WorldWideScience

Sample records for superior technology est

  1. Technology Maturity is Technology Superiority

    Science.gov (United States)

    2008-09-09

    Dominant Air Power: Design For Tomorrow…Deliver Today 2 TECHNOLOGY MATURITY CONFERENCE • ONE DEFINITION OF MATURITY – GOOD JUDGEMENT COMES FROM...EXPERIENCE—EXPERIENCE COMES FROM BAD JUDGEMENT Dominant Air Power: Design For Tomorrow…Deliver Today 3 TECHNOLOGY MATURITY CONFERENCE • THIS WILL BE A...2008 TECHNOLOGY MATURITY CONFERENCE “ TECHNOLOGY MATURITY IS TECHNOLOGY SUPERIORITY” Aeronautical Systems Center Dr. Tom Christian ASC/EN, WPAFB OH

  2. superior o atractivo artilugio estético?

    Directory of Open Access Journals (Sweden)

    Miguel Angel Munive Villanueva

    2007-01-01

    Full Text Available En este ensayo se presenta un análisis de la acreditación bajo la idea de que es el mejor instrumento para fortalecer la mejora de la calidad de la educación superior, lo que da lugar a la reflexión sobre la manera en que se logran sus objetivos y resultados. Este preámbulo es la pauta que sirve para abordar la acreditación no como la simple conquista o adjudicación de una constancia de un órgano o instancia acreditadora, poniendo de realce que la efectividad y trascendencia de la acreditación, y particularmente de la evaluación, radica en su integración formal a los procesos de planeación de las tareas académicas y de apoyo de las entidades académicas.

  3. Manufacturing Innovation and Technological Superiority

    Science.gov (United States)

    2016-09-01

    Defense AT&L: September-October 2016 2 From the Under Secretary of Defense for Acquisit ion, Technology, and Logist ics Manufacturing Innovation ...English advantages in mechanized textile manufacturing in the early 1800s drove the performance of the British economy, just as Carnegie’s steel...program to establish Manufacturing Innovation Institutes (MIIs) that would create incubators for advanced manufacturing technology in key

  4. Study on evaluation system of high & new technology superior enterprises

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    With the globalization of economy and science & technology, high & new technology enterprises have become the point of Chinese economic growth and the important basis for constructing innovative country. By analyzing the characteristics of high & new technology superior enterprises and the influential factors, the evaluation index and method based on Grey Relation Analysis are designed. Some high & new technology enterprises in Heilongjiang province are evaluated and application tactics of evaluation system are proposed. This study provides scientific method and basis for government to obtain development state about high & new technology enterprises and design planning and policies of high & new technology industry.

  5. Estándares e indicadores de calidad para bibliotecas de instituciones de educación superior

    OpenAIRE

    Comité Permanente de Bibliotecas de Instituciones de Educación Superior de Bogotá D.C.; Cabarcas, Luz María; Espitaleta, Lina; Lisowska Navarro, Malgorzata; Mejía Gutiérrez, Ángela María; Moncada, María Consuelo; Ruiz De Umaña, Marta Eugenia; Sarmiento De Rivera, Marlén

    2005-01-01

    Esta publicación propone un conjunto de estándares e indicadores de calidad para el desarrollo de las bibliotecas en las instituciones de educación superior, con el objetivo de que estas desarrollen procesos de autoevaluación y medición de la calidad en el desarrollo de sus actividades.

  6. QuEST: Qualifying Environmentally Sustainable Technologies. Volume 6

    Science.gov (United States)

    Lewis, Pattie

    2011-01-01

    QuEST is a publication of the NASA Technology Evaluation for Environmental Risk Mitigation Principal Center (TEERM). This issue contains brief articles on: Risk Identification and Mitigation, Material Management and Substitution Efforts--Hexavalent Chrome-free Coatings and Low volatile organic compounds (VOCs) Coatings, Lead-Free Electronics, Corn-Based Depainting Media; Alternative Energy Efforts Hydrogen Sensors and Solar Air Conditioning. Other TEERM Efforts include: Energy and Water Management and Remediation Technology Collaboration.

  7. QuEST: Qualifying Environmentally Sustainable Technologies, Volume 5

    Science.gov (United States)

    Lewis, Pattie

    2010-01-01

    This edition of the QuEST newsletter contains brief articles that discuss the NASA Technology Evaluation for Environmental Risk Mitigation (TEERM) program, and the importance of collaboration, efforts in materials management and substitution for coatings for launch structures, Low volatile organic compound (VOC) Coatings Field Testing, Non-Chrome Coating Systems, Life Cycle Corrosion Testing, Lead-Free Electronics Testing and Corn Based Depainting and efforts in Pollution Control in the area of Hypergolic Propellant Destruction Evaluation, efforts in development of alternative energy in particular Hydrogen Sensors, Energy and Water Management, and efforts in remediation in the removal of Polychlorinated Biphenyl (PCB) contamination

  8. Characterizing ammonia emissions from swine farms in eastern North Carolina: part 2--potential environmentally superior technologies for waste treatment.

    Science.gov (United States)

    Aneja, Viney P; Arya, S Pal; Rumsey, Ian C; Kim, D-S; Bajwa, K; Arkinson, H L; Semunegus, H; Dickey, D A; Stefanski, L A; Todd, L; Mottus, K; Robarge, W P; Williams, C M

    2008-09-01

    The need for developing environmentally superior and sustainable solutions for managing the animal waste at commercial swine farms in eastern North Carolina has been recognized in recent years. Program OPEN (Odor, Pathogens, and Emissions of Nitrogen), funded by the North Carolina State University Animal and Poultry Waste Management Center (APWMC), was initiated and charged with the evaluation of potential environmentally superior technologies (ESTs) that have been developed and implemented at selected swine farms or facilities. The OPEN program has demonstrated the effectiveness of a new paradigm for policy-relevant environmental research related to North Carolina's animal waste management programs. This new paradigm is based on a commitment to improve scientific understanding associated with a wide array of environmental issues (i.e., issues related to the movement of N from animal waste into air, water, and soil media; the transmission of odor and odorants; disease-transmitting vectors; and airborne pathogens). The primary focus of this paper is on emissions of ammonia (NH3) from some potential ESTs that were being evaluated at full-scale swine facilities. During 2-week-long periods in two different seasons (warm and cold), NH3 fluxes from water-holding structures and NH3 emissions from animal houses or barns were measured at six potential EST sites: (1) Barham farm--in-ground ambient temperature anaerobic digester/energy recovery/greenhouse vegetable production system; (2) BOC #93 farm--upflow biofiltration system--EKOKAN; (3) Carrolls farm--aerobic blanket system--ISSUES-ABS; (4) Corbett #1 farm--solids separation/ gasification for energy and ash recovery centralized system--BEST; (5) Corbett #2 farm--solid separation/ reciprocating water technology--ReCip; and (6) Vestal farm--Recycling of Nutrient, Energy and Water System--ISSUES-RENEW. The ESTs were compared with similar measurements made at two conventional lagoon and spray technology (LST) farms (Moore

  9. QuEST: Qualifying Environmentally Sustainable Technologies. Volume 4

    Science.gov (United States)

    Lewis, Pattie L.

    2009-01-01

    In 2004, in one of their first collaborative efforts, Centro Para Prevencao da Poluicao (Portuguese Center for Pollution Prevention or C3P). teamed with Technology Evaluation for Environmental Risk Mitigation Principal Center (TEERM) and two Portuguese entities, TAP Portugal (Portuguese National Airline) and OGMA Indtistria Aeron utica de Portugal (Portuguese Aeronautics Industry), to target the reduction of hexavalent chromium, cadmium, and volatile organic compounds (VOCs) in aircraft maintenance operations. This project focused on two coating systems that utilize non-chrome pretreatments and low-VOC primers and topcoats.

  10. Evaluación estética del tratamiento de casos con agenesia de incisivos laterales superiores : cierre frente a apertura de espacios

    OpenAIRE

    Suárez Tuero, Cristina

    2015-01-01

    La ausencia de incisivos laterales maxilares compromete la estética de la sonrisa y la función normal debido a que afecta a las proporciones del segmento maxilar anterior. Cuando un incisivo lateral maxilar falta congénitamente se generan alteraciones en la arcada superior así como en su relación con la mandíbula, no solo por el hecho de la ausencia en si, sino porque la agenesia dental coexiste, en ocasiones, con otro tipo de cambios en la forma y tamaño del resto de la dentición. El restabl...

  11. Evaluación estética del tratamiento de casos con agenesia de incisivos laterales superiores : cierre frente a apertura de espacios

    OpenAIRE

    Suárez Tuero, Cristina

    2015-01-01

    La ausencia de incisivos laterales maxilares compromete la estética de la sonrisa y la función normal debido a que afecta a las proporciones del segmento maxilar anterior. Cuando un incisivo lateral maxilar falta congénitamente se generan alteraciones en la arcada superior así como en su relación con la mandíbula, no solo por el hecho de la ausencia en si, sino porque la agenesia dental coexiste, en ocasiones, con otro tipo de cambios en la forma y tamaño del resto de la dentición. El restabl...

  12. Nature of Science and Technology Representations From a Teacher's Stse Perspective at Normal Superior Schools

    Directory of Open Access Journals (Sweden)

    Rosa Nidia Tuay-Sigua

    2016-01-01

    Full Text Available Throughout this paper, this research results about academic training based on CTSA relations are presented. These results, highlight among other aspects, the importance of guaranteeing Citizenship proposal of socio-enviromental decisions, based on scientific and technological aspects.The research is based on a qualitative paradigm, with interpretative-descriptive characteristics, this perspective allows to take account of more complex aspects, such as social interactions, and also contributes to the analysis of scientific and technological interactions with socio-environmental contexts. This study is aimed to Escuelas Normales Superiores (Normal Superior Schools teachers, whom had worked with this proposal, focused on building Didactic units which take account of CTSA relations.

  13. El financiamiento de las competencias profesionales del Banco Interamericano de Desarrollo (BID en la educación superior tecnológica (EST de México

    Directory of Open Access Journals (Sweden)

    Carlos Martínez Padilla

    2015-12-01

    Full Text Available Este artículo analiza la relación que tiene lugar entre el gobierno mexicano con organismos internacionales como el Banco Mundial (BM y, el Banco Interamericano de Desarrollo (BID para el financiamiento de las competencias profesionales en las Instituciones de Educación Superior Tecnológicas (IEST. Desde la perspectiva teórica de la Nueva Gestión Pública (NGP se argumenta que el BID, a través de sus programas de competencias profesionales, tiene una gran influencia en las funciones y atribuciones de las Universidades Politécnicas (UUPP y, que dichos programas responden más a una lógica de compromisos institucionales que a una evaluación efectiva de resultados

  14. Reconstrucción estética de labio superior tras necrosis secundaria a infiltración de material aloplástico

    Directory of Open Access Journals (Sweden)

    A.M.L. Caldeira

    2015-03-01

    Full Text Available La utilización de implantes aloplásticos en la restauración de deformidades y alteraciones del relieve cutáneo ha sido ampliamente difundida en las últimas tres décadas. Su uso excesivo puede ser, en ocasiones una solución errónea para camuflar las alteraciones generadas por la senilidad simulando parcialmente resultados quirúrgicos. Presentamos el caso de una paciente con necrosis total de labio superior secundaria a infiltración de polimetilmetacrilato. Precisó reconstrucción del labio superior en 11 tiempos quirúrgicos, durante casi 3 años, con un promedio de 3 a 4 meses de intervalo entre cada uno, con el propósito de restaurar la forma y función de la zona afectada y permitir la reinserción social de la paciente y el reencuentro de su equilibrio físico y emocional. Fue necesario emplear múltiples colgajos para recuperar el volumen adecuado, tanto cutáneo como mucoso, y luego lograr gradual y progresivamente la remodelación del segmento afectado. Los colgajos de Webster, Abbe y de lengua fueron los más importantes a la hora de recuperar forma y funcionalidad. Creemos que en la mayoría de las cirugías reconstructivas lo más importante es el enfoque funcional, pero consideramos también de extrema importancia la recuperación estética del paciente que permita un retorno natural a la convivencia social. Por ello, en el caso de la reconstrucción labial, después de realizar la transferencia de tejidos, debemos proceder a múltiples intervenciones quirúrgicas con el objetivo de lograr también una segura y gradual recomposición de la estética labial.

  15. Creating science and technology superiority,increasing marine equipment manufacturing capability to build China into world No.1 shipbuilding country

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    The creation of science and technol-ogy superiority is the basic driving forceto push forward the development ofChina’s shipbuilding Industry by leaps andbounds,and achieve the goal of buildingChina into the world number one ship-building country. 1.The strength of science and tech-nology is the decisive factor affecting ourcompetitiveness in the world market The shipbuilding industry is a labour-intensive,capital-intensive and technology-intensive industry.However,ever since the90’s of the last century,with the wide ap-plication of new technology and new manu-facturing process,the productivity of shipconstruction has increased significantly,therole of primary production elements suchas low-priced labor has weakened dramati-cally in the market competition.With thecontinuous increase of technology inten-siveness in the shipbuilding industry,thestrength of science and technology is becoming the most important factor of mar-ket competitiveness.In the last ten years,in order to strengthen their technical sup

  16. Dinámica cultural estético-artística extensionista para las instituciones de la Educación Superior

    Directory of Open Access Journals (Sweden)

    Alberto Pérez-Martínez

    2012-01-01

    circunstancias de los contextos históricos socioculturales, actuar correctamente en beneficio de los demás, vivir, desarrollarse y transformar a la sociedad con una postura ético-estética comprometida, designada bajo el honor y el decoro, lo bello y lo sublime de las actitudes y comportamiento de los hombres, lo que implica una contextualización de relaciones esenciales, que se revelan en la apreciación artístico cultural.

  17. La calidad de la enseñanza en educación superior ¿Qué es una buena enseñanza en este nivel educativo?

    OpenAIRE

    Jesús Carlos Guzmán

    2011-01-01

    El objetivo de este artículo es analizar los estilos de aprendizaje y prácticas de enseñanza en la educación superior en el período 2000 a 2010, haciendo énfasis en los desarrollos de América Latina y el Caribe. Los estudios en las aulas universitarias confluyeron en la investigación de los mecanismos del proceso de aprendizaje. Esta problemática se abordó principalmente desde la teoría de los estilos de aprendizaje. En este contexto, se sitúan como corrientes teóricas predominantes en el esc...

  18. Políticas públicas para la inclusión educativa, el caso del Programa de Estímulos a la Educación Superior en Terrenate, Tlaxcala

    Directory of Open Access Journals (Sweden)

    Adriana Carro Olvera

    2015-01-01

    Full Text Available La investigación es sobre el Programa de estímulos a los estudiantes de educación superior del municipio rural de Terrenate, en el estado de Tlaxcala. El objetivo es describir y analizar cómo el gobierno municipal trató de contrarrestar la exclusión escolar y la falta de oportunidades de los jóvenes del lugar para estudiar una carrera universitaria, partiendo de la hipótesis que en las zonas distantes de los centros de educación superior y con ingresos promedio bajos es más difícil cursar una licenciatura con recursos propios. Debido al desarrollo de la experiencia, para su interpretación se emplea como metodología el estudio de caso con un enfoque de políticas públicas. Los resultados obtenidos muestran un impacto positivo de jóvenes matriculados en instituciones de educación superior lo que conduce a oportunidades de inclusión educativa mediante la optimización de los recursos y la corresponsabilidad ciudadana.

  19. Environmental and Sustainable Technology Evaluations (ESTE): Verification of Microbial Resistant Building Materials

    Science.gov (United States)

    This is an ESTE project summary brief. Many of the finished interior surfaces of homes and buildings are composed of materials that are prone to mold growth. These surfaces include gypsum board, wood flooring, insulation, and components of the heating and air conditioning system...

  20. English for Science and Technology (EST). Specialised Bibliography B17, January 1977.

    Science.gov (United States)

    British Council, London (England). English-Teaching Information Centre.

    This bibliography contains about 180 British and American titles dealing with scientific and technological English for the second language learner. Both books and articles are cited. Section one of the bibliography deals with analyses of scientific English. The citations in section two concern the teaching of scientific English. Section three…

  1. Correlação entre sintomas e tempo de evolução do câncer do trato aerodigestivo superior com o estádio inicial e avançado

    Directory of Open Access Journals (Sweden)

    Francis Balduino Guimarães Santos

    2013-12-01

    Full Text Available Muitos dos aspectos clínicos e biológicos da história natural do câncer do trato aerodigestivo superior estão por elucidar, o que no Brasil tem como consequência direta a falha sistemática das campanhas de prevenção e de diagnóstico precoce. OBJETIVO: Analisar os sinais e sintomas apresentados por portadores da doença em estadiamentos iniciais e avançados. Outras variáveis como o tempo de evolução da doença, o estado geral e nutricional foram consideradas. MÉTODO: Estudo de coorte histórica com corte transversal em 895 indivíduos portadores do câncer do trato aerodigestivo superior. RESULTADOS: Os sinais e sintomas encontrados não se correlacionaram de forma estatisticamente significativa com o tempo de evolução da doença nem com a doença em fases iniciais, mas evidenciaram um desenvolvimento rápido da doença. CONCLUSÃO: Os resultados sugerem uma doença de início insidioso nas fases iniciais e de rápida evolução. O tempo longo de evolução - maior que três meses, associou-se às pioras nos estados geral e nutricional dos pacientes.

  2. Transferability of ASTM/NIST alanine-polyethylene recipe at ISS. American Society for Testing and Materials/National Institute for Standards and Technology. Istituto Superiore de Sanita

    Science.gov (United States)

    De Angelis C; Fattibene; Onori; Petetti; Bartolotta; Sansone Santamaria A

    2000-05-01

    Alanine-polyethylene solid state dosimeters were prepared at Istituto Superiore di Sanita (ISS) following the recipe proposed by National Institute of Standards and Technology (NIST) with the goal of testing its transferability. Dosimeters were prepared using 95% alanine and 5% polyethylene, by weight. They are rugged and of increased sensitivity, repeatability and reproducibility as respect to the ISS alanine-paraffin pellets. Reproducibility of about 1% was obtained at 10 Gy and at 3 Gy if one single pellet or a stack of five dosimeters were used, respectively.

  3. As mediações tecnológicas no desenvolvimento das funções psicológicas superiores/The Technological mediations in the psychologies superiores functions development

    Directory of Open Access Journals (Sweden)

    Ana Maria Munhoz Fett

    2005-01-01

    Full Text Available O artigo apresenta uma pesquisa qualitativa, na modalidade de estudo de caso, que teve como objetivo analisar a utilização da tecnologia por meio do computador como instrumento mediador no desenvolvimento das funções psicológicas superiores, em um contexto psicopedagógico clínico. O caso é o de um menino de onze anos, com vários encaminhamentos a profissionais da saúde e os diagnósticos de dificuldades de aprendizagem e psicose infantil. Os dados foram coletados a partir de observações dos registros de treze atendimentos psicopedagógicos, nos quais o computador foi utilizado, e de entrevistas com a família. A análise dos dados se deu pelos seus conteúdos, caracterizados por unidades de representação significativas e homogêneas propostas por Bardin (1977. A partir das reflexões embasadas na Teoria Sociohistórica, chegou-se à conclusão de que as mediações do computador aliadas à mediação da psicopedagoga contribuíram no desenvolvimento das funções psicológicas superiores do sujeito dessa pesquisa, principalmente as de atenção, memória, emoção e linguagem. This article presents a qualitative research on a case study modality. Its objective was analyze the use of technology utilization using one microcomputer mediating instrument to develop the upper psychological functions in a clinical psycho pedagogic context. It’s an eleven years old boy case with several professionals health redirections vested with learning difficulties and infantile psychosis diagnostic. The data had been collected from thirteen psychos pedagogic sessions register observations, in which it was comprehended the microcomputer utilization and family interviews. The data analysis it was based in its contents characterized for significant and homogeneous representation units proposals for Bardin (1977. From the reflections based in the Socio historical theory, it was arrived the conclusion that the computer mediations allied to the psycho

  4. Biomarcadores de estresse em ratos exercitados por natação em intensidades igual e superior à máxima fase estável de lactato Biomarkers of stress in rats exercised in swimming at intensities equal and superior to the maximal estable lactate phase

    Directory of Open Access Journals (Sweden)

    Ricardo Vinicius Ledesma Contarteze

    2007-06-01

    Full Text Available INTRODUÇÃO: O estresse alcançado durante exercício agudo/crônico é relevante, pois altos índices de estresse podem prejudicar o bem-estar dos animais. As concentrações dos hormônios adrenocorticotrófico (ACTH e corticosterona, bem como as concentrações de ácido ascórbico e colesterol das glândulas adrenais são importantes biomarcadores de estresse. OBJETIVO: Analisar a sensibilidade de diferentes biomarcadores de estresse em ratos durante exercício agudo de natação em diferentes intensidades. MÉTODO: Ratos (18 adaptados à natação foram submetidos a três testes de 25 minutos suportando cargas 5,0; 5,5 e 6,0% do peso corporal (PC, para obtenção da máxima fase estável de lactato (MFEL. Em seguida, os animais foram divididos em dois grupos: M (n = 9, sacrificado após 25 minutos de exercício na intensidade de MFEL e S (n = 9, sacrificado após exercício exaustivo, em intensidade 25% superior a MFEL. Para comparações, um grupo controle C (n = 10 foi sacrificado em repouso. RESULTADOS: As concentrações séricas de ACTH e corticosterona foram superiores após exercício em ambas as intensidades comparadas com o grupo controle (P INTRODUCTION: The level of stress during acute/chronic exercise is important, since higher levels of stress may impair animal welfare. The adrenocorticotrophic (ACTH and corticosterone hormone concentrations, as well as cholesterol and ascorbic acid concentrations in adrenal gland, are considered an important stress biomarker. PURPOSE: To analyze the sensitivity of the different biomarkers during acute swimming exercise in different intensities performed by rats. METHODS: Male Wistar adult rats (n = 18 previously adapted to swimming were submitted to three 25 min. swimming tests with loads of 5.0; 5.5 and 6.0% of their body weight (BW, for maximum lactate steady state (MLSS determination. After MLSS attainment, the animals were divided into two groups: M (n = 9 sacrificed shortly after a 25

  5. High-fidelity simulator technology may not be superior to traditional low-fidelity equipment for neonatal resuscitation training.

    Science.gov (United States)

    Finan, E; Bismilla, Z; Whyte, H E; Leblanc, V; McNamara, P J

    2012-04-01

    Despite completing accredited resuscitation training, neonatal trainees often feel unprepared to deal with real-life clinical emergencies. High-fidelity simulator (HFS) technology offers the potential of recreating a realistic stressful clinical environment to aid training and evaluation. To date, there are limited data examining the physiological impact of this training modality in comparison to less costly alternatives. The objective of this study was to compare the effects of low-fidelity simulator (LFS) versus HFS technology on performance levels, objective and subjective measures of stress in neonatal trainees. Sixteen neonatal fellows were invited to participate in a prospective randomized study. Subjects were divided into pairs and randomized to LFS or HFS for completion of scenario I. After an interval of 1 month, fellow teams crossed over to complete scenario II using the alternative simulator technology. Technical and non-technical skills were assessed using validated resuscitation scoring tools. Participants recorded subjective stress at sequential time points before and after each simulation. Buccal cortisol was measured at each corresponding time point and comparison between HFS and LFS groups was made. The mean overall resuscitation performance score was 75.8%±10, but there was no difference in performance between HFS and LFS groups. There was also no significant difference in non-technical skills performance between groups. Salivary cortisol increased over the duration of the simulated experience, but there were no differences between the two groups (P=0.001, two-way repeated measures analysis of variance). We also identified changes in subjective measures of stress (P<0.001, analysis of variance) over time, but again there were no differences between groups. Simulated neonatal resuscitations induce a significant stress response in neonatal trainees; however, we were unable to identify any difference in stress measures between HFS and LFS. These

  6. Contabilidad Financiera Superior

    OpenAIRE

    Ipiñazar Petralanda, Izaskun

    2013-01-01

    Duración (en horas): De 31 a 40 horas. Destinatario: Estudiante y Docente A través de este material se presentan las pautas necesarias para implementar un aprendizaje basado en problemas en la asignatura de Contabilidad Financiera Superior dentro de los temas “Constitución de S.A. y S.R.L.” (Tema 2), “Ampliaciones de Capital” (Tema 3) y “Reducciones de Capital” (Tema 4). En primer lugar se presentan las guías generales de la asignatura, y a continuación, las diferentes activida...

  7. Contabilidad Financiera Superior

    OpenAIRE

    Ipiñazar Petralanda, Izaskun

    2013-01-01

    Duración (en horas): De 31 a 40 horas. Destinatario: Estudiante y Docente A través de este material se presentan las pautas necesarias para implementar un aprendizaje basado en problemas en la asignatura de Contabilidad Financiera Superior dentro de los temas “Constitución de S.A. y S.R.L.” (Tema 2), “Ampliaciones de Capital” (Tema 3) y “Reducciones de Capital” (Tema 4). En primer lugar se presentan las guías generales de la asignatura, y a continuación, las diferentes activida...

