taken a sampling of core-collapse (CC) and Type Ia SNe to get a time-dependent distribution of UV and IR colors (U-B,r’-[JHK]), and then generated color curves are used to extrapolate SEDs into the UV and IR. The SED extrapolation process is now easily duplicated using a user’s own data and parameters via our open-source Python package: SNSEDextend. This work develops the tools necessary to explore the JWST’s ability to discriminate between CC and Type Ia SNe, as well as provides a repository of SN SEDs that will be invaluable to future JWST and WFIRST SN studies.
SUPERNOVA 2003ie WAS LIKELY A FAINT TYPE IIP EVENT
Energy Technology Data Exchange (ETDEWEB)
Arcavi, Iair; Gal-Yam, Avishay [Department of Particle Physics and Astrophysics, The Weizmann Institute of Science, Rehovot 76100 (Israel); Sergeev, Sergey G., E-mail: iair.arcavi@weizmann.ac.il [Crimean Astrophysical Observatory, P/O Nauchny, Crimea 98409 (Ukraine)
2013-04-15
We present new photometric observations of supernova (SN) 2003ie starting one month before discovery, obtained serendipitously while observing its host galaxy. With only a weak upper limit derived on the mass of its progenitor (<25 M{sub Sun }) from previous pre-explosion studies, this event could be a potential exception to the ''red supergiant (RSG) problem'' (the lack of high-mass RSGs exploding as Type IIP SNe). However, this is true only if SN2003ie was a Type IIP event, something which has never been determined. Using recently derived core-collapse SN light-curve templates, as well as by comparison to other known SNe, we find that SN2003ie was indeed a likely Type IIP event. However, with a plateau magnitude of {approx} - 15.5 mag, it is found to be a member of the faint Type IIP class. Previous members of this class have been shown to arise from relatively low-mass progenitors (<12 M{sub Sun }). It therefore seems unlikely that this SN had a massive RSG progenitor. The use of core-collapse SN light-curve templates is shown to be helpful in classifying SNe with sparse coverage. These templates are likely to become more robust as large homogeneous samples of core-collapse events are collected.
International Nuclear Information System (INIS)
Sanders, N. E.; Soderberg, A. M.; Foley, R. J.; Chornock, R.; Milisavljevic, D.; Margutti, R.; Drout, M. R.; Moe, M.; Berger, E.; Brown, W. R.; Lunnan, R.; Smartt, S. J.; Fraser, M.; Kotak, R.; Magill, L.; Smith, K. W.; Wright, D.; Huang, K.; Urata, Y.; Mulchaey, J. S.
2013-01-01
We report on our discovery and observations of the Pan-STARRS1 supernova (SN) PS1-12sk, a transient with properties that indicate atypical star formation in its host galaxy cluster or pose a challenge to popular progenitor system models for this class of explosion. The optical spectra of PS1-12sk classify it as a Type Ibn SN (SN Ibn; cf. SN 2006jc), dominated by intermediate-width (3 × 10 3 km s –1 ) and time variable He I emission. Our multi-wavelength monitoring establishes the rise time dt ∼ 9-23 days and shows an NUV-NIR spectral energy distribution with temperature ∼> 17 × 10 3 K and a peak magnitude of M z = –18.88 ± 0.02 mag. SN Ibn spectroscopic properties are commonly interpreted as the signature of a massive star (17-100 M ☉ ) explosion within an He-enriched circumstellar medium. However, unlike previous SNe Ibn, PS1-12sk is associated with an elliptical brightest cluster galaxy, CGCG 208–042 (z = 0.054) in cluster RXC J0844.9+4258. The expected probability of an event like PS1-12sk in such environments is low given the measured infrequency of core-collapse SNe in red-sequence galaxies compounded by the low volumetric rate of SN Ibn. Furthermore, we find no evidence of star formation at the explosion site to sensitive limits (Σ Hα ∼ –3 M ☉ yr –1 kpc –2 ). We therefore discuss white dwarf binary systems as a possible progenitor channel for SNe Ibn. We conclude that PS1-12sk represents either a fortuitous and statistically unlikely discovery, evidence for a top-heavy initial mass function in galaxy cluster cooling flow filaments, or the first clue suggesting an alternate progenitor channel for SNe Ibn.
A Peculiar Subclass of Type Ia Supernovae a.k.a. Type Iax
Singh, Mridweeka; Misra, Kuntal; Sahu, Devendra Kumar; Dastidar, Raya; Gangopadhyay, Anjasha; Bose, Subhash; Srivastav, Shubham; Anapuma, Gadiyara Chakrapani; Chakradhari, Nand Kumar; Kumar, Brajesh; Kumar, Brijesh; Pandey, Shashi Bhushan
2018-04-01
We present optical photometric (upto ˜ 410 days since Bmax) and spectroscopic (upto ˜ 235 days since Bmax) observations of a type Iax supernova SN 2014dt located in M61. The broad band light curves follow a linear decline up to ˜ 100 days after which a significant flattening is seen in the late-time (beyond 150 days) light curves of SN 2014dt. SN 2014dt best matches the light curve evolution of SN 2005hk and reaches a peak magnitude of MB˜ -18.12±0.04 with ?m15˜ 1.35±0.06 mag. The earliest spectrum at ˜ 23 days is dominated by FeII and CoII lines with the absence of the Si II 6150 Å line. Using the peak bolometric luminosity we estimate a 56Ni mass of 0.14 M⊙ in the case of SN 2005hk and the striking similarity between SN 2014dt and SN 2005hk implies that a comparable amount of 56Ni would have been synthesized in the explosion of SN 2014dt. There are several explosion scenarios proposed for these peculiar events. Being one of the brightest and closest SN! , SN 2014dt is an ideal candidate for long term monitoring. Late phase observations are very essential to understand the progenitor system and the actual explosion scenario for these events.
PROMPT Ia SUPERNOVAE ARE SIGNIFICANTLY DELAYED
International Nuclear Information System (INIS)
Raskin, Cody; Scannapieco, Evan; Rhoads, James; Della Valle, Massimo
2009-01-01
The time delay between the formation of a population of stars and the onset of type Ia supernovae (SNe Ia) sets important limits on the masses and nature of SN Ia progenitors. Here, we use a new observational technique to measure this time delay by comparing the spatial distributions of SNe Ia to their local environments. Previous work attempted such analyses encompassing the entire host of each SN Ia, yielding inconclusive results. Our approach confines the analysis only to the relevant portions of the hosts, allowing us to show that even so-called prompt SNe Ia that trace star formation on cosmic timescales exhibit a significant delay time of 200-500 million years. This implies that either the majority of Ia companion stars have main-sequence masses less than 3 M sun , or that most SNe Ia arise from double white dwarf binaries. Our results are also consistent with a SNe Ia rate that traces the white dwarf formation rate, scaled by a fixed efficiency factor.
THE CARNEGIE SUPERNOVA PROJECT: ANALYSIS OF THE FIRST SAMPLE OF LOW-REDSHIFT TYPE-Ia SUPERNOVAE
International Nuclear Information System (INIS)
Folatelli, Gaston; Phillips, M. M.; Contreras, Carlos; Stritzinger, Maximilian; Boldt, Luis; Gonzalez, Sergio; Krzeminski, Wojtek; Morrell, Nidia; Roth, Miguel; Salgado, Francisco; Burns, Christopher R.; Freedman, W. L.; Persson, S. E.; Madore, Barry F.; Murphy, David; Hamuy, Mario; Suntzeff, Nicholas B.; Krisciunas, Kevin; Wyatt, Pamela; Li Weidong
2010-01-01
An analysis of the first set of low-redshift (z s ) light curves in a well-understood photometric system. Methods are described for deriving light-curve parameters, and for building template light curves which are used to fit SN Ia data in the ugriBVYJH bands. The intrinsic colors at maximum light are calibrated using a subsample of supernovae (SNe) assumed to have suffered little or no reddening, enabling color excesses to be estimated for the full sample. The optical-NIR color excesses allow the properties of the reddening law in the host galaxies to be studied. A low average value of the total-to-selective absorption coefficient, R V ∼ 1.7, is derived when using the entire sample of SNe. However, when the two highly reddened SNe (SN 2005A and SN 2006X) in the sample are excluded, a value R V ∼ 3.2 is obtained, similar to the standard value for the Galaxy. The red colors of these two events are well matched by a model where multiple scattering of photons by circumstellar dust steepens the effective extinction law. The absolute peak magnitudes of the SNe are studied in all bands using a two-parameter linear fit to the decline rates and the colors at maximum light, or alternatively, the color excesses. In both cases, similar results are obtained with dispersions in absolute magnitudes of 0.12-0.16 mag, depending on the specific filter-color combination. In contrast to the results obtained from the comparison of the color excesses, these fits of absolute magnitude give R V ∼ 1-2 when the dispersion is minimized, even when the two highly reddened SNe are excluded. This discrepancy suggests that, beyond the 'normal' interstellar reddening produced in the host galaxies, there is an intrinsic dispersion in the colors of SNe Ia which is correlated with luminosity but independent of the decline rate. Finally, a Hubble diagram for the best-observed subsample of SNe is produced by combining the results of the fits of absolute magnitude versus decline rate and color
THE LOCAL HOSTS OF TYPE Ia SUPERNOVAE
International Nuclear Information System (INIS)
Neill, James D.; Martin, D. Christopher; Barlow, Tom A.; Foster, Karl; Friedman, Peter G.; Morrissey, Patrick; Wyder, Ted K.; Sullivan, Mark; Howell, D. Andrew; Conley, Alex; Seibert, Mark; Madore, Barry F.; Neff, Susan G.; Schiminovich, David; Bianchi, Luciana; Donas, Jose; Milliard, Bruno; Heckman, Timothy M.; Lee, Young-Wook; Rich, R. Michael
2009-01-01
We use multi-wavelength, matched aperture, integrated photometry from the Galaxy Evolution Explorer (GALEX), the Sloan Digital Sky Survey, and the RC3 to estimate the physical properties of 166 nearby galaxies hosting 168 well-observed Type Ia supernovae (SNe Ia). The ultraviolet (UV) imaging of local SN Ia hosts from GALEX allows a direct comparison with higher-redshift hosts measured at optical wavelengths that correspond to the rest-frame UV. Our data corroborate well-known features that have been seen in other SN Ia samples. Specifically, hosts with active star formation produce brighter and slower SNe Ia on average, and hosts with luminosity-weighted ages older than 1 Gyr produce on average more faint, fast, and fewer bright, slow SNe Ia than younger hosts. New results include that in our sample, the faintest and fastest SNe Ia occur only in galaxies exceeding a stellar mass threshold of ∼10 10 M sun , leading us to conclude that their progenitors must arise in populations that are older and/or more metal rich than the general SN Ia population. A low host extinction subsample hints at a residual trend in peak luminosity with host age, after correcting for light-curve shape, giving the appearance that older hosts produce less-extincted SNe Ia on average. This has implications for cosmological fitting of SNe Ia, and suggests that host age could be useful as a parameter in the fitting. Converting host mass to metallicity and computing 56 Ni mass from the supernova light curves, we find that our local sample is consistent with a model that predicts a shallow trend between stellar metallicity and the 56 Ni mass that powers the explosion, but we cannot rule out the absence of a trend. We measure a correlation between 56 Ni mass and host age in the local universe that is shallower and not as significant as that seen at higher redshifts. The details of the age- 56 Ni mass correlations at low and higher redshift imply a luminosity-weighted age threshold of ∼3 Gyr
Energy Technology Data Exchange (ETDEWEB)
Kuncarayakti, Hanindyo; Maeda, Keiichi [Kavli Institute for the Physics and Mathematics of the Universe (WPI), Todai Institutes for Advanced Study, The University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8583 (Japan); Doi, Mamoru; Morokuma, Tomoki; Hashiba, Yasuhito [Institute of Astronomy, Graduate School of Science, The University of Tokyo, 2-21-1 Osawa, Mitaka, Tokyo 181-0015 (Japan); Aldering, Greg [Physics Division, Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, CA 94720 (United States); Arimoto, Nobuo [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-0015 (Japan); Pereira, Rui [CNRS/IN2P3, Institut de Physique Nucleaire de Lyon, 4 Rue Enrico Fermi, F-69622 Villeurbanne Cedex (France); Usuda, Tomonori, E-mail: hanindyo.kuncarayakti@ipmu.jp [Subaru Telescope, National Astronomical Observatory of Japan, 650 North A' ohoku Place, Hilo, HI 96720 (United States)
2013-08-01
Integral field spectroscopy of 11 Type Ib/Ic supernova (SN Ib/Ic) explosion sites in nearby galaxies has been obtained using UH88/SNIFS and Gemini-N/GMOS. The use of integral field spectroscopy enables us to obtain both spatial and spectral information about the explosion site, enabling the identification of the parent stellar population of the SN progenitor star. The spectrum of the parent population provides metallicity determination via strong-line method and age estimation obtained via comparison with simple stellar population models. We adopt this information as the metallicity and age of the SN progenitor, under the assumption that it was coeval with the parent stellar population. The age of the star corresponds to its lifetime, which in turn gives the estimate of its initial mass. With this method we were able to determine both the metallicity and initial (zero-age main sequence) mass of the progenitor stars of SNe Ib and Ic. We found that on average SN Ic explosion sites are more metal-rich and younger than SN Ib sites. The initial mass of the progenitors derived from parent stellar population age suggests that SN Ic has more massive progenitors than SN Ib. In addition, we also found indication that some of our SN progenitors are less massive than {approx}25 M{sub Sun }, indicating that they may have been stars in a close binary system that have lost their outer envelope via binary interactions to produce SNe Ib/Ic, instead of single Wolf-Rayet stars. These findings support the current suggestions that both binary and single progenitor channels are in effect in producing SNe Ib/Ic. This work also demonstrates the power of integral field spectroscopy in investigating SN environments and active star-forming regions.
Mass Extinctions and Supernova Explosions
Korschinek, Gunther
A nearby supernova (SN) explosion could have negatively influenced life on Earth, maybe even been responsible for mass extinctions. Mass extinction poses a significant extinction of numerous species on Earth, as recorded in the paleontologic, paleoclimatic, and geological record of our planet. Depending on the distance between the Sun and the SN, different types of threats have to be considered, such as ozone depletion on Earth, causing increased exposure to the Sun's ultraviolet radiation or the direct exposure of lethal X-rays. Another indirect effect is cloud formation, induced by cosmic rays in the atmosphere which result in a drop in the Earth's temperature, causing major glaciations of the Earth. The discovery of highly intensive gamma-ray bursts (GRBs), which could be connected to SNe, initiated further discussions on possible life-threatening events in the Earth's history. The probability that GRBs hit the Earth is very low. Nevertheless, a past interaction of Earth with GRBs and/or SNe cannot be excluded and might even have been responsible for past extinction events.
Light echoes - Type II supernovae
International Nuclear Information System (INIS)
Schaefer, B.E.
1987-01-01
Type II supernovae (SNs) light curves show a remarkable range of shapes. Data have been collected for the 12 Type II SNs that have light curve information for more than four months past maximum. Contrary to previous reports, it is found that (1) the decay rate after 100 days past maximum varies by almost an order of magnitude and (2) the light curve shapes are not bimodally distributed, but actually form a continuum. In addition, it is found that the extinctions to the SNs are related to the light curve shapes. This implies that the absorbing dust is local to the SNs. The dust is likely to be part of a circumstellar shell emitted by the SN progenitor that Dwek (1983) has used to explain infrared echoes. The optical depth of the shell can get quite large. In such cases, it is found that the photons scattered and delayed by reflection off dust grains will dominate the light curve several months after peak brightness. This light echo offers a straightforward explanation of the diversity of Type II SN light curves. 22 references
Could a nearby supernova explosion have caused a mass extinction?
International Nuclear Information System (INIS)
Ellis, J.; Schramm, D.N.
1995-01-01
We examine the possibility that a nearby supernova explosion could have caused one or more of the mass extinctions identified by paleontologists. We discuss the possible rate of such events in the light of the recent suggested identification of Geminga as a supernova remnant less than 100 parsec (pc) away and the discovery of a millisecond pulsar about 150 pc away and observations of SN 1987A. The fluxes of γ-radiation and charged cosmic rays on the Earth are estimated, and their effects on the Earth's ozone layer are discussed. A supernova explosion of the order of 10 pc away could be expected as often as every few hundred million years and could destroy the ozone layer for hundreds of years, letting in potentially lethal solar ultraviolet radiation. In addition to effects on land ecology, this could entail mass destruction of plankton and reef communities, with disastrous consequences for marine life as well. A supernova extinction should be distinguishable from a meteorite impact such as the one that presumably killed the dinosaurs at the open-quotes KT boundary.close quotes The recent argument that the KT event was exceedingly large and thus quite rare supports the need for other catastrophic events. 24 refs
Supernovae, compact stars and nuclear physics
International Nuclear Information System (INIS)
Glendenning, N.K.
1989-01-01
We briefly review the current understanding of supernova. We investigate the implications of rapid rotation corresponding to the frequency of the new pulsar reported in the supernovae remnant SN1987A. It places very stringent conditions on the equation of state if the star is assumed to be bound by gravity alone. We find that the central energy density of the star must be greater than 12 times that of nuclear density to be stable against the most optimistic estimate of general relativistic instabilities. This is too high for the matter to plausibly consist of individual hadrons. We conclude that the newly discovered pulsar, if its half-millisecond signals are attributable to rotation, cannot be a neutron star. We show that it can be a strange quark star, and that the entire family of strange stars can sustain high rotation under appropriate conditions. We discuss the conversion of a neutron star to strange star, the possible existence of a crust of heavy ions held in suspension by centrifugal and electric forces, the cooling and other features. 39 refs., 8 figs., 2 tabs
CARBON MONOXIDE IN THE COLD DEBRIS OF SUPERNOVA 1987A
Energy Technology Data Exchange (ETDEWEB)
Kamenetzky, J.; McCray, R.; Glenn, J. [Department of Astrophysical and Planetary Sciences, University of Colorado at Boulder, UCB 391, Boulder, CO 80309 (United States); Indebetouw, R. [Department of Astronomy, University of Virginia, P.O. Box 400325, Charlottesville, VA 22903 (United States); Barlow, M. J.; Matsuura, M. [Department of Physics and Astronomy, University College London, Gower Street, London WC1E 6BT (United Kingdom); Baes, M. [Sterrenkundig Observatorium, Universiteit Gent, Krijgslaan 281 S9, B-9000 Gent (Belgium); Blommaert, J. A. D. L.; Decin, L. [Instituut voor Sterrenkunde, KU Leuven, Celestijnenlaan 200D BUS 2401, B-2001 Leuven (Belgium); Bolatto, A. [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Dunne, L. [Department of Physics and Astronomy, University of Canterbury, Private Bag 4800, Christchurch 8410 (New Zealand); Fransson, C. [Department of Astronomy, Oskar Klein Centre, Stockholm University, AlbaNova, SE-106 91 Stockholm (Sweden); Gomez, H. L. [School of Physics and Astronomy, Cardiff University, The Parade, Cardiff CF24 3AA (United Kingdom); Groenewegen, M. A. T. [Royal Observatory of Belgium, Ringlaan 3, B-1180 Brussels (Belgium); Hopwood, R. [Physics Department, Imperial College London, London SW7 2AZ (United Kingdom); Kirshner, R. P. [Harvard College Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Lakicevic, M. [Lennard-Jones Laboratories, Keele University, Staffordshire ST5 5BG (United Kingdom); Marcaide, J. [Universidad de Valencia, C/Dr. Moliner 50, E-46100 Burjassot (Spain); Marti-Vidal, I. [Onsala Space Observatory, SE-439 92 Onsala (Sweden); Meixner, M. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); and others
2013-08-20
We report spectroscopic and imaging observations of rotational transitions of cold CO and SiO in the ejecta of SN1987A, the first such emission detected in a supernova remnant. In addition to line luminosities for the CO J = 1-0, 2-1, 6-5, and 7-6 transitions, we present upper limits for all other transitions up to J = 13-12, collectively measured from the Atacama Large Millimeter Array, the Atacama Pathfinder EXperiment, and the Herschel Spectral and Photometric Imaging REceiver. Simple models show the lines are emitted from at least 0.01 M{sub Sun} of CO at a temperature >14 K, confined within at most 35% of a spherical volume expanding at {approx}2000 km s{sup -1}. Moreover, we locate the emission within 1'' of the central debris. These observations, along with a partial observation of SiO, confirm the presence of cold molecular gas within supernova remnants and provide insight into the physical conditions and chemical processes in the ejecta. Furthermore, we demonstrate the powerful new window into supernova ejecta offered by submillimeter observations.
CARBON MONOXIDE IN THE COLD DEBRIS OF SUPERNOVA 1987A
International Nuclear Information System (INIS)
Kamenetzky, J.; McCray, R.; Glenn, J.; Indebetouw, R.; Barlow, M. J.; Matsuura, M.; Baes, M.; Blommaert, J. A. D. L.; Decin, L.; Bolatto, A.; Dunne, L.; Fransson, C.; Gomez, H. L.; Groenewegen, M. A. T.; Hopwood, R.; Kirshner, R. P.; Lakicevic, M.; Marcaide, J.; Marti-Vidal, I.; Meixner, M.
2013-01-01
We report spectroscopic and imaging observations of rotational transitions of cold CO and SiO in the ejecta of SN1987A, the first such emission detected in a supernova remnant. In addition to line luminosities for the CO J = 1-0, 2-1, 6-5, and 7-6 transitions, we present upper limits for all other transitions up to J = 13-12, collectively measured from the Atacama Large Millimeter Array, the Atacama Pathfinder EXperiment, and the Herschel Spectral and Photometric Imaging REceiver. Simple models show the lines are emitted from at least 0.01 M ☉ of CO at a temperature >14 K, confined within at most 35% of a spherical volume expanding at ∼2000 km s –1 . Moreover, we locate the emission within 1'' of the central debris. These observations, along with a partial observation of SiO, confirm the presence of cold molecular gas within supernova remnants and provide insight into the physical conditions and chemical processes in the ejecta. Furthermore, we demonstrate the powerful new window into supernova ejecta offered by submillimeter observations
MULTIFREQUENCY RADIO MEASUREMENTS OF SUPERNOVA 1987A OVER 22 YEARS
International Nuclear Information System (INIS)
Zanardo, G.; Staveley-Smith, L.; Potter, T. M.; Ball, Lewis; Kesteven, M. J.; Manchester, R. N.; Tzioumis, A. K.; Gaensler, B. M.; Ng, C.-Y.
2010-01-01
We present extensive observations of the radio emission from the remnant of supernova (SN) 1987A made with the Australia Telescope Compact Array (ATCA), since the first detection of the remnant in 1990. The radio emission has evolved in time providing unique information on the interaction of the SN shock with the circumstellar medium. We particularly focus on the monitoring observations at 1.4, 2.4, 4.8, and 8.6 GHz, which have been made at intervals of 4-6 weeks. The flux density data show that the remnant brightness is now increasing exponentially, while the radio spectrum is flattening. The current spectral index value of -0.68 represents an 18 ± 3% increase over the last eight years. The exponential trend in the flux is also found in the ATCA imaging observations at 9 GHz, which have been made since 1992, approximately twice a year, as well as in the 843 MHz data set from the Molonglo Observatory Synthesis Telescope from 1987 to 2007 March. Comparisons with data at different wavelengths (X-ray, Hα) are made. The rich data set that has been assembled in the last 22 years forms a basis for a better understanding of the evolution of the supernova remnant.
SNaX: A Database of Supernova X-Ray Light Curves
Energy Technology Data Exchange (ETDEWEB)
Ross, Mathias; Dwarkadas, Vikram V., E-mail: Mathias_Ross@msn.com, E-mail: vikram@oddjob.uchicago.edu [Astronomy and Astrophysics, University of Chicago, 5640 S Ellis Avenue, ERC 569, Chicago, IL 60637 (United States)
2017-06-01
We present the Supernova X-ray Database (SNaX), a compilation of the X-ray data from young supernovae (SNe). The database includes the X-ray fluxes and luminosities of young SNe, from days to years after outburst. The original goal and intent of this study was to present a database of Type IIn SNe (SNe IIn), which we have accomplished. Our ongoing goal is to expand the database to include all SNe for which published data are available. The database interface allows one to search for SNe using various criteria, plot all or selected data points, and download both the data and the plot. The plotting facility allows for significant customization. There is also a facility for the user to submit data that can be directly incorporated into the database. We include an option to fit the decay of any given SN light curve with a power-law. The database includes a conversion of most data points to a common 0.3–8 keV band so that SN light curves may be directly compared with each other. A mailing list has been set up to disseminate information about the database. We outline the structure and function of the database, describe its various features, and outline the plans for future expansion.
SNaX: A Database of Supernova X-Ray Light Curves
International Nuclear Information System (INIS)
Ross, Mathias; Dwarkadas, Vikram V.
2017-01-01
We present the Supernova X-ray Database (SNaX), a compilation of the X-ray data from young supernovae (SNe). The database includes the X-ray fluxes and luminosities of young SNe, from days to years after outburst. The original goal and intent of this study was to present a database of Type IIn SNe (SNe IIn), which we have accomplished. Our ongoing goal is to expand the database to include all SNe for which published data are available. The database interface allows one to search for SNe using various criteria, plot all or selected data points, and download both the data and the plot. The plotting facility allows for significant customization. There is also a facility for the user to submit data that can be directly incorporated into the database. We include an option to fit the decay of any given SN light curve with a power-law. The database includes a conversion of most data points to a common 0.3–8 keV band so that SN light curves may be directly compared with each other. A mailing list has been set up to disseminate information about the database. We outline the structure and function of the database, describe its various features, and outline the plans for future expansion.