  8. Produção científica dos alunos do curso superior de Tecnologia em Cosmetologia e Estética Da Univali: período 2007 a 2010

    OpenAIRE

    2012-01-01

    O curso de Cosmetologia e Estética vem acrescentando conhecimento na área por meio de pesquisa científica, ao desenvolver no último período do curso o trabalho de iniciação científica (TIC). Este estudo teve como objetivo verificar a quantidade de TICs desenvolvidos no período 2007-2010, bem como as linhas de pesquisa e temáticas mais trabalhadas, quais os professores que mais orientam, metodologia escolhida, as palavras chaves mais utilizadas e número de referências nacionais e internacionai...

  9. La estética y la formación en valores en el escenario de la educación superior (La conformación de la antropoética

    Directory of Open Access Journals (Sweden)

    Emilio Aguilar Rodríguez

    2012-01-01

    Full Text Available El nuevo milenio no es sólo un cambio de época, sino una época de cambios, los cuales representan problemas y retos que a la humanidad le preocupan y ocupan, para los cuales las visiones y paradigmas del siglo anterior no tienen respuesta porque se han visto rebasados por el desarrollo de las ciencias y las tecnologías. Con este trabajo presentamos a la estética y la educación como una nueva alianza para enfrentarlos, considerándolos como dos sistemas complejos, lo que aunado a la complejidad de sus elementos, componentes y subsistemas que los integran, los hace ser más complejos, por lo que se plantea la estrategia de la formación en valores del individuo para conformar una ética del genero humano, la conformación de la antropoética.

  10. COMPETENCIAS GENÉRICAS EN LA EDUCACIÓN SUPERIOR TECNOLÓGICA MEXICANA: DESDE LAS PERCEPCIONES DE DOCENTES Y ESTUDIANTES (GENERIC COMPETENCES IN MEXICAN HIGHER TECHNOLOGICAL EDUCATION: FROM THE PERCEPTIONS OF TEACHERS AND STUDENTS

    Directory of Open Access Journals (Sweden)

    Amalia Medina Palomera

    2010-12-01

    Full Text Available Resumen:Los modelos educativos, a nivel mundial, están sufriendo modificaciones hacia la implementación del enfoque en competencias. Tal es el caso del Sistema Nacional de Educación Superior Tecnológica en México. Dada la relevancia, se llevó a cabo un estudio para conocer la perspectiva que tienen los docentes y estudiantes sobre las competencias genéricas (CG. El trabajo se desarrolló mediante encuestas aplicadas en Institutos Tecnológicos a nivel nacional. En este artículo se presentan los resultados obtenidos sobre los siguientes tópicos: la importancia de las CG, la identificación de las esenciales, y la relación que tienen entre las diferentes categorías de carreras de los Institutos Tecnológicos. Se encontró que los docentes otorgan mayor importancia a las CG que los estudiantes; además, se advierte una concordancia de los resultados entre las CG esenciales tanto por los docentes como por los estudiantes; asimismo, se observan varias diferencias entre categorías de carreras. Se concluye que tanto académicos y estudiantes perciben positivamente la incorporación de las CG en los programas de estudio, dejando entrever un ambiente propicio para su implementación. Se propone, además, un estudio complementario. El análisis reveló que a cada carrera le corresponden diferentes CG esenciales.Abstract: The educational models around the world are undergoing modifications to the implementation of the competences approach. Such is the case of the National Higher Technological Education System in Mexico. Given the importance of this, conducted a study to determine the perspective which teachers and students on generic competences (CG. The work was developed through surveys completed in Institutes of Technology nationwide. This article presents the results obtained on the following topics: the importance of the CG, the identification of essential and the relationship they have between different categories of careers in research

  11. 电吸附水处理技术及设备%Electro-adsorption technology and EST equipment

    Institute of Scientific and Technical Information of China (English)

    孙晓慰; 朱国富

    2002-01-01

    主要介绍电吸附水处理技术(EST)与系统及其应用试验情况,实验表明,电吸附技术可用于水的除盐淡化及去硬,具有能耗低、使用简便以及对环境友好等特点.并依据已经掌握的技术数据,提出了其应用领域及市场前景的展望.

  12. Escuela Superior de Palos Verdes

    Directory of Open Access Journals (Sweden)

    Neutra, Richard J.

    1965-02-01

    Full Text Available Before initiating the building operations for the «Palos Verdes» School, the site was divided into two large horizontal surfaces, at different levels. The lower one served to accommodate the playing fields, a car park, the physical training building, and shop and ancillary buildings. On the higher of these two surfaces, and to the West of the access road, there is a car park and also the building and plot of ground devoted to agricultural technology, as well as the literary studies and general purpose buildings. As a complement to these, there is a series of blocks, arranged in parallel rows, which house the administrative offices, the art school, the craft's school, the general classrooms, and those devoted to higher education. The fascinating aspect of this school is the outstanding penetration of the architect's mind into the essential function of the project. Its most evident merit is the sense of comradeship and harmony that permeates the whole architectural manifold.Antes de construir el complejo escolar «Palos Verdes» se comenzó por crear, en el terreno, dos grandes mesetas a niveles diferentes. Sobre el inferior se organizaron: los campos de juegos, de deportes, un aparcamiento, el edificio para educación física y los destinados a tiendas y servicios. Sobre la meseta superior, al oeste de la vía de acceso, se dispuso un aparcamiento y el edificio y campo para adiestramiento agrícola; al este, otro aparcamiento, el edificio dedicado a materias literarias, y el destinado a usos múltiples. Completan las instalaciones de la escuela una serie de bloques paralelos: la administración, la escuela de arte, las clases de trabajos manuales, las aulas de enseñanzas generales, y las de los cursos superiores. Lo fascinante de este complejo escolar es la perfecta y magistral compenetración del arquitecto con el tema proyectado, y su mayor mérito, la sensación de cordialidad y armonía con el ambiente.

  13. The Challenge of Technological Superiority

    Science.gov (United States)

    2015-08-01

    smaller and leaner force structure. The DoD has employed such “offset strategies” in the past to compensate for other challenges to national security. Our...LRRDPP.html). So far, more than 300 “ideas” have been submitted. Emerging themes surround the use of autonomy , range and quantities at cost (the

  14. Produção científica dos alunos do curso superior de Tecnologia em Cosmetologia e Estética Da Univali: período 2007 a 2010

    Directory of Open Access Journals (Sweden)

    Fernanda Cardoso Linhares

    2011-07-01

    Full Text Available O curso de Cosmetologia e Estética vem acrescentando conhecimento na área por meio de pesquisa científica, ao desenvolver no último período do curso o trabalho de iniciação científica (TIC. Este estudo teve como objetivo verificar a quantidade de TICs desenvolvidos no período 2007-2010, bem como as linhas de pesquisa e temáticas mais trabalhadas, quais os professores que mais orientam, metodologia escolhida, as palavras chaves mais utilizadas e número de referências nacionais e internacionais utilizadas pelos acadêmicos para a elaboração dos trabalhos. Caracterizou-se como uma pesquisa documental do tipo descritiva, com abordagem quali-quantitativa. No período de 2007 a 2010 foram realizados 199 TICs. Quanto a metodologia, a pesquisa bibliográfica, do tipo exploratória com abordagem qualitativa foi a mais utilizada. Em relação a utilização de material bibliográfico para seus estudos, percebeu-se uma maior procura por obras nacionais. Espera-se que os resultados possibilitem uma orientação para futuras pesquisas científicas, envolvendo as áreas que precisam de um melhor aporte científico, como é o caso da área de ética profissional, nutrição e maquiagem.

  15. Frenillo labial superior doble

    Directory of Open Access Journals (Sweden)

    Carlos Albornoz López del Castillo

    Full Text Available El frenillo labial superior doble no sindrómico es una anomalía del desarrollo que no hemos encontrado reportada en la revisión bibliográfica realizada. Se presenta una niña de 11 años de edad que fue remitida al servicio de Cirugía Maxilofacial del Hospital "Eduardo Agramonte Piña", de Camagüey, por presentar un frenillo labial superior doble de baja inserción. Se describen los síntomas clínicos asociados a esta anomalía y el tratamiento quirúrgico utilizado para su solución: una frenectomía y plastia sobre la banda muscular frénica anormal que provocaba exceso de tejido en la mucosa labial. Consideramos muy interesante la descripción de este caso, por no haber encontrado reporte similar en la literatura revisada.

  16. Sobredentadura total superior implantosoportada

    Directory of Open Access Journals (Sweden)

    Luis Orlando Rodríguez García

    2010-06-01

    Full Text Available Se presenta un caso de un paciente desdentado total superior, rehabilitado en la consulta de implantología de la Clínica "Pedro Ortiz" del municipio Habana del Este en Ciudad de La Habana, Cuba, en el año 2009, mediante prótesis sobre implantes osteointegrados, técnica que se ha incorporado a la práctica estomatológica en Cuba como alternativa al tratamiento convencional en los pacientes desdentados totales. Se siguió un protocolo que comprendió una fase quirúrgica, procedimiento con o sin realización de colgajo y carga precoz o inmediata. Se presenta un paciente masculino de 56 años de edad, que acudió a la consulta multidisciplinaria, preocupado, porque se le habían elaborado tres prótesis en los últimos dos años y ninguna reunía los requisitos de retención que él necesitaba para sentirse seguro y cómodo con las mismas. El resultado final fue la satisfacción total del paciente, con el mejoramiento de la calidad estética y funcional.

  17. Reformulação e expansão dos cursos superiores de tecnologia no Brasil: as dificuldades da retomada da educação profissional Reformulación y expansión de los cursos superiores de tecnología en Brasil: las dificultades de la retomada de la educación profesional Reformulation and expansion of the higher technological courses in Brazil: the difficulties of the professional education retaken

    Directory of Open Access Journals (Sweden)

    Adriana Roseli Wünsch Takahashi

    2008-06-01

    causada por la llegada y diseminación de nuevas tecnologías. Con tales consideraciones, este artículo se propone a discutir el papel de organizador del Estado y las políticas públicas implementadas en los últimos años para la reformulación e expansión del sistema profesional de educación, en especifico en los Cursos Superiores de Tecnología. Por fin, se intenta ofrecer referencias para la organización de una agenda de pesquisas para la mejoría de las políticas públicas para esta área, bien como de sus formas de evaluación de impacto.The discussions about the retaken of the professional education in Brazil as the responsible for encouraging the labor market insertion and also the social inclusions have other important subjects like the development of the Economy Based on Knowledge- EBK and the National Innovation System diffusion. In this point of view, the educational sector is considered an essential base, composed by the Universities and their ability to create and transfer knowledge for the whole society. The duty of the higher technological education, which is one sector of the higher education, is to provide quick and high level quality labor to fill the blanks left by the appearance and dissemination of new technologies. This paper presents the State's organizer role and public politics which have been implemented to reformulate and to expand the professional educational system, especially the Technological Colleges. And it also intends to offer references to organize a scheduled research to improve public politics in this area and its impact evaluation forms.

  18. Estímulos ao Desenvolvimento Tecnológico: Influência do Mercado Driving Forces for Technology Development: Market

    Directory of Open Access Journals (Sweden)

    José de A. Cid

    2002-01-01

    Full Text Available Hoje em dia não se discute mais a importância da Pesquisa e Desenvolvimento para a sobrevivência e longevidade de uma Empresa. Todo tipo de indústria sente o impacto do aumento da competição e da velocidade dos avanços tecnológicos. Entretanto, os recursos estão escassos, tanto para as despesas necessárias às atividades de negócio quanto para a pesquisa, o que deixa os gerentes com a difícil tarefa de decidir onde os recursos serão aplicados. Anos atrás, quando os recursos eram (aparentemente ilimitados a força que impulsionava a pesquisa era o desafio da descoberta do novo. A complexidade do processo, os intricados métodos de análise, a quebra de barreiras do conhecimento, alimentavam as mentes dos cientistas. Depois da pesquisa, os profissionais de marketing deveriam encontrar mercados para os novos produtos. Atualmente a pesquisa de mercado, as ferramentas de análise de negócio e outros aspectos outrora desconhecidos dos cientistas dominam as mesas dos gerentes. Este artigo descreve três diferentes abordagens na distribuição de recursos para pesquisa e resume alguns dos princípios que ajudam as empresas a funcionar melhor.Nowadays the importance of Research and Development to a Company survival and longevity is well known. Virtually every industry feels the impact of increased competition and the fast pace of technology change. However, resources are getting scarce, both for doing business and research as well, leaving managers with the tough job of selecting which project will get funding. Years ago, when money was (seemingly unlimited the driving force to research was the challenge of inventing something new. The process complexity, the intricate analysis methods, the breaking of new frontiers were the food for the scientists inquiring minds. Then marketing professionals had to work to find or create market. Now market research, business analysis tools and other aspects once unknown to scientists rule. This article

  19. Intraoperative neuromonitoring of the external branch of the superior laryngeal nerve during thyroidectomy: the need for evidence-based data and perioperative technical/technological standardization.

    Science.gov (United States)

    Mangano, Alberto; Lianos, Georgios D; Boni, Luigi; Kim, Hoon Yub; Roukos, Dimitrios H; Dionigi, Gianlorenzo

    2014-01-01

    The external branch of the superior laryngeal nerve (EBSLN) is surgically relevant since its close anatomical proximity to the superior thyroid vessels. There is heterogeneity in the EBSLN anatomy and EBSLN damage produces changes in voice that are very heterogenous and difficult to diagnose. The reported prevalence of EBSLN injury widely ranges. EBSLN iatrogenic injury is considered the most commonly underestimated complication in endocrine surgery because vocal assessment underestimates such event and laryngoscopic postsurgical evaluation does not show standardized findings. In order to decrease the risk for EBSLN injury, multiple surgical approaches have been described so far. IONM provides multiple advantages in the EBSLN surgical approach. In this review, we discuss the current state of the art of the monitored approach to the EBSLN. In particular, we summarize, providing our additional remarks, the most relevant aspects of the standardized technique brilliantly described by the INMSG (International Neuromonitoring Study Group). In conclusion, in our opinion, there is currently the need for more prospective randomized trials investigating the electrophysiological and pathological aspects of the EBSLN for a better understanding of the role of IONM in the EBSLN surgery.

  20. Intraoperative Neuromonitoring of the External Branch of the Superior Laryngeal Nerve during Thyroidectomy: The Need for Evidence-Based Data and Perioperative Technical/Technological Standardization

    Directory of Open Access Journals (Sweden)

    Alberto Mangano

    2014-01-01

    Full Text Available The external branch of the superior laryngeal nerve (EBSLN is surgically relevant since its close anatomical proximity to the superior thyroid vessels. There is heterogeneity in the EBSLN anatomy and EBSLN damage produces changes in voice that are very heterogenous and difficult to diagnose. The reported prevalence of EBSLN injury widely ranges. EBSLN iatrogenic injury is considered the most commonly underestimated complication in endocrine surgery because vocal assessment underestimates such event and laryngoscopic postsurgical evaluation does not show standardized findings. In order to decrease the risk for EBSLN injury, multiple surgical approaches have been described so far. IONM provides multiple advantages in the EBSLN surgical approach. In this review, we discuss the current state of the art of the monitored approach to the EBSLN. In particular, we summarize, providing our additional remarks, the most relevant aspects of the standardized technique brilliantly described by the INMSG (International Neuromonitoring Study Group. In conclusion, in our opinion, there is currently the need for more prospective randomized trials investigating the electrophysiological and pathological aspects of the EBSLN for a better understanding of the role of IONM in the EBSLN surgery.

  1. Desafios da organização e da regulação da educação superior em Timor-Leste e a questão da capacitação institucional Desafíos de la organización y de la regulación de la educación superior en Timor Este y la cuestión de la capacitación Challenges of organizing and regulating the higher education system in Timor-Leste and the issue of the institutional capacity building

    Directory of Open Access Journals (Sweden)

    Antonio Elizio Pazeto

    2007-09-01

    Full Text Available Este trabalho aborda aspectos da educação superior, no âmbito do Ministério da Educação e das instituições, em Timor-Leste. As questões e objetivos desta abordagem dizem respeito à organização e à regulação da educação superior e à capacitação institucional. Para abordar tais questões, foi feita uma análise dos principais documentos oficiais relativos ao tema, associada à atuação deste autor em grupos de trabalho e em programas de capacitação e assessoramento no Ministério, em 2004 e 2005. As ações desenvolvidas e a presente análise levaram em consideração aspectos da realidade histórico-cultural do país e procedimentos conjuntos com as "contrapartes" timorenses. Em decorrência dessa concepção, foram alcançados os seguintes resultados: elaboração dos termos de referência para a organização do Ministério; definição de agenda para estruturação da educação superior; elaboração de proposta da legislação educacional para o Ministério da Educação; finalização do Plano de Política Nacional de Educação 2005-2010; elaboração de proposta de Estatuto para a Universidade Nacional Timor Lorosa'e - UNTL. Não obstante as limitações em relação aos quadros humanos, recursos técnicos e financeiros e das peculiaridades histórico-culturais e políticas daquele país, encontram-se delineadas as bases de referência para a organização, regulação e capacitação institucional no âmbito do Ministério da Educação e, em particular, da educação superior.Este trabajo aborda aspectos de la educación superior, en el ámbito del Ministerio de la Educación y de las instituciones, en Timor Este. Las cuestiones y objetivos de este abordaje dicen respecto a la organización y a la regulación superior y a la capacitación institucional. Para abordar estas cuestiones, fue hecha un análisis de los principales documentos oficiales relativos al tema, asociada a la actuación de este autor, en grupos

  2. Superior Hiking Trail

    Data.gov (United States)

    Minnesota Department of Natural Resources — Superior Hiking Trail main trail, spurs, and camp spurs for completed trail throughout Cook, Lake, St. Louis and Carlton counties. These data were collected with...

  3. Bathymetry of Lake Superior

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry of Lake Superior has been compiled as a component of a NOAA project to rescue Great Lakes lake floor geological and geophysical data and make it more...

  4. Superior Hiking Trail Facilities

    Data.gov (United States)

    Minnesota Department of Natural Resources — Superior Hiking Trail main trail, spurs, and camp spurs for completed trail throughout Cook, Lake, St. Louis and Carlton counties. These data were collected with...

  5. Improved Oral Bioavailability of Lacidipine Using Nanosuspension Technology: Inferior in vitro Dissolution and Superior in vivo Drug Absorption versus Lacipil®.

    Science.gov (United States)

    Zhao, Juanhang; Luo, Lei; Fu, Qiang; Guo, Bei; Li, Yun; Geng, Yajie; Wang, Junfeng; Zhang, Tianhong

    2016-01-01

    Improved dissolution is a better way of increasing the oral absorption of lacidipine (LCDP) because it is a BCS II class drug. The purpose of this study is to improve the oral bioavailability of LCDP by applying nanosuspension technology. LCDP nanosuspensions were prepared by a hybrid method of microprecipitation and high pressure homogenization. The effects of the production parameters (shearing rate and time, the stabilizers and their concentrations, homogenization pressure and number of cycles) were investigated to optimize the preparation process. In vitro characterizations (X-ray powder diffraction, differential scanning calorimetry, scanning electron microscopy and dissolution measurement) were carried out and an oral pharmacokinetic study was performed in beagle dogs. LCDP was transformed into an amorphous state during the preparation process, and the mean particle size was about 714.0 ± 12.7 nm. The dissolution rate of LCDP nanosuspensions was faster than that of physical mixtures, but slower than that of Lacipil® (the commercial tablet). Regarding the in vivo pharmacokinetics, the key pharmacokinetic parameters (Cmax and AUC0-∞) of the nanosuspensions were statistically significantly higher than those of both the commercial tablet and physical mixtures. So, this is an efficient drug delivery strategy to facilitate the oral administration of LCDP by using nanosuspension technology, and should be generally applicable to many poorly water-soluble drugs with dissolution rate-limited absorption.

  6. GAPDH and β-actin protein decreases with aging, making Stain-Free technology a superior loading control in Western blotting of human skeletal muscle

    DEFF Research Database (Denmark)

    Vigelsø Hansen, Andreas; Dybboe, Rie; Hansen, Christina Neigaard

    2015-01-01

    physiology where the intervention has been suggested to impede normalization (ageing, muscle atrophy, and different muscle fiber type composition). The linearity of signal and the methodological variation coefficient was obtained. Furthermore, the inter- and intraindividual variation in signals obtained from...... SF and RP was measured in relation to ageing, muscle atrophy, and different muscle fiber type composition, respectively. A stronger linearity of SF and β-actin compared with GAPDH and α-tubulin was observed. The methodological variation was relatively low in all four methods (4-11%). Protein level...... and differences in muscle fiber type. The novel SF technology adds lower variation to the results compared with the existing methods for correcting for loading inaccuracy in Western blotting of human skeletal muscle in applied physiology....

  7. 17种攀援植物良种繁殖栽培及配置应用技术%Applied Technology of Propagation Cultivation and Configuration of 17 Kinds of Superior Varieties Climbing Plants

    Institute of Scientific and Technical Information of China (English)

    黎兆海

    2012-01-01

    详细地分析了"柳州市攀援植物筛选及其配置应用研究"筛选出的17优良攀援植物品种的繁殖、栽培、配置应用以及病虫害防治等技术,指出了这些良种可在广西柳州及相应地区推广应用。%This paper gives detailed description of the selection of 17 kinds of superior varieties climbing plants and of studying the technologies of propagation cultication,configuration and pest control,so as to promote the use of these seeds in Liuzhou and other corresponding areas in Guangxi.

  8. PERSISTENT LEFT SUPERIOR VENACAVA

    Directory of Open Access Journals (Sweden)

    Devinder Singh

    2014-05-01

    Full Text Available A Persistent Left Superior Venacava (PLSVC is the most common variation of the thoracic venous system and rare congenital vascular anomaly and is prevalent in 0.3% of the population. It may be associated with other cardiovascular abnormalities including atrial septal defect, bicuspid aortic valve, coarctation of aorta, coronary sinus ostial atresia, and cor triatriatum. Incidental rotation of a dilated coronary sinus on echocardiography should raise the suspicion of PLSVC. The diagnosis should be confirmed by saline contrast echocardiography. Condition is usually asymptomatic. Here we present a rare case of persistent left superior vena cava presented in OPD with dyspnoea & palpitations.

  9. Os Centros Federais de Educação Tecnológica e o ensino superior: duas lógicas em confronto The federal centers of technological education and higher education: two confronting logics

    Directory of Open Access Journals (Sweden)

    Maria Ciavatta

    2006-10-01

    Full Text Available O sentido educacional que os Centros Federais de Educação Tecnológica assumem ao se tornarem, progressivamente, instituições de ensino superior, exige que se defina que ser humano se quer formar e a que finalidades se destina a educação. Cabe ainda uma reflexão sobre a questão da técnica, da ciência e da tecnologia e sua relação com o trabalho e a educação. Tendo como horizonte uma visão de totalidade social dos fenômenos, nas múltiplas relações que estabelecem, portanto, na sua complexidade, trataremos do tema proposto em sua dimensão histórica e política. Primeiro, refletimos sobre o significado da técnica e sua relação com o conhecimento, a ciência e as tecnologias. A seguir, trataremos dos termos cidadão produtivo e/ou emancipado e da estrutura social brasileira e suas grandes desigualdades. Por último, da questão da universidade, da produção do conhecimento e de sua relação com o ensino médio e a formação de tecnólogos em nível superior.As the Federal Centers of Technological Education gradually become higher education institutions the educational meaning they assume requires a definition of which human being we want to form and what purposes education serves. A reflection about the issue of technique, science and technology and their relation to work and education is also needed. Seeking a vision of social totality of the phenomena, in their multiple relations, therefore, in their complexity, we tackle the proposed subject in its historical and political dimension. We first reflect on the meaning of technique and its relation to knowledge, science and technologies. We then approach the terms productive and/or emancipated citizen and the Brazilian social structure, marked by great inequalities. Finally, we raise the issues of universities and production of knowledge and their relation to senior high school and the education of technologists on a higher level.

  10. What is Educational Technology? An Inquiry into the Meaning, Use, and Reciprocity of Technology / Qu’est-ce que la technologie pédagogique ? Un examen de la signification, de l’utilisation et de la réciprocité de la technologie

    Directory of Open Access Journals (Sweden)

    Arun Lakhana

    2014-08-01

    Full Text Available This position paper explores the ambiguity of technology, toward refined understanding of Educational Technology. The purpose of education is described by John Dewey as growing, or habitual learning. Two philosophical conceptions of technology are reviewed. Dewey positions inquiry as a technology that creates knowledge. Val Dusek offers a “consensus definition,” a systems approach to technology that merges into social construction theory and actor-network theory, both of which emphasize complex relations between humans and technology. Using Dewey and Dusek as reference, literature related to Educational Technology is reviewed. A history of its definitions and conceptions of hard (material technology and of soft (process technology are examined. Three brief case studies reveal a bias toward hard technology in contemporary discourse. A misconception that soft technology begins with pre-authenticated knowledge is identified and shown to obscure the reciprocity between technology and the intellect. Cet exposé de position se penche sur l’ambiguïté de la technologie en vue de raffiner la compréhension de la technologie pédagogique. L’objectif de l’éducation est décrit par John Dewey comme étant un apprentissage croissant ou habituel. Deux conceptions philosophiques de la technologie sont examinées. Dewey considère l’enquête comme une technologie qui crée le savoir. Val Dusek offre une « définition consensuelle », une approche systémique de la technologie qui rejoint la théorie de la construction sociale et la théorie de l’acteur-réseau, qui mettent toutes deux l’accent sur les relations complexes entre les humains et la technologie. Utilisant Dewey et Dusek comme référence, la documentation portant sur la technologie pédagogique est examinée. L’historique des définitions et conceptions de la technologie « dure » (matérielle et de la technologie « douce » (processus est examiné. Trois courtes études de

  11. Air Superiority Fighter Characteristics.

    Science.gov (United States)

    1998-06-05

    many a dispute could have been deflated into a single paragraph if the disputants had just dared to define their terms.7 Aristotle ...meaningful. This section will expand on some key ideology concepts. The phrase "air superiority fighter" may bring to mind visions of fighter... biographies are useful in garnering airpower advocate theories as well as identifying key characteristics. Air campaign results, starting with World

  12. Sobredentadura total superior implantosoportada Superior total overdenture on implants

    Directory of Open Access Journals (Sweden)

    Luis Orlando Rodríguez García

    2010-06-01

    Full Text Available Se presenta un caso de un paciente desdentado total superior, rehabilitado en la consulta de implantología de la Clínica "Pedro Ortiz" del municipio Habana del Este en Ciudad de La Habana, Cuba, en el año 2009, mediante prótesis sobre implantes osteointegrados, técnica que se ha incorporado a la práctica estomatológica en Cuba como alternativa al tratamiento convencional en los pacientes desdentados totales. Se siguió un protocolo que comprendió una fase quirúrgica, procedimiento con o sin realización de colgajo y carga precoz o inmediata. Se presenta un paciente masculino de 56 años de edad, que acudió a la consulta multidisciplinaria, preocupado, porque se le habían elaborado tres prótesis en los últimos dos años y ninguna reunía los requisitos de retención que él necesitaba para sentirse seguro y cómodo con las mismas. El resultado final fue la satisfacción total del paciente, con el mejoramiento de la calidad estética y funcional.This is the case of a total maxilla edentulous patient seen in consultation of the "Pedro Ortíz" Clinic Implant of Habana del Este municipality in 2009 and con rehabilitation by prosthesis over osteointegration implants added to stomatology practice in Cuba as an alternative to conventional treatment in patients totally edentulous. We follow a protocol including a surgery or surgical phase, technique without or with flap creation and early or immediate load. This is a male patient aged 56 came to our multidisciplinary consultation worried because he had three prostheses in last two years and any fulfilled the requirements of retention to feel safe and comfortable with prostheses. The final result was the total satisfaction of rehabilitated patient improving its aesthetic and functional quality.

  13. Annotation of Ehux ESTs

    Energy Technology Data Exchange (ETDEWEB)

    Kuo, Alan; Grigoriev, Igor

    2009-06-12

    22 percent ESTs do no align with scaffolds. EST Pipeleine assembles 17126 consensi from the noaligned ESTs. Annotation Pipeline predicts 8564 ORFS on the consensi. Domain analysis of ORFs reveals missing genes. Cluster analysis reveals missing genes. Expression analysis reveals potential strain specific genes.

  14. Deep conversion of black oils with Eni Slurry technology

    Energy Technology Data Exchange (ETDEWEB)

    Panariti, Nicoletta; Rispoli, Giacomo

    2010-09-15

    Eni Slurry Technology represents a significant technological innovation in residue conversion and unconventional oils upgrading. EST allows the almost total conversion of heavy feedstocks into useful products, mainly transportation fuels, with a great major impact on the economic and environmental valorization of hydrocarbon resources. The peculiar characteristics of EST in terms of yields, products quality, absence of undesired by-products and feedstock flexibility constitute its superior economic and environmental attractiveness. The first full scale industrial plant based on this new technology will be realized in Eni's Sannazzaro refinery (23,000 bpd). Oil in is scheduled by 4th quarter 2012.

  15. The current status of coal liquefaction technologies - Panorama 2008; La liquefaction du charbon: ou en est-on aujourd'hui? - Panorama 2008

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2008-07-01

    In 2008, a first coal liquefaction unit to produce motor fuel (20,000 BPSD) will come on-stream in Shenhua, China (in the Ercos region of Inner Mongolia). Other, more ambitious projects have been announced in China for between now and 2020. Since oil production is expected to peak in the medium term, this technology may develop regionally in the next 20 years to cover ever-increasing demand for motor fuel.

  16. 理工类研究生科技语篇翻译技能发展问题与对策研究%Skill Development of EST Text Translation and Relevant Countermeasures for Graduates Majoring in Science and Technology

    Institute of Scientific and Technical Information of China (English)

    王群沣

    2014-01-01

    Under the background of economic globalization, researches on translation of scientific texts have become the concerns for many scientists and language researchers, among which the study on skill development of EST text translation for graduate majoring in science and technology has aroused great interest. This paper, by the analysis of the statistics collected from questionnaire designed and teaching experiments conducted, unveils the current problems concerning skill development of EST text translation for graduate majoring in science and technology and put up with the relevant countermeasures: improvement on curriculum and teaching methods, the establishment of new team of teachers and creation of more practical EST translation opportunities for students.%在经济全球一体化背景下,科技语篇翻译的研究越来越受到科技工作者和语言研究者的关注,而理工类研究生科技语篇翻译技能发展的问题成为研究的重要课题之一。本文通过问卷调查和教学实验研究,揭示了目前理工类研究生科技语篇技能发展存在的问题,提出了未来解决这些问题相应的对策:改变课程设置,教学方法,建立新型师资团队,以及为学生创造科技翻译实践活动。

  17. Statistics of superior records

    Science.gov (United States)

    Ben-Naim, E.; Krapivsky, P. L.

    2013-08-01

    We study statistics of records in a sequence of random variables. These identical and independently distributed variables are drawn from the parent distribution ρ. The running record equals the maximum of all elements in the sequence up to a given point. We define a superior sequence as one where all running records are above the average record expected for the parent distribution ρ. We find that the fraction of superior sequences SN decays algebraically with sequence length N, SN˜N-β in the limit N→∞. Interestingly, the decay exponent β is nontrivial, being the root of an integral equation. For example, when ρ is a uniform distribution with compact support, we find β=0.450265. In general, the tail of the parent distribution governs the exponent β. We also consider the dual problem of inferior sequences, where all records are below average, and find that the fraction of inferior sequences IN decays algebraically, albeit with a different decay exponent, IN˜N-α. We use the above statistical measures to analyze earthquake data.

  18. Noise management to achieve superiority in quantum information systems

    Science.gov (United States)

    Nemoto, Kae; Devitt, Simon; Munro, William J.

    2017-06-01

    Quantum information systems are expected to exhibit superiority compared with their classical counterparts. This superiority arises from the quantum coherences present in these quantum systems, which are obviously absent in classical ones. To exploit such quantum coherences, it is essential to control the phase information in the quantum state. The phase is analogue in nature, rather than binary. This makes quantum information technology fundamentally different from our classical digital information technology. In this paper, we analyse error sources and illustrate how these errors must be managed for the system to achieve the required fidelity and a quantum superiority. This article is part of the themed issue 'Quantum technology for the 21st century'.

  19. Transliteration in EST Translation

    Institute of Scientific and Technical Information of China (English)

    王新然

    2016-01-01

    Firstly, this paper presents the definition of transliteration and its important position in EST translation. Secondly, in terms of the previous practice and experience in EST translation, four main transliteration techniques are concluded and analyzed. But meanwhile, there are still some negative issues and phenomena. As a result, it is worthy to make good use of the existing transliteration techniques and create more proper ones to remove the obstructions and promote the development of EST translation.

  20. On Features of EST and Its Translation

    Institute of Scientific and Technical Information of China (English)

    易高燕

    2009-01-01

    The study of translation has always been emphasizing the translation of literature, therefore, the translation of EST (English for science and technology), which is a special style or genre of English, doesn't get enough attention yet. This thesis attempts to discuss the translation of English for science and technology, and its features.

  1. 电吸附水处理技术(EST)对污水悬浮物去除效果研究%Study of the sewage suspended solids removal efficiency of Electric adsorption water treatment technology (EST)

    Institute of Scientific and Technical Information of China (English)

    柯起龙

    2015-01-01

    In order to study the adsorption of Electric adsorption water treatment technology ( EST ) on suspended solids removal efficiency of sewage, through experiment suggests the suspended solids removal efficiency of electric adsorption is 74. 07%, and electric adsorption module itself only 14. 29%, chloride ions、 the concentration of suspended and the hardness value has no effect on the suspended solids removal efficiency. Therefore, the electric adsorption water treatment technology can be used as a new kind of effective method to treat sewage.%为了研究电吸附水处理技术( EST)对污水悬浮物的去除效果,本文采用电吸附水处理技术对生活污水中悬浮物进行处理分析,结果表明电吸附水处理系统对悬浮物的去除效果较好,去除率达到74.07%,而电吸附模块本身对悬浮物去除率仅为14.29%,氯离子、进水中悬浮物的浓度及进水中的硬度值均对悬浮物去除效率没有影响。因此,电吸附水处理技术可作为污水处理的一种新型有效方法。

  2. Producer benefits using Terra Blue treatment technology: Increased pig productivity, expansion, and carbon credits

    Science.gov (United States)

    The State of North Carolina and USDA NRCS’s Environmental Quality Incentives Program started a statewide Lagoon Conversion Program (LCP) that provides financial support to livestock farmers installing Environmentally Superior Technology (EST) for manure management. A second generation treatment syst...

  3. EST-PAC a web package for EST annotation and protein sequence prediction

    Directory of Open Access Journals (Sweden)

    Strahm Yvan

    2006-10-01

    Full Text Available Abstract With the decreasing cost of DNA sequencing technology and the vast diversity of biological resources, researchers increasingly face the basic challenge of annotating a larger number of expressed sequences tags (EST from a variety of species. This typically consists of a series of repetitive tasks, which should be automated and easy to use. The results of these annotation tasks need to be stored and organized in a consistent way. All these operations should be self-installing, platform independent, easy to customize and amenable to using distributed bioinformatics resources available on the Internet. In order to address these issues, we present EST-PAC a web oriented multi-platform software package for expressed sequences tag (EST annotation. EST-PAC provides a solution for the administration of EST and protein sequence annotations accessible through a web interface. Three aspects of EST annotation are automated: 1 searching local or remote biological databases for sequence similarities using Blast services, 2 predicting protein coding sequence from EST data and, 3 annotating predicted protein sequences with functional domain predictions. In practice, EST-PAC integrates the BLASTALL suite, EST-Scan2 and HMMER in a relational database system accessible through a simple web interface. EST-PAC also takes advantage of the relational database to allow consistent storage, powerful queries of results and, management of the annotation process. The system allows users to customize annotation strategies and provides an open-source data-management environment for research and education in bioinformatics.

  4. La organización de la tecnología lítica de los pobladores tempranos del este de Uruguay The Organization Of Lithic Technology Among The Early Inhabitants Of Eastern Uruguay

    Directory of Open Access Journals (Sweden)

    Andrés Gascue

    2009-06-01

    Full Text Available Se presentan los resultados de las investigaciones realizadas en el sitio Rincón de los Indios (Rocha, Uruguay. Se analizaron los vestigios líticos (lascas, núcleos, instrumentos tallados, instrumentos confeccionados por picoteo y/o abrasión, preformas de puntas de proyectil y puntas de proyectil recuperados en los niveles tempranos. Con el análisis se ha buscado la especificidad de la utilización diferencial de las materias primas y los diferentes procesos de fabricación, identificando así los distintos subsistemas tecnológicos. La organización de la tecnología de los pobladores tempranos del Este de Uruguay implicó el aprovisionamiento de diversas materias primas minerales, tanto locales y regionales, como extra regionales. Se realizaban importantes desplazamientos para aprovisionarse de rocas de buena calidad, concordando con grupos cazadores de alta movilidad residencial que explotaban gran diversidad de ambientesThis paper presents the results of research carried out in Rincón de los Indios site, Rocha, Uruguay. The lithic remains (flakes, cores, flaked instruments, polished and pecked instruments, projectile point preforms and projectile points recovered from the early levels were analyzed. The objective was to study the distinctive use of raw materials and manufacture procedures, identifying the different technological sub-systems. The technological organization of the early inhabitants of eastern Uruguay involved the acquisition of a variety of local, regional and extra-regional mineral raw materials. These groups undertook signifi cant displacements in order to stock up on good quality rocks, which accords with groups of hunter-gatherers with high residential mobility who exploited a high diversity of environments

  5. 先天性上斜肌麻痹下斜肌的CT三维重建%Application of three - dimensional CT reconstruction technology on inferior oblique muscle in congenital superior oblique palsy

    Institute of Scientific and Technical Information of China (English)

    张阳; 宋籽浔; 王晓青

    2014-01-01

    AIM: To investigate the viability of the morphology of inferior oblique muscle observed stereoscopically using 3-dimensional CT reconstruction technique. METHODS: This control study included of 29 cases which were clinically diagnosed with monocular congenital superior oblique palsy, examined by dimensional CT. The images of the inferior oblique muscle were reconstructed by Mimics software. 3D digital images on the basis of CT scanning data of the individuals were established. Observing the morphology of binocular inferior oblique muscle by self-controlled design, we compared the maximum transverse diameter of inferior oblique muscle of paralyzed eye with non-paralyzed one. We chose 5% as the significant level. RESULTS: The reconstructed results of 3-dimensional CT scan showed that not all of the inferior oblique abdominal muscle of paralyzed eyes were thinner than that of the non-paralyzed eye in maximum transverse diameter of cross - sectional area. The maximum transverse diameter of inferior oblique muscle was measured. The average maximum transverse diameter of the paralyzed eye was 6. 797±1. 083mm and the non-paralyzed eye was 6. 507 ± 0. 848mm. The maximum transverse diameter of inferior oblique muscle of paralyzed eye did not, however, differ significantly from the normal (P>0. 05). CONCLUSION: The three - dimensional CT reconstruction technology can be used for preoperative evaluation of the morphology of inferior oblique muscle.%目的:探索应用CT三维重建技术立体观察下斜肌形态的可行性。  方法:临床诊断单眼先天性上斜肌麻痹的患者29例进行眼眶CT扫描。用Mimics软件对原始CT扫描数据进行三维重建,建立基于个体CT扫描数据的下斜肌数字图像,观察双眼下斜肌的3D形态。用自身对照设计,比较麻痹眼和健眼下斜肌最大横径差异,设定P  结果:先天性上斜肌麻痹患者麻痹眼的下斜肌有的比健眼下斜肌粗;有的比健眼下斜

  6. A Contribuição da Educomunicação para o Ensino Superior

    Directory of Open Access Journals (Sweden)

    Rose Mara Pinheiro

    2016-05-01

    Full Text Available O interesse desse trabalho volta-se para o ensino superior e sobre o curso de Jornalismo, onde os estudantes aprendem desde cedo a lidar com os meios de comunicação e as novas tecnologias. Como fruto do meu estágio de pós-doutoramento na Faculdade Cásper Líbero, a pesquisa pretende refletir sobre a relação Comunicação e Educação nos próprios cursos de comunicação, ou seja, se a apropriação das tecnologias da informação forma cidadãos críticos e conscientes de sua participação na sociedade. Quero chamar a atenção para a contribuição da Educomunicação para o Ensino Superior. Palavras-chave: Jornalismo; Educomunicação; Formação. Abstract The interest of this paper turns to higher education and over the course of Journalism, where students learn early to deal with the media and new technologies. As a result of my post-doctoral internship at the Faculty Casper Libero, the research intends to reflect on the relationship Communication and Education in their own communication courses, that is, if the appropriation of information technology so critical and aware citizens of their participation in society. I want to draw attention to the contribution of the Media Education for Higher Education. Keywords: Journalism; Media Education; Education. RESUMEN El interés de este trabajo se convierte en la educación superior y en el curso de Periodismo, donde los estudiantes aprenden temprano para hacer frente a los medios de comunicación y las nuevas tecnologías. Como resultado de mi pasantía post-doctoral en la Facultad Cásper Líbero, la investigación tiene la intención de reflexionar sobre la relación de Comunicación y Educación en sus propios cursos de comunicación, es decir, si los ciudadanos la apropiación de la tecnología de la información de manera crítica y consciente de su participación en la sociedad. Quiero llamar la atención sobre la contribución de la Educomunicación para la Educación Superior

  7. Paso superior en una ladera

    Directory of Open Access Journals (Sweden)

    Bender, O.

    1965-07-01

    Full Text Available The Redwood highway, through the Californian forest, runs on a viaduct, as it crosses a mountain slope of about 45° inclination. The firm ground is fairly deep, and as an additional constructional difficulty, it was necessary to respect the natural beauty of the countryside. A structure of portal frames were built, forming a number of short spans. These spans were bridged with metal girders, on which a 19 m wide deck was placed. The columns are hollow and have a transversal cross beam, to join each pair. There was difficulty in excavating the foundations for the columns, as it was necessary to dig through the soft top soil, and also prevent this soil from hurting the trunks of the forest trees. Another significant difficulty in the construction of this viaduct was the access to the working site, since there were no suitable platforms from which to operate the appropriate machinery. This made it necessary to do a lot of the work by manual operation. As one of the edges of the deck is very close to the mountain side, a supporting beam was erected on this side. It was made of concrete, on metal piles. The formwork for the deck structure was placed on the concrete stems of the supporting piles.La autopista denominada Redwood (California salva, con un paso superior, la ladera de un bosque cuya pendiente es del 1/1. El terreno firme se halla a bastante profundidad, añadiéndose, a los naturales problemas de la construcción, el imperativo de respetar la belleza agreste del paraje. La solución adoptada consiste en una estructura porticada, con varios tramos de pequeñas luces, salvados con vigas metálicas, sobre los que se coloca la losa del tablero, de 19 m de anchura total. Los soportes están constituidos por pórticos de dos montantes huecos (con bases de hormigón en masa por debajo del suelo, hasta el firme coronados por un cabezal. La perforación de pozos para el hormigonado de los montantes presentaba la dificultad de atravesar el terreno

  8. Retos y perspectivas de la Educación Superior

    Directory of Open Access Journals (Sweden)

    Carlos Tünnermann Bemheim

    2000-12-01

    Full Text Available Las características de una educación superior capaz de hacer frente a las demandas de los próximos años, - los primeros de un nuevo siglo y un nuevo milenio, durante los cuales asistimos, además, a un cambio de épocas - , son analizados en este trabajo. Para ello, el autor se apoya en los aportes de diferentes documentos internacionales sobre este asunto, en las reflexiones del ex Director General de la UNESCO, Profesor Federico Mayor Zaragoza y, sobre todo, en su propia dilatadísima experiencia en el ámbito universitario.

  9. Análise da dieta das larvas de 4º estádio de Cricotopus sp. (Diptera: Chironomidae, em diferentes substratos artificiais e fases hídricas, no trecho superior do rio Paraná = Diet analysis of Cricotopus sp. larvae (Diptera: Chironomidae, fourth stage, in different artificial substrates and hydrological phases, in the upper Paraná river

    Directory of Open Access Journals (Sweden)

    Adriana Felix dos Anjos

    2009-10-01

    Full Text Available No Brasil, estudos sobre hábitos alimentares das larvas de Chironomidae ainda são escassos e estas informações são importantes para entender a estrutura trófica e a organização dos ecossistemas aquáticos. Neste estudo, teve-se como objetivo identificar osprincipais itens alimentares ingeridos por Cricotopus sp. e comparar as possíveis diferenças na dieta das larvas em diferentes substratos artificiais e fases hídricas. Foram utilizados quatro tipos de substratos artificiais: madeira em forma de X (MADX, placas de nitacetal em forma de X (NITX, PVC em forma de tubo (PVCT e metal galvanizado em forma de tubo (METT, cada um com três réplicas. As coletas foram realizadas quinzenalmente, entre os meses de agosto de 2004 e dezembro de 2005. A dieta de Cricotopus sp. foi constituída por detritos, algas e hifas de fungos. Detrito foi o principal item alimentar, com valores superiores a 50% do total consumido. Os resultados indicaram que Cricotopus sp. é uma espécie coletora e, independentemente do substrato, as larvas alimentam-se dos recursos disponíveis no ambiente. Entretanto, mudanças no regime hidrológico do rio Paraná podem influenciar a disponibilidade de alimento, principalmente algumas diatomaceas como Melosira sp., consumidas em maior quantidade apenas na fase de águas baixas.In Brazil, studies on the diet of Chironomidae larvae are still scarce and these data are important to understand the trophic structure and organization of aquatic ecosystems. In this study, we identified the main food items consumed by Cricotopus sp. and compared possible differences in the larval diet at different artificial substrates and hydrological phases. We used four types of artificial substrates: X-shaped wood (MADX; X-shaped nitacetal plates (NITX; tube-shaped PVC (PVCT and tube-shaped galvanizedmetal (METT, each with three replicates. Samplings were undertaken fortnightly, between August 2004 and December 2005. Cricotopus sp. diet was

  10. ¡Ya no estás en la casa! Tecnologías de la escolarización - You are already in the house! Technologies of schooling

    Directory of Open Access Journals (Sweden)

    Alberto Martínez Boom, Colômbia

    2012-08-01

    Full Text Available JÁ NÃO ESTÁS EM CASA! TECNOLOGIAS DE ESCOLARIZAÇÃOResumoO fenômeno da escolarização pode ser analisado por diferentes abordagens. Alguns o estudam como um fato, outros o observam como uma decisão política, outros ainda estão interessados em sua função social como um fator de inclusão. Este trabalho não trabalha com esses registros. Procura se deter mais na descrição de certos detalhes dos começos; por isso o uso de fontes primárias e documentos de época, para mostrar o processo que conecta o surgimento da escola pública com a expansão da escolarização como dispositivo governamental, ou seja, uma prática que passa por descrever minúcias do espaço e do tempo de escola, a geometrização do corpo infantil,  a ênfase na sua  quietude e obediência como caminhos de escolarização que podem ser entendidos e associado a uma ortopedia moral.Palavras-chave: escolarização, ortopedia moral, planos de escola, geometrização do corpo. YOU ARE ALREADY IN THE HOUSE! TECHNOLOGIES OF SCHOOLINGAbstractThe phenomenon of schooling can be analyzed from diverse approaches, some of them study it like a datum, some see it like a political decision, some others are interested in its social function as an inclusion factor; this work does not include those perspectives. It is better focus on the description of certain details of the beginning, for that reason the use of primary sources and documents of the epoch, to show the process that links the emergence of the public school with the wideness of the schooling like governmental mechanism, which means, a practice that describes the trifles of the school space and time, the geometrization of the infant body, the insistence on his quietness, stillness and obedience like principles of a schooling that can be understood and associated to a moral orthopaedics.Keywords: schooling, moral orthopaedics, school plans, body geometrization. ¡YA NO ESTÁS EN LA CASA! TECNOLOGÍAS DE LA

  11. Noise management to achieve superiority in quantum information systems.

    Science.gov (United States)

    Nemoto, Kae; Devitt, Simon; Munro, William J

    2017-08-06

    Quantum information systems are expected to exhibit superiority compared with their classical counterparts. This superiority arises from the quantum coherences present in these quantum systems, which are obviously absent in classical ones. To exploit such quantum coherences, it is essential to control the phase information in the quantum state. The phase is analogue in nature, rather than binary. This makes quantum information technology fundamentally different from our classical digital information technology. In this paper, we analyse error sources and illustrate how these errors must be managed for the system to achieve the required fidelity and a quantum superiority.This article is part of the themed issue 'Quantum technology for the 21st century'. © 2017 The Author(s).