Research in nuclear astrophysics: Stellar collapse and supernovae
International Nuclear Information System (INIS)
Lattimer, J.M.; Yahil, A.
1990-01-01
The interaction between nuclear theory and some outstanding problems in astrophysics has been examined. We have been actively researching both the astrophysics of gravitational collapse, neutron star birth, and the emission of neutrinos from supernovae, on the one hand, and the nuclear physics of the equation of state of hot, dense matter on the other hand. There is close coupling between nuclear theory and supernova and neutron star phenomenon; in fact, nuclear matter properties, especially supernuclear densities, might be best delineated by astrophysical considerations. Our research has also focused on the neutrinos emitted from supernovae, since they are the only available observables of the internal supernova mechanism. The recent observations of neutrinos from SN 1987A proved to be in remarkable agreement with models we pioneered prior to its explosion. We have also developed a novel hydrodynamical code in which shocks are treated via Riemann resolution rather than with artificial viscosity. We have also extended models of the neutrino emission and cooling of neutron stars to include the effects of rotation. The Lattimer compressible liquid drop model is the basis of our equation of state. We have developed a rapid version for use in hydrodynamic codes that retains essentially all the physics of earlier, more detailed equations of state. We have also focused on the nuclei-nuclear matter phase transition just below nuclear matter density, including the probable nuclear deformations and the possible ''inside-out'' phase of bubbles, which could be of major importance in supernovae models. Work also progressed toward understanding the origin of the r-process elements, through focusing on the neutron star decompression model
Evolution of the color indices in SN 2006aj associated with GRB 060218
Czech Academy of Sciences Publication Activity Database
Šimon, Vojtěch; Pizzichini, G.; Hudec, René
2010-01-01
Roč. 523, Nov-Dec (2010), A56/1-A56/11 ISSN 0004-6361 R&D Projects: GA ČR GA205/08/1207 Grant - others:ESA(XE) ESA-PECS project No. 98058 Institutional research plan: CEZ:AV0Z10030501 Keywords : gamma-ray burst * radiation mechanisms Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.410, year: 2010
SN 2013dh in NGC 5936 is probably a type Iax supernova
Jha, Saurabh W.; McCully, Curtis; Foley, Ryan J.; Cenko, S. Bradley; Zheng, WeiKang; Clubb, Kelsey I.; Shivvers, Isaac; Filippenko, Alexei V.; Tucker, Brad E.; Garnavich, Peter M.
2013-06-01
Further to CBET 3561 (Kumar et al. 2013; Cenko et al. 2013), we have analyzed spectra of SN 2013dh obtained on June 14.3 and June 17.3 UT with the Shane 3-m reflector (+ Kast spectrograph) at Lick Observatory. The observations continue to show that SN 2013dh has a blue continuum with relatively narrow (FWHM approximately 3000 km/s) Fe III absorption.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AJ15 (Link to dictyBase) - G01152 DDB0232964 Contig-U16520-...to library) Clone ID FC-AJ15 (Link to dictyBase) Atlas ID - NBRP ID G01152 dictyBase ID DDB0232964 Link to C...ontig Contig-U16520-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC...KIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTHTDFKKAKEKVL YRKTAGAPEGLYM*kkknqnqk Trans...vih*qlviwrrlsmxitpschqp*tralcpyhvfv--- ---ELLNQLDGFDASTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICT
Early Blue Excess from the Type Ia Supernova 2017cbv and Implications for Its Progenitor
Energy Technology Data Exchange (ETDEWEB)
Hosseinzadeh, Griffin; Howell, D. Andrew; McCully, Curtis; Arcavi, Iair [Las Cumbres Observatory, 6740 Cortona Drive, Suite 102, Goleta, CA 93117-5575 (United States); Sand, David J.; Tartaglia, Leonardo [Department of Astronomy/Steward Observatory, 933 North Cherry Avenue, Room N204, Tucson, AZ 85721-0065 (United States); Valenti, Stefano; Bostroem, K. Azalee [Department of Physics, University of California, 1 Shields Avenue, Davis, CA 95616-5270 (United States); Brown, Peter [Mitchell Institute for Fundamental Physics and Astronomy, Texas A and M University, College Station, TX 77843-4242 (United States); Kasen, Daniel [Nuclear Science Division, Lawrence Berkeley National Laboratory, Berkeley, CA 94720-8169 (United States); Hsiao, Eric Y.; Davis, Scott; Shahbandeh, Melissa [Department of Physics, Florida State University, 77 Chieftain Way, Tallahassee, FL 32306-4350 (United States); Stritzinger, Maximilian D., E-mail: griffin@lco.global [Department of Physics and Astronomy, Aarhus University, Ny Munkegade 120, DK-8000 Aarhus C (Denmark)
2017-08-20
We present very early, high-cadence photometric observations of the nearby Type Ia SN 2017cbv. The light curve is unique in that it has a blue bump during the first five days of observations in the U , B , and g bands, which is clearly resolved given our photometric cadence of 5.7 hr during that time span. We model the light curve as the combination of early shocking of the supernova ejecta against a nondegenerate companion star plus a standard SN Ia component. Our best-fit model suggests the presence of a subgiant star 56 R {sub ☉} from the exploding white dwarf, although this number is highly model-dependent. While this model matches the optical light curve well, it overpredicts the observed flux in the ultraviolet bands. This may indicate that the shock is not a blackbody, perhaps because of line blanketing in the UV. Alternatively, it could point to another physical explanation for the optical blue bump, such as interaction with circumstellar material or an unusual nickel distribution. Early optical spectra of SN 2017cbv show strong carbon (C ii λ 6580) absorption up through day −13 with respect to maximum light, suggesting that the progenitor system contains a significant amount of unburned material. These early results on SN 2017cbv illustrate the power of early discovery and intense follow-up of nearby supernovae to resolve standing questions about the progenitor systems and explosion mechanisms of SNe Ia.
Early Blue Excess from the Type Ia Supernova 2017cbv and Implications for Its Progenitor
International Nuclear Information System (INIS)
Hosseinzadeh, Griffin; Howell, D. Andrew; McCully, Curtis; Arcavi, Iair; Sand, David J.; Tartaglia, Leonardo; Valenti, Stefano; Bostroem, K. Azalee; Brown, Peter; Kasen, Daniel; Hsiao, Eric Y.; Davis, Scott; Shahbandeh, Melissa; Stritzinger, Maximilian D.
2017-01-01
We present very early, high-cadence photometric observations of the nearby Type Ia SN 2017cbv. The light curve is unique in that it has a blue bump during the first five days of observations in the U , B , and g bands, which is clearly resolved given our photometric cadence of 5.7 hr during that time span. We model the light curve as the combination of early shocking of the supernova ejecta against a nondegenerate companion star plus a standard SN Ia component. Our best-fit model suggests the presence of a subgiant star 56 R _☉ from the exploding white dwarf, although this number is highly model-dependent. While this model matches the optical light curve well, it overpredicts the observed flux in the ultraviolet bands. This may indicate that the shock is not a blackbody, perhaps because of line blanketing in the UV. Alternatively, it could point to another physical explanation for the optical blue bump, such as interaction with circumstellar material or an unusual nickel distribution. Early optical spectra of SN 2017cbv show strong carbon (C ii λ 6580) absorption up through day −13 with respect to maximum light, suggesting that the progenitor system contains a significant amount of unburned material. These early results on SN 2017cbv illustrate the power of early discovery and intense follow-up of nearby supernovae to resolve standing questions about the progenitor systems and explosion mechanisms of SNe Ia.
A plausible (overlooked) super-luminous supernova in the Sloan digital sky survey stripe 82 data
International Nuclear Information System (INIS)
Kostrzewa-Rutkowska, Zuzanna; Kozłowski, Szymon; Wyrzykowski, Łukasz; Djorgovski, S. George; Mahabal, Ashish A.; Glikman, Eilat; Koposov, Sergey
2013-01-01
We present the discovery of a plausible super-luminous supernova (SLSN), found in the archival data of Sloan Digital Sky Survey (SDSS) Stripe 82, called PSN 000123+000504. The supernova (SN) peaked at m g < 19.4 mag in the second half of 2005 September, but was missed by the real-time SN hunt. The observed part of the light curve (17 epochs) showed that the rise to the maximum took over 30 days, while the decline time lasted at least 70 days (observed frame), closely resembling other SLSNe of SN 2007bi type. The spectrum of the host galaxy reveals a redshift of z = 0.281 and the distance modulus of μ = 40.77 mag. Combining this information with the SDSS photometry, we found the host galaxy to be an LMC-like irregular dwarf galaxy with an absolute magnitude of M B = –18.2 ± 0.2 mag and an oxygen abundance of 12+log [O/H]=8.3±0.2; hence, the SN peaked at M g < –21.3 mag. Our SLSN follows the relation for the most energetic/super-luminous SNe exploding in low-metallicity environments, but we found no clear evidence for SLSNe to explode in low-luminosity (dwarf) galaxies only. The available information on the PSN 000123+000504 light curve suggests the magnetar-powered model as a likely scenario of this event. This SLSN is a new addition to a quickly growing family of super-luminous SNe.
Branch, David
2017-01-01
Targeting advanced students of astronomy and physics, as well as astronomers and physicists contemplating research on supernovae or related fields, David Branch and J. Craig Wheeler offer a modern account of the nature, causes and consequences of supernovae, as well as of issues that remain to be resolved. Owing especially to (1) the appearance of supernova 1987A in the nearby Large Magellanic Cloud, (2) the spectacularly successful use of supernovae as distance indicators for cosmology, (3) the association of some supernovae with the enigmatic cosmic gamma-ray bursts, and (4) the discovery of a class of superluminous supernovae, the pace of supernova research has been increasing sharply. This monograph serves as a broad survey of modern supernova research and a guide to the current literature. The book’s emphasis is on the explosive phases of supernovae. Part 1 is devoted to a survey of the kinds of observations that inform us about supernovae, some basic interpreta tions of such data, and an overview of t...
Massive stars dying alone: Extremely remote environments of SN2009ip and SN2010jp
Smith, Nathan
2014-10-01
We propose an imaging study of the astonishingly remote environments of two recent supernovae (SNe): SN2009ip and SN2010jp. Both were unusual Type IIn explosions that crashed into dense circumstellar material (CSM) ejected by the star shortly before explosion. The favored progenitors of these SNe are very massive luminous blue variable (LBV) stars. In fact, SN2009ip presents an extraordinay case where the LBV-like progenitor was actually detected directly in archival HST data, and where we obtained spectra and photometry for numerous pre-SN eruptions. No other SN has this treasure trove of detailed information about the progenitor (not even SN1987A). SN2010jp represents a possible collapsar-powered event, since it showed evidence of a fast bipolar jet in spectra and a low 56Ni mass; this would be an analog of the black-hole forming explosions that cause gamma ray bursts, but where the relativistic jet is damped by a residual H envelope on the star. In both cases, the only viable models for these SNe involve extremely massive (initial masses of 40-100 Msun) progenitor stars. This seems at odds with their extremely remote environments in the far outskirts of their host galaxies, with no detected evidence for an underlying massive star population in ground-based data (nor in the single shallow WFPC2/F606W image of SN2009ip). Here we propose deep UV HST images to search for any mid/late O-type stars nearby, deep red images to detect any red supergiants, and an H-alpha image to search for any evidence of ongoing star formation in the vicinity. These observations will place important and demanding constraints on the initial masses and ages of these progenitors.
The Massive Progenitor of the Type II-linear Supernova 2009kr
Elias-Rosa, Nancy; Van Dyk, Schuyler D.; Li, Weidong; Miller, Adam A.; Silverman, Jeffrey M.; Ganeshalingam, Mohan; Boden, Andrew F.; Kasliwal, Mansi M.; Vinkó, József; Cuillandre, Jean-Charles; Filippenko, Alexei V.; Steele, Thea N.; Bloom, Joshua S.; Griffith, Christopher V.; Kleiser, Io K. W.; Foley, Ryan J.
2010-05-01
We present early-time photometric and spectroscopic observations of supernova (SN) 2009kr in NGC 1832. We find that its properties to date support its classification as Type II-linear (SN II-L), a relatively rare subclass of core-collapse supernovae (SNe). We have also identified a candidate for the SN progenitor star through comparison of pre-explosion, archival images taken with WFPC2 on board the Hubble Space Telescope with SN images obtained using adaptive optics plus NIRC2 on the 10 m Keck-II telescope. Although the host galaxy's substantial distance (~26 Mpc) results in large uncertainties in the relative astrometry, we find that if this candidate is indeed the progenitor, it is a highly luminous (M 0 V = -7.8 mag) yellow supergiant with initial mass ~18-24 M sun. This would be the first time that an SN II-L progenitor has been directly identified. Its mass may be a bridge between the upper initial mass limit for the more common Type II-plateau SNe and the inferred initial mass estimate for one Type II-narrow SN. Based in part on observations made with the NASA/ESA Hubble Space Telescope (HST), obtained from the Data Archive at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy (AURA), Inc., under NASA contract NAS 05-26555; the 6.5 m Magellan Clay Telescope located at Las Campanas Observatory, Chile; various telescopes at Lick Observatory; the 1.3 m PAIRITEL on Mt. Hopkins; the SMARTS Consortium 1.3 m telescope located at Cerro Tololo Inter-American Observatory (CTIO), Chile; the 3.6 m Canada-France-Hawaii Telescope (CFHT), which is operated by the National Research Council of Canada, the Institut National des Sciences de l'Univers of the Centre National de la Recherche Scientifique of France, and the University of Hawaii; and the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and NASA, with
Suppression of Self-Induced Flavor Conversion in the Supernova Accretion Phase
Sarikas, Srdjan; Raffelt, Georg G.; Hüdepohl, Lorenz; Janka, Hans-Thomas
2012-02-01
Self-induced flavor conversions of supernova (SN) neutrinos can strongly modify the flavor-dependent fluxes. We perform a linearized flavor stability analysis with accretion-phase matter profiles of a 15M⊙ spherically symmetric model and corresponding neutrino fluxes. We use realistic energy and angle distributions, the latter deviating strongly from quasi-isotropic emission, thus accounting for both multiangle and multienergy effects. For our matter and neutrino density profile we always find stable conditions: flavor conversions are limited to the usual Mikheyev-Smirnov-Wolfenstein effect. In this case one may distinguish the neutrino mass hierarchy in a SN neutrino signal if the mixing angle θ13 is as large as suggested by recent experiments.
Energy Technology Data Exchange (ETDEWEB)
Kelly, Patrick L.; Fox, Ori D.; Filippenko, Alexei V.; Shen, Ken J.; Zheng, WeiKang; Graham, Melissa L.; Tucker, Brad E. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Cenko, S. Bradley [NASA/Goddard Space Flight Center, Code 662, Greenbelt, MD 20771 (United States); Prato, Lisa [Lowell Observatory, 1400 West Mars Hill Road, Flagstaff, AZ 86001 (United States); Schaefer, Gail, E-mail: pkelly@astro.berkeley.edu [The CHARA Array of Georgia State University, Mount Wilson Observatory, Mount Wilson, CA 91023 (United States)
2014-07-20
We constrain the properties of the progenitor system of the highly reddened Type Ia supernova (SN Ia) 2014J in Messier 82 (M82; d ≈ 3.5 Mpc). We determine the supernova (SN) location using Keck-II K-band adaptive optics images, and we find no evidence for flux from a progenitor system in pre-explosion near-ultraviolet through near-infrared Hubble Space Telescope (HST) images. Our upper limits exclude systems having a bright red giant companion, including symbiotic novae with luminosities comparable to that of RS Ophiuchi. While the flux constraints are also inconsistent with predictions for comparatively cool He-donor systems (T ≲ 35,000 K), we cannot preclude a system similar to V445 Puppis. The progenitor constraints are robust across a wide range of R{sub V} and A{sub V} values, but significantly greater values than those inferred from the SN light curve and spectrum would yield proportionally brighter luminosity limits. The comparatively faint flux expected from a binary progenitor system consisting of white dwarf stars would not have been detected in the pre-explosion HST imaging. Infrared HST exposures yield more stringent constraints on the luminosities of very cool (T < 3000 K) companion stars than was possible in the case of SN Ia 2011fe.
International Nuclear Information System (INIS)
Kelly, Patrick L.; Fox, Ori D.; Filippenko, Alexei V.; Shen, Ken J.; Zheng, WeiKang; Graham, Melissa L.; Tucker, Brad E.; Cenko, S. Bradley; Prato, Lisa; Schaefer, Gail
2014-01-01
We constrain the properties of the progenitor system of the highly reddened Type Ia supernova (SN Ia) 2014J in Messier 82 (M82; d ≈ 3.5 Mpc). We determine the supernova (SN) location using Keck-II K-band adaptive optics images, and we find no evidence for flux from a progenitor system in pre-explosion near-ultraviolet through near-infrared Hubble Space Telescope (HST) images. Our upper limits exclude systems having a bright red giant companion, including symbiotic novae with luminosities comparable to that of RS Ophiuchi. While the flux constraints are also inconsistent with predictions for comparatively cool He-donor systems (T ≲ 35,000 K), we cannot preclude a system similar to V445 Puppis. The progenitor constraints are robust across a wide range of R V and A V values, but significantly greater values than those inferred from the SN light curve and spectrum would yield proportionally brighter luminosity limits. The comparatively faint flux expected from a binary progenitor system consisting of white dwarf stars would not have been detected in the pre-explosion HST imaging. Infrared HST exposures yield more stringent constraints on the luminosities of very cool (T < 3000 K) companion stars than was possible in the case of SN Ia 2011fe.
International Nuclear Information System (INIS)
Schorn, R.A.
1988-01-01
The advances in understanding that have been made concerning SN 1987A in the year since it appeared are reviewed. The rapidity of the initial rise in brightness and the relatively faint absolute magnitude during the first few weeks have been found to be due to the progenitor star's being a blue giant, relatively small compared to a red giant. The nitrogen lines in the spectrum are evidence that the star was once a red giant whose stellar wind was so strong that the resulting loss of material converted the star into a blue giant. The variations in the light curve of the supernova are explained in terms of the radioactive decay of Ni-56 and Co-56 and the interaction of the resulting gamma rays with the debris cloud. Some of the remaining unanswered questions are summarized
No supernovae detected in two long-duration gamma-ray bursts.
Watson, D; Fynbo, J P U; Thöne, C C; Sollerman, J
2007-05-15
There is strong evidence that long-duration gamma-ray bursts (GRBs) are produced during the collapse of a massive star. In the standard version of the collapsar model, a broad-lined and luminous Type Ic core-collapse supernova (SN) accompanies the GRB. This association has been confirmed in observations of several nearby GRBs. Recent observations show that some long-duration GRBs are different. No SN emission accompanied the long-duration GRBs 060505 and 060614 down to limits fainter than any known Type Ic SN and hundreds of times fainter than the archetypal SN 1998bw that accompanied GRB 980425. Multi-band observations of the early afterglows, as well as spectroscopy of the host galaxies, exclude the possibility of significant dust obscuration. Furthermore, the bursts originated in star-forming galaxies, and in the case of GRB 060505, the burst was localized to a compact star-forming knot in a spiral arm of its host galaxy. We find that the properties of the host galaxies, the long duration of the bursts and, in the case of GRB 060505, the location of the burst within its host, all imply a massive stellar origin. The absence of an SN to such deep limits therefore suggests a new phenomenological type of massive stellar death.
The Type Ia Supernova Rate at z~0.5 from the Supernova Legacy Survey
Neill, J. D.; Sullivan, M.; Balam, D.; Pritchet, C. J.; Howell, D. A.; Perrett, K.; Astier, P.; Aubourg, E.; Basa, S.; Carlberg, R. G.; Conley, A.; Fabbro, S.; Fouchez, D.; Guy, J.; Hook, I.; Pain, R.; Palanque-Delabrouille, N.; Regnault, N.; Rich, J.; Taillet, R.; Aldering, G.; Antilogus, P.; Arsenijevic, V.; Balland, C.; Baumont, S.; Bronder, J.; Ellis, R. S.; Filiol, M.; Gonçalves, A. C.; Hardin, D.; Kowalski, M.; Lidman, C.; Lusset, V.; Mouchet, M.; Mourao, A.; Perlmutter, S.; Ripoche, P.; Schlegel, D.; Tao, C.
2006-09-01
We present a measurement of the distant Type Ia supernova (SN Ia) rate derived from the first 2 yr of the Canada-France-Hawaii Telescope Supernova Legacy Survey. We observed four 1deg×1deg fields with a typical temporal frequency of ~4 observer-frame days over time spans of 158-211 days per season for each field, with breaks during the full Moon. We used 8-10 m class telescopes for spectroscopic follow-up to confirm our candidates and determine their redshifts. Our starting sample consists of 73 spectroscopically verified SNe Ia in the redshift range 0.2=0.47)=[0.42+0.13-0.09(syst.)+/-0.06(stat.)×10-4 yr-1 Mpc3, assuming h=0.7, Ωm=0.3, and a flat cosmology. Using recently published galaxy luminosity functions derived in our redshift range, we derive a SN Ia rate per unit luminosity of rL(=0.47)=0.154+0.048-0.033(syst.)+0.039-0.031(stat.) SN units. Using our rate alone, we place an upper limit on the component of SN Ia production that tracks the cosmic star formation history of 1 SN Ia per 103 Msolar of stars formed. Our rate and other rates from surveys using spectroscopic sample confirmation display only a modest evolution out to z=0.55. Based on observations obtained with MegaPrime/MegaCam, a joint project of the Canada-France-Hawaii Telescope (CFHT) and CEA/DAPNIA, at CFHT, which is operated by the National Research Council (NRC) of Canada, the Institut National des Sciences de l'Univers of the Centre National de la Recherche Scientifique (CNRS) of France, and the University of Hawaii. This work is based in part on data products produced at the Canadian Astronomy Data Centre as part of the Canada-France-Hawaii Telescope Legacy Survey, a collaborative project of NRC and CNRS. This work is also based on observations obtained at the European Southern Observatory using the Very Large Telescope on the Cerro Paranal (ESO Large Program 171.A-0486), and on observations (programs GN-2004A-Q-19, GS-2004A-Q-11, GN-2003B-Q-9, and GS-2003B-Q-8) obtained at the Gemini
The rebirth of Supernova 1987A : a study of the ejecta-ring collision
Gröningsson, Per
Supernovae are some of the most energetic phenomena in the Universe and they have throughout history fascinated people as they appeared as new stars in the sky. Supernova (SN) 1987A exploded in the nearby satellite galaxy, the Large Magellanic Cloud (LMC), at a distance of only 168,000 light years. The proximity of SN 1987A offers a unique opportunity to study the medium surrounding the supernova in great detail. Powered by the dynamical interaction of the ejecta with the inner circumstellar ring, SN 1987A is dramatically evolving at all wavelengths on time scales less than a year. This makes SN 1987A a great ``laboratory'' for studies of shock physics. Repeated observations of the ejecta-ring collision have been carried out using the UVES echelle spectrograph at VLT. This thesis covers seven epochs of high resolution spectra taken between October 1999 and November 2007. Three different emission line components are identified from the spectra. A narrow (~10 km/s) velocity component emerges from the unshocked ring. An intermediate (~250 km/s) component arises in the shocked ring, and a broad component extending to ~15,000 km/s comes from the reverse shock. Thanks to the high spectral resolution of UVES, it has been possible to separate the shocked from the unshocked ring emission. For the unshocked gas, ionization stages from neutral up to Ne V and Fe VII were found. The line fluxes of the low-ionization lines decline during the period of the observations. However, the fluxes of the [O III] and [Ne III] lines appear to increase and this is found to be consistent with the heating of the pre-shock gas by X-rays from the shock interactions. The line emission from the ejecta-ring collision increases rapidly as more gas is swept up by the shocks. This emission comes from ions with a range of ionization stages (e.g., Fe II-XIV). The low-ionization lines show an increase in their line widths which is consistent with that these lines originate from radiative shocks. The
Rapid ionization of the environment of SN 1987A
International Nuclear Information System (INIS)
Raga, A.C.
1987-01-01
It has been suggested by some authors that IUE observations of the supernova SN 1987A show the presence of a strong component of the interstellar C IV 1550 and Si IV 1393 absorption lines at a velocity that approximately corresponds to the velocity of the LMC. It is possible that this component might come from originally neutral (or at least not very highly ionized) gas which has been photoionized by the initially very strong ionizing radiation field of the supernova. Theoretical considerations of this scenario lead to the study of fast (with velocities of about c) ionization fronts. It is shown that for reasonable model parameters it is possible to obtain considerably large C IV column densities, in agreement with the IUE observations. On the other hand, the models do not so easily predict the large Si IV column densities that are also obtained from the IUE observations. It is found that only models in which the interstellar medium surrounding SN 1987A is initially composed of already ionized hydrogen and helium predict substantial Si IV column densities. This result provides an interesting prediction of the ionization state of the environment of the presupernova star. 9 references
Rapid ionization of the environment of SN 1987A
Raga, A. C.
1987-01-01
It has been suggested by some authors that IUE observations of the supernova SN 1987A show the presence of a strong component of the interstellar C IV 1550 and Si IV 1393 absorption lines at a velocity that approximately corresponds to the velocity of the LMC. It is possible that this component might come from originally neutral (or at least not very highly ionized) gas which has been photoionized by the initially very strong ionizing radiation field of the supernova. Theoretical considerations of this scenario lead to the study of fast (with velocities of about c) ionization fronts. It is shown that for reasonable model parameters it is possible to obtain considerably large C IV column densities, in agreement with the IUE observations. On the other hand, the models do not so easily predict the large Si IV column densities that are also obtained from the IUE observations. It is found that only models in which the interstellar medium surrounding SN 1987A is initially composed of already ionized hydrogen and helium predict substantial Si IV column densities. This result provides an interesting prediction of the ionization state of the environment of the presupernova star.
An updated Type II supernova Hubble diagram
Gall, E. E. E.; Kotak, R.; Leibundgut, B.; Taubenberger, S.; Hillebrandt, W.; Kromer, M.; Burgett, W. S.; Chambers, K.; Flewelling, H.; Huber, M. E.; Kaiser, N.; Kudritzki, R. P.; Magnier, E. A.; Metcalfe, N.; Smith, K.; Tonry, J. L.; Wainscoat, R. J.; Waters, C.
2018-03-01
We present photometry and spectroscopy of nine Type II-P/L supernovae (SNe) with redshifts in the 0.045 ≲ z ≲ 0.335 range, with a view to re-examining their utility as distance indicators. Specifically, we apply the expanding photosphere method (EPM) and the standardized candle method (SCM) to each target, and find that both methods yield distances that are in reasonable agreement with each other. The current record-holder for the highest-redshift spectroscopically confirmed supernova (SN) II-P is PS1-13bni (z = 0.335-0.012+0.009), and illustrates the promise of Type II SNe as cosmological tools. We updated existing EPM and SCM Hubble diagrams by adding our sample to those previously published. Within the context of Type II SN distance measuring techniques, we investigated two related questions. First, we explored the possibility of utilising spectral lines other than the traditionally used Fe IIλ5169 to infer the photospheric velocity of SN ejecta. Using local well-observed objects, we derive an epoch-dependent relation between the strong Balmer line and Fe IIλ5169 velocities that is applicable 30 to 40 days post-explosion. Motivated in part by the continuum of key observables such as rise time and decline rates exhibited from II-P to II-L SNe, we assessed the possibility of using Hubble-flow Type II-L SNe as distance indicators. These yield similar distances as the Type II-P SNe. Although these initial results are encouraging, a significantly larger sample of SNe II-L would be required to draw definitive conclusions. Tables A.1, A.3, A.5, A.7, A.9, A.11, A.13, A.15 and A.17 are also available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/611/A25
Photometric classification and redshift estimation of LSST Supernovae
Dai, Mi; Kuhlmann, Steve; Wang, Yun; Kovacs, Eve
2018-04-01
Supernova (SN) classification and redshift estimation using photometric data only have become very important for the Large Synoptic Survey Telescope (LSST), given the large number of SNe that LSST will observe and the impossibility of spectroscopically following up all the SNe. We investigate the performance of a SN classifier that uses SN colors to classify LSST SNe with the Random Forest classification algorithm. Our classifier results in an AUC of 0.98 which represents excellent classification. We are able to obtain a photometric SN sample containing 99% SNe Ia by choosing a probability threshold. We estimate the photometric redshifts (photo-z) of SNe in our sample by fitting the SN light curves using the SALT2 model with nested sampling. We obtain a mean bias () of 0.012 with σ ( z_phot-z_spec/1+z_spec) = 0.0294 without using a host-galaxy photo-z prior, and a mean bias () of 0.0017 with σ ( z_phot-z_spec/1+z_spec) = 0.0116 using a host-galaxy photo-z prior. Assuming a flat ΛCDM model with Ωm = 0.3, we obtain Ωm of 0.305 ± 0.008 (statistical errors only), using the simulated LSST sample of photometric SNe Ia (with intrinsic scatter σint = 0.11) derived using our methodology without using host-galaxy photo-z prior. Our method will help boost the power of SNe from the LSST as cosmological probes.
The evolution of red supergiants to supernovae
Beasor, Emma R.; Davies, Ben
2017-11-01
With red supergiants (RSGs) predicted to end their lives as Type IIP core collapse supernova (CCSN), their behaviour before explosion needs to be fully understood. Mass loss rates govern RSG evolution towards SN and have strong implications on the appearance of the resulting explosion. To study how the mass-loss rates change with the evolution of the star, we have measured the amount of circumstellar material around 19 RSGs in a coeval cluster. Our study has shown that mass loss rates ramp up throughout the lifetime of an RSG, with more evolved stars having mass loss rates a factor of 40 higher than early stage RSGs. Interestingly, we have also found evidence for an increase in circumstellar extinction throughout the RSG lifetime, meaning the most evolved stars are most severely affected. We find that, were the most evolved RSGs in NGC2100 to go SN, this extra extinction would cause the progenitor's initial mass to be underestimated by up to 9M⊙.
Radioactive Iron Rain: Transporting 60Fe in Supernova Dust to the Ocean Floor
Fry, Brian J.; Fields, Brian D.; Ellis, John R.
2016-08-01
Several searches have found evidence of {}60{{Fe}} deposition, presumably from a near-Earth supernova (SN), with concentrations that vary in different locations on Earth. This paper examines various influences on the path of interstellar dust carrying {}60{{Fe}} from an SN through the heliosphere, with the aim of estimating the final global distribution on the ocean floor. We study the influences of magnetic fields, angle of arrival, wind, and ocean cycling of SN material on the concentrations at different locations. We find that the passage of SN material through the mesosphere/lower thermosphere has the greatest influence on the final global distribution, with ocean cycling causing lesser alteration as the SN material sinks to the ocean floor. SN distance estimates in previous works that assumed a uniform distribution are a good approximation. Including the effects on surface distributions, we estimate a distance of {46}-6+10 pc for an 8{--}10 {M}⊙ SN progenitor. This is consistent with an SN occurring within the Tuc-Hor stellar group ˜2.8 Myr ago, with SN material arriving on Earth ˜2.2 Myr ago. We note that the SN dust retains directional information to within 1◦ through its arrival in the inner solar system, so that SN debris deposition on inert bodies such as the Moon will be anisotropic, and thus could in principle be used to infer directional information. In particular, we predict that existing lunar samples should show measurable {}60{{Fe}} differences.
Supernova 1604, Kepler’s Supernova, and Its Remnant
Vink, J.; Alsabti, A.W.; Murdin, P.
2016-01-01
Supernova 1604 is the last galactic supernova for which historical records exist. Johannes Kepler’s name is attached to it, as he published a detailed account of the observations made by himself and European colleagues. Supernova 1604 was very likely a type Ia supernova, which exploded 350–750 pc
Very Deep inside the SN 1987A Core Ejecta: Molecular Structures Seen in 3D
Energy Technology Data Exchange (ETDEWEB)
Abellán, F. J.; Marcaide, J. M. [Departamento de Astronomía y Astrofísica, Universidad de Valencia, C/Dr. Moliner 50, E-46100 Burjassot (Spain); Indebetouw, R.; Chevalier, R. [Department of Astronomy, University of Virginia, P.O. Box 400325, Charlottesville, VA 22904 (United States); Gabler, M.; Janka, H.-Th. [Max-Planck-Institut für Astrophysik, Karl-Schwarzschild-Straße 1, D-85748 Garching (Germany); Fransson, C.; Lundqvist, P. [Department of Astronomy, The Oskar Klein Centre, Stockholm University, Alba Nova University Centre, SE-106 91 Stockholm (Sweden); Spyromilio, J. [ESO, Karl-Schwarzschild-Straße 2, D-85748 Garching (Germany); Burrows, D. N. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Cigan, P.; Gomez, H. L.; Matsuura, M. [School of Physics and Astronomy, Cardiff University, Queens Buildings, The Parade, Cardiff CF24 3AA (United Kingdom); Gaensler, B. M. [Dunlap Institute for Astronomy and Astrophysics, University of Toronto, Toronto, ON M5S 3H4 (Canada); Kirshner, R. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Larsson, J. [KTH, Department of Physics, and the Oskar Klein Centre, AlbaNova, SE-106 91 Stockholm (Sweden); McCray, R. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Ng, C.-Y. [Department of Physics, The University of Hong Kong, Pokfulam Road, Hong Kong (China); Park, S. [Department of Physics, University of Texas at Arlington, 108 Science Hall, Box 19059, Arlington, TX 76019 (United States); Roche, P., E-mail: francisco.abellan@uv.es [Department of Physics, University of Oxford, Oxford OX1 3RH (United Kingdom); and others
2017-06-20
Most massive stars end their lives in core-collapse supernova explosions and enrich the interstellar medium with explosively nucleosynthesized elements. Following core collapse, the explosion is subject to instabilities as the shock propagates outward through the progenitor star. Observations of the composition and structure of the innermost regions of a core-collapse supernova provide a direct probe of the instabilities and nucleosynthetic products. SN 1987A in the Large Magellanic Cloud is one of very few supernovae for which the inner ejecta can be spatially resolved but are not yet strongly affected by interaction with the surroundings. Our observations of SN 1987A with the Atacama Large Millimeter/submillimeter Array are of the highest resolution to date and reveal the detailed morphology of cold molecular gas in the innermost regions of the remnant. The 3D distributions of carbon and silicon monoxide (CO and SiO) emission differ, but both have a central deficit, or torus-like distribution, possibly a result of radioactive heating during the first weeks (“nickel heating”). The size scales of the clumpy distribution are compared quantitatively to models, demonstrating how progenitor and explosion physics can be constrained.
Very Deep inside the SN 1987A Core Ejecta: Molecular Structures Seen in 3D
International Nuclear Information System (INIS)
Abellán, F. J.; Marcaide, J. M.; Indebetouw, R.; Chevalier, R.; Gabler, M.; Janka, H.-Th.; Fransson, C.; Lundqvist, P.; Spyromilio, J.; Burrows, D. N.; Cigan, P.; Gomez, H. L.; Matsuura, M.; Gaensler, B. M.; Kirshner, R.; Larsson, J.; McCray, R.; Ng, C.-Y.; Park, S.; Roche, P.
2017-01-01
Most massive stars end their lives in core-collapse supernova explosions and enrich the interstellar medium with explosively nucleosynthesized elements. Following core collapse, the explosion is subject to instabilities as the shock propagates outward through the progenitor star. Observations of the composition and structure of the innermost regions of a core-collapse supernova provide a direct probe of the instabilities and nucleosynthetic products. SN 1987A in the Large Magellanic Cloud is one of very few supernovae for which the inner ejecta can be spatially resolved but are not yet strongly affected by interaction with the surroundings. Our observations of SN 1987A with the Atacama Large Millimeter/submillimeter Array are of the highest resolution to date and reveal the detailed morphology of cold molecular gas in the innermost regions of the remnant. The 3D distributions of carbon and silicon monoxide (CO and SiO) emission differ, but both have a central deficit, or torus-like distribution, possibly a result of radioactive heating during the first weeks (“nickel heating”). The size scales of the clumpy distribution are compared quantitatively to models, demonstrating how progenitor and explosion physics can be constrained.
A reconnaissance of the possible donor stars to the Kepler supernova
International Nuclear Information System (INIS)
Kerzendorf, Wolfgang E.; Childress, Michael; Schmidt, Brian P.; Scharwächter, Julia; Do, Tuan
2014-01-01
The identity of Type Ia supernova progenitors remains a mystery, with various lines of evidence pointing toward either accretion from a nondegenerate companion or the rapid merger of two degenerate stars leading to the thermonuclear destruction of a white dwarf. In this paper, we spectroscopically scrutinize 24 of the brightest stars residing in the central 38'' × 38'' of the SN 1604 (Kepler) supernova remnant to search for a possible surviving companion star. We can rule out, with high certainty, a red giant companion star—a progenitor indicated by some models of the supernova remnant. Furthermore, we find no star that exhibits properties uniquely consistent with those expected of a donor star down to L > 10 L ☉ . While the distribution of star properties toward the remnant are consistent with unrelated stars, we identify the most promising candidates for further astrometric and spectroscopic follow up. Such a program would either discover the donor star or place strong limits on progenitor systems to luminosities with L << L ☉ .
VLBI OBSERVATIONS OF THE NEARBY TYPE IIb SUPERNOVA 2011dh
International Nuclear Information System (INIS)
Bietenholz, M. F.; Brunthaler, A.; Soderberg, A. M.; Zauderer, B.; Krauss, M.; Chomiuk, L.; Rupen, M. P.; Bartel, N.
2012-01-01
We report on phase-referenced very long baseline interferometry radio observations of the Type IIb supernova 2011dh, at times t = 83 days and 179 days after the explosion and at frequencies, respectively, of 22.2 and 8.4 GHz. We detected SN 2011dh at both epochs. At the first epoch only an upper limit on SN 2011dh's angular size was obtained, but at the second epoch, we determine the angular radius of SN 2011dh's radio emission to be 0.25 ± 0.08 mas by fitting a spherical shell model directly to the visibility measurements. At a distance of 8.4 Mpc, this angular radius corresponds to a time-averaged (since t = 0) expansion velocity of the forward shock of 21, 000 ± 7000 km s –1 . Our measured values of the radius of the emission region are in excellent agreement with those derived from fitting synchrotron self-absorbed models to the radio spectral energy distribution, providing strong confirmation for the latter method of estimating the radius. We find that SN 2011dh's radius evolves in a power-law fashion, with R∝t 0.92±0.10 .
The End of Days -- Chandra Catches X-ray Glow From Supernova
1999-12-01
Through a combination of serendipity and skill, scientists have used NASA's Chandra X-ray Observatory to capture a rare glimpse of X-radiation from the early phases of a supernova, one of the most violent events in nature. Although more than a thousand supernovas have been observed by optical astronomers, the early X-ray glow from the explosions has been detected in less than a dozen cases. The Chandra observations were made under the direction of a team of scientists from the Massachusetts Institute of Technology (MIT) in Cambridge, led by Walter Lewin and his graduate student, Derek Fox. When combined with simultaneous observations by radio and optical telescopes, the X-ray observations tell about the thickness of the shell that was blown off, its density, its speed, and how much material was shed by the star before it exploded. Chandra observed an X-ray glow from SN1999em with the total power of 50,000 suns. Ten days later it observed the supernova for another nine hours, and found that the X rays had faded to half their previous intensity. The optical luminosity, which had the brightness of 200 million suns, had faded somewhat less. No radio emission was detected at any time. With this information, the MIT group and their colleagues are already piecing together a picture of the catastrophic explosion. Observations by optical astronomers showed that SN1999em was a Type II supernova produced by the collapse of the core of a star ten or more times as massive as the Sun. The intense heat generated in the collapse produces a cataclysmic rebound that sends high speed debris flying outward at speeds in excess of 20 million miles per hour. The debris crashes into matter shed by the former star before the explosion. This awesome collision generates shock waves that heat expanding debris to three million degrees. The X-ray glow from this hot gas was detected by Chandra and gives astrophysicists a better understanding of the dynamics of the explosion, as well as the
THE EARLIEST NEAR-INFRARED TIME-SERIES SPECTROSCOPY OF A TYPE Ia SUPERNOVA
Energy Technology Data Exchange (ETDEWEB)
Hsiao, E. Y.; Phillips, M. M.; Morrell, N.; Contreras, C.; Roth, M. [Carnegie Observatories, Las Campanas Observatory, Colina El Pino, Casilla 601 (Chile); Marion, G. H.; Kirshner, R. P. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Burns, C. R.; Freedman, W. L.; Persson, S. E. [Carnegie Observatories, 813 Santa Barbara St, Pasadena, CA 91101 (United States); Winge, C. [Gemini South Observatory, c/o AURA Inc., Casilla 603, La Serena (Chile); Kromer, M.; Gall, E. E. E. [Max-Planck-Institut fuer Astrophysik, Karl-Schwarzschild-Str. 1, D-85741 Garching bei Muenchen (Germany); Gerardy, C. L.; Hoeflich, P. [Department of Physics, Florida State University, Tallahassee, FL 32306 (United States); Im, M.; Jeon, Y. [CEOU/Astronomy Program, Department of Physics and Astronomy, Seoul National University, Seoul (Korea, Republic of); Nugent, P. E. [Computational Cosmology Center, Computational Research Division, Lawrence Berkeley National Laboratory, 1 Cyclotron Road MS 50B-4206, Berkeley, CA 94611 (United States); Pignata, G. [Departamento de Ciencias Fisicas, Universidad Andres Bello, Avda. Republica 252, Santiago (Chile); Stanishev, V., E-mail: hsiao@lco.cl [CENTRA - Centro Multidisciplinar de Astrofisica, Instituto Superior Tecnico, Av. Rovisco Pais 1, 1049-001 Lisbon (Portugal); and others
2013-04-01
We present ten medium-resolution, high signal-to-noise ratio near-infrared (NIR) spectra of SN 2011fe from SpeX on the NASA Infrared Telescope Facility (IRTF) and Gemini Near-Infrared Spectrograph (GNIRS) on Gemini North, obtained as part of the Carnegie Supernova Project. This data set constitutes the earliest time-series NIR spectroscopy of a Type Ia supernova (SN Ia), with the first spectrum obtained at 2.58 days past the explosion and covering -14.6 to +17.3 days relative to B-band maximum. C I {lambda}1.0693 {mu}m is detected in SN 2011fe with increasing strength up to maximum light. The delay in the onset of the NIR C I line demonstrates its potential to be an effective tracer of unprocessed material. For the first time in a SN Ia, the early rapid decline of the Mg II {lambda}1.0927 {mu}m velocity was observed, and the subsequent velocity is remarkably constant. The Mg II velocity during this constant phase locates the inner edge of carbon burning and probes the conditions under which the transition from deflagration to detonation occurs. We show that the Mg II velocity does not correlate with the optical light-curve decline rate {Delta}m{sub 15}(B). The prominent break at {approx}1.5 {mu}m is the main source of concern for NIR k-correction calculations. We demonstrate here that the feature has a uniform time evolution among SNe Ia, with the flux ratio across the break strongly correlated with {Delta}m{sub 15}(B). The predictability of the strength and the onset of this feature suggests that the associated k-correction uncertainties can be minimized with improved spectral templates.
Structural characteristics and elevated temperature mechanical properties of AJ62 Mg alloy
Energy Technology Data Exchange (ETDEWEB)
Kubásek, J., E-mail: Jiri.Kubasek@vscht.cz; Vojtěch, D.; Martínek, M.
2013-12-15
Structure and mechanical properties of the novel casting AJ62 (Mg–6Al–2Sr) alloy developed for elevated temperature applications were studied. The AJ62 alloy was compared to commercial casting AZ91 (Mg–9Al–1Zn) and WE43 (Mg–4Y–3RE) alloys. The structure was examined by scanning electron microscopy, x-ray diffraction and energy dispersive spectrometry. Mechanical properties were characterized by Viskers hardness measurements in the as-cast state and after a long-term heat treatment at 250 °C/150 hours. Compressive mechanical tests were also carried out both at room and elevated temperatures. Compressive creep tests were conducted at a temperature of 250 °C and compressive stresses of 60, 100 and 140 MPa. The structure of the AJ62 alloy consisted of primary α-Mg dendrites and interdendritic nework of the Al{sub 4}Sr and massive Al{sub 3}Mg{sub 13}Sr phases. By increasing the cooling rate during solidification from 10 and 120 K/s the average dendrite arm thickness decreased from 18 to 5 μm and the total volume fraction of the interdendritic phases from 20% to 30%. Both factors slightly increased hardness and compressive strength. The room temperature compressive strength and hardness of the alloy solidified at 30 K/s were 298 MPa and 50 HV 5, i.e. similar to those of the as-cast WE43 alloy and lower than those of the AZ91 alloy. At 250 °C the compressive strength of the AJ62 alloy decreased by 50 MPa, whereas those of the AZ91 and WE43 alloys by 100 and 20 MPa, respectively. The creep rate of the AJ62 alloy was higher than that of the WE43 alloy, but significantly lower in comparison with the AZ91 alloy. Different thermal stabilities of the alloys were discussed and related to structural changes during elevated temperature expositions. - Highlights: • Small effect of cooling rate on the compressive strength and hardness of AJ 62 • A bit lower compressive strength of AJ 62 compared to AZ91 at room temperature • Higher resistance of the AJ 62
Intensive Monitoring Survey of Nearby Galaxies (IMSNG): Catching Early Light Curves of Supernovae
Im, Myungshin; IMSNG Team
2018-01-01
SNe light curves have been used to study the expansion history of the universe, and a lot of efforts have gone into understanding the overall shape of the radioactively powered light curve. However, we still have little direct observational evidence for the theorized SN progenitor systems. Recent studies suggest that the light curve of a supernova shortly after its explosion (world. Through this survey, we expect to catch the very early precursor emission as faint as R=21 mag (~0.1 Rsun for the progenitor). This poster outlines this project, and present a few scientific highlights, such as the early light curve of SN 2015F in NGC 2442.
Data of evolutionary structure change: 1AJ9A-2ZLWD [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1AJ9A-2ZLWD 1AJ9 2ZLW A D -VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPT...R VQLSGEEKAAVLALWDKVN--EEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL... 2ZLW D 2ZLWD
The Final Stages of Massive Star Evolution and Their Supernovae
Heger, Alexander
In this chapter I discuss the final stages in the evolution of massive stars - stars that are massive enough to burn nuclear fuel all the way to iron group elements in their core. The core eventually collapses to form a neutron star or a black hole when electron captures and photo-disintegration reduce the pressure support to an extent that it no longer can hold up against gravity. The late burning stages of massive stars are a rich subject by themselves, and in them many of the heavy elements in the universe are first generated. The late evolution of massive stars strongly depends on their mass, and hence can be significantly effected by mass loss due to stellar winds and episodic mass loss events - a critical ingredient that we do not know as well as we would like. If the star loses all the hydrogen envelope, a Type I supernova results, if it does not, a Type II supernova is observed. Whether the star makes neutron star or a black hole, or a neutron star at first and a black hole later, and how fast they spin largely affects the energetics and asymmetry of the observed supernova explosion. Beyond photon-based astronomy, other than the sun, a supernova (SN 1987) has been the only object in the sky we ever observed in neutrinos, and supernovae may also be the first thing we will ever see in gravitational wave detectors like LIGO. I conclude this chapter reviewing the deaths of the most massive stars and of Population III stars.
Methodological studies on the search for Gravitational Waves and Neutrinos from Type II Supernovae
International Nuclear Information System (INIS)
Casentini, Claudio
2016-01-01
Type II SNe, also called Core-collapse SuperNovae have a neutrino (v) emission, as confirmed by SN 1987A, and are also potential sources of gravitational waves. Neutrinos and gravitational waves from these sources reach Earth almost contemporaneously and without relevant interaction with stellar matter and interstellar medium. The upcoming advanced gravitational interferometers would be sensitive enough to detect gravitational waves signals from close galactic Core-collapse SuperNovae events. Nevertheless, significant uncertainties on theoretical models of emission remain. A joint search of coincident low energy neutrinos and gravitational waves events from these sources would bring valuable information from the inner core of the collapsing star and would enhance the detection of the so-called Silent SuperNovae. Recently a project for a joint search involving gravitational wave interferometers and neutrino detectors has started. We discuss the benefits of a joint search and the status of the search project. (paper)
Hot Dust! Late-Time Infrared Emission From Supernovae
Fox, Ori; Skrutskie, M. F.; Chevalier, R. A.
2010-01-01
Supernovae light curves typically peak and fade in the course of several months. Some supernovae , however, exhibit late-time infrared emission that in some cases can last for several years. These supernovae tend to be of the Type IIn subclass, which is defined by narrow hydrogen and helium emission lines arising from a dense, pre-existing circumstellar medium excited by the supernova radiation. Such a late-time ``IR excess'' with respect to the optical blackbody counterpart typically indicates the presence of warm dust. The origin and heating mechanism of the dust is not, however, always well constrained. In this talk, I will explore several scenarios that explain the observed late-time emission. In particular, I will discuss the case of the Type IIn SN 2005ip, which has displayed an ``IR excess'' for over 3 years. The results allow us to interpret the progenitor system and better understand the late stages of stellar evolution. Much of the data used for this analysis were obtained with TripleSpec, a medium-resolution near-infrared spectrograph located at Apache Point Observatory, NM, and FanCam, a JHK imager located at Fan Mountain Observatory, just outside of Charlottesville, VA. These two instruments were designed, fabricated, built, and commissioned by our instrumentation group at the University of Virginia. I will also spend some time discussing these instruments. I would like to thank the following for financial support of this work throughout my graduate career: NASA GSRP, NSF AAG-0607737, Spitzer PID 50256, Achievement Reward for College Scientists (ARCS), and the Virginia Space Grant Consortium.
Measuring Cosmological Parameters with Photometrically Classified Pan-STARRS Supernovae
Jones, David; Scolnic, Daniel; Riess, Adam; Rest, Armin; Kirshner, Robert; Berger, Edo; Kessler, Rick; Pan, Yen-Chen; Foley, Ryan; Chornock, Ryan; Ortega, Carolyn; Challis, Peter; Burgett, William; Chambers, Kenneth; Draper, Peter; Flewelling, Heather; Huber, Mark; Kaiser, Nick; Kudritzki, Rolf; Metcalfe, Nigel; Tonry, John; Wainscoat, Richard J.; Waters, Chris; Gall, E. E. E.; Kotak, Rubina; McCrum, Matt; Smartt, Stephen; Smith, Ken
2018-01-01
We use nearly 1,200 supernovae (SNe) from Pan-STARRS and ~200 low-z (z energy equation of state parameter w to be -0.986±0.058 (stat+sys). If we allow w to evolve with redshift as w(a) = w0 + wa(1-a), we find w0 = -0.923±0.148 and wa = -0.404±0.797. These results are consistent with measurements of cosmological parameters from the JLA and from a new analysis of 1049 spectroscopically confirmed SNe Ia (Scolnic et al. 2017). We try four different photometric classification priors for Pan-STARRS SNe and two alternate ways of modeling the CC SN contamination, finding that none of these variants gives a w that differs by more than 1% from the baseline measurement. The systematic uncertainty on w due to marginalizing over the CC SN contamination, σwCC = 0.019, is approximately equal to the photometric calibration uncertainty and is lower than the systematic uncertainty in the SN\\,Ia dispersion model (σwdisp = 0.024). Our data provide one of the best current constraints on w, demonstrating that samples with ~5% CC SN contamination can give competitive cosmological constraints when the contaminating distribution is marginalized over in a Bayesian framework.