  12. Electrical Stress Test (EST)

    Science.gov (United States)

    2015-03-11

    PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) Fuze and Precision Armaments Technology Directorate U.S. Army Armament Research, Development and...ACTIVITY: Fuze and Precision Armaments Technology Directorate U.S. Army Armament Research, Development and Engineering Center ATTN: RDAR-MEF-F...or questions on this document should be addressed to: Chairman, DOD Fuze Engineering Standardization Working Group, U.S. Army Armament Research

  13. Modelo basado en competencias en la educación superior. Reflexiones e interrogantes

    OpenAIRE

    2014-01-01

    Este trabajo presenta algunas reflexiones surgidas en torno al modelo educativo basado en competencias en el marco del CAI+D 2009 denominado Educación y trabajo. El caso de los alumnos que abandonan los estudios superiores. A tales efectos se indaga acerca de los orígenes históricos y culturales de la utilización de este enfoque en el ámbito de la educación superior, partiendo de la Declaración de Bolonia del año 1999, y del análisis de los modos en que este enfoque se operativizó (Proyecto T...

  14. 75 FR 28542 - Superior Resource Advisory Committee

    Science.gov (United States)

    2010-05-21

    ... orient the new Superior Resource Advisory Committee members on their roles and responsibilities. DATES... of the roles and responsibilities of the Superior Resource Advisory Committee members; Election of... Forest Service Superior Resource Advisory Committee AGENCY: Forest Service, USDA. ACTION: Notice...

  15. [The superior laryngeal nerve and the superior laryngeal artery].

    Science.gov (United States)

    Lang, J; Nachbaur, S; Fischer, K; Vogel, E

    1987-01-01

    Length, diameter and anastomoses of the nervus vagus and its ganglion inferius were measured 44 halved heads. On the average, 8.65 fiber bundles of the vagus nerve leave the retro-olivary area. In the area of the jugular foramen is the near superior ganglion of the 10th cranial nerve. In this area were found 1.48 (mean value) anastomoses with the 9th cranial nerve. 11.34 mm below the margo terminalis sigmoidea branches off the ramus internus of the accessory nerve which has a length of 9.75 mm. Further anastomoses with the 10th cranial nerve were found. The inferior ganglion of the 10th nerve had a length of 25.47 mm and a diameter of 3.46 mm. Five mm below the ganglion the 10th nerve had a width of 2.9 and a thickness of 1.5 mm. The mean length of the superior sympathetic ganglion was 26.6 mm, its width 7.2 and its thickness 3.4 mm. In nearly all specimens anastomoses of the superior sympathetic ganglion with the ansa cervicalis profunda and the inferior ganglion of the 10th cranial nerve were found. The superior laryngeal nerve branches off about 36 mm below the margo terminalis sigmoidea. The width of this nerve was 1.9 mm, its thickness 0.8 mm on the right and 1.0 mm on the left side. The division in the internal and external rami was found about 21 mm below its origin. Between the n. vagus and thyreohyoid membrane the ramus internus had a length of 64 mm, the length of external ramus between the vagal nerve and the inferior pharyngeal constrictor muscle was 89 mm. Its mean length below the thyreopharyngeal part was 10.7 mm, 8.6 branchlets to the cricothyroid muscle were counted. The superior laryngeal artery had its origin in 80% of cases in the superior thyroideal artery, in 6.8% this vessel was a branch of the external carotid artery. Its average outer diameter was 1.23 mm on the right side and 1.39 mm on the left. The length of this vessel between its origin and the thyreohyoid membrane was 34 mm. In 7% on the right side and in 13% on the left, the superior

  16. CitEST libraries

    Directory of Open Access Journals (Sweden)

    Maria Luísa P. Natividade Targon

    2007-01-01

    Full Text Available In order to obtain a better understanding of what is citrus, 33 cDNA libraries were constructed from different citrus species and genera. Total RNA was extracted from fruits, leaves, flowers, bark, seeds and roots, and subjected or not to different biotic and abiotic stresses (pathogens and drought and at several developmental stages. To identify putative promoter sequences, as well as molecular markers that could be useful for breeding programs, one shotgun library was prepared from sweet orange (Citrus sinensis var. Olimpia. In addition, EST libraries were also constructed for a citrus pathogen, the oomycete Phythophthora parasitica in either virulent or avirulent form. A total of 286,559 cDNA clones from citrus were sequenced from their 5’ end, generating 242,790 valid reads of citrus. A total of 9,504 sequences were produced in the shotgun library and the valid reads were assembled using CAP3. In this procedure, we obtained 1,131 contigs and 4,083 singletons. A total of 19,200 cDNA clones from P. parasitica were sequenced, resulting in 16,400 valid reads. The number of ESTs generated in this project is, to our knowledge, the largest citrus sequence database in the world.

  17. La gestión del buril en el marco de las cadenas operativas del nivel IV.4 (Magdaleniense Superior de la cueva de La Pila (Cantabria

    Directory of Open Access Journals (Sweden)

    Mercedes Lloret

    1998-01-01

    Full Text Available Este artículo presenta brevemente los modelos de la dinámica tecnológica observada en uno de los niveles (IVA de ocupación Magdaleniense superior de la cueva de La Pila con el objeto de caracterizar el comportamiento de los hombres que habitaron el lugar en el desan-ollo de su producción lítica.This article presents the technological models which have been observed in the upper Magdalenian level (IVA at La Pila cave in order to show the dinamic behaviour to select their lithic production.

  18. La gestión del buril en el marco de las cadenas operativas del nivel IV.4 (Magdaleniense Superior) de la cueva de La Pila (Cantabria)

    OpenAIRE

    Mercedes Lloret

    1998-01-01

    Este artículo presenta brevemente los modelos de la dinámica tecnológica observada en uno de los niveles (IVA) de ocupación Magdaleniense superior de la cueva de La Pila con el objeto de caracterizar el comportamiento de los hombres que habitaron el lugar en el desan-ollo de su producción lítica.This article presents the technological models which have been observed in the upper Magdalenian level (IVA) at La Pila cave in order to show the dinamic behaviour to select their lithic production....

  19. What are Millian Qualitative Superiorities?

    Directory of Open Access Journals (Sweden)

    Jonathan Riley

    2008-04-01

    Full Text Available In an article published in Prolegomena 2006, Christoph Schmidt-Petri has defended his interpretation and attacked mine of Mill’s idea that higher kinds of pleasure are superior in quality to lower kinds, regardless of quantity. Millian qualitative superiorities as I understand them are infinite superiorities. In this paper, I clarify my interpretation and show how Schmidt-Petri has misrepresented it and ignored the obvious textual support for it. As a result, he fails to understand how genuine Millian qualitative superiorities determine the novel structure of Mill’s pluralistic utilitarianism, in which a social code of justice that distributes equal rights and duties takes absolute priority over competing considerations. Schmidt-Petri’s own interpretation is a non-starter, because it does noteven recognize that Mill is talking about different kinds of pleasant feelings, such that the higher kinds are intrinsically more valuable than the lower. I conclude by outlining why my interpretation is free of any metaphysical commitment to the “essence” of pleasure.

  20. Isolated superior mesenteric artery dissection

    Directory of Open Access Journals (Sweden)

    Lalitha Palle

    2010-01-01

    Full Text Available Isolated superior mesenteric artery (SMA dissection without involvement of the aorta and the SMA origin is unusual. We present a case of an elderly gentleman who had chronic abdominal pain, worse after meals. CT angiography, performed on a 64-slice CT scanner, revealed SMA dissection with a thrombus. A large artery of Drummond was also seen. The patient was managed conservatively.

  1. A escrita no Ensino Superior

    Directory of Open Access Journals (Sweden)

    Maria Conceição Pillon Christofoli

    2013-01-01

    Full Text Available http://dx.doi.org/10.5902/198464445865 O presente artigo trata de apresentar resultados oriundos de pesquisa realizada no Ensino Superior, enfocando a escrita em contextos universitários. Depoimentos por parte dos acadêmicos evidenciam certa resistência ao ato de escrever, o que acaba muitas vezes distanciando o sujeito da produção de um texto. Assim sendo, mesmo que parciais, os resultados até então analisados dão conta de que: pressuposto 1 – há ruptura da ideia de coerência entre o que pensamos, o que conseguimos escrever, o que entende nosso interlocutor; pressuposto 2 – a autocorreção de textos como exercício de pesquisa é imprescindível para a qualificação da escrita; pressuposto 3 – os diários de aula representam rico instrumento para a qualificação da escrita no Ensino Superior; pressuposto 4 – há necessidade de que o aluno do Ensino Superior escreva variados tipos de escrita, ainda que a universidade cumpra com seu papel, enfatizando a escrita acadêmica; pressuposto 5 – o trabalho com a escrita no Ensino Superior deve enfatizar os componentes básicos da expressão escrita: o código escrito e a composição da escrita. Palavras-chave: Escrita; Ensino Superior; formação de professores.

  2. Reflexiones: Pensar las instituciones de educación superior éticamente

    Directory of Open Access Journals (Sweden)

    Jairo Salazar

    2015-10-01

    Full Text Available Hasta la fecha ha existido el paradigma en nuestras Instituciones de educación superior, de que a ellas vienen o se matriculan los estudiantes para aprender (una carrera técnica, tecnológica, profesional, una especialidad, una maestría, un doctorado, etc., como si la Institución educativa fuera un ser todo poderoso y perfecto, sin errores, que se dedica a enseñar. Consideramos que este paradigma debe reformarse y que es hora de que en nuestro país comencemos a proceder de tal manera, que marchemos pensando hacia instituciones de educación superior éticamente.Abstract There has been so far the paradigm in our university educational institutions -the students are enrolled students to learn - (technical, technological, professional career, a specialty, a master’s degree, a Ph.d., etc. as if the educational institution was a powerful and perfect being, without errors, that is dedicated to teaching. We consider that this paradigm must be reformed and that it is time that in our country we start to proceed in such a way, let’s think university educational institutions ethically.

  3. La educación superior como eje del desarrollo

    Directory of Open Access Journals (Sweden)

    Benjamín Afanador Vargas

    2003-11-01

    Full Text Available Este documento analiza cómo ha sido la interacción entre la política educativa y las estrategiasde desarrollo en Colombia, a lo largo del siglo XX. Se presenta una revisión del estadoactual de la educación en Colombia, tanto a nivel de educación básica y media, como de laeducación superior. Para ello se toman tres criterios básicos que son la cobertura, la calidady la equidad en el acceso a la educación. Para el caso de la educación superior, se comparala oferta de cupos con la demanda existente, se clasifican los distintos segmentos en que sedivide la educación superior y se hace una breve reseña sobre el recurso humano con que secuenta en la educación superior colombiana. Así mismo, se expone una conceptualización delos retos que enfrenta la educación superior, sobretodo para lograr una cohesión de la sociedad,evitando que algunos de sus integrantes sean excluidos y permitiendo que todos losestamentos de la sociedad puedan compartir los mismos ideales y los consideren asequibles.Finalmente, se presentan unas conclusiones que se derivan del estudio y se proponen algunasrecomendaciones de política .

  4. Avaliação docente em relação às novas tecnologias para a didática e atenção no ensino superior Teacher evaluation in relation to new technologies for teaching and attention in higher education

    Directory of Open Access Journals (Sweden)

    Luciana Lozza de Moraes Marchiori

    2011-07-01

    Full Text Available Discute-se a importância da atenção no ensino/aprendizagem na universidade em conexão com as novas tecnologias, propondo-se de forma simples, o aprimoramento do desempenho do professor universitário em relação a estas tecnologias, visando à melhoria da atenção do aluno no ensino superior.It discusses the importance of attention in teaching and learning at the university in connection with new technologies, proposing, in a simple way to improve the performance of university teachers vis-à-visthese technologies, with the purpose of improving student attention in higher education.

  5. EST2Prot: Mapping EST sequences to proteins

    Directory of Open Access Journals (Sweden)

    Lin David M

    2006-03-01

    Full Text Available Abstract Background EST libraries are used in various biological studies, from microarray experiments to proteomic and genetic screens. These libraries usually contain many uncharacterized ESTs that are typically ignored since they cannot be mapped to known genes. Consequently, new discoveries are possibly overlooked. Results We describe a system (EST2Prot that uses multiple elements to map EST sequences to their corresponding protein products. EST2Prot uses UniGene clusters, substring analysis, information about protein coding regions in existing DNA sequences and protein database searches to detect protein products related to a query EST sequence. Gene Ontology terms, Swiss-Prot keywords, and protein similarity data are used to map the ESTs to functional descriptors. Conclusion EST2Prot extends and significantly enriches the popular UniGene mapping by utilizing multiple relations between known biological entities. It produces a mapping between ESTs and proteins in real-time through a simple web-interface. The system is part of the Biozon database and is accessible at http://biozon.org/tools/est/.

  6. Pensamiento Superior y Desarrollo Territorial

    Directory of Open Access Journals (Sweden)

    Víctor Manuel Racancoj Alonzo

    2015-04-01

    Full Text Available Esta reflexión pretende explicar el papel, fundamental, que juega el pensamiento superior, en la formulación y la práctica de modelos de desarrollo territorial local; para que contribuyan de forma sustantiva, en la transformación de las condiciones socioeconómicas adversas que hoy viven comunidades indígenas y rurales de muchos países, como Guatemala, situación que puede resumirse en altos índices de pobreza y desnutrición. Pero, el pensamiento superior, debe ser competencia de la población con pertenencia a lo local, pues si y solo si esta condición existe, se dará validez y viabilidad al desarrollo territorial. Para alcanzar competencias de pensamiento superior, en los espacios locales, se tiene que superar obstáculos en el modelo de universidad, que hoy estamos familiarizados a ver y pensar; modelos que tienen las características de: herencia colonial, disfunción con la problemática económica, cultural, social y política de la sociedad y la negación de los saberes ancestrales.

  7. Superior sulcus tumors (Pancoast tumors).

    Science.gov (United States)

    Marulli, Giuseppe; Battistella, Lucia; Mammana, Marco; Calabrese, Francesca; Rea, Federico

    2016-06-01

    Superior Sulcus Tumors, frequently termed as Pancoast tumors, are a wide range of tumors invading the apical chest wall. Due to its localization in the apex of the lung, with the potential invasion of the lower part of the brachial plexus, first ribs, vertebrae, subclavian vessels or stellate ganglion, the superior sulcus tumors cause characteristic symptoms, like arm or shoulder pain or Horner's syndrome. The management of superior sulcus tumors has dramatically evolved over the past 50 years. Originally deemed universally fatal, in 1956, Shaw and Paulson introduced a new treatment paradigm with combined radiotherapy and surgery ensuring 5-year survival of approximately 30%. During the 1990s, following the need to improve systemic as well as local control, a trimodality approach including induction concurrent chemoradiotherapy followed by surgical resection was introduced, reaching 5-year survival rates up to 44% and becoming the standard of care. Many efforts have been persecuted, also, to obtain higher complete resection rates using appropriate surgical approaches and involving multidisciplinary team including spine surgeon or vascular surgeon. Other potential treatment options are under consideration like prophylactic cranial irradiation or the addition of other chemotherapy agents or biologic agents to the trimodality approach.

  8. Technology.

    Science.gov (United States)

    Online-Offline, 1998

    1998-01-01

    Focuses on technology, on advances in such areas as aeronautics, electronics, physics, the space sciences, as well as computers and the attendant progress in medicine, robotics, and artificial intelligence. Describes educational resources for elementary and middle school students, including Web sites, CD-ROMs and software, videotapes, books,…

  9. Utilización y funcionalidad de los recursos tecnológicos y de las nuevas tecnologías en la educación superior Use and functionality of the technological resources and of the new technologies in higher education

    Directory of Open Access Journals (Sweden)

    Elías Blanco

    2009-12-01

    Full Text Available En el artículo se estudia el grado de utilización que realiza el profesorado de los recursos tecnológicos y se analiza su funcionalidad pedagógica en la enseñanza superior de las carreras de educación en España y Portugal. El diseño de investigación se aborda desde el estudio de caso, analizando la situación objeto de estudio en ambos países. La investigación desarrollada es de corte transversal y combina el estudio extensivo con el intensivo. Se ha recurrido al cuestionario para la toma de datos del alumnado y a la realización de grupos de discusión con el profesorado. Entre las conclusiones se constata que el profesorado de las carreras de educación de España y Portugal continua utilizando en mayor medida los recursos tecnológicos tradicionales que los nuevos avances digitales. Las funciones educativas de aplicación más habitual son las de ejemplificar los modelos de enseñanza-aprendizaje, motivar, transmitir información y estructurar contenidos.This paper studies the quantitative use of technological resources by teachers. It analyzes their pedagogical functionality in education courses both in Spain and Portugal. Its methodological approach is based on case studies and an analysis of the situation of the study object in both countries. This transverse research combines extensive and intensive studies. A questionnaire was used to gather data concerning students and discussion groups among teachers were created. One of its conclusions is that, both in Spain and Portugal, teachers lecturing in education undergraduate courses still make more use of the analogical, traditional technological resources than of the new digital advances. The educational functions more commonly applied consist of exemplifying teaching and learning models, motivating, transmitting information and structuring content.

  10. El impacto del diseño de actividades en el plagio de Internet en educación superior

    National Research Council Canada - National Science Library

    2016-01-01

    El objetivo de este trabajo es comprender mejor la naturaleza del plagio en la Educación Superior. Analizamos una serie de actividades en un curso on-line de nivel universitario, con el objetivo de encontrar...

  11. Avanços tecnológicos na prática ortopédica: análises de membros superiores e inferiores Technological advances in orthopedics: upper and lower limbs analysis

    Directory of Open Access Journals (Sweden)

    Alberto Cliquet Júnior

    2004-03-01

    Full Text Available A Biomecânica, atualmente, é caracterizada por novos procedimentos para análise do movimento humano e por novas técnicas de medição, armazenamento e processamento de dados, contribuindo para os avanços na prática ortopédica. A temática proposta no presente trabalho baseia-se na aplicação da biomecânica ortopédica em diferentes quadros clínicos, através de avaliações quantitativas do movimento dos membros superiores e inferiores, além da criação de novas técnicas de medição. Três exemplos são mostrados neste artigo: (I análise tridimensional do movimento de abdução do ombro; (II análise da marcha de indivíduos com lesão no ligamento cruzado anterior; e (III o desenvolvimento de instrumentação eletrônica para dispositivos de auxílio, ou seja, bengalas e muletas instrumentalizadas para o estudo das relações de força entre os membros superiores e inferiores, durante a marcha de pacientes com lesão ortopédica e neurológica.Biomechanics is nowadays characterized by new procedures for human movement analysis and by modern measurement techniques, data processing and storage, contributing to the advances in the orthopedic practice. The proposed thematic in this work is based on the application of orthopedic biomechanics to different clinical cases, through quantitative evaluation of the upper and lower limb movement and the development of new assessment techniques. Three examples are shown in this paper: (I a tridimensional analysis of the abduction movement of the shoulder; (II a gait analysis in individuals with anterior cruciate ligament injury; and (III the development of electronic instrumentation for walking aids i.e., instrumented canes and crutches for the study of the relationship between the upper and lower limb loads during gait of orthopedic and neurologic patients.

  12. galaxieEST: addressing EST identity through automated phylogenetic analysis

    Directory of Open Access Journals (Sweden)

    Larsson Karl-Henrik

    2004-07-01

    Full Text Available Abstract Background Research involving expressed sequence tags (ESTs is intricately coupled to the existence of large, well-annotated sequence repositories. Comparatively complete and satisfactory annotated public sequence libraries are, however, available only for a limited range of organisms, rendering the absence of sequences and gene structure information a tangible problem for those working with taxa lacking an EST or genome sequencing project. Paralogous genes belonging to the same gene family but distinguished by derived characteristics are particularly prone to misidentification and erroneous annotation; high but incomplete levels of sequence similarity are typically difficult to interpret and have formed the basis of many unsubstantiated assumptions of orthology. In these cases, a phylogenetic study of the query sequence together with the most similar sequences in the database may be of great value to the identification process. In order to facilitate this laborious procedure, a project to employ automated phylogenetic analysis in the identification of ESTs was initiated. Results galaxieEST is an open source Perl-CGI script package designed to complement traditional similarity-based identification of EST sequences through employment of automated phylogenetic analysis. It uses a series of BLAST runs as a sieve to retrieve nucleotide and protein sequences for inclusion in neighbour joining and parsimony analyses; the output includes the BLAST output, the results of the phylogenetic analyses, and the corresponding multiple alignments. galaxieEST is available as an on-line web service for identification of fungal ESTs and for download / local installation for use with any organism group at http://galaxie.cgb.ki.se/galaxieEST.html. Conclusions By addressing sequence relatedness in addition to similarity, galaxieEST provides an integrative view on EST origin and identity, which may prove particularly useful in cases where similarity searches

  13. Entidades fiscalizadoras superiores y accountability

    OpenAIRE

    Estela Moreno, María

    2016-01-01

    OBJETIVOS DE LA TESIS: El objetivo general del trabajo es establecer el nivel de eficacia de las Entidades Fiscalizadoras Superiores (EFS) como agencia asignada y herramienta de accountability horizontal, a través de la valoración de su diseño institucional y de la calidad de sus productos finales, los informes de auditoría, estableciéndose los siguientes objetivos específicos: 1. Relevar las nociones de accountability, actualizando el Estado del Arte de la cuestión. 2. Analizar la ...

  14. AcEST: BP920571 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tein homolog OS=... 34 0.62 sp|Q9Y239|NOD1_HUMAN Nucleotide-binding oligomerization domain-c... 33 1.1 sp|Q5FWL4|EST2A_XENLA Extended...ITAKGTAQLADALQSNTGITEICLNGNLIKPEEAKVYEDEKRII 951 >sp|Q5FWL4|EST2A_XENLA Extended synaptotagmin-2-A OS=Xenopu

  15. Technology

    Directory of Open Access Journals (Sweden)

    Xu Jing

    2016-01-01

    Full Text Available The traditional answer card reading method using OMR (Optical Mark Reader, most commonly, OMR special card special use, less versatile, high cost, aiming at the existing problems proposed a method based on pattern recognition of the answer card identification method. Using the method based on Line Segment Detector to detect the tilt of the image, the existence of tilt image rotation correction, and eventually achieve positioning and detection of answers to the answer sheet .Pattern recognition technology for automatic reading, high accuracy, detect faster

  16. The sentence superiority effect revisited.

    Science.gov (United States)

    Snell, Joshua; Grainger, Jonathan

    2017-11-01

    A sentence superiority effect was investigated using post-cued word-in-sequence identification with the rapid parallel visual presentation (RPVP) of four horizontally aligned words. The four words were presented for 200ms followed by a post-mask and cue for partial report. They could form a grammatically correct sentence or were formed of the same words in a scrambled agrammatical sequence. Word identification was higher in the syntactically correct sequences, and crucially, this sentence superiority effect did not vary as a function of the target's position in the sequence. Cloze probability measures for words at the final, arguably most predictable position, revealed overall low values that did not interact with the effects of sentence context, suggesting that these effects were not driven by word predictability. The results point to a level of parallel processing across multiple words that enables rapid extraction of their syntactic categories. These generate a sentence-level representation that constrains the recognition process for individual words, thus facilitating parallel word processing when the sequence is grammatically sound. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Private visit to the CMS assembly site of Dr. Fidel Castro Diaz-Balart from the Superior Institute of Sciences and Nuclear Technologies, Havana, accompanied by His Excellency Mr. Emilio Caballero, Ambassador, Permanent Mission of Cuba in Paris.

    CERN Document Server

    Maximilien Brice

    2002-01-01

    Photo 01: Left to right: His Excellency Mr Emilio Caballero; Prof. Tejinder Virdee, Deputy Spokesman of the CMS experiment; Dr Fidel Castro Diaz-Balart; Dr Matthias Schroeder, physicist, Experimental Physics division; Mrs Noëlle Levy, Casa del Habano, Geneva; Dr John Ellis, Adviser for Non-Member State relations; Dr Christian Roche, Senior Advisor to the Director-General. Photo 02: Left to right: His Excellency Mr Emilio Caballero, Prof. Tejinder Virdee, Dr Fidel Castro Diaz-Balart; Dr Matthias Schroeder; Mrs Noëlle Levy, Prof. Juan Antonio Rubio, Head of the Education and Technology Transfer division; Dr John Ellis.

  18. O MARKETING NO ENSINO SUPERIOR: COMPARATIVO BRASIL-PORTUGAL

    Directory of Open Access Journals (Sweden)

    Helena Alves

    2010-12-01

    Full Text Available Ao abordar o marketing aplicado ao ensino superior, este estudo tem como objetivos discutir os conceitos teóricos do marketing educacional e aplicálos aos contextos brasileiro e português. Tendo em consideração que o marketing educacional tem a sua maior expressão nos E.U.A., a sua aplicação a diferentes realidades e culturas requer adaptações. Inicialmente, fez-se uma revisão dos conceitos tradicionais de marketing educacional, com ênfase nas vantagens, desvantagens e no marketing-mix aplicado à educação. Posteriormente realizou-se uma caraterização dos contextos atuais do ensino superior no Brasil e em Portugal, e fez-se uma comparação da aplicação do marketing educacional nas realidades brasileira e portuguesa, focando as análises no marketing-mix educacional. Percebeu-se que o ensino superior no Brasil tem caraterísticas muito diversas do ensino superior em Portugal e ambos divergem na aplicação dos conceitos mais tradicionais do marketing à educação. Desta forma, faz-se necessária a construção de abordagens teóricas específicas para a aplicação do marketing educacional a diferentes nações.