The sloan digital sky Survey-II supernova survey: search algorithm and follow-up observations
Energy Technology Data Exchange (ETDEWEB)
Sako, Masao [Department of Physics and Astronomy, University of Pennsylvania, 209 South 33rd Street, Philadelphia, PA 19104 (United States); Bassett, Bruce [Department of Mathematics and Applied Mathematics, University of Cape Town, Rondebosch 7701 (South Africa); Becker, Andrew; Hogan, Craig J. [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States); Cinabro, David [Department of Physics, Wayne State University, Detroit, MI 48202 (United States); DeJongh, Fritz; Frieman, Joshua A.; Marriner, John; Miknaitis, Gajus [Center for Particle Astrophysics, Fermi National Accelerator Laboratory, P.O. Box 500, Batavia, IL 60510 (United States); Depoy, D. L.; Prieto, Jose Luis [Department of Astronomy, Ohio State University, 140 West 18th Avenue, Columbus, OH 43210-1173 (United States); Dilday, Ben; Kessler, Richard [Kavli Institute for Cosmological Physics, The University of Chicago, 5640 South Ellis Avenue Chicago, IL 60637 (United States); Doi, Mamoru [Institute of Astronomy, Graduate School of Science, University of Tokyo 2-21-1, Osawa, Mitaka, Tokyo 181-0015 (Japan); Garnavich, Peter M. [University of Notre Dame, 225 Nieuwland Science, Notre Dame, IN 46556-5670 (United States); Holtzman, Jon [Department of Astronomy, MSC 4500, New Mexico State University, P.O. Box 30001, Las Cruces, NM 88003 (United States); Jha, Saurabh [Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, P.O. Box 20450, MS29, Stanford, CA 94309 (United States); Konishi, Kohki [Institute for Cosmic Ray Research, University of Tokyo, 5-1-5, Kashiwanoha, Kashiwa, Chiba, 277-8582 (Japan); Lampeitl, Hubert [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Nichol, Robert C. [Institute of Cosmology and Gravitation, Mercantile House, Hampshire Terrace, University of Portsmouth, Portsmouth PO1 2EG (United Kingdom); and others
2008-01-01
The Sloan Digital Sky Survey-II Supernova Survey has identified a large number of new transient sources in a 300 deg{sup 2} region along the celestial equator during its first two seasons of a three-season campaign. Multi-band (ugriz) light curves were measured for most of the sources, which include solar system objects, galactic variable stars, active galactic nuclei, supernovae (SNe), and other astronomical transients. The imaging survey is augmented by an extensive spectroscopic follow-up program to identify SNe, measure their redshifts, and study the physical conditions of the explosions and their environment through spectroscopic diagnostics. During the survey, light curves are rapidly evaluated to provide an initial photometric type of the SNe, and a selected sample of sources are targeted for spectroscopic observations. In the first two seasons, 476 sources were selected for spectroscopic observations, of which 403 were identified as SNe. For the type Ia SNe, the main driver for the survey, our photometric typing and targeting efficiency is 90%. Only 6% of the photometric SN Ia candidates were spectroscopically classified as non-SN Ia instead, and the remaining 4% resulted in low signal-to-noise, unclassified spectra. This paper describes the search algorithm and the software, and the real-time processing of the SDSS imaging data. We also present the details of the supernova candidate selection procedures and strategies for follow-up spectroscopic and imaging observations of the discovered sources.
The Sloan Digital Sky Survey-II Supernova Survey:Search Algorithm and Follow-up Observations
Energy Technology Data Exchange (ETDEWEB)
Sako, Masao; /Pennsylvania U. /KIPAC, Menlo Park; Bassett, Bruce; /Cape Town U. /South African Astron. Observ.; Becker, Andrew; /Washington U., Seattle, Astron. Dept.; Cinabro, David; /Wayne State U.; DeJongh, Don Frederic; /Fermilab; Depoy, D.L.; /Ohio State U.; Doi, Mamoru; /Tokyo U.; Garnavich, Peter M.; /Notre Dame U.; Craig, Hogan, J.; /Washington U., Seattle, Astron. Dept.; Holtzman, Jon; /New Mexico State U.; Jha, Saurabh; /Stanford U., Phys. Dept.; Konishi, Kohki; /Tokyo U.; Lampeitl, Hubert; /Baltimore, Space; Marriner, John; /Fermilab; Miknaitis, Gajus; /Fermilab; Nichol, Robert C.; /Portsmouth U.; Prieto, Jose Luis; /Ohio State U.; Richmond, Michael W.; /Rochester Inst.; Schneider, Donald P.; /Penn State U., Astron. Astrophys.; Smith, Mathew; /Portsmouth U.; SubbaRao, Mark; /Chicago U. /Tokyo U. /Tokyo U. /South African Astron. Observ. /Tokyo
2007-09-14
The Sloan Digital Sky Survey-II Supernova Survey has identified a large number of new transient sources in a 300 deg2 region along the celestial equator during its first two seasons of a three-season campaign. Multi-band (ugriz) light curves were measured for most of the sources, which include solar system objects, Galactic variable stars, active galactic nuclei, supernovae (SNe), and other astronomical transients. The imaging survey is augmented by an extensive spectroscopic follow-up program to identify SNe, measure their redshifts, and study the physical conditions of the explosions and their environment through spectroscopic diagnostics. During the survey, light curves are rapidly evaluated to provide an initial photometric type of the SNe, and a selected sample of sources are targeted for spectroscopic observations. In the first two seasons, 476 sources were selected for spectroscopic observations, of which 403 were identified as SNe. For the Type Ia SNe, the main driver for the Survey, our photometric typing and targeting efficiency is 90%. Only 6% of the photometric SN Ia candidates were spectroscopically classified as non-SN Ia instead, and the remaining 4% resulted in low signal-to-noise, unclassified spectra. This paper describes the search algorithm and the software, and the real-time processing of the SDSS imaging data. We also present the details of the supernova candidate selection procedures and strategies for follow-up spectroscopic and imaging observations of the discovered sources.
THE SPECTROSCOPIC DIVERSITY OF TYPE Ia SUPERNOVAE
International Nuclear Information System (INIS)
Blondin, S.; Matheson, T.; Kirshner, R. P.; Mandel, K. S.; Challis, P.; Berlind, P.; Calkins, M.; Garnavich, P. M.; Jha, S. W.; Modjaz, M.; Riess, A. G.; Schmidt, B. P.
2012-01-01
We present 2603 spectra of 462 nearby Type Ia supernovae (SNe Ia), including 2065 previously unpublished spectra, obtained during 1993-2008 through the Center for Astrophysics Supernova Program. There are on average eight spectra for each of the 313 SNe Ia with at least two spectra. Most of the spectra were obtained with the FAST spectrograph at the Fred Lawrence Whipple Observatory 1.5 m telescope and reduced in a consistent manner, making this data set well suited for studies of SN Ia spectroscopic diversity. Using additional data from the literature, we study the spectroscopic and photometric properties of SNe Ia as a function of spectroscopic class using the classification schemes of Branch et al. and Wang et al. The width-luminosity relation appears to be steeper for SNe Ia with broader lines, although the result is not statistically significant with the present sample. Based on the evolution of the characteristic Si II λ6355 line, we propose improved methods for measuring velocity gradients, revealing a larger range than previously suspected, from ∼0 to ∼400 km s −1 day −1 considering the instantaneous velocity decline rate at maximum light. We find a weaker and less significant correlation between Si II velocity and intrinsic B – V color at maximum light than reported by Foley et al., owing to a more comprehensive treatment of uncertainties and host galaxy dust. We study the extent of nuclear burning and the presence of unburnt carbon in the outermost layers of the ejecta and report new detections of C II λ6580 in 23 early-time SN Ia spectra. The frequency of C II detections is not higher in SNe Ia with bluer colors or narrower light curves, in conflict with the recent results of Thomas et al. Based on nebular spectra of 27 SNe Ia, we find no relation between the FWHM of the iron emission feature at ∼4700 Å and Δm 15 (B) after removing the two low-luminosity SN 1986G and SN 1991bg, suggesting that the peak luminosity is not strongly dependent
Energy Technology Data Exchange (ETDEWEB)
Riess, Adam G.; Nugent, Peter E.; Schmidt, Brian P.; Tonry, John; Dickinson, Mark; Gilliland, Ronald L.; Thompson, Rodger I.; Budavari,Tamas; Casertano, Stefano; Evans, Aaron S.; Filippenko, Alexei V.; Livio,Mario; Sanders, David B.; Shapley, Alice E.; Spinrad, Hyron; Steidel,Charles C.; Stern, Daniel; Surace, Jason; Veilleux, Sylvain
2001-04-01
We present photometric observations of an apparent Type Iasupernova (SN Ia) at a redshift of approximately 1.7, the farthest SNobserved to date. The supernova, SN 1997, was discovered in a repeatobservation by the Hubble Space Telescope (HST) of the Hubble DeepField{North (HDF-N), and serendipitously monitored with NICMOS on HSTthroughout the Thompson et al. GTO campaign. The SN type can bedetermined from the host galaxy type: an evolved, red elliptical lackingenough recent star formation to provide a significant population ofcore-collapse supernovae. The classification is further supported bydiagnostics available from the observed colors and temporal behavior ofthe SN, both of which match a typical SN Ia. The photometric record ofthe SN includes a dozen flux measurements in the I, J, and H bandsspanning 35 days in the observed frame. The redshift derived from the SNphotometry, z = 1:7 plus or minus 0:1, is in excellent agreement with theredshift estimate of z = 1:65 plus or minus 0:15 derived from the U_300B_450 V_-606 I_814 J_110 J_125 H_160 H_165 K_s photometry of the galaxy.Optical and near-infrared spectra of the host provide a very tentativespectroscopic redshift of 1.755. Fits to observations of the SN provideconstraints for the redshift-distance relation of SNe Ia and a powerfultest of the current accelerating Universe hypothesis. The apparent SNbrightness is consistent with that expected in the decelerating phase ofthe preferred cosmological model, Omega_M approximately equal to 1/3;Omega_Lambda approximately equal to 2/3. It is inconsistent with greydust or simple luminosity evolution, candidate astrophysical effectswhich could mimic previous evidence for an accelerating Universe from SNeIa at z approximately equal to 0:5. We consider several sources ofpotential systematic error including gravitational lensing, supernovamisclassification, sample selection bias, and luminosity calibrationerrors. Currently, none of these effects alone appears likely
iPTF13bvn: The first evidence of a binary progenitor for a type Ib supernova
Energy Technology Data Exchange (ETDEWEB)
Bersten, Melina C.; Folatelli, Gastón; Nomoto, Ken' ichi; Quimby, Robert [Kavli Institute for the Physics and Mathematics of the Universe (WPI), The University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8583 (Japan); Benvenuto, Omar G. [Facultad de Ciencias Astronómicas y Geofísicas, Universidad Nacional de La Plata, Paseo del Bosque S/N, B1900FWA La Plata (Argentina); Kuncarayakti, Hanindyo [Millennium Institute of Astrophysics, Casilla 36-D, Santiago (Chile); Srivastav, Shubham; Anupama, G. C.; Sahu, Devendra K., E-mail: melina.bersten@ipmu.jp [Indian Institute of Astrophysics, Koramangala, Bangalore 560034 (India)
2014-10-01
The recent detection in archival Hubble Space Telescope images of an object at the location of supernova (SN) iPTF13bvn may represent the first direct evidence of the progenitor of a Type Ib SN. The object's photometry was found to be compatible with a Wolf-Rayet pre-SN star mass of ≈11 M {sub ☉}. However, based on hydrodynamical models, we show that the progenitor had a pre-SN mass of ≈3.5 M {sub ☉} and that it could not be larger than ≈8 M {sub ☉}. We propose an interacting binary system as the SN progenitor and perform evolutionary calculations that are able to self-consistently explain the light curve shape, the absence of hydrogen, and the pre-SN photometry. We further discuss the range of allowed binary systems and predict that the remaining companion is a luminous O-type star of significantly lower flux in the optical than the pre-SN object. A future detection of such a star may be possible and would provide the first robust identification of a progenitor system for a Type Ib SN.
Detection of Supernova Neutrinos on the Earth for Large θ13
Xu, Jing; Huang, Ming-Yang; Hu, Li-Jun; Guo, Xin-Heng; Young, Bing-Lin
2014-02-01
Supernova (SN) neutrinos detected on the Earth are subject to the shock wave effects, the Mikheyev—Smirnov—Wolfenstein (MSW) effects, the neutrino collective effects and the Earth matter effects. Considering the recent experimental result about the large mixing angle θ13 (≃ 8.8°) provided by the Daya Bay Collaboration and applying the available knowledge for the neutrino conversion probability in the high resonance region of SN, PH, which is in the form of hypergeometric function in the case of large θ13, we deduce the expression of PH taking into account the shock wave effects. It is found that PH is not zero in a certain range of time due to the shock wave effects. After considering all the four physical effects and scanning relevant parameters, we calculate the event numbers of SN neutrinos for the “Garching” distribution of neutrino energy spectrum. From the numerical results, it is found that the behaviors of neutrino event numbers detected on the Earth depend on the neutrino mass hierarchy and neutrino spectrum parameters including the dimensionless pinching parameter βα (where α refers to neutrino flavor), the average energy , and the SN neutrino luminosities Lα. Finally, we give the ranges of SN neutrino event numbers that will be detected at the Daya Bay experiment.
How supernovae launch galactic winds?
Fielding, Drummond; Quataert, Eliot; Martizzi, Davide; Faucher-Giguère, Claude-André
2017-09-01
We use idealized three-dimensional hydrodynamic simulations of global galactic discs to study the launching of galactic winds by supernovae (SNe). The simulations resolve the cooling radii of the majority of supernova remnants (SNRs) and thus self-consistently capture how SNe drive galactic winds. We find that SNe launch highly supersonic winds with properties that agree reasonably well with expectations from analytic models. The energy loading (η _E= \\dot{E}_wind/ \\dot{E}_SN) of the winds in our simulations are well converged with spatial resolution while the wind mass loading (η _M= \\dot{M}_wind/\\dot{M}_\\star) decreases with resolution at the resolutions we achieve. We present a simple analytic model based on the concept that SNRs with cooling radii greater than the local scaleheight break out of the disc and power the wind. This model successfully explains the dependence (or lack thereof) of ηE (and by extension ηM) on the gas surface density, star formation efficiency, disc radius and the clustering of SNe. The winds our simulations are weaker than expected in reality, likely due to the fact that we seed SNe preferentially at density peaks. Clustering SNe in time and space substantially increases the wind power.
PSN J11290437+1714095 is a Type Ia supernova (91T-like) near maximum light
Childress, M.; Owen, C.; Scalzo, R.; Yuan, F.; Schmidt, B.; Tucker, B.
2013-12-01
We report spectroscopic classification of PSN J11290437+1714095 with the Wide Field Spectrograph (WiFeS - Dopita et al., 2007, ApSS, 310, 255) on the ANU 2.3m telescope at Siding Spring Observatory, NSW Australia, using the B3000/R3000 gratings (3500-9800 A, 1 A resolution). PSN J11290437+1714095 was discovered by TAROT on 2013 Dec 11.09 at mag 15.9 in UGC 6483. A 20 minute spectrum of the SN on 2013 Dec 12.72 shows this to be a Type Ia supernova of the SN 1991T subclass near maximum light.
TYPE II-P SUPERNOVAE FROM THE SDSS-II SUPERNOVA SURVEY AND THE STANDARDIZED CANDLE METHOD
International Nuclear Information System (INIS)
D'Andrea, Chris B.; Sako, Masao; Dilday, Benjamin; Jha, Saurabh; Frieman, Joshua A.; Kessler, Richard; Holtzman, Jon; Konishi, Kohki; Yasuda, Naoki; Schneider, D. P.; Sollerman, Jesper; Wheeler, J. Craig; Cinabro, David; Nichol, Robert C.; Lampeitl, Hubert; Smith, Mathew; Atlee, David W.; Bassett, Bruce; Castander, Francisco J.; Goobar, Ariel
2010-01-01
We apply the Standardized Candle Method (SCM) for Type II Plateau supernovae (SNe II-P), which relates the velocity of the ejecta of a SN to its luminosity during the plateau, to 15 SNe II-P discovered over the three season run of the Sloan Digital Sky Survey-II Supernova Survey. The redshifts of these SNe-0.027 0.01) as all of the current literature on the SCM combined. We find that the SDSS SNe have a very small intrinsic I-band dispersion (0.22 mag), which can be attributed to selection effects. When the SCM is applied to the combined SDSS-plus-literature set of SNe II-P, the dispersion increases to 0.29 mag, larger than the scatter for either set of SNe separately. We show that the standardization cannot be further improved by eliminating SNe with positive plateau decline rates, as proposed in Poznanski et al. We thoroughly examine all potential systematic effects and conclude that for the SCM to be useful for cosmology, the methods currently used to determine the Fe II velocity at day 50 must be improved, and spectral templates able to encompass the intrinsic variations of Type II-P SNe will be needed.
Type-Ia Supernova Rates and the Progenitor Problem: A Review
Maoz, D.; Mannucci, F.
2012-01-01
The identity of the progenitor systems of type-Ia supernovae (SNe Ia) is a major unsolved problem in astrophysics. SN Ia rates are providing some striking clues. We review the basics of SN rate measurement, preach about some sins of SN rate measurement and analysis, and illustrate one of these sins with an analogy about Martian scientists. We review the recent progress in measuring SN Ia rates in various environments and redshifts, and their use to reconstruct the SN Ia delay-time distribution (DTD) - the SN rate versus time that would follow a hypothetical brief burst of star formation. A good number of DTD measurements, using a variety of methods, appear to be converging. At delays 1measurements show a similar, ~t-1, power-law shape. The DTD peaks at the shortest delays probed. This result supports the idea of a double-degenerate progenitor origin for SNe Ia. Single-degenerate progenitors may still play a role in producing short-delay SNe Ia, or perhaps all SNe Ia, if the red-giant donor channel is more efficient than is found by most theoretical models. The DTD normalization enjoys fairly good agreement (though perhaps some tension), among the various measurements, with a Hubble time-integrated DTD value of about 2+/-1 SNe Ia per 1000Msolar (stellar mass formed with a low-mass turnover initial mass function). The local WD binary population suggests that the WD merger rate can explain the Galactic SN Ia rate, but only if sub-Chandra mergers lead to SN Ia events. We point to some future directions that should lead to progress in the field, including measurement of the bivariate (delay and stretch) SN Ia response function.
Spectral Time Series of the Cas A Supernova
Rest, Armin
2016-10-01
We propose to obtain time-resolved spectroscopy of the outburst of the enigmatic historical supernova Cas A using STIS spectroscopy of light scattered by a narrow filament of interstellar dust. Our group has identified recent, high-surface brightness filaments that are likely to provide high signal-to-noise reproduction of the evolving spectrum of the Cas A outburst using verified, published techniques developed by us.The timescales to see any appreciable evolution in individual astrophysical objects are typically many orders of magnitudes larger than a human life. As a result, astronomers study large numbers of objects at different stages of their evolution to connect how a single object should change with time. Cas A can provide us with the ability, to look back in time to the point of explosion by observing its light echoes - SN light scattered off of dust in the Milky Way, which causes a time delay in reaching us. In obtaining spectra of light echoes, we have been able to determine the maximum-light characteristics of the SN. Our goal here is to obtain a single STIS spectrum of a bright Cas A LE, which will provide us a time series of spectra and a spatially resolved light curve of the Cas A SN. With these data, we will measure the properties of the cooling envelope after the shock breakout of the SN to estimate the radius of the progenitor star. We will then be able to connect the progenitor star to the explosion to the SN to the SNR.
LINKING TYPE Ia SUPERNOVA PROGENITORS AND THEIR RESULTING EXPLOSIONS
International Nuclear Information System (INIS)
Foley, Ryan J.; Kirshner, Robert P.; Simon, Joshua D.; Burns, Christopher R.; Gal-Yam, Avishay; Hamuy, Mario; Morrell, Nidia I.; Phillips, Mark M.; Shields, Gregory A.; Sternberg, Assaf
2012-01-01
Comparing the ejecta velocities at maximum brightness and narrow circumstellar/interstellar Na D absorption line profiles of a sample of 23 Type Ia supernovae (SNe Ia), we determine that the properties of SN Ia progenitor systems and explosions are intimately connected. As demonstrated by Sternberg et al., half of all SNe Ia with detectable Na D absorption at the host-galaxy redshift in high-resolution spectroscopy have Na D line profiles with significant blueshifted absorption relative to the strongest absorption component, which indicates that a large fraction of SN Ia progenitor systems have strong outflows. In this study, we find that SNe Ia with blueshifted circumstellar/interstellar absorption systematically have higher ejecta velocities and redder colors at maximum brightness relative to the rest of the SN Ia population. This result is robust at a 98.9%-99.8% confidence level, providing the first link between the progenitor systems and properties of the explosion. This finding is further evidence that the outflow scenario is the correct interpretation of the blueshifted Na D absorption, adding additional confirmation that some SNe Ia are produced from a single-degenerate progenitor channel. An additional implication is that either SN Ia progenitor systems have highly asymmetric outflows that are also aligned with the SN explosion or SNe Ia come from a variety of progenitor systems where SNe Ia from systems with strong outflows tend to have more kinetic energy per unit mass than those from systems with weak or no outflows.
NEUTRONIZATION DURING CARBON SIMMERING IN TYPE IA SUPERNOVA PROGENITORS
Energy Technology Data Exchange (ETDEWEB)
Martínez-Rodríguez, Héctor; Badenes, Carles [Department of Physics and Astronomy and Pittsburgh Particle Physics, Astrophysics and Cosmology Center (PITT PACC), University of Pittsburgh, 3941 O’Hara Street, Pittsburgh, PA 15260 (United States); Piro, Anthony L. [Carnegie Observatories, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Schwab, Josiah, E-mail: hector.mr@pitt.edu [Department of Physics, University of California, Berkeley, CA 94720 (United States)
2016-07-01
When a Type Ia supernova (SN Ia) progenitor first ignites carbon in its core, it undergoes ∼10{sup 3}–10{sup 4} years of convective burning prior to the onset of thermonuclear runaway. This carbon simmering phase is important for setting the thermal profile and composition of the white dwarf. Using the MESA stellar evolution code, we follow this convective burning and examine the production of neutron-rich isotopes. The neutron content of the SN fuel has important consequences for the ensuing nucleosynthesis, and in particular, for the production of secondary Fe-peak nuclei like Mn and stable Ni. These elements have been observed in the X-ray spectra of SN remnants like Tycho, Kepler, and 3C 397, and their yields can provide valuable insights into the physics of SNe Ia and the properties of their progenitors. We find that weak reactions during simmering can at most generate a neutron excess of ≈ 3 × 10{sup −4}. This is ≈ 70% lower than that found in previous studies that do not take the full density and temperature profile of the simmering region into account. Our results imply that the progenitor metallicity is the main contributor to the neutron excess in SN Ia fuel for Z ≳ 1/3 Z {sub ⊙}. Alternatively, at lower metallicities, this neutron excess provides a floor that should be present in any centrally-ignited SN Ia scenario.
NEUTRONIZATION DURING CARBON SIMMERING IN TYPE IA SUPERNOVA PROGENITORS
International Nuclear Information System (INIS)
Martínez-Rodríguez, Héctor; Badenes, Carles; Piro, Anthony L.; Schwab, Josiah
2016-01-01
When a Type Ia supernova (SN Ia) progenitor first ignites carbon in its core, it undergoes ∼10 3 –10 4 years of convective burning prior to the onset of thermonuclear runaway. This carbon simmering phase is important for setting the thermal profile and composition of the white dwarf. Using the MESA stellar evolution code, we follow this convective burning and examine the production of neutron-rich isotopes. The neutron content of the SN fuel has important consequences for the ensuing nucleosynthesis, and in particular, for the production of secondary Fe-peak nuclei like Mn and stable Ni. These elements have been observed in the X-ray spectra of SN remnants like Tycho, Kepler, and 3C 397, and their yields can provide valuable insights into the physics of SNe Ia and the properties of their progenitors. We find that weak reactions during simmering can at most generate a neutron excess of ≈ 3 × 10 −4 . This is ≈ 70% lower than that found in previous studies that do not take the full density and temperature profile of the simmering region into account. Our results imply that the progenitor metallicity is the main contributor to the neutron excess in SN Ia fuel for Z ≳ 1/3 Z ⊙ . Alternatively, at lower metallicities, this neutron excess provides a floor that should be present in any centrally-ignited SN Ia scenario.
Energy Technology Data Exchange (ETDEWEB)
Sanders, N. E.; Soderberg, A. M.; Foley, R. J.; Chornock, R.; Milisavljevic, D.; Margutti, R.; Drout, M. R.; Moe, M.; Berger, E.; Brown, W. R.; Lunnan, R. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Smartt, S. J.; Fraser, M.; Kotak, R.; Magill, L.; Smith, K. W.; Wright, D. [Astrophysics Research Centre, School of Maths and Physics, Queens University, Belfast BT7 1NN (United Kingdom); Huang, K. [Academia Sinica Institute of Astronomy and Astrophysics, Taipei 106, Taiwan (China); Urata, Y. [Institute of Astronomy, National Central University, Chung-Li 32054, Taiwan (China); Mulchaey, J. S., E-mail: nsanders@cfa.harvard.edu [Carnegie Observatories, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); and others
2013-05-20
We report on our discovery and observations of the Pan-STARRS1 supernova (SN) PS1-12sk, a transient with properties that indicate atypical star formation in its host galaxy cluster or pose a challenge to popular progenitor system models for this class of explosion. The optical spectra of PS1-12sk classify it as a Type Ibn SN (SN Ibn; cf. SN 2006jc), dominated by intermediate-width (3 Multiplication-Sign 10{sup 3} km s{sup -1}) and time variable He I emission. Our multi-wavelength monitoring establishes the rise time dt {approx} 9-23 days and shows an NUV-NIR spectral energy distribution with temperature {approx}> 17 Multiplication-Sign 10{sup 3} K and a peak magnitude of M{sub z} = -18.88 {+-} 0.02 mag. SN Ibn spectroscopic properties are commonly interpreted as the signature of a massive star (17-100 M{sub Sun }) explosion within an He-enriched circumstellar medium. However, unlike previous SNe Ibn, PS1-12sk is associated with an elliptical brightest cluster galaxy, CGCG 208-042 (z = 0.054) in cluster RXC J0844.9+4258. The expected probability of an event like PS1-12sk in such environments is low given the measured infrequency of core-collapse SNe in red-sequence galaxies compounded by the low volumetric rate of SN Ibn. Furthermore, we find no evidence of star formation at the explosion site to sensitive limits ({Sigma}{sub H{alpha}} {approx}< 2 Multiplication-Sign 10{sup -3} M{sub Sun} yr{sup -1} kpc{sup -2}). We therefore discuss white dwarf binary systems as a possible progenitor channel for SNe Ibn. We conclude that PS1-12sk represents either a fortuitous and statistically unlikely discovery, evidence for a top-heavy initial mass function in galaxy cluster cooling flow filaments, or the first clue suggesting an alternate progenitor channel for SNe Ibn.
SN 2008D: A WOLF-RAYET EXPLOSION THROUGH A THICK WIND
International Nuclear Information System (INIS)
Svirski, Gilad; Nakar, Ehud
2014-01-01
Supernova (SN) 2008D/XRT 080109 is considered to be the only direct detection of a shock breakout from a regular SN to date. While a breakout interpretation was favored by several papers, inconsistencies remain between the observations and current SN shock breakout theory. Most notably, the duration of the luminous X-ray pulse is considerably longer than expected for a spherical breakout through the surface of a type Ibc SN progenitor, and the X-ray radiation features, mainly its flat spectrum and its luminosity evolution, are enigmatic. We apply a recently developed theoretical model for the observed radiation from a Wolf-Rayet SN exploding through a thick wind and show that it naturally explains all of the observed features of SN 2008D X-ray emission, including the energetics, the spectrum, and the detailed luminosity evolution. We find that the inferred progenitor and SN parameters are typical for an exploding Wolf-Rayet. A comparison of the wind density found at the breakout radius and the density at much larger radii, as inferred by late radio observations, suggests an enhanced mass-loss rate taking effect about 10 days prior to the SN explosion. This finding joins accumulating evidence for a possible late phase in the stellar evolution of massive stars, involving vigorous mass loss a short time before the SN explosion
SN 2008D: A WOLF-RAYET EXPLOSION THROUGH A THICK WIND
Energy Technology Data Exchange (ETDEWEB)
Svirski, Gilad; Nakar, Ehud [Raymond and Beverly Sackler School of Physics and Astronomy, Tel Aviv University, Tel Aviv 69978 (Israel)
2014-06-10
Supernova (SN) 2008D/XRT 080109 is considered to be the only direct detection of a shock breakout from a regular SN to date. While a breakout interpretation was favored by several papers, inconsistencies remain between the observations and current SN shock breakout theory. Most notably, the duration of the luminous X-ray pulse is considerably longer than expected for a spherical breakout through the surface of a type Ibc SN progenitor, and the X-ray radiation features, mainly its flat spectrum and its luminosity evolution, are enigmatic. We apply a recently developed theoretical model for the observed radiation from a Wolf-Rayet SN exploding through a thick wind and show that it naturally explains all of the observed features of SN 2008D X-ray emission, including the energetics, the spectrum, and the detailed luminosity evolution. We find that the inferred progenitor and SN parameters are typical for an exploding Wolf-Rayet. A comparison of the wind density found at the breakout radius and the density at much larger radii, as inferred by late radio observations, suggests an enhanced mass-loss rate taking effect about 10 days prior to the SN explosion. This finding joins accumulating evidence for a possible late phase in the stellar evolution of massive stars, involving vigorous mass loss a short time before the SN explosion.
Late-Time Spectral Observations of Type IIP Supernovae
Silverman, Jeffrey M.; Pickett, Stephanie; Wheeler, J. Craig; Filippenko, Alexei
2016-01-01
Type II-Plateau supernovae (SNe IIP) are H-rich explosions that come from red supergiant (RSG) progenitors. Despite the fact that they are the most common subtype of SN, little work has been done on late-time observations of SNe IIP owing to their relative faintness at these epochs. We analyze 91 late-time (older than about 100 days past explosion) optical spectra of 38 SNe IIP, making this the largest sample of SN IIP nebular spectra ever studied. Quantitative criteria from the spectra themselves are employed to determine if an observation is truly nebular, and thus should be included in the study. We measure the fluxes, shapes, and velocities of various emission lines and investigate their temporal evolution. These values are also compared to photometric data in order to search for correlations that may allow us to gain insight into the RSG progenitors of SNe IIP and learn more about the details of the explosion itself.
ANALYTIC APPROXIMATION OF CARBON CONDENSATION ISSUES IN TYPE II SUPERNOVAE
Energy Technology Data Exchange (ETDEWEB)
Clayton, Donald D., E-mail: claydonald@gmail.com [Department of Physics and Astronomy, Clemson University, Clemson, SC (United States)
2013-01-01
I present analytic approximations for some issues related to condensation of graphite, TiC, and silicon carbide in oxygen-rich cores of supernovae of Type II. Increased understanding, which mathematical analysis can support, renders researchers more receptive to condensation in O-rich supernova gases. Taking SN 1987A as typical, my first analysis shows why the abundance of CO molecules reaches an early maximum in which free carbon remains more abundant than CO. This analysis clarifies why O-rich gas cannot oxidize C if {sup 56}Co radioactivity is as strong as in SN 1987A. My next analysis shows that the CO abundance could be regarded as being in chemical equilibrium if the CO molecule is given an effective binding energy rather than its laboratory dissociation energy. The effective binding energy makes the thermal dissociation rate of CO equal to its radioactive dissociation rate. This preserves possible relevance for the concept of chemical equilibrium. My next analysis shows that the observed abundances of CO and SiO molecules in SN 1987A rule out frequent suggestions that equilibrium condensation of SUNOCONs has occurred following atomic mixing of the He-burning shell with more central zones in such a way as to reproduce roughly the observed spectrum of isotopes in SUNOCONs while preserving C/O > 1. He atoms admixed along with the excess carbon would destroy CO and SiO molecules, leaving their observed abundances unexplained. The final analysis argues that a chemical quasiequilibrium among grains (but not gas) may exist approximately during condensation, so that its computational use is partially justified as a guide to which mineral phases would be stable against reactions with gas. I illustrate this point with quasiequilibrium calculations by Ebel and Grossman that have shown that graphite is stable even when O/C >1 if prominent molecules are justifiably excluded from the calculation of chemical equilibrium.
Supernovae and Gamma-Ray Bursts : the Greatest Explosions since the Big Bang
Panagia, Nino; Sahu, Kailash; Space Telescope Science Institute Symposium
2001-01-01
Since the dramatic discovery that the supernova SN1998bw coincided in position and time with a gamma-ray burst, the possibility was raised that these two types of spectacular explosions are related. This timely volume presents especially written articles by a host of world experts who gathered together for an international conference at the Space Telescope Science Institute. This was the first meeting in which the communities of supernova researchers and gamma-ray burst researchers were brought together to share ideas. The contributions review the mechanisms for these explosive events, the possible connections between them, and their relevance for cosmology. Both observations and theoretical developments are covered. This book is an invaluable source of information for both active researchers and graduate students in this exciting area of research.
SUPERNOVA PTF 09UJ: A POSSIBLE SHOCK BREAKOUT FROM A DENSE CIRCUMSTELLAR WIND
International Nuclear Information System (INIS)
Ofek, E. O.; Neill, J. D.; Kulkarni, S. R.; Forster, K.; Kasliwal, M. M.; Law, N.; Martin, C.; Quimby, R. M.; Rabinak, I.; Arcavi, I.; Waxman, E.; Gal-Yam, A.; Cenko, S. B.; Bloom, J. S.; Filippenko, A. V.; Poznanski, D.; Nugent, P. E.; Jacobsen, J.; Bildsten, L.; Howell, D. A.
2010-01-01
Type-IIn supernovae (SNe IIn), which are characterized by strong interaction of their ejecta with the surrounding circumstellar matter (CSM), provide a unique opportunity to study the mass-loss history of massive stars shortly before their explosive death. We present the discovery and follow-up observations of an SN IIn, PTF 09uj, detected by the Palomar Transient Factory (PTF). Serendipitous observations by Galaxy Evolution Explorer (GALEX) at ultraviolet (UV) wavelengths detected the rise of the SN light curve prior to the PTF discovery. The UV light curve of the SN rose fast, with a timescale of a few days, to a UV absolute AB magnitude of about -19.5. Modeling our observations, we suggest that the fast rise of the UV light curve is due to the breakout of the SN shock through the dense CSM (n ∼ 10 10 cm -3 ). Furthermore, we find that prior to the explosion the progenitor went through a phase of high mass-loss rate (∼0.1 M sun yr -1 ) that lasted for a few years. The decay rate of this SN was fast relative to that of other SNe IIn.
Medicina-Noto VLBI observation of SN2013ej
Sokolovsky, K.; Giroletti, M.; Stagni, M.; Nanni, M.; Mahabal, A.
2013-08-01
We used the 32m radio telescopes of Istituto di Radioastronomia (INAF-IRA) in Medicina and Noto as a two-element very long baseline interferometer to search for a possible radio counterpart of SN2013ej, a type IIP supernova (CBET #3606, ATel #5228, #5229, #5230, #5237, #5243) in M74. The observations were conducted at 6.7 GHz on 2013 July 31.3 UT, 6 days after the first optical detection reported in CBET #3609.
Measurements of Ω and Λ from 42 High-Redshift Supernovae
International Nuclear Information System (INIS)
Perlmutter, S.; Aldering, G.; Goldhaber, G.; Knop, R.A.; Nugent, P.; Castro, P.G.; Deustua, S.; Fabbro, S.; Goobar, A.; Groom, D.E.; Hook, I.M.; Kim, A.G.; Kim, M.Y.; Lee, J.C.; Nunes, N.J.; Pain, R.; Pennypacker, C.R.; Quimby, R.; Lidman, C.; Ellis, R.S.; Irwin, M.; McMahon, R.G.; Ruiz-Lapuente, P.; Walton, N.; Schaefer, B.; Boyle, B.J.; Filippenko, A.V.; Matheson, T.; Fruchter, A.S.; Panagia, N.; Newberg, H.J.; Couch, W.J.
1999-01-01
We report measurements of the mass density, Ω M , and cosmological-constant energy density, Ω Λ , of the universe based on the analysis of 42 type Ia supernovae discovered by the Supernova Cosmology Project. The magnitude-redshift data for these supernovae, at redshifts between 0.18 and 0.83, are fitted jointly with a set of supernovae from the Calacute an/Tololo Supernova Survey, at redshifts below 0.1, to yield values for the cosmological parameters. All supernova peak magnitudes are standardized using a SN Ia light-curve width-luminosity relation. The measurement yields a joint probability distribution of the cosmological parameters that is approximated by the relation 0.8Ω M -0.6Ω Λ ∼-0.2±0.1 in the region of interest (Ω M approx-lt 1.5). For a flat (Ω M +Ω Λ =1) cosmology we find Ω flat M =0.28 +0.09 -0.08 (1 σ statistical) +0.05 -0.04 (identified systematics). The data are strongly inconsistent with a Λ=0 flat cosmology, the simplest inflationary universe model. An open, Λ=0 cosmology also does not fit the data well: the data indicate that the cosmological constant is nonzero and positive, with a confidence of P(Λ>0)=99%, including the identified systematic uncertainties. The best-fit age of the universe relative to the Hubble time is t flat 0 =14.9 +1.4 -1.1 (0.63/h) Gyr for a flat cosmology. The size of our sample allows us to perform a variety of statistical tests to check for possible systematic errors and biases. We find no significant differences in either the host reddening distribution or Malmquist bias between the low-redshift Calacute an/Tololo sample and our high-redshift sample. Excluding those few supernovae that are outliers in color excess or fit residual does not significantly change the results. The conclusions are also robust whether or not a width-luminosity relation is used to standardize the supernova peak magnitudes. We discuss and constrain, where possible, hypothetical alternatives to a cosmological constant
PSR B 1706-44 and the SNR G 343.1-2.3 as the remnants of a cavity supernova explosion
Bock, D. C.-J.; Gvaramadze, V. V.
2002-11-01
The possible association of the supernova remnant (SNR) G 343.1-2.3 with the pulsar PSR B 1706-44 (superposed on the arclike ``shell" of the SNR) has been questioned by some authors on the basis of an inconsistency between the implied and measured (scintillation) transverse velocities of the pulsar, the absence of any apparent interaction between the pulsar and the SNR's ``shell'', and some other indirect arguments. We suggest, however, that this association could be real if both objects are the remnants of a supernova (SN) which exploded within a mushroom-like cavity (created by the SN progenitor wind breaking out of the parent molecular cloud). This suggestion implies that the actual shape of the SNR's shell is similar to that of the well-known SNR VRO 42.05.01 and that the observed bright arc corresponds to the ``half'' of the SNR located inside the cloud. We report the discovery in archival radio data of an extended ragged radio arc to the southeast of the bright arc which we interpret as the ``half'' of the SN blast wave expanding in the intercloud medium.
THE TYPE IIb SUPERNOVA 2011dh FROM A SUPERGIANT PROGENITOR
International Nuclear Information System (INIS)
Bersten, Melina C.; Nomoto, Ken'ichi; Folatelli, Gastón; Maeda, Keiichi; Benvenuto, Omar G.; Ergon, Mattias; Sollerman, Jesper; Benetti, Stefano; Ochner, Paolo; Tomasella, Lina; Botticella, Maria Teresa; Fraser, Morgan; Kotak, Rubina
2012-01-01
A set of hydrodynamical models based on stellar evolutionary progenitors is used to study the nature of SN 2011dh. Our modeling suggests that a large progenitor star—with R ∼ 200 R ☉ —is needed to reproduce the early light curve (LC) of SN 2011dh. This is consistent with the suggestion that the yellow super-giant star detected at the location of the supernova (SN) in deep pre-explosion images is the progenitor star. From the main peak of the bolometric LC and expansion velocities, we constrain the mass of the ejecta to be ≈2 M ☉ , the explosion energy to be E = (6-10) × 10 50 erg, and the 56 Ni mass to be approximately 0.06 M ☉ . The progenitor star was composed of a helium core of 3-4 M ☉ and a thin hydrogen-rich envelope of ≈0.1M ☉ with a main-sequence mass estimated to be in the range of 12-15 M ☉ . Our models rule out progenitors with helium-core masses larger than 8 M ☉ , which correspond to M ZAMS ∼> 25M ☉ . This suggests that a single star evolutionary scenario for SN 2011dh is unlikely.
Energy Technology Data Exchange (ETDEWEB)
Harris, Chelsea E.; Nugent, Peter E.; Kasen, Daniel N., E-mail: chelseaharris@berkeley.edu [Astronomy Department, University of California Berkeley, Berkeley, CA (United States)
2016-06-01
For decades a wide variety of observations spanning the radio through optical and on to the X-ray have attempted to uncover signs of type Ia supernovae (SNe Ia) interacting with a circumstellar medium (CSM). The goal of these studies is to constrain the nature of the hypothesized SN Ia mass-donor companion. A continuous CSM is typically assumed when interpreting observations of interaction. However, while such models have been successfully applied to core-collapse SNe, the assumption of continuity may not be accurate for SNe Ia, because shells of CSM could be formed by pre-supernova eruptions (novae). In this work, we model the interaction of SNe with a spherical, low-density, finite-extent CSM and create a suite of synthetic radio synchrotron light curves. We find that CSM shells produce sharply peaked light curves. We also identify a fiducial set of models that obey a common evolution and can be used to generate radio light curves for an interaction with an arbitrary shell. The relations obeyed by the fiducial models can be used to deduce CSM properties from radio observations; we demonstrate this by applying them to the nondetections of SN 2011fe and SN 2014J. Finally, we explore a multiple shell CSM configuration and describe its more complicated dynamics and the resultant radio light curves.
Preparatory studies for the WFIRST supernova cosmology measurements
Perlmutter, Saul
tune details, like the wavelength coverage and S/N requirements, of the WFIRST IFS to capitalize on these systematic error reduction methods. b) Supernova extraction and host galaxy subtractions. The underlying light of the host galaxy must be subtracted from the supernova images making up the lightcurves. Using the IFS to provide the lightcurve points via spectrophotometry requires the subtraction of a reference spectrum of the galaxy taken after the supernova light has faded to a negligible level. We plan to apply the expertise obtained from the SNfactory to develop galaxy background procedures that minimize the systematic errors introduced by this step in the analysis. c) Instrument calibration and ground to space cross calibration. Calibrating the entire supernova sample will be a challenge as no standard stars exist that span the range of magnitudes and wavelengths relevant to the WFIRST survey. Linking the supernova measurements to the relatively brighter standards will require several links. WFIRST will produce the high redshift sample, but the nearby supernova to anchor the Hubble diagram will have to come from ground based observations. Developing algorithms to carry out the cross calibration of these two samples to the required one percent level will be an important goal of our proposal. An integral part of this calibration will be to remove all instrumental signatures and to develop unbiased measurement techniques starting at the pixel level. We then plan to pull the above studies together in a synthesis to produce a correlated error matrix. We plan to develop a Fisher Matrix based model to evaluate the correlated error matrix due to the various systematic errors discussed above. A realistic error model will allow us to carry out a more reliable estimates of the eventual errors on the measurement of the cosmological parameters, as well as serve as a means of optimizing and fine tuning the requirements for the instruments and survey strategies.
The Type IIb Supernova 2013df and its Cool Supergiant Progenitor
VanDyk, Schuyler D.; Zeng, Weikang; Fox, Ori D.; Cenko, S. Bradley; Clubb, Kelsey I.; Filippenko, Alexei; Foley, Ryan J.; Miller, Adam A.; Smith, Nathan; Kelly, Patrick L.;
2014-01-01
We have obtained early-time photometry and spectroscopy of supernova (SN) 2013df in NGC 4414. The SN is clearly of Type II b, with notable similarities to SN 1993J. From its luminosity at secondary maximum light, it appears that less Ni-56 (is approximately less than 0.06M) was synthesized in the SN 2013df explosion than was the case for the SNe II b 1993J, 2008ax, and 2011dh. Based on a comparison of the light curves, the SN 2013df progenitor must have been more extended in radius prior to explosion than the progenitor of SN 1993J. The total extinction for SN 2013dfis estimated to be A(sub V) = 0.30 mag. The metallicity at the SN location is likely to be solar. We have conducted Hubble Space Telescope(HST) Target of Opportunity observations of the SN with the Wide Field Camera 3, and from a precise comparison of these new observations to archival HST observations of the host galaxy obtained 14 yr prior to explosion, we have identified the progenitor of SN 2013df to be a yellow supergiant, somewhat hotter than a red supergiant progenitor for a normal Type II-Plateau SN. From its observed spectral energy distribution, assuming that the light is dominated by one star, the progenitor had effective temperature T(sub eff) = 4250+/-100 K and a bolometric luminosity L(sub bol) =10(exp 4.94+/-0.06) Solar Luminosity. This leads to an effective radius Reff = 545+/-65 Solar Radius. The star likely had an initial mass in the range of 13-17Solar Mass; however, if it was a member of an interacting binary system, detailed modeling of the system is required to estimate this mass more accurately. The progenitor star of SN 2013df appears to have been relatively similar to the progenitor of SN 1993J.
The type IIb supernova 2013df and its cool supergiant progenitor
Energy Technology Data Exchange (ETDEWEB)
Van Dyk, Schuyler D. [Spitzer Science Center/Caltech, Mail Code 220-6, Pasadena, CA 91125 (United States); Zheng, WeiKang; Fox, Ori D.; Clubb, Kelsey I.; Filippenko, Alexei V.; Kelly, Patrick L. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Cenko, S. Bradley [Astrophysics Science Division, NASA Goddard Space Flight Center, Mail Code 661, Greenbelt, MD 20771 (United States); Foley, Ryan J. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Miller, Adam A. [Jet Propulsion Laboratory, MS 169-506, Pasadena, CA 91109 (United States); Smith, Nathan [Steward Observatory, University of Arizona, Tucson, AZ 85720 (United States); Lee, William H. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Apdo. Postal 70-264, Cd. Universitaria, México DF 04510 (Mexico); Ben-Ami, Sagi; Gal-Yam, Avishay, E-mail: vandyk@ipac.caltech.edu [Benoziyo Center for Astrophysics, The Weizmann Institute of Science, Rehovot 76100 (Israel)
2014-02-01
We have obtained early-time photometry and spectroscopy of supernova (SN) 2013df in NGC 4414. The SN is clearly of Type IIb, with notable similarities to SN 1993J. From its luminosity at secondary maximum light, it appears that less {sup 56}Ni (≲ 0.06 M {sub ☉}) was synthesized in the SN 2013df explosion than was the case for the SNe IIb 1993J, 2008ax, and 2011dh. Based on a comparison of the light curves, the SN 2013df progenitor must have been more extended in radius prior to explosion than the progenitor of SN 1993J. The total extinction for SN 2013df is estimated to be A{sub V} = 0.30 mag. The metallicity at the SN location is likely to be solar. We have conducted Hubble Space Telescope (HST) Target of Opportunity observations of the SN with the Wide Field Camera 3, and from a precise comparison of these new observations to archival HST observations of the host galaxy obtained 14 yr prior to explosion, we have identified the progenitor of SN 2013df to be a yellow supergiant, somewhat hotter than a red supergiant progenitor for a normal Type II-Plateau SN. From its observed spectral energy distribution, assuming that the light is dominated by one star, the progenitor had effective temperature T {sub eff} = 4250 ± 100 K and a bolometric luminosity L {sub bol} = 10{sup 4.94±0.06} L {sub ☉}. This leads to an effective radius R {sub eff} = 545 ± 65 R {sub ☉}. The star likely had an initial mass in the range of 13-17 M {sub ☉}; however, if it was a member of an interacting binary system, detailed modeling of the system is required to estimate this mass more accurately. The progenitor star of SN 2013df appears to have been relatively similar to the progenitor of SN 1993J.
EVIDENCE FOR A COMPACT WOLF-RAYET PROGENITOR FOR THE TYPE Ic SUPERNOVA PTF 10vgv
Energy Technology Data Exchange (ETDEWEB)
Corsi, A. [LIGO laboratory, California Institute of Technology, MS 100-36, Pasadena, CA 91125 (United States); Ofek, E. O.; Gal-Yam, A.; Arcavi, I.; Ben-Ami, S.; Rabinak, I. [Department of Particle Physics and Astrophysics, Weizmann Institute of Science, Rehovot 76100 (Israel); Frail, D. A. [National Radio Astronomy Observatory, P.O. Box 0, Socorro, NM 87801 (United States); Poznanski, D. [School of Physics and Astronomy, Tel-Aviv University, Tel-Aviv 69978 (Israel); Mazzali, P. A. [INAF-Osservatorio Astronomico, vicolo dellOsservatorio, 5, I-35122 Padova (Italy); Kulkarni, S. R.; Kasliwal, M. M.; Horesh, A. [Cahill Center for Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Cenko, S. B.; Filippenko, A. V.; Kleiser, I. K. W.; Silverman, J. M. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Fox, D. B.; Howell, J. L. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Nakar, E. [Raymond and Beverly Sackler School of Physics and Astronomy, Tel Aviv University, Tel Aviv 69978 (Israel); Sari, R., E-mail: corsi@caltech.edu [Racah Institute for Physics, Hebrew University, Jerusalem 91904 (Israel); and others
2012-03-15
We present the discovery of PTF 10vgv, a Type Ic supernova (SN) detected by the Palomar Transient Factory, using the Palomar 48 inch telescope (P48). R-band observations of the PTF 10vgv field with P48 probe the SN emission from its very early phases (about two weeks before R-band maximum) and set limits on its flux in the week prior to the discovery. Our sensitive upper limits and early detections constrain the post-shock-breakout luminosity of this event. Via comparison to numerical (analytical) models, we derive an upper-limit of R {approx}< 4.5 R{sub Sun} (R {approx}< 1 R{sub Sun }) on the radius of the progenitor star, a direct indication in favor of a compact Wolf-Rayet star. Applying a similar analysis to the historical observations of SN 1994I yields R {approx}< 1/4 R{sub Sun} for the progenitor radius of this SN.