  19. Sistema simulador para el examen de egreso del técnico superior universitario

    OpenAIRE

    Saldaña Gonzáles, Griselda; Cerezo Sánchez, Jorge

    2010-01-01

    En México los estudiantes de Universidades Tecnológicas, al concluir sus estudios tienen que presentar un examen general de egreso, donde se evalúa el conocimiento teórico – técnico adquirido durante su estancia en el programa educativo al que pertenecen. Este examen es realizado por el Centro Nacional de Evaluación para la Educación Superior (CENEVAL) [1]. En este artículo se presenta la propuesta de un simulador del Examen General de Egreso de Técnico Superior Universitario (EGETSU) cuya f...

  20. Sistema simulador para el examen de egreso del técnico superior universitario

    OpenAIRE

    Saldaña Gonzáles, Griselda; Cerezo Sánchez, Jorge

    2010-01-01

    En México los estudiantes de Universidades Tecnológicas, al concluir sus estudios tienen que presentar un examen general de egreso, donde se evalúa el conocimiento teórico – técnico adquirido durante su estancia en el programa educativo al que pertenecen. Este examen es realizado por el Centro Nacional de Evaluación para la Educación Superior (CENEVAL) [1]. En este artículo se presenta la propuesta de un simulador del Examen General de Egreso de Técnico Superior Universitario (EGETSU) cuya f...

  1. Estás contratado!

    OpenAIRE

    2012-01-01

    Este Objeto de aprendizaje interactivo muestra la simulación de una entrevista de trabajo. En este objeto se deberá elegir la opción de respuesta más adecuada de acuerdo con la pregunta planteada, recibiendo de manera inmediata las respuestas correctas y equivocadas.

  2. 78 FR 21116 - Superior Supplier Incentive Program

    Science.gov (United States)

    2013-04-09

    ... Department of the Navy Superior Supplier Incentive Program AGENCY: Department of the Navy, DoD. ACTION... policy that will establish a Superior Supplier Incentive Program (SSIP). Under the SSIP, contractors that..., performance, quality, and business relations would be granted Superior Supplier Status (SSS). Contractors...

  3. superior en México

    Directory of Open Access Journals (Sweden)

    César Mureddu Torres

    2008-01-01

    Full Text Available El presente artículo desarrolla algunos de los retos que ha traído consigo el acceso a la información existente en la red de Internet y lo que ello supone. Se abordan principalmente las consecuencias de la presencia actual de una sociedad llamada del conocimiento, si se mantiene la confusión entre conocimiento e información. Por ello, la sola gestión de la información no puede ser tomada como definitoria respecto a la función de educación superior confiada a las universidades. Hacerlo sería cometer un error aún más grave que la confusión teórica entre los términos mencionados.

  4. DESAFÍOS Y PARADIGMAS DE LA EDUCACIÓN SUPERIOR

    OpenAIRE

    2012-01-01

    Se plantean como desafíos y paradigmas de la educación superior en nuestro país los siguientes: construcción de la sociedad del conocimiento; acceso universal a la educación superior; recursos presupuestarios acordes con los estándares internacionales; diversificación del financiamiento; transparencia y rendición de cuentas; internacionalización de la educación superior; implantación de mecanismos de evaluación y acreditación En tales aspectos, el Estado Mexicano debe recuperar su liderazgo y...

  5. FINANCIAMIENTO DE LA EDUCACIÓN SUPERIOR: UNA INTRODUCCIÓN

    OpenAIRE

    Maximiliano González

    2000-01-01

    ¿Por qué es importante pensar y discutir sobre el financiamiento de la educación superior? En primer lugar, la demanda que existe de educación superior es mayor en los actuales momentos que en el pasado, lo cual hace que los requerimientos financierosdestinados a la educación superior tiendan a incrementarse considerablemente; en segundo lugar, los países están en menor capacidad de atender dichos requerimientos dados los abultados déficits fiscales. Dicho esto es necesario estudiar otras fue...

  6. CALIDAD Y EXPERIENCIA DOCENTE EN EDUCACIÓN SUPERIOR

    Directory of Open Access Journals (Sweden)

    María Isabel Lafuente Guantes

    2010-01-01

    Full Text Available En este trabajo se considera la forma de entender la calidad en la experiencia docente en educación superior a partir de la práctica del profesorado, y en relación con las orientaciones educativas hoy al uso. Se analiza en tres trabajos: las nociones en que se basa esta experiencia, su valor en el proceso docente, qué condiciones se requieren para lograr que la creencia en la calidad alcance su efectuación.

  7. El lenguaje y la educación superior

    Directory of Open Access Journals (Sweden)

    Juan Carlos Vergara Silva

    2001-07-01

    Full Text Available En este artículo se plantea el análisis de algunos retos que genera la relación entre el lenguaje y la educación superior en una sociedad digital; así mismo, se establece cómo los usuarios de las nuevas tecnologías exigen al docente universitario un manejo efectivo de los lenguajes hipertextuales a fin de superar el esquema de "transmisor de información", heredado de los modelos tradicionales de educación.

  8. Environmentally Sustainable Transport (EST). Concept, Goal, and Strategy. The OECD's EST Project

    Energy Technology Data Exchange (ETDEWEB)

    Wiederkehr, P.; Caid, N. [Environment Directorate, Organisation for Economic Cooperation and Development OECD, Paris (France); Gilbert, R. [Centre for Sustainable Transportation, Toronto (Canada); Crist, P. [Directorate of Science, Technology and Industry, Organisation for Economic Cooperation and Development OECD, Paris (France)

    2004-07-01

    OECD countries recognized in the mid-1990s that transport trends were not sustainable and that existing policy frameworks seemed unlikely to be able to move society towards more sustainable transport systems. A new approach to transport policy was required that would be consistent with the broad definition of sustainable development. To this end, the project on Environmentally Sustainable Transport (EST) was initiated to give some precision to the concept of EST through the use of criteria that have environmental significance and can be quantified. A method known as 'backcasting' was used to develop policies and strategies for achieving a desired future state through targeted action. This paper summarizes the results of the project, which involved twelve OECD countries that undertook case studies at local, regional, national and international scales. The project concluded that some 40 per cent of the effort necessary to meet the EST criteria will come from technology and 60 per cent from demand-side management and a shift towards more sustainable transport modes. EST is attainable, but only if a broad range of instruments is deployed. These include regulations and standards, fiscal measures, changes in governance arrangements, and education, the provision of information, awareness raising, and attitude change, all assembled into coherent packages of instruments applied with careful consideration to phasing. Significant structural changes and adaptations will be required to realize EST. They will reduce social costs and provide net benefits for the environment and for quality of life in general. The required changes will provide major opportunities for new business, including integrated mobility services, freight logistics, and information technology. A key outcome of the project was a set of guidelines for moving towards EST.

  9. Síndrome de Deiscência de Canal Semicircular Superior Superior Canal Dehiscence Syndrome

    Directory of Open Access Journals (Sweden)

    Suzane da Cunha Ferreira

    2006-06-01

    Full Text Available A Síndrome de Deiscência de Canal Semicircular Superior (SDCSS, primeiramente descrita em 1998 por Minor et al., caracteriza-se por vertigem associada à presença de nistagmo, relacionados à exposição a estímulos sonoros intensos ou a modificações de pressão dentro da orelha média ou intracraniana. Disacusia, em sua maioria de padrão condutivo à audiometria tonal, também pode estar presente. Nesta revisão da literatura objetivou-se abordar a SDCSS, com seus principais sinais e sintomas, achados diagnósticos e tratamento, assim como enfatizar a importância de sua inclusão dentre as causas de vertigem, visto tratar-se de acometimento ainda pouco conhecido até mesmo entre especialistas. O diagnóstico correto, além de possibilitar seu tratamento, impede que abordagens diagnósticas e terapêuticas inapropriadas sejam realizadas.The Superior Canal Dehiscence Syndrome (SCDS was first reported by Minor at. Al. (1998, and has been characterized by vertigo and vertical-torsional eye movements related to loud sounds or stimuli that change middle ear or intracranial pressure. Hearing loss, for the most part with conductive patterns on audiometry, may be present in this syndrome. We performed a literature survey in order to to present symptoms, signs, diagnostic and therapeutic approaches to the SCDS, also aiming at stressing the great importance of including this syndrome among the tractable cause of vertigo. We should emphasize that this is a recent issue, still unknown by some specialists. The Correct SCDS diagnosis, besides enabling patient treatment, precludes misdiagnosis and inadequate therapeutic approaches.

  10. 黑龙江省发展大麻的优势与主要栽培技术%The Superiority and Main Cultivation Technology of Hemp in Heilongjiang Province

    Institute of Scientific and Technical Information of China (English)

    宋宪友; 张利国; 房郁妍; 郑楠

    2011-01-01

    The status and the development advantages of hemp industry in Heilongjiang Province were described in this article: Heilongjiang Province is the first one to use flat sowing, close planting and mechanized processing. Warm water retting, dew retting technology and decorticating scutching machinery were adopted in the hemp production. The planting area of hemp in Heilongjiang Province was 9300 hm2 in 2007 and 4200 hm2 in 2009, accounting for 38.9% of the total in China. There are rich soil resources,suitable climate, a long history of planting hemp, the large-scale processing conditions and the mechanized conditions for cultivation and production. At the same time, the primary cultivation techniques were stated including seed treatment, right soil selection, ploughing in the summer and the fall, careful soil preparation,rational fertilization, timely planting, chemical weed control, irrigation, the control of diseases and pests,timely harvest, the proper storage and the mechanical threshing.%本文介绍了黑龙江省大麻产业的现状和发展优势:率先采用平播密植,机械加工.大麻生产主要采用温水沤麻和雨露工艺进行生物脱胶,利用亚麻剥麻机制麻.2007年我省大麻种植面积9300hm2,2009年仍有4200hm2,种植面积占全国大麻种植面积的38.9%.黑龙江种植大麻有丰富的土地资源、适宜的气候条件;有悠久的种麻历史、规模加工条件;有全程的机械化栽培生产条件.同时,结合黑龙江生产实际提出了大麻主要栽培技术:播前种子药剂处理,选择适宜的地块种植,伏、秋翻地,精细整地,合理施肥,适时播种,适时进行化学除草、灌溉、防病治虫,适期收获,妥善保管,机械脱粒.

  11. Relatório de estágio em terapia manual ortopédica

    OpenAIRE

    Silva, Florinda

    2010-01-01

    Este Estágio foi realizado no âmbito do Mestrado em Fisioterapia em Terapia Manual Ortopédica, no Centro Hospitalar entre o Douro e Vouga EPE, Unidade de S. João da Madeira no período entre Janeiro e Abril de 2010. Pretendeu-se durante o estágio abranger uma variedade de patologias mas esta pretensão esteve condicionada às patologias existentes no serviço e que se adequavam aos objectivos do estágio. Assim os casos tratados centraram-se no quadrante superior por serem predominantes. A a...

  12. EST and EST-SSR marker resources for Iris

    Directory of Open Access Journals (Sweden)

    Taylor Christopher A

    2009-06-01

    Full Text Available Abstract Background Limited DNA sequence and DNA marker resources have been developed for Iris (Iridaceae, a monocot genus of 200–300 species in the Asparagales, several of which are horticulturally important. We mined an I. brevicaulis-I. fulva EST database for simple sequence repeats (SSRs and developed ortholog-specific EST-SSR markers for genetic mapping and other genotyping applications in Iris. Here, we describe the abundance and other characteristics of SSRs identified in the transcript assembly (EST database and the cross-species utility and polymorphisms of I. brevicaulis-I. fulva EST-SSR markers among wild collected ecotypes and horticulturally important cultivars. Results Collectively, 6,530 ESTs were produced from normalized leaf and root cDNA libraries of I. brevicaulis (IB72 and I. fulva (IF174, and assembled into 4,917 unigenes (1,066 contigs and 3,851 singletons. We identified 1,447 SSRs in 1,162 unigenes and developed 526 EST-SSR markers, each tracing a different unigene. Three-fourths of the EST-SSR markers (399/526 amplified alleles from IB72 and IF174 and 84% (335/399 were polymorphic between IB25 and IF174, the parents of I. brevicaulis × I. fulva mapping populations. Forty EST-SSR markers were screened for polymorphisms among 39 ecotypes or cultivars of seven species – 100% amplified alleles from wild collected ecotypes of Louisiana Iris (I.brevicaulis, I.fulva, I. nelsonii, and I. hexagona, whereas 42–52% amplified alleles from cultivars of three horticulturally important species (I. pseudacorus, I. germanica, and I. sibirica. Ecotypes and cultivars were genetically diverse – the number of alleles/locus ranged from two to 18 and mean heterozygosity was 0.76. Conclusion Nearly 400 ortholog-specific EST-SSR markers were developed for comparative genetic mapping and other genotyping applications in Iris, were highly polymorphic among ecotypes and cultivars, and have broad utility for genotyping applications within

  13. CURRENT COLLOIDAL DISPERSION GELS ARE NOT SUPERIOR TO POLYMER FLOODING

    Institute of Scientific and Technical Information of China (English)

    Seright Randy; Han Peihui; Wang Dongmei

    2006-01-01

    The suggestion that the colloidal-dispersion-gel (CDG) process is superior to normal polymer flooding is misleading and generally incorrect. Colloidal dispersion gels, in their present state of technological development, should not be advocated as an improvement to, or substitute for, polymer flooding. Gels made from aluminum-citrate crosslinked polyacrylamides can act as conventional gels and provide effective conformance improvement in treating some types of excess water production problems if sound scientific and engineering principles are respected.

  14. UN MODELO PARA EL FONDO ESPECIAL PARA LA EDUCACIÓN SUPERIOR (FEES)

    OpenAIRE

    Oldemar Rodríguez Rojas

    2010-01-01

    En este artículo se hace un análisis comparativo de los cinco convenios para el financiamiento de la educación superior pública que se han firmado hasta la fecha; para esto se utilizan los datos de los años 2004 al 2009. Luego, con base en este análisis proponemos un nuevo modelo alternativo para el cálculo del FEES; este nuevo modelo es comparado con el modelo establecido en el quinto convenio para el cálculo del FEES, con base en una simulación en un posible escenario del comportamiento de ...

  15. AcEST: DK952058 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 09 sp|Q7ZWU7|EST2B_XENLA Extended synaptotagmin-2-B OS=Xenopus laev... 63 2e-09 sp|Q5FWL4|EST2A_XENLA Extended...=... 62 2e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 62 3e-09 sp|Q7TNF0|DOC2A_M... OS=Mus musculus... 61 5e-09 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Ho

  16. Hacia una educación superior inclusiva en Colombia

    Directory of Open Access Journals (Sweden)

    Sandra Lucia Arizabaleta Dominguez

    2016-12-01

    Full Text Available En este artículo se analizan concepciones teórico-conceptuales básicas que subyacen a la educación superior inclusiva, en el marco de los Lineamientos de la Política de Educación Superior Inclusiva del Ministerio de Educación Nacional de Colombia (men. Además, se plantean los desafíos que deben asumir las instituciones de educación superior (ies en la identificación de barreras de aprendizaje de su población estudiantil y la promoción de estrategias que garanticen la accesibilidad, permanencia, pertinencia académica y la graduación. Esta situación lleva a las ies a reflexionar y repensarse a partir de los procesos de autoevaluación institucional para crear estrategias participativas que promuevan la gestión inclusiva en un sistema educativo equitativo, pertinente y de calidad

  17. Un ami qui est toujours

    Institute of Scientific and Technical Information of China (English)

    王艳

    2012-01-01

    Un jour,pendant la récréation,je suis descendue dans le bureau du secrétariat.Quand je préparais un café,une femme professeur d'espagnol s'est exclamée:《Tiens! Tu es de bonne humeur ce matin ! 》 (E)tonnée,je lui ai demandé pourquoi.Elle a répondu:《 Parce que tu prends un ca fé.》Quelle réponse inattendue! Ce n'est qu'un café instantané,un peu fade,pas très bon,à dire vrai.Si j'en prends une petite tasse,ce n'est pas que je suis de bonne humeur.C'est plut(o)t mon habitude,ou bien c'est que le café me donne une belle humeur.

  18. La evaluación institucional y la educación superior

    Directory of Open Access Journals (Sweden)

    ANGÉLICA ROSAS HUERTA

    2013-01-01

    Full Text Available En este momento el gobierno mexicano está impulsando un conjunto de políticas orientadas a lograr la calidad de la educación superior, entre ellas destaca la política de evaluación, que no representa un curso de acción reciente, sino que es producto de gestiones anteriores. Por ello, este artículo busca exponer el desarrollo que ha tenido en México la política de evaluación y sus programas en los últimos veinte años, destacando su importancia en la transformación que experimenta la educación superior en todos sus ámbitos.

  19. Centro Profesional del Este. Caracas

    Directory of Open Access Journals (Sweden)

    Romero Gutiérrez, Jorge

    1957-12-01

    Full Text Available El edificio para el «Centro Profesional del Este» tiene como finalidad agrupar a los profesionales de diferentes especialidades, cuyo trabajo está relacionado con la planificación e industria de la construcción. Tanto en el sentido de creación como en el de realidad utilizable, ha sido concebido como un todo armónico que pueda satisfacer, no sólo las necesidades de tipo técnico, sino aquéllas de correlación de actividades afines desde el punto de vista económico, social y cultural.

  20. THE HUMAN SUBJECTIVITY BETWEEN THE SUPERIOR AND INFERIOR TYPES A SUBJETIVIDADE HUMANA ENTRE OS TIPOS SUPERIORES E INFERIORES

    Directory of Open Access Journals (Sweden)

    Vagner Silva

    2011-12-01

    Full Text Available This article attempts to solve the following contradiction of Nietzsche's thought: man has a subjective drive constitution, these drives, however, are individuals, and its being (the being of the drives, is constituted for more power fight (the will to power. Nietzsche's superior man (educated and cultivated man is that one, in which there is harmony in the drives, who can give greater freedom to its most terrible drives, without, however, loses the control over them. That is the contradiction: if man has to control the drives, they are not harmonics. There is incompatibility between harmony and control. In other words, the superior man is indeed the man of culture and cultivated man of Nietzsche? If the answer to this question is yes, then, in this man, reigns the drives harmony. If, on the other hand, the answer is no, then, for this man does not become a barbarian destroyer, dangerous to himself and to others it is necessary that a drive dominates the others. However it is not possible to escape the contradiction: either there is harmony in human drive or control.Este artigo busca resolver a seguinte contradição do pensamento de Nietzsche: o homem possui uma constituição subjetiva pulsional, estas pulsões, porém, são individuais, e o seu ser, o das pulsões, constitui-se da luta por mais poder (vontade de poder. O homem superior de Nietzsche (homem culto e cultivado é aquele no qual há harmonia nas pulsões, aquele que pode dar mais liberdade às suas mais terríveis pulsões, sem, no entanto, perder o controle sobre elas. Eis a contradição: se o homem superior exerce controle sobre as pulsões então elas não são harmônicas. Há, aqui, a incompatibilidade entre harmonia e controle. Em outros termos: o homem superior é de fato o homem culto e cultivado de Nietzsche? Se a resposta para esta pergunta for sim, então neste homem reina a harmonia pulsional. Se, por outro lado, a resposta for não, então, para que este homem n

  1. Ensaio tecnológico e sensorial de soja [Glycine max (L. Merrill] enlatada em estádios verdes e no estádio da maturação de colheita Technological and sensorial assay of soybean [Glycine max (L. Merrill] canned at green stages and at harvest maturation stage

    Directory of Open Access Journals (Sweden)

    M.F.P BARCELOS

    1999-01-01

    Full Text Available Foi estudada a viabilidade de consumo da cultivar de soja IAC PL-1 enlatada como grão verde e sua melhor época de colheita para enlatamento. Para tanto procederam-se cinco colheitas a partir do 48º dia após a floração (DAF até a extinção da coloração verde. O processamento iniciou-se pelo branqueamento das vagens, debulha e enlatamento. Aos cinco lotes obtidos adicionou-se um sexto lote para estudar o efeito do armazenamento. Para qualificar os seis lotes de grãos enlatados foram efetuadas medidas de peso, cor, textura e características do líquido de enlatamento. Foram realizados estudos das propriedades sensoriais dos grãos enlatados para dimensionar a aceitação pela degustação e aparência. O enlatamento foi otimizado para 121ºC com tempo de esterilização em torno de 4 minutos. A maturidade fisiológica dos grãos ocorreu entre o 61º ao 64º DAF. O processo térmico conservou a cor verde dos grãos enlatados e não induziu perda expressiva da massa dos grãos; a textura firme dos grãos aumentou com a maturação. Os provadores demonstraram boa aceitação dos produtos e não ocorreu preferência em relação aos estádios de maturação. O trabalho conclui que grãos verdes de soja IAC PL-1 proporcionam enlatados com boas características técnicas e gustativas. Foi observado que grãos colhidos no ponto convencional de maturação, armazenados e enlatados obtiveram boa aceitação gustativa, concluindo-se que a cultivar IAC PL-1 é também adequada para o consumo e enlatada após o armazenamento.It was investigated the consumption possibility of the soybean cultivar IAC PL-1 canned as green grain and its best harvest time for canning. Five harvests were processed from the 48th day after flowering (DAF until extinction of the green coloration. The canning procedure started by pod bleaching, dehulling and canning. To the five lots obtained, a sixth lot was added to study the effect of storage. To qualify the six lots of

  2. Clinical implications of preventing the recurrence of the acute gallstone pancreatitis by using the EST technology%EST预防急性胆源性胰腺炎复发的临床研究

    Institute of Scientific and Technical Information of China (English)

    周鸣清; 陈欣然; 陆仁达

    2008-01-01

    目的:探讨内镜下乳头括约肌切开(EST)对预防急性胆源性胰腺炎(ABP)复发的临床价值.方法:将临床治愈的296例ABP患者分为EST治疗组(n=119)和非EST对照组(n=177).将两组患者进一步分为胆囊切除组和非胆囊切除组.随访所有ABP患者,比较二组复发率有无显著差异.结果:两组ABP患者,平均随访时间32±14月;15例失访,随访率94.9%.EST治疗组(11/113)的复发率明显低于非EST治疗组(75/168),其差异有显著性,P<O.01;而胆囊切除虽然能降低ABP的复发率,但其差异无显著性P>0.05.结论 应用EST技术治疗ABP,可预防ABP的再次发作.

  3. Flexibilidad en la educación superior: revisión de expectativas Flexibility in Higher Education: Revisiting Expectations

    Directory of Open Access Journals (Sweden)

    Betty Collis

    2011-10-01

    Full Text Available Llevamos bastantes años estudiando la construcción de la flexibilidad en la educación superior, tanto desde la óptica de la investigación como de la práctica. Entendemos por flexibilidad la opción de ofrecer a los estudiantes la posibilidad de elegir cómo, qué, dónde, cuándo y con quién participan en las actividades de aprendizaje mientras están en una institución de educación superior. En el libro que escribimos sobre esta temática en 2001 identificamos opciones posibles para los estudiantes de educación superior con la finalidad de incrementar la flexibilidad de su participación. Lo estudiamos no solo desde la perspectiva del estudiante sino también desde las implicaciones para los profesores y para las instituciones de educación superior, y examinamos el papel fundamental que desempeñan el cambio pedagógico y la tecnología en el aumento de la flexibilidad. Ahora, diez años después, revisamos los temas clave relacionados con la flexibilidad en la educación superior e identificamos, en términos generales, hasta qué punto se ha ido estableciendo el incremento de la flexibilidad, si todavía está evolucionando o si ha evolucionado de una forma que no pudimos prever hace diez años. Revisamos también nuestros escenarios para el cambio en la educación superior relacionados con la flexibilidad y los contrastamos con un estudio más reciente llevado a cabo en el Reino Unido. Nuestra conclusión principal es que la cuestión de la flexibilidad en la educación superior sigue siendo tan pertinente en 2010 como lo era en 2001.We have studied the construct of flexibility in higher education for many years, as researchers and practitioners. In this context we define flexibility as offering the student choices in how, what, where, when and with whom he or she participates in learning-related activities while enrolled in a higher education institution. In a textbook we wrote on the topic in 2001 we identified options that

  4. Pseudodisplacements of superior vena cava catheter in the persistent left superior vena cava

    Energy Technology Data Exchange (ETDEWEB)

    Jantsch, H.; Draxler, V.; Muhar, U.; Schlemmer, M.; Waneck, R.

    1983-01-01

    Pseudodisplacement of a left sided superior vena cava catheter in a persistent superior vena cava may be expected in adults in 0,37% and in a group of children with congenital heart disease in 2,5%. Embryology, anatomy and clinical implications is discussed on the basis of our own cases. The vena cava superior sinistra persitents is depending on a sufficient calibre a suitable vessel for a superior cava catheter.