THE LONG-LIVED UV ''PLATEAU'' OF SN 2012aw
Energy Technology Data Exchange (ETDEWEB)
Bayless, Amanda J.; Roming, Peter W. A. [Southwest Research Institute, Department of Space Science, 6220 Culebra Road, San Antonio, TX 78238 (United States); Pritchard, Tyler A. [Department of Astronomy and Astrophysics, Penn State University, 525 Davey Lab, University Park, PA 16802 (United States); Kuin, Paul [Mullard Space Science Laboratory, Holmbury St. Mary, Dorking, Surrey RH5 6NT (United Kingdom); Brown, Peter J. [Texas A and M University, Department of Physics and Astronomy, College Station, TX 77843-4242 (United States); Botticella, Maria Teresa; Dall' Ora, Massimo [INAF-Osservatorio Astronomico di Capodimonte, via Moiariello 16, I-80131 Napoli (Italy); Frey, Lucille H.; Even, Wesley; Fryer, Chris L. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Maund, Justyn R.; Fraser, Morgan [Astrophysics Research Center, School of Mathematics and Physics, Queen' s University Belfast, Belfast BT7 1NN (United Kingdom)
2013-02-10
Observations with the Swift UV Optical Telescope have unambiguously uncovered for the first time a long-lived, UV ''plateau'' in a Type II-P supernova (SN). Although this flattening in slope is hinted at in a few other SNe, due to its proximity and minimal line-of-sight extinction, SN 2012aw has afforded the first opportunity to clearly observe this UV plateau. The observations of SN 2012aw revealed all Swift UV and u-band light curves initially declined rapidly, but 27 days after the explosion the light curves flattened. Some possible sources of the UV plateau are the same thermal process that causes the optical plateau, heating from radioactive decay, or a combination of both processes.
Optical, Near-IR, and X-Ray Observations of SN 2015J and Its Host Galaxy
Nucita, A. A.; De Paolis, F.; Saxton, R.; Testa, V.; Strafella, F.; Read, A.; Licchelli, D.; Ingrosso, G.; Convenga, F.; Boutsia, K.
2017-12-01
SN 2015J was discovered on 2015 April 27th and is classified as an SN IIn. At first, it appeared to be an orphan SN candidate, I.e., without any clear identification of its host galaxy. Here, we present an analysis of the observations carried out by the VLT 8 m class telescope with the FORS2 camera in the R band and the Magellan telescope (6.5 m) equipped with the IMACS Short-Camera (V and I filters) and the FourStar camera (Ks filter). We show that SN 2015J resides in what appears to be a very compact galaxy, establishing a relation between the SN event and its natural host. We also present and discuss archival and new X-ray data centered on SN 2015J. At the time of the supernova explosion, Swift/XRT observations were made and a weak X-ray source was detected at the location of SN 2015J. Almost one year later, the same source was unambiguously identified during serendipitous observations by Swift/XRT and XMM-Newton, clearly showing an enhancement of the 0.3-10 keV band flux by a factor ≃ 30 with respect to the initial state. Swift/XRT observations show that the source is still active in the X-rays at a level of ≃ 0.05 counts s-1. The unabsorbed X-ray luminosity derived from the XMM-Newton slew and SWIFT observations, {L}x≃ 5× {10}41 erg s-1, places SN 2015J among the brightest young supernovae in X-rays. Based on observations obtained with XMM-Newton, an ESA science mission with instruments and contributions directly funded by ESA Member States and NASA, with ESO Telescopes at the La Silla-Paranal Observatory under program ID 298.D-5016(A), and with the 6.5 m Magellan Telescopes located at Las Campanas Observatory, Chile. We also acknowledge the use of public data from the Swift data archive.
Geometry of the non-thermal emission in SN 1006. Azimuthal variations of cosmic-ray acceleration
Rothenflug, R.; Ballet, J.; Dubner, Gloria Mabel; Giacani, Elsa Beatriz; Decourchelle, A.; Ferrando, P.
2017-01-01
SN 1006 is the prototype of shell supernova remnants, in which non-thermal synchrotron emission dominates the X-ray spectrum. The non-thermal emission is due to the cosmic-ray electrons accelerated behind the blast wave. The X-ray synchrotron emission is due to the highest energy electrons, and is thus a tracer of the maximum energy electrons may reach behind a shock. We have put together all XMM-Newton observations to build a full map of SN 1006. The very low brightness a...
Inhomogeneities and the Modeling of Radio Supernovae
Energy Technology Data Exchange (ETDEWEB)
Björnsson, C.-I.; Keshavarzi, S. T., E-mail: bjornsson@astro.su.se [Department of Astronomy, AlbaNova University Center, Stockholm University, SE–106 91 Stockholm (Sweden)
2017-05-20
Observations of radio supernovae (SNe) often exhibit characteristics not readily accounted for by a homogeneous, spherically symmetric synchrotron model; e.g., flat-topped spectra/light curves. It is shown that many of these deviations from the standard model can be attributed to an inhomogeneous source structure. When inhomogeneities are present, the deduced radius of the source and, hence, the shock velocity, is sensitive to the details of the modeling. As the inhomogeneities are likely to result from the same mechanism that amplify the magnetic field, a comparison between observations and the detailed numerical simulations now under way may prove mutually beneficial. It is argued that the radio emission in Type Ib/c SNe has a small volume filling factor and comes from a narrow region associated with the forward shock, while the radio emission region in SN 1993J (Type IIb) is determined by the extent of the Rayleigh–Taylor instability emanating from the contact discontinuity. Attention is also drawn to the similarities between radio SNe and the structural properties of SN remnants.
supernovae: Photometric classification of supernovae
Charnock, Tom; Moss, Adam
2017-05-01
Supernovae classifies supernovae using their light curves directly as inputs to a deep recurrent neural network, which learns information from the sequence of observations. Observational time and filter fluxes are used as inputs; since the inputs are agnostic, additional data such as host galaxy information can also be included.
On Deep-Ocean $^{60}Fe$ as a Fossil of a Near-Earth Supernova
Fields, B D; Fields, Brian D.; Ellis, John
1999-01-01
Live $^{60}$Fe has recently been reported in a deep-ocean ferromanganese crust. Analysis of the isotopic ratios in the sample suggests that the measured $^{60}$Fe abundance exceeds the levels generated by terrestrial and cosmogenic sources, and it has been proposed that the excess of $^{60}$Fe is a signature of a supernova that exploded near the earth several Myr ago. In this paper, we consider the possible background sources, and confirm that the measured $^{60}$Fe is significantly higher than all known backgrounds, in contrast with the reported abundance of live $^{53}$Mn. We discuss scenarios in which the data are consistent with a supernova event at a distance $D \\sim 30$ pc and an epoch $t_{\\rm SN} \\sim 5$ Myr ago. We propose tests that could confirm or refute the interpretation of the $^{60}$Fe discovery, including searches for $^{10}$Be, $^{129}$I and $^{146}$Sm. Such a nearby supernova event might have had some impact on the earth's biosphere, principally by enhancing the cosmic-ray flux. This might h...
Aksenov, A. G.; Chechetkin, V. M.
2018-04-01
Most of the energy released in the gravitational collapse of the cores of massive stars is carried away by neutrinos. Neutrinos play a pivotal role in explaining core-collape supernovae. Currently, mathematical models of the gravitational collapse are based on multi-dimensional gas dynamics and thermonuclear reactions, while neutrino transport is considered in a simplified way. Multidimensional gas dynamics is used with neutrino transport in the flux-limited diffusion approximation to study the role of multi-dimensional effects. The possibility of large-scale convection is discussed, which is interesting both for explaining SN II and for setting up observations to register possible high-energy (≳10MeV) neutrinos from the supernova. A new multi-dimensional, multi-temperature gas dynamics method with neutrino transport is presented.
THE IMPACT OF METALLICITY ON THE RATE OF TYPE Ia SUPERNOVAE
International Nuclear Information System (INIS)
Kistler, Matthew D.; Stanek, K. Z.; Kochanek, Christopher S.; Thompson, Todd A.; Prieto, José L.
2013-01-01
The metallicity of a star strongly affects both its evolution and the properties of the stellar remnant that results from its demise. It is generally accepted that stars with initial masses below ∼8 M ☉ leave behind white dwarfs and that some sub-population of these lead to Type Ia supernovae (SNe Ia). However, it is often tacitly assumed that metallicity has no effect on the rate of SNe Ia. We propose that a consequence of the effects of metallicity is to significantly increase the SN Ia rate in lower-metallicity galaxies, in contrast to previous expectations. This is because lower-metallicity stars leave behind higher-mass white dwarfs, which should be easier to bring to explosion. We first model SN Ia rates in relation to galaxy masses and ages alone, finding that the elevation in the rate of SNe Ia in lower-mass galaxies measured by Lick Observatory SN Search is readily explained. However, we then see that models incorporating this effect of metallicity agree just as well. Using the same parameters to estimate the cosmic SN Ia rate, we again find good agreement with data up to z ≈ 2. We suggest that this degeneracy warrants more detailed examination of host galaxy metallicities. We discuss additional implications, including for hosts of high-z SNe Ia, the SN Ia delay time distribution, super-Chandrasekhar SNe, and cosmology.
Acceleration of cosmic rays in supernova-remnants
Dorfi, E. A.; Drury, L. O.
1985-01-01
It is commonly accepted that supernova-explosions are the dominant source of cosmic rays up to an energy of 10 to the 14th power eV/nucleon. Moreover, these high energy particles provide a major contribution to the energy density of the interstellar medium (ISM) and should therefore be included in calculations of interstellar dynamic phenomena. For the following the first order Fermi mechanism in shock waves are considered to be the main acceleration mechanism. The influence of this process is twofold; first, if the process is efficient (and in fact this is the cas) it will modify the dynamics and evolution of a supernova-remnant (SNR), and secondly, the existence of a significant high energy component changes the overall picture of the ISM. The complexity of the underlying physics prevented detailed investigations of the full non-linear selfconsistent problem. For example, in the context of the energy balance of the ISM it has not been investigated how much energy of a SN-explosion can be transfered to cosmic rays in a time-dependent selfconsistent model. Nevertheless, a lot of progress was made on many aspects of the acceleration mechanism.
Acceleration of cosmic rays in supernova-remnants
International Nuclear Information System (INIS)
Dorfi, E.A.; Drury, L.O.
1985-01-01
It is commonly accepted that supernova-explosions are the dominant source of cosmic rays up to an energy of 10 to the 14th power eV/nucleon. Moreover, these high energy particles provide a major contribution to the energy density of the interstellar medium (ISM) and should therefore be included in calcuations of interstellar dynamic phenomena. For the following the first order Fermi mechanism in shock waves are considered to be the main acceleration mechanism. The influence of this process is twofold; first, if the process is efficient (and in fact this is the case) it will modify the dynamics and evolution of a supernova-remnant (SNR), and secondly, the existence of a significant high energy component changes the overall picture of the ISM. The complexity of the underlying physics prevented detailed investigations of the full non-linear selfconsistent problem. For example, in the context of the energy balance of the ISM it has not been investigated how much energy of a SN-explosion can be transfered to cosmic rays in a time-dependent selfconsistent model. Nevertheless, a lot of progress was made on many aspects of the acceleration mechnism
Radio emission from embryonic superluminous supernova remnants
Omand, Conor M. B.; Kashiyama, Kazumi; Murase, Kohta
2018-02-01
It has been widely argued that Type-I superluminous supernovae (SLSNe-I) are driven by powerful central engines with a long-lasting energy injection after the core-collapse of massive progenitors. One of the popular hypotheses is that the hidden engines are fast-rotating pulsars with a magnetic field of B ˜ 1013-1015 G. Murase, Kashiyama & Mészáros proposed that quasi-steady radio/submm emission from non-thermal electron-positron pairs in nascent pulsar wind nebulae can be used as a relevant counterpart of such pulsar-driven supernovae (SNe). In this work, focusing on the nascent SLSN-I remnants, we examine constraints that can be placed by radio emission. We show that the Atacama Large Millimeter/submillimetre Array can detect the radio nebula from SNe at DL ˜ 1 Gpc in a few years after the explosion, while the Jansky Very Large Array can also detect the counterpart in a few decades. The proposed radio follow-up observation could solve the parameter degeneracy in the pulsar-driven SN model for optical/UV light curves, and could also give us clues to young neutron star scenarios for SLSNe-I and fast radio bursts.
Rodney, Steven A.; Riess, Adam G.; Strogler, Louis-Gregory; Dahlen, Tomas; Graur, Or; Casertano, Stefano; Dickinson, Mark E.; Ferguson, Henry C.; Garnavich, Peter; Cenko, Stephen Bradley
2014-01-01
The Cosmic Assembly Near-infrared Deep Extragalactic Legacy Survey (CANDELS) was a multi-cycle treasury program on the Hubble Space Telescope(HST) that surveyed a total area of approx. 0.25 deg(sup 2) with approx.900 HST orbits spread across five fields over three years. Within these survey images we discovered 65 supernovae (SNe) of all types, out to z approx. 2.5. We classify approx. 24 of these as Type Ia SNe (SNe Ia) based on host galaxy redshifts and SN photometry (supplemented by grism spectroscopy of six SNe). Here we present a measurement of the volumetric SN Ia rate as a function of redshift, reaching for the first time beyond z = 2 and putting new constraints on SN Ia progenitor models. Our highest redshift bin includes detections of SNe that exploded when the universe was only approx. 3 Gyr old and near the peak of the cosmic star formation history. This gives the CANDELS high redshift sample unique leverage for evaluating the fraction of SNe Ia that explode promptly after formation (500 Myr). Combining the CANDELS rates with all available SN Ia rate measurements in the literature we find that this prompt SN Ia fraction isfP0.530.09stat0.100.10sys0.26, consistent with a delay time distribution that follows a simplet1power law for all timest40 Myr. However, mild tension is apparent between ground-based low-z surveys and space-based high-z surveys. In both CANDELS and the sister HST program CLASH (Cluster Lensing And Supernova Survey with Hubble), we find a low rate of SNe Ia at z > 1. This could be a hint that prompt progenitors are in fact relatively rare, accounting for only 20 of all SN Ia explosions though further analysis and larger samples will be needed to examine that suggestion.
On the O/Fe versus Fe/H relationship and the progenitors of type I supernovae
International Nuclear Information System (INIS)
Abia, C.; Canal, R.; Isern, J.
1991-01-01
The new observational O/Fe versus Fe/H abundance relationship for halo stars is studied in terms of several models of chemical evolution for the solar neighborhood. Nucleosynthesis products from type I (both Ia and Ib) and Type II SNs are taken into account. The behavior of the O/Fe ratio for halo and disk stars is well reproduced by assuming (1) a lower iron production in SN II than in previous theoretical prescriptions, (2) the coalescence by gravitational wave radiation of two CO white dwarfs as the scenario for type Ia supernovae, and (3) stars in the Wolf-Rayet stage as progenitors of type Ib supernovae. Nevertheless, the best agreement with the observations is obtained by adopting an IMF favoring massive star formation only at very early epochs in the life of the Galaxy. Model predictions from other plausible scenarios for the origin of type I supernovae are also discussed. 41 refs
The Low-luminosity Type IIP Supernova 2016bkv with Early-phase Circumstellar Interaction
Nakaoka, Tatsuya; Kawabata, Koji S.; Maeda, Keiichi; Tanaka, Masaomi; Yamanaka, Masayuki; Moriya, Takashi J.; Tominaga, Nozomu; Morokuma, Tomoki; Takaki, Katsutoshi; Kawabata, Miho; Kawahara, Naoki; Itoh, Ryosuke; Shiki, Kensei; Mori, Hiroki; Hirochi, Jun; Abe, Taisei; Uemura, Makoto; Yoshida, Michitoshi; Akitaya, Hiroshi; Moritani, Yuki; Ueno, Issei; Urano, Takeshi; Isogai, Mizuki; Hanayama, Hidekazu; Nagayama, Takahiro
2018-06-01
We present optical and near-infrared observations of a low-luminosity (LL) Type IIP supernova (SN) 2016bkv from the initial rising phase to the plateau phase. Our observations show that the end of the plateau is extended to ≳140 days since the explosion, indicating that this SN takes one of the longest times to finish the plateau phase among Type IIP SNe (SNe IIP), including LL SNe IIP. The line velocities of various ions at the middle of the plateau phase are as low as 1000–1500 km s‑1, which is the lowest even among LL SNe IIP. These measurements imply that the ejecta mass in SN 2016bkv is larger than that of the well-studied LL IIP SN 2003Z. In the early phase, SN 2016bkv shows a strong bump in the light curve. In addition, the optical spectra in this bump phase exhibit a blue continuum accompanied by a narrow Hα emission line. These features indicate an interaction between the SN ejecta and the circumstellar matter (CSM) as in SNe IIn. Assuming the ejecta–CSM interaction scenario, the mass loss rate is estimated to be ∼ 1.7× {10}-2 {M}ȯ yr‑1 within a few years before the SN explosion. This is comparable to or even larger than the largest mass loss rate observed for the Galactic red supergiants (∼ {10}-3 {M}ȯ yr‑1 for VY CMa). We suggest that the progenitor star of SN 2016bkv experienced a violent mass loss just before the SN explosion.
Energy Technology Data Exchange (ETDEWEB)
Graham, M. L.; Sand, D. J. [Las Cumbres Observatory Global Telescope Network, 6740 Cortona Drive, Suite 102, Santa Barbara, CA 93117 (United States); Bildfell, C. J.; Pritchet, C. J. [Department of Physics and Astronomy, University of Victoria, P.O. Box 3055, STN CSC, Victoria BC V8W 3P6 (Canada); Zaritsky, D.; Just, D. W.; Herbert-Fort, S. [Steward Observatory, University of Arizona, Tucson, AZ 85721 (United States); Hoekstra, H. [Leiden Observatory, Leiden University, Niels Bohrweg 2, NL-2333 CA Leiden (Netherlands); Sivanandam, S. [Dunlap Institute for Astronomy and Astrophysics, 50 St. George St., Toronto, ON M5S 3H4 (Canada); Foley, R. J. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)
2012-07-01
We present seven spectroscopically confirmed Type II cluster supernovae (SNe II) discovered in the Multi-Epoch Nearby Cluster Survey, a supernova survey targeting 57 low-redshift 0.05 < z < 0.15 galaxy clusters with the Canada-France-Hawaii Telescope. We find the rate of Type II supernovae within R{sub 200} of z {approx} 0.1 galaxy clusters to be 0.026{sup +0.085}{sub -0.018}(stat){sup +0.003}{sub -0.001}(sys) SNuM. Surprisingly, one SN II is in a red-sequence host galaxy that shows no clear evidence of recent star formation (SF). This is unambiguous evidence in support of ongoing, low-level SF in at least some cluster elliptical galaxies, and illustrates that galaxies that appear to be quiescent cannot be assumed to host only Type Ia SNe. Based on this single SN II we make the first measurement of the SN II rate in red-sequence galaxies, and find it to be 0.007{sup +0.014}{sub -0.007}(stat){sup +0.009}{sub -0.001}(sys) SNuM. We also make the first derivation of cluster specific star formation rates (sSFR) from cluster SN II rates. We find that for all galaxy types the sSFR is 5.1{sup +15.8}{sub -3.1}(stat) {+-} 0.9(sys) M{sub Sun} yr{sup -1} (10{sup 12} M{sub Sun }){sup -1}, and for red-sequence galaxies only it is 2.0{sup +4.2}{sub -0.9}(stat) {+-} 0.4(sys) M{sub Sun} yr{sup -1} (10{sup 12} M{sub Sun }){sup -1}. These values agree with SFRs measured from infrared and ultraviolet photometry, and H{alpha} emission from optical spectroscopy. Additionally, we use the SFR derived from our SNII rate to show that although a small fraction of cluster Type Ia SNe may originate in the young stellar population and experience a short delay time, these results do not preclude the use of cluster SN Ia rates to derive the late-time delay time distribution for SNe Ia.
The Fast Evolution of SN 2010bh Associated with XRF 100316D
Olivares E., F.; Greiner, J.; Schady, P.; Rau, A.; Klose, S.; Kruhler, T.; Afonso, P. M. J.; Updike, A. C.; Nardini, M.; Filgas, R.;
2012-01-01
The first observational evidence of a connection between supernovae (SNe) and gamma-ray bursts (GRBs) was found about a decade ago. Since then, only half a dozen spectroscopically confirmed associations have been discovered and XRF 1003160 associated with the type-Ic SN 20lObh is among the latest. Aims. We constrain the progenitor radius, the host-galaxy extinction, and the physical parameters of the explosion of XRF l00316D/SN 20lObh at z 0.059. We study the SN brightness and colours in the context of GRB-SNe. Methods. We began observations with the Gamma-Ray burst Optical and Near-infrared Detector (GROND) 12 hours after the GRB trigger and continued until 80 days after the burst. GROND provided excellent photometric data in six filter bands covering a wavelength range from approximately 350 to 1800 nm, significantly expanding the pre-existing data set for this event. Combining GROND and Swift data, the early broad-band spectral energy distribution (SED) is modelled with a blackbody and afterglow component attenuated by dust and gas absorption. The temperature and radius evolution of the thermal component are analysed and combined with earlier measurements available from the literature. Templates of SN 1998bw are fitted to the SN itself to directly compare the lightcurve properties. Finally, a two-component parametrized model is fitted to the quasi-bolometric light curve. which delivers physical parameters of the explosion. Results. The best-fit models to the broad-band SEDs imply moderate reddening along the line of sight through the host galaxy (A(sub v.host = 1.2 +/- 0.1 mag). Furthermore, the parameters of the blackbody component reveal a cooling envelope at an apparent initial radius of 7 x 10(exp 11) cm, which is compatible with a dense wind surrounding a Wolf-Rayet star. A multicolor comparison shows that SN 2010bh is 60 - 70% as bright as SN 1998bw. Reaching maximum brightness at 8 - 9 days after the burst in the blue bands, SN 20lObh proves to be the
Ejection of the Massive Hydrogen-rich Envelope Timed with the Collapse of the Stripped SN 2014C
Energy Technology Data Exchange (ETDEWEB)
Margutti, Raffaella [Center for Interdisciplinary Exploration and Research in Astrophysics (CIERA), Department of Physics and Astronomy, Northwestern University, Evanston, IL 60208 (United States); Kamble, A.; Milisavljevic, D.; Drout, M.; Chakraborti, S.; Kirshner, R.; Parrent, J. T.; Patnaude, D.; Soderberg, A. M. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Zapartas, E.; De Mink, S. E. [Anton Pannenkoek Institute for Astronomy, University of Amsterdam, 1090 GE Amsterdam (Netherlands); Chornock, R. [Astrophysical Institute, Department of Physics and Astronomy, 251B Clippinger Lab, Ohio University, Athens, OH 45701 (United States); Risaliti, G. [INAF-Arcetri Astrophysical Observatory, Largo E. Fermi 5, I-50125 Firenze (Italy); Zauderer, B. A. [Center for Cosmology and Particle Physics, New York University, 4 Washington Place, New York, NY 10003 (United States); Bietenholz, M. [Department of Physics and Astronomy, York University, Toronto, ON M3J 1P3 (Canada); Cantiello, M. [Kavli Institute for Theoretical Physics, University of California, Santa Barbara, CA 93106 (United States); Chomiuk, L. [Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States); Fong, W. [Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Grefenstette, B. [Cahill Center for Astrophysics, 1216 E. California Boulevard, California Institute of Technology, Pasadena, CA 91125 (United States); Guidorzi, C. [University of Ferrara, Department of Physics and Earth Sciences, via Saragat 1, I-44122 Ferrara (Italy); and others
2017-02-01
We present multi-wavelength observations of SN 2014C during the first 500 days. These observations represent the first solid detection of a young extragalactic stripped-envelope SN out to high-energy X-rays ∼40 keV. SN 2014C shows ordinary explosion parameters ( E {sub k} ∼ 1.8 × 10{sup 51} erg and M {sub ej} ∼ 1.7 M{sub ⊙}). However, over an ∼1 year timescale, SN 2014C evolved from an ordinary hydrogen-poor supernova into a strongly interacting, hydrogen-rich supernova, violating the traditional classification scheme of type-I versus type-II SNe. Signatures of the SN shock interaction with a dense medium are observed across the spectrum, from radio to hard X-rays, and revealed the presence of a massive shell of ∼1 M {sub ⊙} of hydrogen-rich material at ∼6 × 10{sup 16} cm. The shell was ejected by the progenitor star in the decades to centuries before collapse. This result challenges current theories of massive star evolution, as it requires a physical mechanism responsible for the ejection of the deepest hydrogen layer of H-poor SN progenitors synchronized with the onset of stellar collapse. Theoretical investigations point at binary interactions and/or instabilities during the last nuclear burning stages as potential triggers of the highly time-dependent mass loss. We constrain these scenarios utilizing the sample of 183 SNe Ib/c with public radio observations. Our analysis identifies SN 2014C-like signatures in ∼10% of SNe. This fraction is reasonably consistent with the expectation from the theory of recent envelope ejection due to binary evolution if the ejected material can survive in the close environment for 10{sup 3}–10{sup 4} years. Alternatively, nuclear burning instabilities extending to core C-burning might play a critical role.