  5. AcEST: DK955788 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Oryza sati... 67 6e-11 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 66 1e-10 sp|Q9ZT4...848_DICDI Probable serine/threonine-protein kinase D... 65 3e-10 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmi...p|P41823|SY65_APLCA Synaptotagmin-1 OS=Aplysia californica GN=S... 60 7e-09 sp|Q5M7N9|ESYT3_XENTR Extended s...ynaptotagmin-3 OS=Xenopus tropic... 60 7e-09 sp|Q7ZWU7|EST2B_XENLA Extended synaptotagmin-2-B OS=Xenopus lae...v... 60 9e-09 sp|Q5FWL4|EST2A_XENLA Extended synaptotagmin-2-A OS=Xenopus laev... 60 9e-09 sp|P48231|TCB2_YE

  6. AcEST: DK955280 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ryza sati... 86 1e-16 sp|Q25AG5|ERG3_ORYSI Elicitor-responsive protein 3 OS=Oryza sati... 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended...6e-11 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 67 8e-1...ne domain-conta... 59 2e-08 sp|Q7ZWU7|EST2B_XENLA Extended synaptotagmin-2-B OS=Xenopus laev... 59 2e-08 sp|Q5M7N9|ESYT3_XENTR Extend...ed synaptotagmin-3 OS=Xenopus tropic... 58 3e-08 sp|Q5FWL4|EST2A_XENLA Extended...MOUSE Ras GTPase-activating protein 4 OS=Mus mus... 52 2e-06 sp|A0FGR9|ESYT3_HUMAN Extended synaptotagmin-3

  7. AcEST: DK959757 [AcEST

    Lifescience Database Archive (English)

    Full Text Available hit_id Q5DTI8 Definition sp|Q5DTI8|ESYT3_MOUSE Extended synaptotagmin-3 OS=Mus musculus Align length 95 Scor... alignments: (bits) Value sp|Q5DTI8|ESYT3_MOUSE Extended synaptotagmin-3 OS=Mus m...usculus G... 56 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropic... 55 5e-07 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 53 2e-06 sp|Q5FWL4|EST2A_XENLA Extended synaptota...gmin-2-A OS=Xenopus laev... 52 3e-06 sp|Q7ZWU7|EST2B_XENLA Extended synaptotagmin-2-B OS=Xenopus laev... 49

  8. AcEST: DK960778 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _HUMAN Myoferlin OS=Homo sapiens GN=FER1L3 PE=1 SV=1 40 0.007 sp|Q7ZWU7|EST2B_XENLA Extended synaptotagmin-2...-B OS=Xenopus laev... 38 0.037 sp|Q5FWL4|EST2A_XENLA Extended synaptotagmin-2-A OS=Xenopus laev... 38 0.037 ...sp|Q9VVI3|NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Dros... 37 0.063 sp|Q9BSJ8|ESYT1_HUMAN Extended ...synaptotagmin-1 OS=Homo sapiens G... 37 0.063 sp|Q3U7R1|ESYT1_MOUSE Extended syna

  9. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  10. Revolución Cubana y educación superior The Cuban Revolution and higher education

    Directory of Open Access Journals (Sweden)

    Sinesio C. Santos Gutiérrez

    2007-06-01

    Full Text Available Los autores elaboran un panorama de la educación superior cubana de los últimos años, subrayando los desafíos económicos y políticos debidos a las dificultades que el gobierno de Cuba está enfrentando desde 1989 (la desaparición del campo socialista; el recrudecimiento del bloqueo de EE.UU, la crisis económica y social del Sur; la "victoria del neoliberalismo", la necesidad de insertarse en un nuevo tipo de mercado mundial global. El artículo analiza las demandas e indicadores de la educación superior cubana, realzando las transformaciones que ocurren especialmente a partir del año 2001 respecto al aumento de la equidad, políticas de inclusión y consolidación de un nuevo modelo de ciencia y tecnología. Además, los autores presentan una tipología de la educación superior y consideran sus impactos en la sociedad cubana.The authors trace a view of Cuban higher education in recent years, emphasizing the economic and political challenges due to the difficulties faced by Cuba since 1989 at national and international levels (disappearance of the socialist field, tightening of the American blockade, the social and economic crisis of the South, the "victory of neo-liberalism", the need to insert itself in a new type of global market, etc.. The article analyses the demands and indicators of Cuban higher education, stressing the transformations that have occurred particularly after 2001, in relation to the increase of equity and inclusion policies, as well as the consolidation of a new model of science and technology. Furthermore, the authors present a typology of higher education and consider its impacts on the Cuban society.

  11. AcEST: DK956931 [AcEST

    Lifescience Database Archive (English)

    Full Text Available A7QJ42|A7QJ42_VITVI Chromosome chr2 scaffold_105, whole genom... 46 0.002 tr|Q9MAQ7|Q9MAQ7_ARATH Location...LLHQELNSSP 654 >tr|Q9MAQ7|Q9MAQ7_ARATH Location of EST 206I21T7, gb|N37185 OS=Arabidopsis thaliana GN=F9L11.

  12. AcEST: BP915175 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ... 162 1e-38 tr|A9SKI3|A9SKI3_PHYPA Predicted protein OS=Physcomitrella paten... 155 9e-37 tr|Q9MAQ7|Q9MAQ7_ARATH Location...bjct: 122 GGDPSLFVNVSKVFSQQLWKYTGYVPKAFHTKCKDIP 158 >tr|Q9MAQ7|Q9MAQ7_ARATH Location of EST 206I21T7, gb|N37

  13. Batching System for Superior Service

    Science.gov (United States)

    2001-01-01

    Veridian's Portable Batch System (PBS) was the recipient of the 1997 NASA Space Act Award for outstanding software. A batch system is a set of processes for managing queues and jobs. Without a batch system, it is difficult to manage the workload of a computer system. By bundling the enterprise's computing resources, the PBS technology offers users a single coherent interface, resulting in efficient management of the batch services. Users choose which information to package into "containers" for system-wide use. PBS also provides detailed system usage data, a procedure not easily executed without this software. PBS operates on networked, multi-platform UNIX environments. Veridian's new version, PBS Pro,TM has additional features and enhancements, including support for additional operating systems. Veridian distributes the original version of PBS as Open Source software via the PBS website. Customers can register and download the software at no cost. PBS Pro is also available via the web and offers additional features such as increased stability, reliability, and fault tolerance.A company using PBS can expect a significant increase in the effective management of its computing resources. Tangible benefits include increased utilization of costly resources and enhanced understanding of computational requirements and user needs.

  14. Carbon phosphide monolayers with superior carrier mobility

    Science.gov (United States)

    Wang, Gaoxue; Pandey, Ravindra; Karna, Shashi P.

    2016-04-01

    Two dimensional (2D) materials with a finite band gap and high carrier mobility are sought after materials from both fundamental and technological perspectives. In this paper, we present the results based on the particle swarm optimization method and density functional theory which predict three geometrically different phases of the carbon phosphide (CP) monolayer consisting of sp2 hybridized C atoms and sp3 hybridized P atoms in hexagonal networks. Two of the phases, referred to as α-CP and β-CP with puckered or buckled surfaces are semiconducting with highly anisotropic electronic and mechanical properties. More remarkably, they have the lightest electrons and holes among the known 2D semiconductors, yielding superior carrier mobility. The γ-CP has a distorted hexagonal network and exhibits a semi-metallic behavior with Dirac cones. These theoretical findings suggest that the binary CP monolayer is a yet unexplored 2D material holding great promise for applications in high-performance electronics and optoelectronics.Two dimensional (2D) materials with a finite band gap and high carrier mobility are sought after materials from both fundamental and technological perspectives. In this paper, we present the results based on the particle swarm optimization method and density functional theory which predict three geometrically different phases of the carbon phosphide (CP) monolayer consisting of sp2 hybridized C atoms and sp3 hybridized P atoms in hexagonal networks. Two of the phases, referred to as α-CP and β-CP with puckered or buckled surfaces are semiconducting with highly anisotropic electronic and mechanical properties. More remarkably, they have the lightest electrons and holes among the known 2D semiconductors, yielding superior carrier mobility. The γ-CP has a distorted hexagonal network and exhibits a semi-metallic behavior with Dirac cones. These theoretical findings suggest that the binary CP monolayer is a yet unexplored 2D material holding great

  15. A comunidade científica, o Estado e as universidades, no atual estágio de desenvolvimento científico tecnológico Scientific community, State and universities in the current stage of scientific technological development

    Directory of Open Access Journals (Sweden)

    Michelangelo Giotto Santoro Trigueiro

    2001-12-01

    Full Text Available O trabalho discute a relação entre a comunidade científica, o Estado e a universidade no contexto atual do desenvolvimento científico-tecnológico. Enfatiza a dimensão política das transformações recentes, sobretudo no tocante aos sistemas decisórios, contrapondo momento mais verticalizado com cenário mais democratizado, e as conseqüências das transformações políticas contemporâneas, na sociedade brasileira. Procura analisar as mútuas correlações entre o Estado, as universidades e as comunidades científicas, a partir do entendimento da especificidade de cada um destes atores na condução do desenvolvimento científico-tecnológico nacional. A esse respeito, é analisado todo um conjunto de ações que se coadunam com o novo modo de produção do conhecimento, buscando destacar a natureza controversa e polêmica da inserção do Estado e o caráter conservador da comunidade científica, bem como a resistência da universidade na proposição de novas linhas de atuação no enfrentamento dos desafios trazidos pela ciência e tecnologias contemporâneas.This article discusses the relationship between scientific community, the State and university in the current circumstances of scientific-technological development. It stresses the political dimension of recent changes, specially regarding decision systems, comparing a more vertical moment and a more democratic scenario and the consequences of contemporary political changes in Brazilian society. It examines mutual relations between the State, universities and the scientific community, based on the understanding of each of those actors' specificities in advancing national scientific-technological development. A whole set of actions is examined in accordance with knowledge's new mode of production in order to highlight the controversial nature of the State and the conservative character of the scientific community as well as the resistance of the university in proposing new lines

  16. Superiority in value and the repugnant conclusion

    DEFF Research Database (Denmark)

    Jensen, Karsten Klint

    2007-01-01

    James Griffin has considered a weak form of superiority in value a possible remedy to the Repugnant Conclusion. In this paper, I demonstrate that, in a context where value is additive, this weaker form collapses into a stronger form of superiority. And in a context where value is non-additive, weak...... superiority does not amount to a radical value difference at all. I then spell out the consequences of these results for different interpretations of Griffin's suggestion regarding population ethics. None of them comes out very successful, but perhaps they nevertheless retain some interest....

  17. USO DE UN MEDIO TECNOLÓGICO EDUCATIVO EN EDUCACIÓN SUPERIOR COMO RECURSO DIDÁCTICO: REPORTE DE UNA EXPERIENCIA EN ODONTOLOGÍA ( THE USE OF EDUCATIONAL TECHNOLOGY MEDIA IN HIGHER EDUCATION AS A TEACHING RESOURCE: DENTISTRY EXPERIENCE REPORT

    Directory of Open Access Journals (Sweden)

    Quirós Garita Marcela

    2010-08-01

    Full Text Available Resumen:La elaboración de una herramienta tecnológica necesita una detallada investigación previa donde se determinan los problemas educativos que justifican su utilización; además, se analizan otros aspectos como los concernientes a las características de la población meta a la cual va dirigida; al respecto, las Tecnologías de la Información y de la Comunicación (TICs han venido propiciando cambios en torno a la educación y a los sistemas de aprendizaje; sus alcances están siendo apreciados cada día más en los distintos centros de enseñanza a todo nivel. Por lo tanto, en este artículo se expone la experiencia de la elaboración y la validación de una herramienta tecnológica para el curso Restaurativa II en la Facultad de Odontología de la Universidad de Costa Rica (UCR; la utilización de la herramienta se propone como una ayuda para el aprendizaje del diseño de Prótesis Parcial removible que necesita de una buena preparación como base para obtener éxito en el tratamiento dental. Dicha experiencia fue bien acogida tanto por los estudiantes entrevistados como por los docentes.Abstract:The development of a technological tool requires a detailed preliminary investigation to identify the educational problems that justify their use. Also it is necessary to explore other issues related to the characteristics of the target population to whom it is addressed, respect, Information and Communication Technologies have been encouraging changes around education and learning systems. His achievements are being increasingly appreciated in the different schools at all levels. Therefore this article describes the experience of the development and use of a multimedia tool for the “Restorative II” course at the Faculty of Dentistry of the University of Costa Rica, (UCR; the use of the tool is proposed as an aid for learning design removable partial denture that needs a good preparation as the basics for success in a dental treatment

  18. EL CARÁCTER SOCIOCULTURAL DE LA ENSEÑANZA EN LA EDUCACIÓN SUPERIOR

    Directory of Open Access Journals (Sweden)

    Carmen Obregón Rodríguez

    2009-01-01

    Full Text Available Como la escuela en general, el ámbito de la educación superior también nos ofrece un escenario privilegiado para recabar evidencias del carácter sociocultural del pensamiento. Fundada en las exploraciones de Vigotzky y expandida por sus seguidores, la perspectiva sociocultural establece que nuestro pensamiento en general, y las funciones mentales superiores en particular, están por definición culturalmente mediados; y que no hay forma de no estar culturalmente situados cuando llevamos a cabo una acción, usualmente acorde con los patrones aceptados por el grupo social al que se pertenece (acción mediada. A partir de estas aseveraciones, este ensayo intenta justificar la importancia de un mayor conocimiento del contexto cultural que tiene lugar al interior de la educación superior, y una mejor comprensión de las implicaciones que las diferencias disciplinarias tienen en la enseñanza y el aprendizaje; dar cuenta de algunos hallazgos de incursiones de la investigación empírica a este respecto; y cerrar enmarcando los aportes concretos de este ejercicio dentro de una eminente preocupación por encontrar nuevas formas de articular la multiculturalidad; de integrar la diversidad que nos habita y nos estructura, y que forma parte de nuestras herencias y de nuestro presente cultural.

  19. Millian superiorities and the repugnant conclusion

    DEFF Research Database (Denmark)

    Jensen, Karsten Klint

    2008-01-01

    James Griffin has considered a form of superiority in value that is weaker than lexical priority as a possible remedy to the Repugnant Conclusion. In this article, I demonstrate that, in a context where value is additive, this weaker form collapses into the stronger form of superiority. And in a ......James Griffin has considered a form of superiority in value that is weaker than lexical priority as a possible remedy to the Repugnant Conclusion. In this article, I demonstrate that, in a context where value is additive, this weaker form collapses into the stronger form of superiority...... of these results for different interpretations of Griffin's suggestion regarding population ethics. None of them comes out very successful, but perhaps they nevertheless retain some interest....

  20. Measuring Financial Gains from Genetically Superior Trees

    Science.gov (United States)

    George Dutrow; Clark Row

    1976-01-01

    Planting genetically superior loblolly pines will probably yield high profits.Forest economists have made computer simulations that predict financial gains expected from a tree improvement program under actual field conditions.

  1. Superior mesenteric artery syndrome causing growth retardation

    Directory of Open Access Journals (Sweden)

    Halil İbrahim Taşcı

    2013-03-01

    Full Text Available Superior mesenteric artery syndrome is a rare and lifethreateningclinical condition caused by the compressionof the third portion of the duodenum between the aortaand the superior mesenteric artery’s proximal part. Thiscompression may lead to chronic intermittent, acute totalor partial obstruction. Sudden weight-loss and the relateddecrease in the fat tissue are considered to be the etiologicalreason of acute stenosis. Weight-loss accompaniedby nausea, vomiting, anorexia, epigastric pain, andbloating are the leading complaints. Barium radiographs,computerized tomography, conventional angiography,tomographic and magnetic resonance angiography areused in the diagnosis. There are medical and surgical approachesto treatment. We hereby present the case ofa patient with superior mesenteric artery syndrome withdelayed diagnosis.Key words: superior mesenteric artery syndrome, nausea-vomiting, anorexia

  2. ENSINO SUPERIOR E OS PARADIGMAS DA POLÍTICA NEOLIBERAL

    OpenAIRE

    Hebert de Melo

    2010-01-01

    Este artigo científico procurou investigar o processo de adaptação da Universidade Brasileira aos novos paradigmas impostos pelas políticas neoliberais. A análise se faz a partir de breve histórico do liberalismo e de suas imbricações no ensino. Apontando também a relativização da suposta democratização e modernização do ensino pelas novas perspectivas impostas pelo mercado. São levantadas também questões como autonomia universitária e legitimação da instituição de ensino superior....

  3. ENSINO SUPERIOR E OS PARADIGMAS DA POLÍTICA NEOLIBERAL

    Directory of Open Access Journals (Sweden)

    Hebert de Melo

    2010-07-01

    Full Text Available Este artigo científico procurou investigar o processo de adaptação da Universidade Brasileira aos novos paradigmas impostos pelas políticas neoliberais. A análise se faz a partir de breve histórico do liberalismo e de suas imbricações no ensino. Apontando também a relativização da suposta democratização e modernização do ensino pelas novas perspectivas impostas pelo mercado. São levantadas também questões como autonomia universitária e legitimação da instituição de ensino superior.

  4. Leiomyosarcoma of the superior vena cava.

    Science.gov (United States)

    de Chaumont, Arthus; Pierret, Charles; de Kerangal, Xavier; Le Moulec, Sylvestre; Laborde, François

    2014-08-01

    Leiomyosarcoma of the superior vena cava is a very rare tumor and only a few cases have been reported, with various techniques of vascular reconstruction. We describe a new case of leiomyosarcoma of the superior vena cava in a 61-year-old woman with extension to the brachiocephalic arterial trunk. Resection and vascular reconstruction were performed using, respectively, polytetrafluoroethylene and polyethylene terephtalate vascular grafts.

  5. Superior mesenteric artery compression syndrome - case report

    OpenAIRE

    Paulo Rocha França Neto; Rodrigo de Almeida Paiva; Antônio Lacerda Filho; Fábio Lopes de Queiroz; Teon Noronha

    2011-01-01

    Superior mesenteric artery syndrome is an entity generally caused by the loss of the intervening mesenteric fat pad, resulting in compression of the third portion of the duodenum by the superior mesenteric artery. This article reports the case of a patient with irremovable metastatic adenocarcinoma in the sigmoid colon, that evolved with intense vomiting. Intestinal transit was carried out, which showed important gastric dilation extended until the third portion of the duodenum, compatible wi...

  6. Interculturalidad y educación superior: diversidad de contextos, actores, visiones y propuestas

    Directory of Open Access Journals (Sweden)

    Daniel Mato

    2007-01-01

    Full Text Available Diversas ideas de interculturalidad constituyen el piso epistemológico de propuestas de educación superior de también diversas organizaciones indígenas y afrodescendientes, universidades "convencionales" y agencias de Estados igualmente diversas. Este artículo procura caracterizar las principales concepciones de la idea de interculturalidad aplicadas a la educación superior y sus relaciones con los respectivos contextos de producción de las mismas, sus convergencias y divergencias.

  7. Redes de colaboración en Educación Superior

    OpenAIRE

    Solano Fernández, Isabel Mª

    2012-01-01

    Redes de colaboración para la Educación Superior. Se analiza el modelo pedagógico constructivista social, y dentro de este el método colaborativo. Posteriormente analiza las posibilidades de las redes, redes sociales y medios sociales, para la Educación. Presentación realizada para realizar el taller "redes de colaboración en Educación Superior" en el Seminario de innovación docente Organizado por el Centro de Desarrolo Docente (CDDOC) de la Universidad Católica de Chile.

  8. Interculturalidad y educación superior: diversidad de contextos, actores, visiones y propuestas

    Directory of Open Access Journals (Sweden)

    Daniel Mato

    2007-10-01

    Full Text Available Diversas ideas de interculturalidad constituyen el piso epistemológico de propuestas de educación superior de también diversas organizaciones indígenas y afrodescendientes, universidades “convencionales” y agencias de Estados igualmente diversas. Este artículo procura caracterizar las principales concepciones de la idea de interculturalidad aplicadas a la educación superior y sus relaciones con los respectivos contextos de producción de las mismas, sus convergencias y divergencias.

  9. A importância de agir e pensar estrategicamente no ensino superior português

    OpenAIRE

    2010-01-01

    Neste artigo explora-se o conceito de planeamento estratégico num contexto específico, designadamente, o ensino superior português. Este artigo pretende, assim, contribuir para a sensibilização dos diversos actores que têm uma intervenção directa ou indirecta neste sector para necessidade de planear e pensar estrategicamente o ensino superior. Para isso, vão-se buscar à indústria diversos contributos que permitam desenhar um modelo conceptual de planeamento estratégico para o sector que possa...

  10. Interculturalidad y educación superior: diversidad de contextos, actores, visiones y propuestas

    OpenAIRE

    Daniel Mato

    2007-01-01

    Diversas ideas de interculturalidad constituyen el piso epistemológico de propuestas de educación superior de también diversas organizaciones indígenas y afrodescendientes, universidades “convencionales” y agencias de Estados igualmente diversas. Este artículo procura caracterizar las principales concepciones de la idea de interculturalidad aplicadas a la educación superior y sus relaciones con los respectivos contextos de producción de las mismas, sus convergencias y divergencias.

  11. La desigualdad social en el nivel medio superior de educación de la Ciudad de México

    OpenAIRE

    Blanco, Emilio

    2014-01-01

    El acceso y la finalización del nivel medio superior de educación son dos eventos educativos cruciales y relativamente poco estudiados en México. Mediante los resultados de una encuesta retrospectiva realizada a jóvenes entre 18 y 29 años de la Ciudad de México en 2010, este artículo analiza detalladamente estos eventos y sus condicionantes. Los resultados muestran que la transición del nivel secundario al medio superior todavía está lejos de ser universal, que los jóvenes de sectores sociale...

  12. La reforma de la educación superior. Señas del debate internacional a fin de siglo

    OpenAIRE

    2000-01-01

    Durante la última década, se ha iniciado un amplio debate sobre los problemas de la educación superior en el mundo. El propósito de este artículo es ubicar algunos de los interlocutores de este debate que tienen mayor visibilidad e impacto, así como reseñar someramente las líneas de argumentación presentes. El texto se divide en dos secciones. La primera hace referencia al papel de diversos organismos internacionales en la definición de políticas públicas sobre la educación superior, con mayo...

  13. en la educación superior mexicana

    Directory of Open Access Journals (Sweden)

    César Mureddu Torres

    2006-01-01

    Full Text Available El presente escrito contempla algunas nociones de relativa novedad en el marco de nuestra política nacional, incluida la política educativa de nivel superior, es el caso concreto de la expresión, ahora tan frecuente políticas públicas. Indaga en torno a los principales impulsores que dieron origen a diversas decisiones que afectaron a la comunidad académica en su quehacer cotidiano. Hace ver que en muchas ocasiones la decisión política responde a requerimientos que proceden de actividades pertenecientes a núcleos más estructurados del actuar público. Tal es el caso de la relación entre las esferas de lo político en su intersección con lo económico. El estudio hace ver también que de esta intersección han surgido la mayor parte de las decisiones que han afectado en lo público al quehacer académico, sin que las motivaciones que llevaron a ese tipo de decisiones hayan sido consensadas, develadas y transparentes, sobre todo en lo que se refiere a sus consecuencias para la mejoría o deterioro de las actividades a regular por tales políticas. Se interroga, entonces, sobre el tipo de consecuencias que han tenido para con el actuar de esta comunidad académica las políticas públicas sobre la educación superior y la respuesta está en el título de este artículo.

  14. Educación superior, movilidad social y desigualdades interdependientes

    Directory of Open Access Journals (Sweden)

    Lorenza Villa Lever

    2016-01-01

    Full Text Available En el contexto de la globalización económica, la educación superior ha redefinido los espacios institucionales para la producción del conocimiento exigiendo una mayor competitividad de las universidades, lo que ha propiciado asimetrías en su desarrollo, ya que a partir de sus respuestas, algunas han mostrado capacidad para responder a la llamada sociedad del conocimiento, mientras que otras se han concretado a dar respuesta a las necesidades precisas del mercado local. Con ese telón de fondo, en este trabajo se analizarán cuatro aspectos de estas transformaciones en América Latina: la ampliación de la matrícula de educación superior, su distribución por estrato social y género, el proceso de segmentación institucional que ha acompañado ese proceso de crecimiento, y las percepciones de los estudiantes sobre su situación, comparada a la de sus padres. Para el análisis se trabajará con dos conceptos: el de movilidad social y el de desigualdades interdependientes. Se parte del supuesto de que a medida que el nivel de bienestar de los hijos dependa del origen socioeconómico de la familia de origen, habrá mayor reducción en las libertades efectivas en la sociedad en su conjunto, y por tanto, mayores limites a las posibilidades reales de que los individuos que provienen de hogares desfavorecidos logren la vida que desean. El trabajo está organizado en tres partes: en la primera se ubica el problema de la movilidad social en América Latina; después se exponen los resultados de una investigación empírica con estudiantes universitarios en Mé- xico; y finalmente se presentan algunas conclusiones.

  15. AcEST: BP912834 [AcEST

    Lifescience Database Archive (English)

    Full Text Available s GN=ITSN1 PE=... 37 0.051 sp|O43374|RASL2_HUMAN Ras GTPase-activating protein 4 OS=Homo sa... 37 0.067 sp|Q9Z1X1|ESYT1_RAT Extended...N Protein kinase C alpha type OS=Homo sapiens... 33 0.97 sp|Q5RAG2|ESYT1_PONAB Extended synaptotagmin-1 OS=P...ongo abelii G... 33 0.97 sp|Q5FWL4|EST2A_XENLA Extended synaptotagmin-2-A OS=Xenopus laev... 33 0.97 sp|Q7ZWU7|EST2B_XENLA Extended...SKSRRHDEGNLGS 251 Query: 170 IEIE 159 +++E Sbjct: 252 LQLE 255 >sp|Q9Z1X1|ESYT1_RAT Extended synaptotagmin-1....11 sp|P48231|TCB2_YEAST Tricalbin-2 OS=Saccharomyces cerevisiae GN=... 35 0.33 sp|Q3U7R1|ESYT1_MOUSE Exte

  16. AcEST: DK954859 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 42 0.002 sp|Q9Z1X1|ESYT1_RAT Extended synaptotagmin-1 OS=Rattus norvegicu... 38 0.042 sp|Q5RAG2|ESYT1_PONAB Extended... synaptotagmin-1 OS=Pongo abelii G... 37 0.094 sp|Q3U7R1|ESYT1_MOUSE Extended synaptotagmin-1 OS=Mus... musculus G... 37 0.094 sp|Q9BSJ8|ESYT1_HUMAN Extended synaptotagmin-1 OS=Homo sa...piens G... 37 0.094 sp|Q9USG8|MU190_SCHPO Meiotically up-regulated gene 190 protein ... 36 0.16 sp|Q7ZWU7|EST2B_XENLA Extended...ce 2 protein OS=Mus ... 35 0.47 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 35 0.47 sp|Q5FWL4|EST2A_XENLA Ext

  17. Origen de la Escuela Normal Superior de México

    Directory of Open Access Journals (Sweden)

    Patricia Ducoing

    2004-01-01

    Full Text Available En este texto se pretende analizar el origen universitario de la Escuela Normal Superior de México, en el marco del período denominado “porfiriato”, el cual, pese a haberse convertido en una dictadura, enarboló los principios de la ideología liberal, los que unidos al pensamiento positivista cotidiano, posibilitaron el desarrollo económico y social y particularmente, educativo, a través de la creación de instituciones y de programas que potenciaron la conformación de un discurso pedagógico moderno. La Escuela Normal Superior nace, en el seno de la Universidad Nacional, como expresión de un proyecto político-cultural que integra las aspiraciones de la época en materia educativa: la organización y homogeneización de un sistema de formación de profesores que contribuyera a garantizar la ruptura con los postulados y símbolos del régimen colonial, los cuales habrían de ser suplantados por otros: la unidad, la cientificidad, el pragmatismo y la secularidad -entre otros-.

  18. La educación superior en Cundinamarca

    Directory of Open Access Journals (Sweden)

    Raúl Palomar Áviles

    2015-04-01

    Full Text Available RESUMEN El artículo parte de un análisis de la ubicación geográfica y espacial del departamento de Cundinamarca, destacando la marcada centralización que tiene Bogotá en todos los órdenes, dada su cercanía. Destaca que, a pesar de la metropolización que tiene a ejercer Bogotá, el departamento cuenta con cuatro ciudades intermedias y alternas con la posibilidad de convertirse en polos de desarrollo regional autónomos. Presenta una descripción de la Educación superior en Cundinamarca, tanto en  la modalidad presencial como en la modalidad  a distancia. Concluye que la cobertura de este nivel educativo es casi nula precisamente por la dependencia que existen 900 cupos en 2 instituciones de Educación Superior, ubicadas en 4 ciudades, para atender  una población de 6.800 bachilleres que egresan anualmente.

  19. Superior oblique surgery: when and how?

    Directory of Open Access Journals (Sweden)

    Taylan Şekeroğlu H

    2013-08-01

    Full Text Available Hande Taylan Şekeroğlu,1 Ali Sefik Sanac,1 Umut Arslan,2 Emin Cumhur Sener11Department of Ophthalmology, 2Department of Biostatistics, Hacettepe University Faculty of Medicine, Ankara, TurkeyBackground: The purpose of this paper is to review different types of superior oblique muscle surgeries, to describe the main areas in clinical practice where superior oblique surgery is required or preferred, and to discuss the preferred types of superior oblique surgery with respect to their clinical outcomes.Methods: A consecutive nonrandomized retrospective series of patients who had undergone superior oblique muscle surgery as a single procedure were enrolled in the study. The diagnosis, clinical features, preoperative and postoperative vertical deviations in primary position, type of surgery, complications, and clinical outcomes were reviewed. The primary outcome measures were the type of strabismus and the type of superior oblique muscle surgery. The secondary outcome measure was the results of the surgeries.Results: The review identified 40 (20 male, 20 female patients with a median age of 6 (2–45 years. Nineteen patients (47.5% had Brown syndrome, eleven (27.5% had fourth nerve palsy, and ten (25.0% had horizontal deviations with A pattern. The most commonly performed surgery was superior oblique tenotomy in 29 (72.5% patients followed by superior oblique tuck in eleven (27.5% patients. The amount of vertical deviation in the fourth nerve palsy and Brown syndrome groups (P = 0.01 for both and the amount of A pattern in the A pattern group were significantly reduced postoperatively (P = 0.02.Conclusion: Surgery for the superior oblique muscle requires experience and appropriate preoperative evaluation in view of its challenging nature. The main indications are Brown syndrome, fourth nerve palsy, and A pattern deviations. Superior oblique surgery may be effective in terms of pattern collapse and correction of vertical deviations in primary

  20. LA EDUCACIÓN SUPERIOR CUBANA: LOGROS Y PERSPECTIVAS

    Directory of Open Access Journals (Sweden)

    Acela Cantero Zayas

    Full Text Available Resumen: El impetuoso desarrollo de la ciencia y la técnica contemporâneo en general y muy específicamente en la realidad cubana, estâ dirigido a satisfacer las necesidades creciente de nuestra sociedad, lo que conlleva a un continuo perfeccionamiento de todo el sistema educativo en correspondencia con las exigencias, demandas y necesidades de nuestro pueblo. En tal sentido, para comprender los resultados que exhibe la Educación cubana y dentro de ella la Educación Superior, se precisa de toda una reflexión histórica, como soporte lógico y metodológico del hecho educativo cubano. En la actualidad, el mayor impacto de nuestra Educación Superior, desde los puntos de vista social, político, económico y en especial formativo, lo constituye, el diseno e implementación del modelo de Universalización, el cual tiene como objetivo supremo la extensión de la Universidad a los distintos municipios del país, con la finalidad de irradiar cultura y saber, que son las únicas modalidades de garantizar un hombre libre y de hecho una sociedad independiente. En el presente trabajo se muestra una panorâmica de la Educación Superior en Cuba, partiendo del elemento histórico hasta la contemporaneidad y en ésta, los nuevos retos impuestos por el contexto socio-político a escala mundial.

  1. LA EDUCACIÓN SUPERIOR CUBANA: LOGROS Y PERSPECTIVAS

    Directory of Open Access Journals (Sweden)

    Acela Cantero Zayas

    2004-01-01

    Full Text Available El impetuoso desarrollo de la ciencia y la técnica contemporáneo en general y muy específicamente en la realidad cubana, está dirigido a satisfacer las necesidades creciente de nuestra sociedad, lo que conlleva a un continuo perfeccionamiento de todo el sistema educativo en correspondencia con las exigencias, demandas y necesidades de nuestro pueblo. En tal sentido, para comprender los resultados que exhibe la Educación cubana y dentro de ella la Educación Superior, se precisa de toda una reflexión histórica, como soporte lógico y metodológico del hecho educativo cubano. En la actualidad, el mayor impacto de nuestra Educación Superior, desde los puntos de vista social, político, económico y en especial formativo, lo constituye, el diseño e implementación del modelo de Universalización, el cual tiene como objetivo supremo la extensión de la Universidad a los distintos municipios del país, con la finalidad de irradiar cultura y saber, que son las únicas modalidades de garantizar un hombre libre y de hecho una sociedad independiente. En el presente trabajo se muestra una panorámica de la Educación Superior en Cuba, partiendo del elemento histórico hasta la contemporaneidad y en ésta, los nuevos retos impuestos por el contexto socio-político a escala mundial.

  2. The-est of Beijing

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    -est in the world The biggest palace in the world:the Palace Museum in the Forbidden City,occu- pying 9 square km. The biggest city square in the world:Tiananmen Square,which occupies 440,000 square meters and can hold as many as half a million people. The steel construction with the biggest span in the world:the National Stadium (Bird’s Nest). The only public building in the world covered totally with ETFE (Polytetrafluoroethylene):the National Aquatics Center (Water Cube).

  3. El uso de las nuevas tecnologías aplicadas a la educación superior

    Directory of Open Access Journals (Sweden)

    Canós Darós, Maria José

    2009-01-01

    Full Text Available RESUMEN En el Espacio Europeo de Educación Superior se promueve la cooperación para adquirir las competencias necesarias para el desarrollo profesional del estudiante durante su futura vida laboral, por ejemplo, el trabajo en equipo, la toma de decisiones, etc. Las nuevas tecnologías pueden resultar útiles para alcanzar este objetivo (foros, chat, videoconferencia, plataformas educacionales, páginas web, bases de datos, etc.. Sin embargo, presentan algunas ventajas y desventajas. Las principales ventajas son la posibilidad de compartir información en tiempo real y el rápido acceso al conocimiento. Algunas desventajas son el coste de los ordenadores, la dependencia de la tecnología o la diferente y nueva organización de los materiales de una asignatura. En este contexto, profesores y estudiantes tienen que adoptar nuevos roles en el proceso de enseñanza-aprendizaje. Además, presentamos las aplicaciones y características de una plataforma on line usada para la gestión y desarrollo de asignaturas en la Universidad Politecnica de Valencia.ABSTRACT In the European Higher Education Area, it is promoted the cooperation to get the competencies required in the professional development of the student’s labour life, for instance, team work, making decisions, etc. New technologies can be useful to achieve this purpose (forum, chat, videoconference, educational platforms, web pages, data bases, etc.. Nowadays, they present both advantages and disadvantages. The main advantages are the possibility to share information on line and the quick access to knowledge. Some disadvantages are the cost of the computers, the dependence on the technology or the different and new organization of materials for the subjects. In this context, teachers and students have to adopt new roles in the teaching-learning process. Moreover, we present the applications and characteristics from one on line platform used to manage and develop subjects in Universidad

  4. Determinantes de la calidad en la educación superior en Colombia

    OpenAIRE

    Escobar Pineda, Stefanía; Orduz Perdomo, María

    2013-01-01

    La calidad de la educación está principalmente determinada por variables asociadas a las características de las instituciones educativas y a las condiciones socioeconómicas de los estudiantes y de las familias. El objetivo de este trabajo es evaluar mediante un modelo logit ordenado, el impacto de estas variables sobre el rendimiento académico de los estudiante de educación superior, el cual se mide con base en la pruebas SaberPro, aplicadas por el ICFES. El ejercicio empírico se realizó por ...

  5. AcEST: DK963011 [AcEST

    Lifescience Database Archive (English)

    Full Text Available -activating-like protein 1 OS=Mus mu... 62 2e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended s...UMAN Multiple C2 and transmembrane domain-conta... 60 8e-09 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 O...ive protein 1 OS=Oryza sati... 58 3e-08 sp|Q5M7N9|ESYT3_XENTR Extended synaptotag...OS=... 56 1e-07 sp|A0FGR9|ESYT3_HUMAN Extended synaptotagmin-3 OS=Homo sapiens G... 56 2e-07 sp|Q5DTI8|ESYT3_MOUSE Extended...us GN=Syt5 PE=... 54 5e-07 sp|Q7ZWU7|EST2B_XENLA Extended synaptotagmin-2-B OS=Xenopus laev... 54 5e-07 >sp|

  6. AcEST: DK955142 [AcEST

    Lifescience Database Archive (English)

    Full Text Available n-conta... 62 3e-09 sp|Q6DN12|MCTP2_HUMAN Multiple C2 and transmembrane domain-conta... 60 8e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended... synaptotagmin-2 OS=Mus musculus G... 60 8e-09 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagm... Tricalbin-2 OS=Saccharomyces cerevisiae GN=... 56 1e-07 sp|A0FGR9|ESYT3_HUMAN Extended synaptotagmin-3 OS=H...omo sapiens G... 56 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synaptotagmin-3 OS=Mus m...usculus G... 55 2e-07 sp|P46935|NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus m... 54 4e-07 sp|Q7ZWU7|EST2B_XENLA Extended

  7. AcEST: BP920282 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ansmembrane domain-conta... 59 1e-08 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin...-2 OS=Mus musculus G... 59 1e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 58 3e-0...... 55 2e-07 sp|A0FGR9|ESYT3_HUMAN Extended synaptotagmin-3 OS=Homo sapiens G... 55 3e-07 sp|Q5DTI8|ESYT3_MOUSE Extended...ase-activating ... 54 3e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xen...romyces cerevisiae GN=... 53 8e-07 sp|Q7ZWU7|EST2B_XENLA Extended synaptotagmin-2-B OS=Xenopus laev... 53 8e

  8. Qui est Méduse?

    Directory of Open Access Journals (Sweden)

    Julia Kristeva

    2015-04-01

    Full Text Available Une belle histoire de têtes coupées traverse l'Antiquité grecque : celle des Gorgones, trois monstres ailés au corps de femme et à la chevelure de serpents, dont le regard changeait en pierre celui qui se risquait à les contempler – Méduse, Euryalé et Sthéno. Pour commencer, Méduse est une jeune fille qui se fait remarquer : séduite puis violée par Poséidon, elle se révèle fertile puisqu'elle accouche de faux jumeaux, le cheval Pégase et le géant Chrysaor. Une longue fable la transforme en terrible puissance. Pour simplifier, disons que le monstre est par deux fois tué : Persée assassine d'abord Méduse pour assurer la protection de sa mère, Danaé, importunée par le roi Polydectès. Ensuite, il délivre Andromède des liens méduséens qui la retiennent et, pour ce faire, tranche la tête de la Gorgone. La mer se teinte de sang, tandis que le vainqueur tient à l'écart l'épouvantail de Méduse, de peur que ne soient changés en statues de pierre ceux qui s'exposeraient à sa vue.

  9. Whisker-related afferents in superior colliculus.

    Science.gov (United States)

    Castro-Alamancos, Manuel A; Favero, Morgana

    2016-05-01

    Rodents use their whiskers to explore the environment, and the superior colliculus is part of the neural circuits that process this sensorimotor information. Cells in the intermediate layers of the superior colliculus integrate trigeminotectal afferents from trigeminal complex and corticotectal afferents from barrel cortex. Using histological methods in mice, we found that trigeminotectal and corticotectal synapses overlap somewhat as they innervate the lower and upper portions of the intermediate granular layer, respectively. Using electrophysiological recordings and optogenetics in anesthetized mice in vivo, we showed that, similar to rats, whisker deflections produce two successive responses that are driven by trigeminotectal and corticotectal afferents. We then employed in vivo and slice experiments to characterize the response properties of these afferents. In vivo, corticotectal responses triggered by electrical stimulation of the barrel cortex evoke activity in the superior colliculus that increases with stimulus intensity and depresses with increasing frequency. In slices from adult mice, optogenetic activation of channelrhodopsin-expressing trigeminotectal and corticotectal fibers revealed that cells in the intermediate layers receive more efficacious trigeminotectal, than corticotectal, synaptic inputs. Moreover, the efficacy of trigeminotectal inputs depresses more strongly with increasing frequency than that of corticotectal inputs. The intermediate layers of superior colliculus appear to be tuned to process strong but infrequent trigeminal inputs and weak but more persistent cortical inputs, which explains features of sensory responsiveness, such as the robust rapid sensory adaptation of whisker responses in the superior colliculus. Copyright © 2016 the American Physiological Society.

  10. Empregabilidade do profissional formado nos cursos superiores de tecnologia do CEFET-PR: estudo de caso em médias e grandes empresas da região norte do Paraná Empregabilidad del profesional graduado en los cursos superiores de tecnología: estudio de caso en las medias y grandes empresas de la región norte del Paraná Empregability of the graduates in the undergraduate courses of technology: study of case in medium-sized and large companies in the northern region of the state Paraná

    Directory of Open Access Journals (Sweden)

    Eurico Pedroso de Almeida Junior

    2007-09-01

    Full Text Available O presente trabalho discute a necessidade das empresas da região Norte do Paraná, por profissionais formados nos Cursos Superiores de Tecnologia. Trata-se de uma pesquisa exploratória que, em função dos procedimentos técnicos adotados, pode ser caracterizada como um estudo de caso. O método de pesquisa empregado foi o indutivo. Os resultados mostram que há por parte das empresas a necessidade por profissionais formados nos Cursos Superiores de Tecnologia, na maioria dos casos, ele atua dentro de sua área de formação, e sua convivência com outros profissionais formados nas áreas tecnológicas ocorre normalmente. Concluiu-se que o tecnólogo no ambiente produtivo é um profissional necessário e que colabora em várias frentes, principalmente em face às novas tendências tecnológicas, uma vez que o mesmo recebe conhecimento teórico e prático e pode contribuir eficazmente tanto com as empresas quanto com a sociedade.Esa investigación discute la necesidad de las compañías del área Norte de Paraná por profesionales formados en las Universidades de Tecnología. Es una investigación exploratoria que, por los procedimientos técnicos adoptados, puede caracterizarse como un estudio de caso. El método de la investigación usado fue el inductivo. Los resultados confirman que hay por parte de las compañías la necesidad de profesionales formados en las Universidades de Tecnología; en la mayor parte de los casos ellos actúan dentro de su área de formación específica, y su convivencia con otros profesionales formados en las áreas tecnológicas ocurre normalmente. La conclusión de la investigación presenta el tecnólogo en el ambiente productivo como un profesional necesario a colaborar en varios frentes, principalmente si pensamos en las nuevas tendencias tecnológicas, una vez que él recibe el conocimiento teórico y práctico y puede contribuir eficazmente tanto con las compañías en cuanto a la sociedad.The present paper

  11. La Dolina de l’Esquerda de les Alzines (Macizo del Garraf, Barcelona: un yacimiento del Pleistoceno superior al aire libre con industria lítica paleolítica

    Directory of Open Access Journals (Sweden)

    Daura, Joan

    2011-12-01

    Full Text Available Dolina Esquerda de les Alzines is the only known site in Garraf massif where abundant Palaeolithic artifacts have been recovered. However, the chronological framework and technological traits cannot place the site amongst one of the Upper or Middle Palaeolithic tool groups. Its singularity is in the location, inside a dissolution doline, a rare deposit in the Middle and Upper Palaeolithic sites in Iberian Peninsula. The lithic assemblage is homogenous, 1,067 artifacts have been analyzed to determine their characteristics and the most significant feature of this assemblage is the dominance of flake-bearing core reduction methods and the manufacture of artifacts showing convergent morphologies. The recovery of some artifacts commonly found in Upper Palaeolithic assemblages should also be stressed.

    La Dolina de l’Esquerda de les Alzines constituye el primer yacimiento del Pleistoceno superior del macizo del Garraf que ha proporcionado abundantes restos líticos del Paleolítico. Los caracteres de este conjunto así como los datos cronológicos no permiten ubicarlo en los grupos tipológicos del Paleolítico medio ni del superior. La singularidad de esta nueva localidad radica en su ubicación en el interior de una dolina, un tipo de depósito poco habitual en el registro del Pleistoceno medio y superior de la Península Ibérica. El yacimiento presenta un conjunto lítico homogéneo, del cual se han analizado 1.067 restos para este trabajo. Predominan las estrategias de reducción de núcleos encaminadas a la producción de lascas y a la configuración de artefactos con morfologías convergentes. Destacamos también la presencia, aunque en escaso número, de artefactos habituales en los conjuntos del Paleolítico superior.

  12. Escuela superior de Hacienda Pública en Speyer, Alemania

    Directory of Open Access Journals (Sweden)

    Ruf, Sep

    1963-12-01

    Full Text Available The total building program connected with this School comprises the following: 1. The Higher School itself, which has an auditorium, lecture halls, main lecture hall, rooms for scientific work done by professors and their assistants, and the usual administrative offices. 2. Living quarters for the professors and students, living rooms, a club and a flat for the porter. 3. A bar and the kitchen. 4. Garage, servicing station and a bicycle shed. The Higher School is built on a single level, around a central patio-style garden, with a pond in the middle. The library, lecture halls, and working rooms are arranged to face this inner open space. The main lecture hall rises in tiers, to facilitate the view of the speaker, and its roof emerges considerably above the level of the rest of the building, as a dominant feature. The living accommodation is housed in a four storey building. The ground floor contains the club, living rooms, and the professors and porter's flats. The upper three floors are taken up with the students rooms. These are single and double rooms. This project is simply proportioned, and the volumes and planes are very clearly differentiated, to achieve a space pattern of very clearcut outline.El conjunto de instalaciones construidas comprende: — La Escuela Superior propiamente dicha, dotada de los correspondientes auditorio, clase, aula magna, salas para trabajos científicos de profesores y asistentes y la zona de administración. — Viviendas para profesores y cursillistas, salas de estar, club y vivienda del conserje. — Bar con cocina. Garaje con estación de servicio y un local para bicicletas. La Escuela Superior se desarrolla en una sola planta, en la cual, alrededor del patio-jardín—con un estanque—, se hallan la biblioteca, clase, auditorios y salas de trabajo. El aula magna tiene acceso al nivel de suelo, y presenta una disposición escalonada que facilita la visibilidad. Como elemento dominante, este cuerpo se eleva

  13. TDT in Argentine and Chile: dynamics of power in the process of adoption of the technological standard ISDB-TB TDT en Argentina y Chile: las dinámicas de poder en el proceso de selección del estándar tecnológico ISDB-TB

    Directory of Open Access Journals (Sweden)

    Carla RODRÍGUEZ MIRANDA

    2012-02-01

    Full Text Available The article analyses the media policymaking process about the adoption of the technological standard for the digital terrestrial television in Argentine and Chile. The explorative and descriptive study inquires about the tensions, articulations and dynamics of the national and supranational parties (State, broadcasters, lobbies of technical standards and civil society that played in the politic process from the late 90s when the issue of digital television inserted into public agenda until August/September on 2009 when both countries adopted the Japanese- Brazilian technology system.El artículo analiza la formación de las políticas públicas de comunicación sobre la selección del estándar técnico para la televisión digital terrestre en Argentina y Chile. El estudio de carácter exploratorio y descriptivo indaga sobre las tensiones, articulaciones y dinámicas de los actores nacionales y supranacionales (Estado, radiodifusores, consorcios de las normas técnicas y sociedad civil que participaron en el proceso a partir de fines de la década de 1990, con la incorporación del tema de la televisión digital terrestre a la agenda pública, hasta agosto/septiembre de 2009 con la adopción del sistema japonés-brasileño

  14. Superior-subordinate relations as organizational processes

    DEFF Research Database (Denmark)

    Asmuss, Birte; Aggerholm, Helle Kryger; Oshima, Sae

    Since the emergence of the practice turn in social sciences (Golsorkhi et al. 2010), studies have shown a number of institutionally relevant aspects as achievements across time and by means of various resources (human and non-human) (Taylor & van Every 2000, Cooren et al. 2006). Such a process view...... on organizational practices relates closely to an increased focus on communication as being constitutive of the organization in general and the superior-subordinate relationship in specific. The current study aims to contribute to this line of research by investigating micro-practices involved in establishing...... superior-subordinate relations in a specific institutionalized setting: performance appraisal interviews (PAIs). While one main task of PAIs is to manage and integrate organizational and employee performance (Fletcher, 2001:473), PAIs are also organizational practices where superior-subordinate relations...

  15. Principios variacionales de orden superior y con funciones de varias variables

    OpenAIRE

    Páez Sánchez, Jordi

    2014-01-01

    En esta memoria se trata de extender el principio variacional unidimensional de primer orden de Hamilton a los siguientes casos: principio variacional de orden superior con funciones de una variable, principio variacional de primer orden con funciones de varias variables (principio variacional múltiple) y principio variacional de segundo orden con funciones de varias variables. En particular, este último caso no se encuentra desarrollado habitualmente en la literatura del cálculo variacional....