Spatially Resolved MaNGA Observations of the Host Galaxy of Superluminous Supernova 2017egm
Chen, Ting-Wan; Schady, Patricia; Xiao, Lin; Eldridge, J. J.; Schweyer, Tassilo; Lee, Chien-Hsiu; Yu, Po-Chieh; Smartt, Stephen J.; Inserra, Cosimo
2017-11-01
Superluminous supernovae (SLSNe) are found predominantly in dwarf galaxies, indicating that their progenitors have a low metallicity. However, the most nearby SLSN to date, SN 2017egm, occurred in the spiral galaxy NGC 3191, which has a relatively high stellar mass and correspondingly high metallicity. In this Letter, we present detailed analysis of the nearby environment of SN 2017egm using MaNGA IFU data, which provides spectral data on kiloparsec scales. From the velocity map we find no evidence that SN 2017egm occurred within some intervening satellite galaxy, and at the SN position most metallicity diagnostics yield a solar and above solar metallicity (12+{log}({{O}}/{{H}})∼ 8.8{--}9.1). Additionally, we measure a small Hα equivalent width (EW) at the SN position of just 34 Å, which is one of the lowest EWs measured at any SLSN or gamma-ray burst position, and indicative of the progenitor star being comparatively old. We also compare the observed properties of NGC 3191 with other SLSN host galaxies. The solar-metallicity environment at the position of SN 2017egm presents a challenge to our theoretical understanding, and our spatially resolved spectral analysis provides further constraints on the progenitors of SLSNe.
Data of evolutionary structure change: 1AJ8B-1IOMA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1AJ8B-1IOMA 1AJ8 1IOM B A LAKGLEDVYIDQTNICYIDGKEGKLYYRGYSVEELAELS...>GLY CA 362 ASP CA 307 LYS CA 257 1IOM... A 1IOMA EKLARLVAEKHGHS ARG CA 182 1IOM A 1IOM... 2.0784668922424316 2 1IOM
Data of evolutionary structure change: 1AJ8A-1IOMA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1AJ8A-1IOMA 1AJ8 1IOM A A LAKGLEDVYIDQTNICYIDGKEGKLYYRGYSVEELAELS...>GLY CA 362 ASP CA 303 LYS CA 256 1IOM... A 1IOMA EKLARLVAEKHGHS ARG CA 187 1IOM A 1IOM... 2.1075398921966553 2 1IOM
Production of {sup 44}Ti in neutrino-driven aspherical supernova explosions
Energy Technology Data Exchange (ETDEWEB)
Fujimoto, Shin-ichiro [Kumamoto National College of Technology, 2659-2 Suya, Goshi 861-1102 (Japan); Ono, Masaomi; Hashimoto, Masa-aki [Department of Physics, School of Sciences, Kyushu University, Fukuoka 810-8560 (Japan); Kotake, Kei [National Astronomical Observatory Japan, 2-21-1, Osawa, Mitaka, Tokyo, 181-8588 (Japan)
2014-05-02
We examine the synthesis of {sup 44}Ti in a neutrino-driven aspherical supernova (SN), focusing on reaction rates related to {sup 44}Ti and rotation of a progenitor. We have performed 2D hydrodynamic simulations of SN of a 15M{sub ⊙} progenitor, whose angular velocity is manually set to be a cylindrical distribution and have followed explosive nucleosynthesis in the ejecta. We find that the faster rates of {sup 40}Ca(α,γ){sup 44}Ti and the slower rate of {sup 44}Ti(α,p){sup 47}V lead to more massive ejection of {sup 44}Ti and {sup 56}Ni and larger ratios <{sup 44}Ti/{sup 56}Ni>. Faster rotation also results in more massive ejection of {sup 44}Ti and {sup 56}Ni. Ratios <{sup 44}Ti/{sup 56}Ni> are however independent from rotation. Large masses of {sup 44}Ti and large ratios
Exploring JLA supernova data with improved flux-averaging technique
Energy Technology Data Exchange (ETDEWEB)
Wang, Shuang; Wen, Sixiang; Li, Miao, E-mail: wangshuang@mail.sysu.edu.cn, E-mail: wensx@mail2.sysu.edu.cn, E-mail: limiao9@mail.sysu.edu.cn [School of Physics and Astronomy, Sun Yat-Sen University, University Road (No. 2), Zhuhai (China)
2017-03-01
In this work, we explore the cosmological consequences of the ''Joint Light-curve Analysis'' (JLA) supernova (SN) data by using an improved flux-averaging (FA) technique, in which only the type Ia supernovae (SNe Ia) at high redshift are flux-averaged. Adopting the criterion of figure of Merit (FoM) and considering six dark energy (DE) parameterizations, we search the best FA recipe that gives the tightest DE constraints in the ( z {sub cut}, Δ z ) plane, where z {sub cut} and Δ z are redshift cut-off and redshift interval of FA, respectively. Then, based on the best FA recipe obtained, we discuss the impacts of varying z {sub cut} and varying Δ z , revisit the evolution of SN color luminosity parameter β, and study the effects of adopting different FA recipe on parameter estimation. We find that: (1) The best FA recipe is ( z {sub cut} = 0.6, Δ z =0.06), which is insensitive to a specific DE parameterization. (2) Flux-averaging JLA samples at z {sub cut} ≥ 0.4 will yield tighter DE constraints than the case without using FA. (3) Using FA can significantly reduce the redshift-evolution of β. (4) The best FA recipe favors a larger fractional matter density Ω {sub m} . In summary, we present an alternative method of dealing with JLA data, which can reduce the systematic uncertainties of SNe Ia and give the tighter DE constraints at the same time. Our method will be useful in the use of SNe Ia data for precision cosmology.
ASPHERICITY, INTERACTION, AND DUST IN THE TYPE II-P/II-L SUPERNOVA 2013EJ IN MESSIER 74
Energy Technology Data Exchange (ETDEWEB)
Mauerhan, Jon C.; Graham, Melissa L.; Filippenko, Alexei V.; Shivvers, Isaac [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Van Dyk, Schuyler D. [Infrared Processing and Analysis Center, California Institute of Technology, 1200 E. California Boulevard, Pasadena, CA 91125 (United States); Johansson, Joel [Department of Particle Physics and Astrophysics, Weizmann Institute of Science, 234 Herzl St., Rehovot (Israel); Hu, Maokai; Wang, Lifan [Department of Physics, Texas A and M University, College Station, TX 77843 (United States); Fox, Ori D., E-mail: mauerhan@astro.berkeley.edu [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States)
2017-01-10
SN 2013ej is a well-studied core-collapse supernova (SN) that stemmed from a directly identified red supergiant (RSG) progenitor in galaxy M74. The source exhibits signs of substantial geometric asphericity, X-rays from persistent interaction with circumstellar material (CSM), thermal emission from warm dust, and a light curve that appears intermediate between supernovae of Types II-P and II-L. The proximity of this source motivates a close inspection of these physical characteristics and their potential interconnection. We present multiepoch spectropolarimetry of SN 2013ej during the first 107 days and deep optical spectroscopy and ultraviolet through infrared photometry past ∼800 days. SN 2013ej exhibits the strongest and most persistent continuum and line polarization ever observed for a SN of its class during the recombination phase. Modeling indicates that the data are consistent with an oblate ellipsoidal photosphere, viewed nearly edge-on and probably augmented by optical scattering from circumstellar dust. We suggest that interaction with an equatorial distribution of CSM, perhaps the result of binary evolution, is responsible for generating the photospheric asphericity. Relatedly, our late-time optical imaging and spectroscopy show that asymmetric CSM interaction is ongoing, and the morphology of broad H α emission from shock-excited ejecta provides additional evidence that the geometry of the interaction region is ellipsoidal. Alternatively, a prolate ellipsoidal geometry from an intrinsically bipolar explosion is also a plausible interpretation of the data but would probably require a ballistic jet of radioactive material capable of penetrating the hydrogen envelope early in the recombination phase. Finally, our latest space-based optical imaging confirms that the late interaction-powered light curve dropped below the stellar progenitor level, confirming the RSG star’s association with the explosion.
The early detection and follow-up of the highly obscured Type II supernova 2016ija/DLT16am
DEFF Research Database (Denmark)
Tartaglia, L.; Sand, D. J.; Valenti, S.
2018-01-01
We present our analysis of the Type II supernova DLT16am (SN~2016ija). The object was discovered during the ongoing $\\rm{D}`edge-on nearby ($D=20.0\\pm1.9\\,\\rm{Mpc}$) galaxy NGC~1532. The subsequent prompt and high-cadenced spectroscopic and photometric follow-up revealed a highly extincted...
Neutrinos from supernova explosion and the Mikheyev-Smirnov-Wolfenstein effect
International Nuclear Information System (INIS)
Minakata, H.; Nunokawa, H.; Shiraishi, K.; Suzuki, H.
1987-01-01
It is shown that by taking the effect of the Earth into account the possible observation of electron neutrinos from the supernova SN1987A at the Kamiokande II is compatible with the solution of the solar neutrino puzzle by the Mikheyev-Smirnov-Wolfenstein mechanism. The authors' scenario requires relatively large mixing angles sin/sup 2/ 2θ>≥0.3 and, most probably, Δm/sup 2/ of the order of 10/sup -6/ -- 10/sup -5/(eV)/sup 2/. The implications of possible observation in other neutrino detectors are briefly discussed
THE 2012 RISE OF THE REMARKABLE TYPE IIn SN 2009ip
International Nuclear Information System (INIS)
Prieto, José L.; Brimacombe, J.; Drake, A. J.; Howerton, S.
2013-01-01
Recent observations by Mauerhan et al. have shown the unprecedented transition of the previously identified luminous blue variable (LBV) and supernova (SN) impostor SN 2009ip to a real Type IIn SN explosion. We present ∼100 optical R- and I-band photometric measurements of SN 2009ip obtained between UT 2012 September 23.6 and October 9.6, using 0.3-0.4 m aperture telescopes from the Coral Towers Observatory in Cairns, Australia. The light curves show well-defined phases, including very rapid brightening early on (0.5 mag in 6 hr observed during the night of September 24), a transition to a much slower rise between September 25 and September 28, and a plateau/peak around October 7. These changes are coincident with the reported spectroscopic changes that most likely mark the start of a strong interaction between the fast SN ejecta and a dense circumstellar medium formed during the LBV eruptions observed in recent years. In the 16-day observing period, SN 2009ip brightened by 3.7 mag from I = 17.4 mag on September 23.6 (M I ≅ –14.2) to I = 13.7 mag (M I ≅ –17.9) on October 9.6, radiating ∼3 × 10 49 erg in the optical wavelength range. As of 2012 October 9.6, SN 2009ip is more luminous than most Type IIP SN and comparable to other Type IIn SN.
Two populations of progenitors for Type Ia supernovae?
Mannucci, F.; Della Valle, M.; Panagia, N.
2006-08-01
We use recent observations of the evolution of the Type Ia supernova (SN Ia) rate with redshift, the dependence of the SN Ia rate on the colours of the parent galaxies, and the enhancement of the SN Ia rate in radio-loud early-type galaxies to derive on robust empirical grounds, the delay time distribution (DTD) between the formation of the progenitor star and its explosion as an SN. Our analysis finds: (i) delay times as long as 3-4 Gyr, derived from observations of SNe Ia at high redshift, cannot reproduce the dependence of the SN Ia rate on the colours and on the radio-luminosity of the parent galaxies, as observed in the local Universe; (ii) the comparison between observed SN rates and a grid of theoretical `single-population' DTDs shows that only a few of them are possibly consistent with observations. The most successful models are all predicting a peak of SN explosions soon after star formation and an extended tail in the DTD, and can reproduce the data but only at a modest statistical confidence level; (iii) present data are best matched by a bimodal DTD, in which about 50 per cent of SNe Ia (dubbed `prompt' SNe Ia) explode soon after their stellar birth, in a time of the order of 108 yr, while the remaining 50 per cent (`tardy' SNe Ia) have a much wider distribution, well described by an exponential function with a decay time of about 3 Gyr. The presence in the DTD of both a strong peak at early times and a prolonged exponential tail, coupled with the well-established bimodal distribution of the decay rate (Δm15) and the systematic difference observed in the expansion velocities of the ejecta of SNe Ia in ellipticals and spirals, suggests the existence of two classes of progenitors. We discuss the cosmological implications of this result and make simple predictions, which are testable with future instrumentation.
Explosive nucleosynthesis in a neutrino-driven core collapse supernova
International Nuclear Information System (INIS)
Fujimoto, Shin-ichiro; Kotake, Kei; Hashimoto, Masa-aki; Ono, Masaomi; Ohnishi, Naofumi
2010-01-01
We investigate explosive nucleosynthesis in a delayed neutrino-driven, supernova explosion aided by standing accretion shock instability (SASI), based on two-dimensional hydrodynamic simulations of the explosion of a 15 M · star. We take into accounts neutrino heating and cooling as well as change in electron fraction due to weak interactions appropriately, in the two-dimensional simulations. We assume the isotropic emission of neutrinos from the neutrino spheres with given luminosities. and the Fermi-Dirac distribution of given temperatures. We find that the stalled shock revives due to the neutrino heating aided by SASI for cases with L νe ≥3.9x10 52 ergss -1 and the as-pherical shock passes through the outer layers of the star (≥10,000 km), with the explosion energies of ∼10 51 ergs.Next we examine abundances and masses of the supernova ejecta. We find that masses of the ejecta and 56 Ni correlate with the neutrino luminosity, and 56 Ni mass is comparable to that observed in SN 1987A. We also find that abundance pattern of the supernova ejecta is similar to that of the solar system, for cases with high explosion energies of >10 51 ergs. We emphasize that 64 Zn, which is underproduced in the spherical case, is abundantly produced in slightly neutron-rich ejecta.
Energy Technology Data Exchange (ETDEWEB)
Yokozawa, Takaaki; Asano, Mitsuhiro; Kanda, Nobuyuki [Graduate School of Science, Osaka City University, Sumiyoshi-ku, Osaka 558-8585 (Japan); Kayano, Tsubasa; Koshio, Yusuke [Department of Physics, Okayama University, Okayama, Okayama, 700-8530 (Japan); Suwa, Yudai [Yukawa Institute for Theoretical Physics, Kyoto University, Oiwake-cho, Kitashirakawa, Sakyo-ku, Kyoto 606-8502 (Japan); Vagins, Mark R. [Kavli Institute for the Physics and Mathematics of the Universe (WPI), University of Tokyo Institutes for Advanced Study, University of Tokyo, Kashiwa, Chiba 277-8583 (Japan)
2015-10-01
The next time a core-collapse supernova (SN) explodes in our galaxy, various detectors will be ready and waiting to detect its emissions of gravitational waves (GWs) and neutrinos. Current numerical simulations have successfully introduced multi-dimensional effects to produce exploding SN models, but thus far the explosion mechanism is not well understood. In this paper, we focus on an investigation of progenitor core rotation via comparison of the start time of GW emission and that of the neutronization burst. The GW and neutrino detectors are assumed to be, respectively, the KAGRA detector and a co-located gadolinium-loaded water Cherenkov detector, either EGADS or GADZOOKS!. Our detection simulation studies show that for a nearby SN (0.2 kpc) we can confirm the lack of core rotation close to 100% of the time, and the presence of core rotation about 90% of the time. Using this approach there is also the potential to confirm rotation for considerably more distant Milky Way SN explosions.
EVOLUTION IN THE VOLUMETRIC TYPE Ia SUPERNOVA RATE FROM THE SUPERNOVA LEGACY SURVEY
Energy Technology Data Exchange (ETDEWEB)
Perrett, K.; Gonzalez-Gaitan, S.; Carlberg, R. [Department of Astronomy and Astrophysics, University of Toronto, 50 St. George Street, Toronto, ON, M5S 3H4 (Canada); Sullivan, M.; Hook, I. M. [Department of Physics (Astrophysics), University of Oxford, DWB, Keble Road, Oxford OX1 3RH (United Kingdom); Conley, A. [Center for Astrophysics and Space Astronomy, University of Colorado, 593 UCB, Boulder, CO 80309-0593 (United States); Fouchez, D. [CPPM, CNRS-IN2P3 and University Aix Marseille II, Case 907, 13288 Marseille cedex 9 (France); Ripoche, P. [Lawrence Berkeley National Laboratory, Mail Stop 50-232, 1 Cyclotron Road, Berkeley, CA 94720 (United States); Neill, J. D. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, 1200 East California Blvd., Pasadena, CA 91125 (United States); Astier, P.; Balland, C.; Guy, J.; Hardin, D.; Pain, R.; Regnault, N. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Paris Diderot Paris 7, CNRS-IN2P3, 4 place Jussieu, 75005 Paris (France); Balam, D. [Dominion Astrophysical Observatory, Herzberg Institute of Astrophysics, 5071 West Saanich Road, Victoria, BC, V9E 2E7 (Canada); Basa, S. [Laboratoire d' Astrophysique de Marseille, Pole de l' Etoile Site de Chateau-Gombert, 38, rue Frederic Joliot-Curie, 13388 Marseille cedex 13 (France); Howell, D. A. [Las Cumbres Observatory Global Telescope Network, 6740 Cortona Dr., Suite 102, Goleta, CA 93117 (United States); Palanque-Delabrouille, N. [DSM/IRFU/SPP, CEA-Saclay, F-91191 Gif-sur-Yvette (France); Pritchet, C., E-mail: perrett@astro.utoronto.ca, E-mail: sullivan@astro.ox.ac.uk [Department of Physics and Astronomy, University of Victoria, P.O. Box 3055, Stn CSC, Victoria, BC, V8W 3P6 (Canada); and others
2012-08-15
We present a measurement of the volumetric Type Ia supernova (SN Ia) rate (SNR{sub Ia}) as a function of redshift for the first four years of data from the Canada-France-Hawaii Telescope Supernova Legacy Survey (SNLS). This analysis includes 286 spectroscopically confirmed and more than 400 additional photometrically identified SNe Ia within the redshift range 0.1 {<=} z {<=} 1.1. The volumetric SNR{sub Ia} evolution is consistent with a rise to z {approx} 1.0 that follows a power law of the form (1+z){sup {alpha}}, with {alpha} = 2.11 {+-} 0.28. This evolutionary trend in the SNLS rates is slightly shallower than that of the cosmic star formation history (SFH) over the same redshift range. We combine the SNLS rate measurements with those from other surveys that complement the SNLS redshift range, and fit various simple SN Ia delay-time distribution (DTD) models to the combined data. A simple power-law model for the DTD (i.e., {proportional_to}t{sup -{beta}}) yields values from {beta} = 0.98 {+-} 0.05 to {beta} = 1.15 {+-} 0.08 depending on the parameterization of the cosmic SFH. A two-component model, where SNR{sub Ia} is dependent on stellar mass (M{sub stellar}) and star formation rate (SFR) as SNR{sub Ia}(z) = A Multiplication-Sign M{sub stellar}(z) + B Multiplication-Sign SFR(z), yields the coefficients A = (1.9 {+-} 0.1) Multiplication-Sign 10{sup -14} SNe yr{sup -1} M{sup -1}{sub Sun} and B = (3.3 {+-} 0.2) Multiplication-Sign 10{sup -4} SNe yr{sup -1} (M{sub Sun} yr{sup -1}){sup -1}. More general two-component models also fit the data well, but single Gaussian or exponential DTDs provide significantly poorer matches. Finally, we split the SNLS sample into two populations by the light-curve width (stretch), and show that the general behavior in the rates of faster-declining SNe Ia (0.8 {<=} s < 1.0) is similar, within our measurement errors, to that of the slower objects (1.0 {<=} s < 1.3) out to z {approx} 0.8.
Massive Star Burps, Then Explodes
2007-04-01
Berkeley -- In a galaxy far, far away, a massive star suffered a nasty double whammy. On Oct. 20, 2004, Japanese amateur astronomer Koichi Itagaki saw the star let loose an outburst so bright that it was initially mistaken for a supernova. The star survived, but for only two years. On Oct. 11, 2006, professional and amateur astronomers witnessed the star actually blowing itself to smithereens as Supernova 2006jc. Swift UVOT Image Swift UVOT Image (Credit: NASA / Swift / S.Immler) "We have never observed a stellar outburst and then later seen the star explode," says University of California, Berkeley, astronomer Ryan Foley. His group studied the event with ground-based telescopes, including the 10-meter (32.8-foot) W. M. Keck telescopes in Hawaii. Narrow helium spectral lines showed that the supernova's blast wave ran into a slow-moving shell of material, presumably the progenitor's outer layers ejected just two years earlier. If the spectral lines had been caused by the supernova's fast-moving blast wave, the lines would have been much broader. artistic rendering This artistic rendering depicts two years in the life of a massive blue supergiant star, which burped and spewed a shell of gas, then, two years later, exploded. When the supernova slammed into the shell of gas, X-rays were produced. (Credit: NASA/Sonoma State Univ./A.Simonnet) Another group, led by Stefan Immler of NASA's Goddard Space Flight Center, Greenbelt, Md., monitored SN 2006jc with NASA's Swift satellite and Chandra X-ray Observatory. By observing how the supernova brightened in X-rays, a result of the blast wave slamming into the outburst ejecta, they could measure the amount of gas blown off in the 2004 outburst: about 0.01 solar mass, the equivalent of about 10 Jupiters. "The beautiful aspect of our SN 2006jc observations is that although they were obtained in different parts of the electromagnetic spectrum, in the optical and in X-rays, they lead to the same conclusions," says Immler. "This
VizieR Online Data Catalog: Radio observations of SN 2009bb (Soderberg+, 2010)
Soderberg, A. M.; Chakraborti, S.; Pignata, G.; Chevalier, R. A.; Chandra, P.; Ray, A.; Wieringa, M. H.; Copete, A.; Chaplin, V.; Connaughton, V.; Barthelmy, S. D.; Bietenholz, M. F.; Chugai, N.; Stritzinger, M. D.; Hamuy, M.; Fransson, C.; Fox, O.; Levesque, E. M.; Grindlay, J. E.; Challis, P.; Foley, R. J.; Kirshner, R. P.; Milne, P. A.; Torres, M. A. P.
2010-02-01
Long duration gamma-ray bursts (GRBs) mark the explosive death of some massive stars and are a rare sub-class of type Ibc supernovae. They are distinguished by the production of an energetic and collimated relativistic outflow powered by a central engine (an accreting black hole or neutron star). Observationally, this outflow is manifested in the pulse of gamma-rays and a long-lived radio afterglow. Until now, central-engine-driven supernovae have been discovered exclusively through their gamma-ray emission, yet it is expected that a larger population goes undetected because of limited satellite sensitivity or beaming of the collimated emission away from our line of sight. In this framework, the recovery of undetected GRBs may be possible through radio searches for type Ibc supernovae with relativistic outflows. Here we report the discovery of luminous radio emission from the seemingly ordinary type Ibc SN 2009bb, which requires a substantial relativistic outflow powered by a central engine. A comparison with our radio survey of type Ibc supernovae reveals that the fraction harbouring central engines is low, about one per cent, measured independently from, but consistent with, the inferred rate of nearby GRBs. Independently, a second mildly relativistic supernova has been reported. (1 data file).
Comparison of distance information given by SN Ia, BAO and CMB
International Nuclear Information System (INIS)
Li Hong
2011-01-01
The observations of Type Ia supernovae (SN Ia), Baryon Acoustic Oscillations (BAO) and Cosmic Microwave Background radiation (CMB) provide powerful tools for the measurement of cosmological parameters. One of the most useful information encodes in the distance measured by those probes. In this Letter, we test the coherence of the observational information provided by SN Ia, BAO and CMB experiments. We make two kinds of comparison: the first is the constraints on cosmological parameters of the equation of state parameter (EoS) of dark energy (DE) and matter budget parameter Ω m from the latest data by global fitting, and we find the large discrepancy from those different probes. The second comparison is performed among the derived distance information from these observations at certain appointed redshift, the results show that the distance provided by WMAP5 are larger than those from SN Ia and BAO on the whole.
The many sides of RCW 86: a Type Ia supernova remnant evolving in its progenitor's wind bubble
Broersen, Sjors; Chiotellis, Alexandros; Vink, Jacco; Bamba, Aya
2014-07-01
We present the results of a detailed investigation of the Galactic supernova remnant RCW 86 using the XMM-Newton X-ray telescope. RCW 86 is the probable remnant of SN 185 A.D., a supernova that likely exploded inside a wind-blown cavity. We use the XMM-Newton Reflection Grating Spectrometer to derive precise temperatures and ionization ages of the plasma, which are an indication of the interaction history of the remnant with the presumed cavity. We find that the spectra are well fitted by two non-equilibrium ionization models, which enables us to constrain the properties of the ejecta and interstellar matter plasma. Furthermore, we performed a principal component analysis on EPIC MOS and pn data to find regions with particular spectral properties. We present evidence that the shocked ejecta, emitting Fe K and Si line emission, are confined to a shell of approximately 2 pc width with an oblate spheroidal morphology. Using detailed hydrodynamical simulations, we show that general dynamical and emission properties at different portions of the remnant can be well reproduced by a Type Ia supernova that exploded in a non-spherically symmetric wind-blown cavity. We also show that this cavity can be created using general wind properties for a single degenerate system. Our data and simulations provide further evidence that RCW 86 is indeed the remnant of SN 185, and is the likely result of a Type Ia explosion of single degenerate origin.
International Nuclear Information System (INIS)
Foley, Ryan J.; Filippenko, Alexei V.; Leonard, Douglas C.; Riess, Adam G.; Nugent, Peter; Perlmutter, Saul
2005-01-01
We have obtained high-quality Keck optical spectra at three epochs of the Type Ia supernova 1997ex, whose redshift z is 0.361. The elapsed calendar time between the first two spectra was 24.88 days, and that between the first and third spectra was 30.95 days. In an expanding universe where 1+z represents the factor by which space has expanded between the emission and detection of light, the amount of aging in the supernova rest frame should be a factor of 1/(1+z) smaller than the observed-frame aging; thus, we expect SN 1997ex to have aged 18.28 and 22.74 days between the first epoch and the second and third epochs, respectively. The quantitative method for determining the spectral-feature age of an SN Ia reveals that the corresponding elapsed times in the supernova rest frame were 16.97+/-2.75 and 18.01+/-3.14 days, respectively. This result is inconsistent with no time dilation with a significance level of 99.0 percent, providing evidence against ''tired light'' and other hypotheses in which no time dilation is expected. Moreover, the observed timescale of spectral evolution is inconsistent with that expected in the ''variable mass theory''. The result is within ∼1 of the aging expected from a universe in which redshift is produced by cosmic expansion
Multiepoch Spectropolarimetry of SN 2011fe
International Nuclear Information System (INIS)
Milne, Peter A.; Williams, G. Grant; Smith, Paul S.; Smith, Nathan; Jannuzi, Buell T.; Green, E. M.; Porter, Amber; Leising, Mark D.
2017-01-01
We present multiple spectropolarimetric observations of the nearby Type Ia supernova (SN) 2011fe in M101, obtained before, during, and after the time of maximum apparent visual brightness. The excellent time coverage of our spectropolarimetry has allowed better monitoring of the evolution of polarization features than is typical, which has allowed us new insight into the nature of normal SNe Ia. SN 2011fe exhibits time-dependent polarization in both the continuum and strong absorption lines. At early epochs, red wavelengths exhibit a degree of continuum polarization of up to 0.4%, likely indicative of a mild asymmetry in the electron-scattering photosphere. This behavior is more common in subluminous SNe Ia than in normal events, such as SN 2011fe. The degree of polarization across a collection of absorption lines varies dramatically from epoch to epoch. During the earliest epoch, a λ 4600–5000 Å complex of absorption lines shows enhanced polarization at a different position angle than the continuum. We explore the origin of these features, presenting a few possible interpretations, without arriving at a single favored ion. During two epochs near maximum, the dominant polarization feature is associated with the Si ii λ 6355 Å absorption line. This is common for SNe Ia, but for SN 2011fe the polarization of this feature increases after maximum light, whereas for other SNe Ia, that polarization feature was strongest before maximum light.
Multiepoch Spectropolarimetry of SN 2011fe
Energy Technology Data Exchange (ETDEWEB)
Milne, Peter A.; Williams, G. Grant; Smith, Paul S.; Smith, Nathan; Jannuzi, Buell T.; Green, E. M. [University of Arizona, Steward Observatory, 933 N. Cherry Avenue, Tucson, AZ 85721 (United States); Porter, Amber; Leising, Mark D. [118 Kinard Laboratory, Clemson University, Clemson, SC 29634 (United States)
2017-01-20
We present multiple spectropolarimetric observations of the nearby Type Ia supernova (SN) 2011fe in M101, obtained before, during, and after the time of maximum apparent visual brightness. The excellent time coverage of our spectropolarimetry has allowed better monitoring of the evolution of polarization features than is typical, which has allowed us new insight into the nature of normal SNe Ia. SN 2011fe exhibits time-dependent polarization in both the continuum and strong absorption lines. At early epochs, red wavelengths exhibit a degree of continuum polarization of up to 0.4%, likely indicative of a mild asymmetry in the electron-scattering photosphere. This behavior is more common in subluminous SNe Ia than in normal events, such as SN 2011fe. The degree of polarization across a collection of absorption lines varies dramatically from epoch to epoch. During the earliest epoch, a λ 4600–5000 Å complex of absorption lines shows enhanced polarization at a different position angle than the continuum. We explore the origin of these features, presenting a few possible interpretations, without arriving at a single favored ion. During two epochs near maximum, the dominant polarization feature is associated with the Si ii λ 6355 Å absorption line. This is common for SNe Ia, but for SN 2011fe the polarization of this feature increases after maximum light, whereas for other SNe Ia, that polarization feature was strongest before maximum light.
Deja Vu All Over Again: The Reappearance of Supernova Refsdal
Kelly, P. L.; Rodney, S. A.; Treu, T.; Strolger, L.-G.; Foley, R. J.; Jha, S. W.; Selsing, J.; Brammer, G.; Bradač, M.; Cenko, S. B.; Graur, O.; Filippenko, A. V.; Hjorth, J.; McCully, C.; Molino, A.; Nonino, M.; Riess, A. G.; Schmidt, K. B.; Tucker, B.; von der Linden, A.; Weiner, B. J.; Zitrin, A.
2016-03-01
In Hubble Space Telescope (HST) imaging taken on 2014 November 10, four images of supernova (SN) “Refsdal” (redshift z = 1.49) appeared in an Einstein-cross-like configuration (images S1-S4) around an early-type galaxy in the cluster MACS J1149.5+2223 (z = 0.54). Almost all lens models of the cluster have predicted that the SN should reappear within a year in a second host-galaxy image created by the cluster’s potential. In HST observations taken on 2015 December 11, we find a new source at the predicted position of the new image of SN Refsdal approximately 8\\prime\\prime from the previous images S1-S4. This marks the first time the appearance of a SN at a particular time and location in the sky was successfully predicted in advance! We use these data and the light curve from the first four observed images of SN Refsdal to place constraints on the relative time delay and magnification of the new image (SX) compared to images S1-S4. This enables us, for the first time, to test “blind” lens model predictions of both magnifications and time delays for a lensed SN. We find that the timing and brightness of the new image are consistent with the blind predictions of a fraction of the models. The reappearance illustrates the discriminatory power of this blind test and its utility to uncover sources of systematic uncertainty. From planned HST photometry, we expect to reach a precision of 1%-2% on the time delay between S1-S4 and SX.
INTERSTELLAR-MEDIUM MAPPING IN M82 THROUGH LIGHT ECHOES AROUND SUPERNOVA 2014J
Energy Technology Data Exchange (ETDEWEB)
Yang, Yi; Wang, Lifan; Brown, Peter J. [George P. and Cynthia Woods Mitchell Institute for Fundamental Physics and Astronomy, Texas A. and M. University, Department of Physics and Astronomy, 4242 TAMU, College Station, TX 77843 (United States); Baade, Dietrich; Patat, Ferdinando; Spyromilio, Jason [European Organisation for Astronomical Research in the Southern Hemisphere (ESO), Karl-Schwarzschild-Straße 2, D-85748 Garching b. München (Germany); Cracraft, Misty; Sparks, William B. [Space Telescope Science Institute, Baltimore, MD 21218 (United States); Höflich, Peter A. [Department of Physics, Florida State University, Tallahassee, Florida 32306-4350 (United States); Maund, Justyn; Stevance, Heloise F. [Department of Physics and Astronomy, University of Sheffield, Hicks Building, Hounsfield Road, Sheffield S3 7RH (United Kingdom); Wang, Xiaofeng [Physics Department and Tsinghua Center for Astrophysics (THCA), Tsinghua University, Beijing, 100084 (China); Wheeler, J. Craig, E-mail: ngc4594@physics.tamu.edu [Department of Astronomy and McDonald Observatory, The University of Texas at Austin, Austin, TX 78712 (United States)
2017-01-01
We present multiple-epoch measurements of the size and surface brightness of the light echoes from supernova (SN) 2014J in the nearby starburst galaxy M82. Hubble Space Telescope ( HST ) ACS/WFC images were taken ∼277 and ∼416 days after B -band maximum in the filters F 475 W , F 606 W , and F 775 W . Observations with HST WFC3/UVIS images at epochs ∼216 and ∼365 days are included for a more complete analysis. The images reveal the temporal evolution of at least two major light-echo components. The first one exhibits a filled ring structure with position-angle-dependent intensity. This radially extended, diffuse echo indicates the presence of an inhomogeneous interstellar dust cloud ranging from ∼100 to ∼500 pc in the foreground of the SN. The second echo component appears as an unresolved luminous quarter-circle arc centered on the SN. The wavelength dependence of scattering measured in different dust components suggests that the dust producing the luminous arc favors smaller grain sizes, while that causing the diffuse light echo may have sizes similar to those of the Milky Way dust. Smaller grains can produce an optical depth consistent with that along the supernova-Earth line of sight measured by previous studies around maximum light. Therefore, it is possible that the dust slab from which the luminous arc arises is also responsible for most of the extinction toward SN 2014J. The optical depths determined from the Milky Way-like dust in the scattering matters are lower than the optical depth produced by the dust slab.
Murdin, Paul
2017-01-01
This reference work gathers all of the latest research in the supernova field areas to create a definitive source book on supernovae, their remnants and related topics. It includes each distinct subdiscipline, including stellar types, progenitors, stellar evolution, nucleosynthesis of elements, supernova types, neutron stars and pulsars, black holes, swept up interstellar matter, cosmic rays, neutrinos from supernovae, supernova observations in different wavelengths, interstellar molecules and dust. While there is a great deal of primary and specialist literature on supernovae, with a great many scientific groups around the world focusing on the phenomenon and related subdisciplines, nothing else presents an overall survey. This handbook closes that gap at last. As a comprehensive and balanced collection that presents the current state of knowledge in the broad field of supernovae, this is to be used as a basis for further work and study by graduate students, astronomers and astrophysicists working in close/r...
Supernovae from massive stars with extended tenuous envelopes
Dessart, Luc; Yoon, Sung-Chul; Livne, Eli; Waldman, Roni
2018-04-01
Massive stars with a core-halo structure are interesting objects for stellar physics and hydrodynamics. Using simulations for stellar evolution, radiation hydrodynamics, and radiative transfer, we study the explosion of stars with an extended and tenuous envelope (i.e. stars in which 95% of the mass is contained within 10% or less of the surface radius). We consider both H-rich supergiant and He-giant progenitors resulting from close-binary evolution and dying with a final mass of 2.8-5 M⊙. An extended envelope causes the supernova (SN) shock to brake and a reverse shock to form, sweeping core material into a dense shell. The shock-deposited energy, which suffers little degradation from expansion, is trapped in ejecta layers of moderate optical depth, thereby enhancing the SN luminosity at early times. With the delayed 56Ni heating, we find that the resulting optical and near-IR light curves all exhibit a double-peak morphology. We show how an extended progenitor can explain the blue and featureless optical spectra of some Type IIb and Ib SNe. The dense shell formed by the reverse shock leads to line profiles with a smaller and near-constant width. This ejecta property can explain the statistically narrower profiles of Type IIb compared to Type Ib SNe, as well as the peculiar Hα profile seen in SN 1993J. At early times, our He-giant star explosion model shows a high luminosity, a blue colour, and featureless spectra reminiscent of the Type Ib SN 2008D, suggesting a low-mass progenitor.
THE PRODUCTION RATE OF SN Ia EVENTS IN GLOBULAR CLUSTERS
International Nuclear Information System (INIS)
Washabaugh, Pearce C.; Bregman, Joel N.
2013-01-01
In globular clusters, dynamical evolution produces luminous X-ray emitting binaries at a rate about 200 times greater than in the field. If globular clusters also produce SN Ia at a high rate, it would account for many of the SN Ia production in early-type galaxies and provide insight into their formation. Here we use archival Hubble Space Telescope (HST) images of nearby galaxies that have hosted an SN Ia to examine the rate at which globular clusters produce these events. The location of the SN Ia is registered on an HST image obtained before the event or after the supernova (SN) faded. Of the 36 nearby galaxies examined, 21 had sufficiently good data to search for globular cluster hosts. None of the 21 SNe have a definite globular cluster counterpart, although there are some ambiguous cases. This places an upper limit to the enhancement rate of SN Ia production in globular clusters of about 42 at the 95% confidence level, which is an order of magnitude lower than the enhancement rate for luminous X-ray binaries. Even if all of the ambiguous cases are considered as having a globular cluster counterpart, the upper bound for the enhancement rate is 82 at the 95% confidence level, still a factor of several below that needed to account for half of the SN Ia events. Barring unforeseen selection effects, we conclude that globular clusters are not responsible for producing a significant fraction of the SN Ia events in early-type galaxies.
Energy Technology Data Exchange (ETDEWEB)
Sand, David J.; Graham, Melissa L. [Las Cumbres Observatory Global Telescope Network, 6740 Cortona Drive, Suite 102, Santa Barbara, CA 93117 (United States); Bildfell, Chris; Pritchet, Chris [Department of Physics and Astronomy, University of Victoria, P.O. Box 3055, STN CSC, Victoria BC V8W 3P6 (Canada); Zaritsky, Dennis; Just, Dennis W.; Herbert-Fort, Stephane [Steward Observatory, University of Arizona, Tucson, AZ 85721 (United States); Hoekstra, Henk [Leiden Observatory, Leiden University, Niels Bohrweg 2, NL-2333 CA Leiden (Netherlands); Sivanandam, Suresh [Dunlap Institute for Astronomy and Astrophysics, 50 St. George Street, Toronto, ON M5S 3H4 (Canada); Foley, Ryan J. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Mahdavi, Andisheh, E-mail: dsand@lcogt.net [Department of Physics and Astronomy, San Francisco State University, San Francisco, CA 94132 (United States)
2012-02-20
We describe the Multi-Epoch Nearby Cluster Survey, designed to measure the cluster Type Ia supernova (SN Ia) rate in a sample of 57 X-ray selected galaxy clusters, with redshifts of 0.05 < z < 0.15. Utilizing our real-time analysis pipeline, we spectroscopically confirmed twenty-three cluster SNe Ia, four of which were intracluster events. Using our deep Canada-France-Hawaii Telescope/MegaCam imaging, we measured total stellar luminosities in each of our galaxy clusters, and we performed detailed supernova (SN) detection efficiency simulations. Bringing these ingredients together, we measure an overall cluster SN Ia rate within R{sub 200} (1 Mpc) of 0.042{sup +0.012}{sub -0.010}{sup +0.010}{sub -0.008} SNuM (0.049{sup +0.016}{sub -0.014}{sup +0.005}{sub -0.004} SNuM) and an SN Ia rate within red-sequence galaxies of 0.041{sup +0.015}{sub -0.015}{sup +0.005}{sub -0.010} SNuM (0.041{sup +0.019}{sub -0.015}{sup +0.005}{sub -0.004} SNuM). The red-sequence SN Ia rate is consistent with published rates in early-type/elliptical galaxies in the 'field'. Using our red-sequence SN Ia rate, and other cluster SN measurements in early-type galaxies up to z {approx} 1, we derive the late-time (>2 Gyr) delay time distribution (DTD) of SN Ia assuming a cluster early-type galaxy star formation epoch of z{sub f} = 3. Assuming a power-law form for the DTD, {Psi}(t){proportional_to}t{sup s} , we find s = -1.62 {+-} 0.54. This result is consistent with predictions for the double degenerate SN Ia progenitor scenario (s {approx} -1) and is also in line with recent calculations for the double detonation explosion mechanism (s {approx} -2). The most recent calculations of the single degenerate scenario DTD predicts an order-of-magnitude drop-off in SN Ia rate {approx}6-7 Gyr after stellar formation, and the observed cluster rates cannot rule this out.
Kuranz, Carolyn C.; Drake, R. Paul; Park, Hye Sook; Huntington, Channing; Miles, Aaron R.; Remington, Bruce A.; Plewa, Tomek; Trantham, Matt; Shvarts, Dov; Raman, Kumar; MacLaren, Steven; Wan, Wesley; Doss, Forrest; Kline, John; Flippos, Kirk; Malamud, Guy; Handy, Timothy; Prisbey, Shon; Grosskopf, Michael; Krauland, Christine; Klein, Sallee; Harding, Eric; Wallace, Russell; Marion, Donna; Kalantar, Dan
2017-06-01
Energy-transport effects can alter the structure that develops as a supernova evolves into a supernova remnant. The Rayleigh Taylor (RT) instability is thought to produce structure at the interface between the stellar ejecta and the circumstellar matter (CSM), based on simple models and hydrodynamic simulations. When a blast wave emerges from an exploding star, it drives a forward shock into the CSM and a reverse shock forms in the expanding stellar ejecta, creating a young supernova remnant (SNR). As mass accumulates in the shocked layers, the interface between these two shocks decelerates, becoming unstable to the RT instability. Simulations predict that RT produces structures at this interface, having a range of spatial scales. When the CSM is dense enough, as in the case of SN 1993J, the hot shocked matter can produce significant radiative fluxes that affect the emission from the SNR. Here we report experimental results from the National Ignition Facility (NIF) to explore how large energy fluxes, which are present in supernovae such as SN 1993J, might affect this structure. The experiment used NIF to create a RT unstable interface subject to a high energy flux by the emergence of a blast wave into lower-density matter, in analogy to the SNR. We also preformed and with a low energy flux to compare the affect of the energy flux on the instability growth. We found that the RT growth was reduced in the experiments with a high energy flux. In analyzing the comparison with SN 1993J, we discovered that the energy fluxes produced by heat conduction appear to be larger than the radiative energy fluxes, and large enough to have dramatic consequences. No reported astrophysical simulations have included radiation and heat conduction self-consistently in modeling SNRs.
THE IMPACT OF METALLICITY ON THE RATE OF TYPE Ia SUPERNOVAE
Energy Technology Data Exchange (ETDEWEB)
Kistler, Matthew D. [California Institute of Technology, Mail Code 350-17, Pasadena, CA 91125 (United States); Stanek, K. Z.; Kochanek, Christopher S.; Thompson, Todd A. [Center for Cosmology and Astro-Particle Physics, Ohio State University, Columbus, OH 43210 (United States); Prieto, Jose L. [Carnegie Observatories, 813 Santa Barbara Street, Pasadena, CA 91101 (United States)
2013-06-20
The metallicity of a star strongly affects both its evolution and the properties of the stellar remnant that results from its demise. It is generally accepted that stars with initial masses below {approx}8 M{sub Sun} leave behind white dwarfs and that some sub-population of these lead to Type Ia supernovae (SNe Ia). However, it is often tacitly assumed that metallicity has no effect on the rate of SNe Ia. We propose that a consequence of the effects of metallicity is to significantly increase the SN Ia rate in lower-metallicity galaxies, in contrast to previous expectations. This is because lower-metallicity stars leave behind higher-mass white dwarfs, which should be easier to bring to explosion. We first model SN Ia rates in relation to galaxy masses and ages alone, finding that the elevation in the rate of SNe Ia in lower-mass galaxies measured by Lick Observatory SN Search is readily explained. However, we then see that models incorporating this effect of metallicity agree just as well. Using the same parameters to estimate the cosmic SN Ia rate, we again find good agreement with data up to z Almost-Equal-To 2. We suggest that this degeneracy warrants more detailed examination of host galaxy metallicities. We discuss additional implications, including for hosts of high-z SNe Ia, the SN Ia delay time distribution, super-Chandrasekhar SNe, and cosmology.
X-RAY AND GAMMA-RAY FLASHES FROM TYPE Ia SUPERNOVAE?
International Nuclear Information System (INIS)
Hoeflich, Peter; Schaefer, Bradley E.
2009-01-01
We investigate two potential mechanisms that will produce X-ray and γ-ray flashes from Type Ia supernovae (SN-Ia). The first mechanism is the breakout of the thermonuclear burning front as it reaches the surface of the white dwarf (WD). The second mechanism is the interaction of the rapidly expanding envelope with material within an accretion disk in the progenitor system. Our study is based on the delayed detonation scenario because this can account for the majority of light curves, spectra, and statistical properties of 'Branch-normal' SN-Ia. Based on detailed radiation-hydro calculations which include nuclear networks, we find that both mechanisms produce brief flashes of high-energy radiation with peak luminosities of 10 48 -10 50 erg s -1 . The breakout from the WD surface produces flashes with a rapid exponential decay by 3-4 orders of magnitude on timescales of a few tenths of a second and with most of the radiation in the X-ray and soft γ-ray range. The shocks produced in gases in and around the binary will produce flashes with a characteristic duration of a few seconds with most of the radiation coming out as X-rays and γ-rays. In both mechanisms, we expect a fast rise and slow decline and, after the peak, an evolution from hard to softer radiation due to adiabatic expansion. In many cases, flashes from both mechanisms will be superposed. The X- and γ-ray visibility of an SN-Ia will depend strongly on self-absorption within the progenitor system, specifically on the properties of the accretion disk and its orientation toward the observer. Such X-ray and γ-ray flashes could be detected as triggered events by gamma-ray burst (GRB) detectors on satellites, with events in current GRB catalogs. We have searched through the GRB catalogs (for the BATSE, HETE, and Swift experiments) for GRBs that occur at the extrapolated time of explosion and in the correct direction for known Type Ia supernovae with radial velocity of less than 3000 km s -1 . For the Burst
A blinded determination of H0 from low-redshift Type Ia supernovae, calibrated by Cepheid variables
Zhang, Bonnie R.; Childress, Michael J.; Davis, Tamara M.; Karpenka, Natallia V.; Lidman, Chris; Schmidt, Brian P.; Smith, Mathew
2017-10-01
Presently, a >3σ tension exists between values of the Hubble constant H0 derived from analysis of fluctuations in the cosmic microwave background by Planck, and local measurements of the expansion using calibrators of Type Ia supernovae (SNe Ia). We perform a blinded re-analysis of Riess et al. (2011) to measure H0 from low-redshift SNe Ia, calibrated by Cepheid variables and geometric distances including to NGC 4258. This paper is a demonstration of techniques to be applied to the Riess et al. (2016) data. Our end-to-end analysis starts from available Harvard -Smithsonian Center for Astrophysics (CfA3) and Lick Observatory Supernova Search (LOSS) photometries, providing an independent validation of Riess et al. (2011). We obscure the value of H0 throughout our analysis and the first stage of the referee process, because calibration of SNe Ia requires a series of often subtle choices, and the potential for results to be affected by human bias is significant. Our analysis departs from that of Riess et al. (2011) by incorporating the covariance matrix method adopted in Supernova Legacy Survey and Joint Lightcurve Analysis to quantify SN Ia systematics, and by including a simultaneous fit of all SN Ia and Cepheid data. We find H_0 = 72.5 ± 3.1 ({stat}) ± 0.77 ({sys}) km s-1 Mpc-1with a three-galaxy (NGC 4258+LMC+MW) anchor. The relative uncertainties are 4.3 per cent statistical, 1.1 per cent systematic, and 4.4 per cent total, larger than in Riess et al. (2011) (3.3 per cent total) and the Efstathiou (2014) re-analysis (3.4 per cent total). Our error budget for H0 is dominated by statistical errors due to the small size of the SN sample, whilst the systematic contribution is dominated by variation in the Cepheid fits, and for the SNe Ia, uncertainties in the host galaxy mass dependence and Malmquist bias.
Energy Technology Data Exchange (ETDEWEB)
Foley, Ryan J. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Filippenko, Alexei V. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Kessler, Richard; Frieman, Joshua A. [Kavli Institute for Cosmological Physics, The University of Chicago, 5640 South Ellis Avenue, Chicago, IL 60637 (United States); Bassett, Bruce; Smith, Mathew [Department of Mathematics and Applied Mathematics, University of Cape Town, Rondebosch 7701 (South Africa); Garnavich, Peter M. [Department of Physics, University of Notre Dame, 225 Nieuwland Science, Notre Dame, IN 46556-5670 (United States); Jha, Saurabh W. [Department of Physics and Astronomy, Rutgers University, 136 Frelinghuysen Road, Piscataway, NJ 08854 (United States); Konishi, Kohki [Institute for Cosmic Ray Research, University of Tokyo, 5-1-5, Kashiwanoha, Kashiwa, Chiba 277-8582 (Japan); Lampeitl, Hubert [Institute of Cosmology and Gravitation, University of Portsmouth, Mercantile House, Hampshire Terrace, Portsmouth PO1 2EG (United Kingdom); Riess, Adam G. [Department of Physics and Astronomy, Johns Hopkins University, Baltimore, MD 21218 (United States); Sako, Masao [Department of Physics and Astronomy, University of Pennsylvania, 209 South 33rd Street, Philadelphia, PA 19104 (United States); Schneider, Donald P. [Department of Astronomy and Astrophysics, 525 Davey Laboratory, Pennsylvania State University, University Park, PA 16802 (United States); Sollerman, Jesper, E-mail: rfoley@cfa.harvard.edu [Oskar Klein Centre, Department of Astronomy, Stockholm University, 106 91 Stockholm (Sweden)
2012-05-15
We present Keck high-quality rest-frame ultraviolet (UV) through optical spectra of 21 Type Ia supernovae (SNe Ia) in the redshift range 0.11 {<=} z {<=} 0.37 and a mean redshift of 0.22 that were discovered during the Sloan Digital Sky Survey-II (SDSS-II) SN Survey. Using the broadband photometry of the SDSS survey, we are able to reconstruct the SN host-galaxy spectral energy distributions (SEDs), allowing for a correction for the host-galaxy contamination in the SN Ia spectra. Comparison of composite spectra constructed from a subsample of 17 high-quality spectra to those created from a low-redshift sample with otherwise similar properties shows that the Keck/SDSS SNe Ia have, on average, extremely similar rest-frame optical spectra but show a UV flux excess. This observation is confirmed by comparing synthesized broadband colors of the individual spectra, showing a difference in mean colors at the 2.4{sigma}-4.4{sigma} level for various UV colors. We further see a slight difference in the UV spectral shape between SNe with low-mass and high-mass host galaxies. Additionally, we detect a relationship between the flux ratio at 2770 and 2900 A and peak luminosity that differs from that observed at low redshift. We find that changing the UV SED of an SN Ia within the observed dispersion can change the inferred distance moduli by {approx}0.1 mag. This effect only occurs when the data probe the rest-frame UV. We suggest that this discrepancy could be due to differences in the host-galaxy population of the two SN samples or to small-sample statistics.