  16. Perspectivas de la educación superior en el Caribe Anglófono

    Directory of Open Access Journals (Sweden)

    Colin Brock

    2008-06-01

    Full Text Available En este capítulo, el autor analiza en sus raíces históricas y desarrollo cultural las perspectivas de la Educación Superior en el Caribe anglófono.In this chapter the author analyzes the historical roots and the cultural developments in order to unveil the perspectives of higher education in the Caribbean English speaking countries.

  17. Principios variacionales de orden superior y con funciones de varias variables

    OpenAIRE

    Páez Sánchez, Jordi

    2014-01-01

    En esta memoria se trata de extender el principio variacional unidimensional de primer orden de Hamilton a los siguientes casos: principio variacional de orden superior con funciones de una variable, principio variacional de primer orden con funciones de varias variables (principio variacional múltiple) y principio variacional de segundo orden con funciones de varias variables. En particular, este último caso no se encuentra desarrollado habitualmente en la literatura del cálculo variacional....

  18. Lake Superior Aquatic Invasive Species Complete Prevention Plan

    Science.gov (United States)

    The Lake Superior Aquatic Invasive Species Complete Prevention Plan is an expression of the best professional judgment of the members of the Lake Superior Task Force as to what is necessary to protect Lake Superior from new aquatic invasive species.

  19. Acreditación, mercado y educación superior

    Directory of Open Access Journals (Sweden)

    JUAN CARLOS SILAS CASILLAS

    2013-01-01

    Full Text Available El trabajo analiza los esquemas y referentes de calidad usados con frecuencia en México y Latinoamérica y se propone descubrir los argumentos de mercado que fundamentan las prácticas de acreditación y evaluación institucional. Se bosqueja, como conclusión, que el concepto de calidad en la educación superior es en sí mismo una construcción que obedece a un contexto dinámico en el cual están inmersos los actores de la educación superior y, en vez de acercarse a cuestiones filosóficas fundamentales, se apega más a esquemas pragmáticos, de mercado, isomorfistas que actúan de acuerdo con las condiciones socio-económicas y políticas que enfrenta el sistema de educación superior.

  20. Superior cross-species reference genes: a blueberry case study.

    Directory of Open Access Journals (Sweden)

    Jose V Die

    Full Text Available The advent of affordable Next Generation Sequencing technologies has had major impact on studies of many crop species, where access to genomic technologies and genome-scale data sets has been extremely limited until now. The recent development of genomic resources in blueberry will enable the application of high throughput gene expression approaches that should relatively quickly increase our understanding of blueberry physiology. These studies, however, require a highly accurate and robust workflow and make necessary the identification of reference genes with high expression stability for correct target gene normalization. To create a set of superior reference genes for blueberry expression analyses, we mined a publicly available transcriptome data set from blueberry for orthologs to a set of Arabidopsis genes that showed the most stable expression in a developmental series. In total, the expression stability of 13 putative reference genes was evaluated by qPCR and a set of new references with high stability values across a developmental series in fruits and floral buds of blueberry were identified. We also demonstrated the need to use at least two, preferably three, reference genes to avoid inconsistencies in results, even when superior reference genes are used. The new references identified here provide a valuable resource for accurate normalization of gene expression in Vaccinium spp. and may be useful for other members of the Ericaceae family as well.

  1. Superior cross-species reference genes: a blueberry case study.

    Science.gov (United States)

    Die, Jose V; Rowland, Lisa J

    2013-01-01

    The advent of affordable Next Generation Sequencing technologies has had major impact on studies of many crop species, where access to genomic technologies and genome-scale data sets has been extremely limited until now. The recent development of genomic resources in blueberry will enable the application of high throughput gene expression approaches that should relatively quickly increase our understanding of blueberry physiology. These studies, however, require a highly accurate and robust workflow and make necessary the identification of reference genes with high expression stability for correct target gene normalization. To create a set of superior reference genes for blueberry expression analyses, we mined a publicly available transcriptome data set from blueberry for orthologs to a set of Arabidopsis genes that showed the most stable expression in a developmental series. In total, the expression stability of 13 putative reference genes was evaluated by qPCR and a set of new references with high stability values across a developmental series in fruits and floral buds of blueberry were identified. We also demonstrated the need to use at least two, preferably three, reference genes to avoid inconsistencies in results, even when superior reference genes are used. The new references identified here provide a valuable resource for accurate normalization of gene expression in Vaccinium spp. and may be useful for other members of the Ericaceae family as well.

  2. Endovascular treatment of superior vena cava syndrome

    DEFF Research Database (Denmark)

    Duvnjak, Stevo; Andersen, Poul Erik

    2011-01-01

    Abstract AIM: The aim of this study was to report our experience with palliative stent treatment of superior vena cava syndrome. METHODS: Between January 2008 and December 2009, 30 patients (mean age 60.7 years) were treated with stents because of stenosed superior vena cava. All patients presented...... there was an immediate clinical improvement with considerable reduction in the edema of upper extremities and head. There was, however, continous dyspnea in five patients (17%) and two patients (7%) had persistent visible collateral venous circulations on the upper chest. There were no stent associated complications...

  3. A atenção ao aluno que se destaca por um Potencial Superior

    Directory of Open Access Journals (Sweden)

    Eunice M. L. Soriano de Alencar

    2011-11-01

    Full Text Available Observa-se, em diversos países, inclusive o Brasil, um interesse crescente em atender às necessidades educacionais e psicológicas de alunos que apresentam um potencial superior. Entretanto, diversos obstáculos se interpõem na implementação de programas e serviços para esta clientela. Este artigo, portanto, discute a importância de se investir na educação do superdotado e apresenta as principais barreiras ao desenvolvimento de práticas educacionais voltadas para os alunos com potencial superior. Além disso, este trabalho analisa o cenário da educação do aluno superdotado e talentoso no Brasil e examina as tendências atuais em relação ao atendimento a este grupo de alunos no cenário internacional.Palavras-chave: Superdotado. Potencial Superior. Educação Especial.

  4. Facilitating superior chronic disease management through a knowledge-based systems development model.

    Science.gov (United States)

    Wickramasinghe, Nilmini S; Goldberg, Steve

    2008-01-01

    To date, the adoption and diffusion of technology-enabled solutions to deliver better healthcare has been slow. There are many reasons for this. One of the most significant is that the existing methodologies that are normally used in general for Information and Communications Technology (ICT) implementations tend to be less successful in a healthcare context. This paper describes a knowledge-based adaptive mapping to realisation methodology to traverse successfully from idea to realisation rapidly and without compromising rigour so that success ensues. It is discussed in connection with trying to implement superior ICT-enabled approaches to facilitate superior Chronic Disease Management (CDM).

  5. Diseño mecánico de un exoesqueleto para rehabilitación de miembro superior

    Directory of Open Access Journals (Sweden)

    Juan Francisco Ayala Lozano

    2015-05-01

    Full Text Available Título en ingles: Mechanical design of an exoskeleton for upper limb rehabilitationTítulo corto: Diseño mecánico de un exoesqueletoResumen: El ritmo de vida actual, tanto sociocultural como tecnológico, ha desembocado en un aumento de enfermedades y padecimientos que afectan las capacidades físico-motrices de los individuos. Esto ha originado el desarrollo de prototipos para auxiliar al paciente a recuperar la movilidad y la fortaleza de las extremidades superiores afectadas. El presente trabajo aborda el diseño de una estructura mecánica de un exoesqueleto con 4 grados de libertad para miembro superior. La cual tiene como principales atributos la capacidad de ajustarse a la antropometría del paciente mexicano (longitud del brazo, extensión del antebrazo, condiciones geométricas de la espalda y altura del paciente. Se aplicó el método BLITZ QFD para obtener el diseño conceptual óptimo y establecer adecuadamente las condiciones de carga de servicio. Por lo que, se definieron 5 casos de estudio cuasi-estáticos e implantaron condiciones para rehabilitación de los pacientes. Asimismo, mediante el Método de Elemento Finito (MEF se analizaron los esfuerzos y deformaciones a los que la estructura está sometida durante la aplicación de los agentes externos de servicio. Los resultados presentados en éste trabajo exhiben una nueva propuesta para la rehabilitación de pacientes con problemas de movilidad en miembro superior. Donde el equipo propuesto permite la rehabilitación del miembro superior apoyado en 4 grados de libertad (tres grados de libertad en el hombro y uno en el codo, el cual es adecuado para realizar terapias activas y pasivas. Asimismo, es un dispositivo que está al alcance de un mayor porcentaje de la población por su bajo costo y fácil desarrollo en la fabricación.Palabras clave: MEF, Blitz QFD, exoesqueletos, diseño mecánico.Abstract: The pace of modern life, both socio-cultural and technologically, has led

  6. Magnetic resonance imaging evaluation of meniscoid superior labrum: normal variant or superior labral tear*

    Science.gov (United States)

    Simão, Marcelo Novelino; Vinson, Emily N.; Spritzer, Charles E.

    2016-01-01

    Objective The objective of this study was to determine the incidence of a "meniscoid" superior labrum. Materials and Methods This was a retrospective analysis of 582 magnetic resonance imaging examinations of shoulders. Of those 582 examinations, 110 were excluded, for a variety of reasons, and the final analysis therefore included 472 cases. Consensus readings were performed by three musculoskeletal radiologists using specific criteria to diagnose meniscoid labra. Results A meniscoid superior labrum was identified in 48 (10.2%) of the 472 cases evaluated. Arthroscopic proof was available in 21 cases (43.8%). In 10 (47.6%) of those 21 cases, the operative report did not include the mention a superior labral tear, thus suggesting the presence of a meniscoid labrum. In only one of those cases were there specific comments about a mobile superior labrum (i.e., meniscoid labrum). In the remaining 11 (52.4%), surgical correlation demonstrated superior labral tears. Conclusion A meniscoid superior labrum is not an infrequent finding. Depending upon assumptions and the requirement of surgical proof, the prevalence of a meniscoid superior labrum in this study was between 2.1% (surgically proven) and 4.8% (projected). However, superior labral tears are just as common and are often confused with meniscoid labra. PMID:27777474

  7. AcEST: DK961704 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ynaptotagmin-7 OS=Homo sapiens GN=SYT7 PE=... 74 7e-13 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus... musculus G... 74 7e-13 sp|Q9R0N7|SYT7_MOUSE Synaptotagmin-7 OS=Mus musculus GN=Syt7 PE=... 73 1e-12 sp|A0FGR8|ESYT2_HUMAN Extended...ing protein 4 OS=Homo sa... 60 1e-08 sp|A0FGR9|ESYT3_HUMAN Extended synaptotagmin-3 OS=Homo sapiens G... 60 ...1e-08 sp|Q7ZWU7|EST2B_XENLA Extended synaptotagmin-2-B OS=Xenopus laev... 59 2e-08 sp|Q9UT00|YKH3_SCHPO Unch...aracterized protein PYUK71.03c OS=Schiz... 58 4e-08 sp|Q5M7N9|ESYT3_XENTR Extended

  8. SNP-finding in pig mitochondrial ESTs

    DEFF Research Database (Denmark)

    Scheibye-Alsing, Karsten; Cirera Salicio, Susanna; Gilchrist, M.J.

    2008-01-01

    The Sino-Danish pig genome project produced 685 851 ESTs (Gorodkin et al. 2007), of which 41 499 originated from the mitochondrial genome. In this study, the mitochondrial ESTs were assembled, and 374 putative SNPs were found. Chromatograms for the ESTs containing SNPs were manually inspected...

  9. From General English to EST: A Proposal to Reform China's Service English Teaching.

    Science.gov (United States)

    Zhijian, Zhou

    1988-01-01

    Describes English teaching in China, covering course materials, teaching activities, and students' reactions, and noting an upsurge of interest in English for science and technology (EST). A proposed reform argues for a shift from General English to EST and offers suggestions for preparing course materials, teacher training, and learner testing.…

  10. Persistencia de la vena cava superior izquierda: Diagnóstico e importancia prenatal Persistency of the left superior caval vein: Diagnosis and its prenatal importance

    Directory of Open Access Journals (Sweden)

    Juan F Jaramillo

    2010-04-01

    Full Text Available Durante un ultrasonido obstétrico de rutina se deben realizar ciertos planos del corazón en los cuales no es complejo identificar un grupo de anomalías como la persistencia de la vena cava superior izquierda. Cuando se identifica una vena cava superior izquierda aislada, sin otras anomalías del corazón fetal, no existe ninguna repercusión perinatal. Su importancia radica en que un grupo considerable de estos casos se acompaña de cardiopatías congénitas y anomalías anatómicas y cromosómicas. En este artículo se describen nueve casos de vena cava superior izquierda persistente, al igual que las anomalías del corazón asociadas, como también las alteraciones extracardiacas encontradas.Certain heart fetal planes must be realized during a routine obstetric ultrasound in order to identify a group of anomalies such as the persistency of the left superior caval vein. When an isolated left superior venal vein is identified without any other anomaly of the fetal heart, it does not have any perinatal repercussion. Its importance lies in the fact that a considerable number of these cases are associated with a high incidence of congenital heart diseases and anatomic and chromosomal abnormalities. This article reports nine cases of persistency of the left superior caval vein as well as the associated heart abnormalities and the extra-cardiac alterations found.

  11. Antecedentes internacionales y nacionales de las TIC a nivel superior: su trayectoria en Panamá

    Directory of Open Access Journals (Sweden)

    Cano Lassonde, Olda María

    2012-09-01

    Full Text Available Resumen: El presente documento recoge los aportes de una investigación titulada: “Modelo de Aprendizaje en Entornos Virtuales en la Educación Superior” que se está desarrollando para el Doctorado en Investigación con énfasis en las Ciencias Sociales en la Universidad Autónoma de Chiriquí (UNACHI, David, Chiriquí, República de Panamá, cuyo Programa Doctoral se realiza de acuerdo con el convenio firmado entre UNACHI y la Universidad del Mar, Chile. Se destacan las gestiones más sobresalientes y las acciones dirigidas hacia la implementación de las TIC para mejorar la calidad de la educación a nivel superior. Se describen los cambios generados por las nuevas Tecnologías de la Información y de la Comunicación en el sistema educativo a nivel mundial, vaticinando la transformación del proceso de enseñanza-aprendizaje, y la forma en que docentes y alumnos acceden al conocimiento y la información. Finalmente, se puntualiza el esfuerzo que realiza el Estado Panameño en la introducción de las TIC a nivel superior con una descripción de la trayectoria de la educación virtual en diferentes instituciones a nivel nacional.Abstract: The following paper reflects input of a research study entitled “A Model for Virtual Learning in Higher Education”, which is being developed for a Doctoral Program in Research with emphasis in Social Science at Universidad Autónoma de Chiriquí (UNACHI, David, Chiriquí, Republic of Panama. This doctoral program is being held according to the agreement signed between UNACHI and Universidad del Mar, Chile. This article makes reference to the international and national policies, particularly in the Republic of Panama, for the implementation of the Information and Communication Technologies (ICTs. The paper highlights the most outstanding management policies and directed actions towards the execution of ICTs for the improvement of the quality of higher education. The main changes or transformations

  12. La parole est à vous

    CERN Multimedia

    Staff Association

    2015-01-01

    Nous avons identifié, ci-dessous, 3 grands chapitres pour lesquelles bon nombre d’entre vous se posent des questions et ont fréquemment sollicités leurs délégués, qui n’ont pas toujours pu donner de réponses : La retraite et sa préparation. L’affiliation aux régimes sécurité sociale de nos états hôtes et ses conséquences au moment de la retraite. La fiscalité en général. Le service juridique, que nous avons interrogé récemment, n’est pas toujours informé de vos interrogations et de ce fait, il n’a pas encore pu investiguer sur ces questions auprès des services compétents. Il nous a suggéré de vous interroger afin de collecter vos questions, de les synthétiser, afin de les transmettre...

  13. UN MODELO PARA EL FONDO ESPECIAL PARA LA EDUCACIÓN SUPERIOR (FEES

    Directory of Open Access Journals (Sweden)

    Oldemar Rodríguez Rojas

    2010-01-01

    Full Text Available En este artículo se hace un análisis comparativo de los cinco convenios para el financiamiento de la educación superior pública que se han firmado hasta la fecha; para esto se utilizan los datos de los años 2004 al 2009. Luego, con base en este análisis proponemos un nuevo modelo alternativo para el cálculo del FEES; este nuevo modelo es comparado con el modelo establecido en el quinto convenio para el cálculo del FEES, con base en una simulación en un posible escenario del comportamiento de la economía para los años del 2011 al 2015.

  14. Conservatorios superiores de música: el drama de la memoria en un escenario de crisis globalizada.

    Directory of Open Access Journals (Sweden)

    Francisco Martínez González

    2015-07-01

    Full Text Available Los conservatorios superiores de música se enfrentan, junto al resto de los centros de enseñanzas artísticas superiores, a una enésima oportunidad histórica de definición de su valor en el marco del sistema educativo estatal. La repentina agudización de su tradicional estado de zozobra –acelerada por factores tanto externos como internos–, unida a un cambio cualitativo muy profundo en el horizonte de expectativas de sus gestores y usuarios, está coadyuvando a generar un estado de opinión mayoritario de alta polaridad crítica y reivindicativa. Cuáles puedan ser las causas cercanas y remotas de este estado de cosas, así como las posibilidades de verificación de las aspiraciones de los sectores implicados, constituyen el tema principal de este artículo.

  15. Calidad y equidad de la Educación Superior Pública. Aspectos por considerar en su interpretación

    Directory of Open Access Journals (Sweden)

    Guiselle María Garbanzo Vargas

    2007-01-01

    Full Text Available El presente artículo contempla una revisión sobre los principales indicadores por considerar en la búsqueda de la calidad de la Educación Superior Pública, que, a criterio de la autora, son fundamentales en la toma de decisiones y en los procesos analíticos en el que hoy está inmerso este sector educativo. Se retoman también aspectos como la evaluación y la equidad educativa, como elementos subyacentes a la calidad de la educación superior pública, a la cual le ha tocado sobrevivir hoy en un mercado internacional competitivo, consecuencia de los cambios sociales, culturales y económicos que, en gran escala, se han dado; situación que está fuera del control de las universidades.

  16. Evolução do acesso de jovens à educação superior no Brasil

    OpenAIRE

    Corbucci,Paulo Roberto

    2014-01-01

    Este texto se propõe a analisar a evolução do acesso à educação superior na coorte de 18 a 24 anos, a qual é considerada adequada à frequência a este nível de ensino. Inicialmente, questiona-se a utilização desta faixa etária como referência para se mensurar o grau de acesso a este nível de ensino no Brasil. Em seguida, são analisados alguns fatores que estabelecem estreita relação com as taxas de frequência à educação superior. No intuito de comparar a situação do Brasil no contexto internac...

  17. Estágio no Departamento Financeiro do Município de Penafiel

    OpenAIRE

    Silva, Cátia Vanessa Oliveira da

    2011-01-01

    Relatório de estágio para obtenção do grau de mestre em Finanças Empresariais O presente documento consiste no Relatório de Estágio do Mestrado em Finanças Empresariais, leccionado na Escola Superior de Estudos Industriais e de Gestão, unidade orgânica do Instituto Politécnico do Porto (ESEIG-IPP). O estágio decorreu no Departamento Financeiro do Município de Penafiel e este relatório tem como objectivo a descrição, apreciação e análise das actividades por ...

  18. ESTUDIO DEL BULLYING EN EL CICLO SUPERIOR DE PRIMARIA

    Directory of Open Access Journals (Sweden)

    Rosario Ruiz Arroyo

    2015-01-01

    Full Text Available Nuestra investigación trata el fenómeno del bullying en el ciclo superior de primaria. Para llevarla a cabo, hemos elaborado un cuestionario ad hoc a partir de una revisión bibliográfica de diferentes investigaciones en las que se han utilizado varios instrumentos, pruebas, cuestionarios... Este instrumento nos ha servido para analizar diferentes temas: la percepción que tienen los niños de ciclo superior sobre el bullying, en qué escenarios del centro escolar se producen más estos comportamientos, los diferentes tipos de bullying (físico, verbal y exclusión social y cuáles se producen más a menudo y analizar las respuestas que nos dan los alumnos en función del género y del curso (5.º y 6.º. Los resultados que hemos obtenido muestran, entre otras cosas: que en los niños se da más el bullying físico, mientras que en las niñas predomina el de tipo verbal y exclusión social; que la única diferencia según el curso es que en 6.º curso se da más exclusión social que en 5.º curso; y que donde se producen más conductas de bullying es en el patio, seguido del aula cuando no se encuentra el docente. Finalmente, partiendo de los resultados obtenidos, hemos elaborado unas propuestas de actuación psicopedagógicas para mejorar la convivencia en la escuela y otros espacios educativos.

  19. Superior-subordinate relations as organizational processes

    DEFF Research Database (Denmark)

    Asmuss, Birte; Aggerholm, Helle Kryger; Oshima, Sae

    Since the emergence of the practice turn in social sciences (Golsorkhi et al. 2010), studies have shown a number of institutionally relevant aspects as achievements across time and by means of various resources (human and non-human) (Taylor & van Every 2000, Cooren et al. 2006). Such a process view...... superior-subordinate relations in a specific institutionalized setting: performance appraisal interviews (PAIs). While one main task of PAIs is to manage and integrate organizational and employee performance (Fletcher, 2001:473), PAIs are also organizational practices where superior-subordinate relations...... are shaped, (re)confirmed and re-evaluated. This paper pursues the better understanding of the latter aspect by looking at one substantial and recurrent activity in PAIs: the evaluation of employee performance. One resource for doing the evaluation work is making assessments (e.g. Goodwin & Goodwin, 1987...

  20. Exploring the word superiority effect using TVA

    DEFF Research Database (Denmark)

    Starrfelt, Randi

    Words are made of letters, and yet sometimes it is easier to identify a word than a single letter. This word superiority effect (WSE) has been observed when written stimuli are presented very briefly or degraded by visual noise. It is unclear, however, if this is due to a lower threshold...... for perception of words, or a higher speed of processing for words than letters. We have investigated the WSE using methods based on a Theory of Visual Attention. In an experiment using single stimuli (words or letters) presented centrally, we show that the classical WSE is specifically reflected in perceptual...... processing speed: words are simply processed faster than single letters. It is also clear from this experiment, that the word superiority effect can be observed at a large range of exposure durations, from the perceptual threshold to ceiling performance. Intriguingly, when multiple stimuli are presented...

  1. Resolution of superior oblique myokymia with memantine.

    Science.gov (United States)

    Jain, Saurabh; Farooq, Shegufta J; Gottlob, Irene

    2008-02-01

    We describe a novel treatment of superior oblique myokymia. A 40-year-old woman was treated with gabapentin for this disorder with partial success and reported significant side effects including loss of libido and weight gain. After a drug holiday, memantine therapy was initiated resulting in a substantial improvement in her symptoms with far fewer side effects and stability on long-term maintenance therapy.

  2. Locked Superior Dislocation of the Acromioclavicular Joint

    Directory of Open Access Journals (Sweden)

    Salma Eltoum Elamin

    2013-01-01

    Full Text Available Acromioclavicular (AC joint injuries account for approximately 3–5% of shoulder girdle injuries (Rockwood et al., 1998. Depending on severity of injury and direction of displacement these are classified using Rockwood classification system for AC joint dislocation. We present an unusual case presenting with locked superior dislocation of the AC joint highlighting the presentation and subsequent successful surgical management of such case. To our knowledge this has not been reported previously in literature.

  3. Reperfusion hemorrhage following superior mesenteric artery stenting.

    LENUS (Irish Health Repository)

    Moore, Michael

    2012-02-03

    Percutaneous transluminal angioplasty and stent placement is now an established treatment option for chronic mesenteric ischemia and is associated with low mortality and morbidity rates. We present a case of reperfusion hemorrhage complicating endovascular repair of superior mesenteric artery stenosis. Although a recognized complication following repair of carotid stenosis, hemorrhage has not previously been reported following mesenteric endovascular reperfusion. We describe both spontaneous cessation of bleeding and treatment with coil embolization.

  4. [Mitral surgery by superior biatrial septotomy].

    Science.gov (United States)

    Saade, A; Delepine, G; Lemaitre, C; Baehrel, B

    1995-01-01

    The superior biatrial septotomy approach consists of two semicircular right atrial and septal incisions joined at the superior end of the interatrial septum and extended across the dome of the left atrium, allowing exposure of the mitral valve by reflecting the ventricular side using stay sutures. From 1991 to 1993, 81 patients underwent mitral valve surgery by this technic. Mitral valve operation was combined with other cardiac procedures in 30 patients (37%) and was performed as a second operation in 21 patients (25.9%). Duration of cardiopulmonary bypass and aortic occlusion was not significantly different from that of patients operated via a conventional left atrial approach. The five hospital deaths (6.2%) were not related to this operative approach. Only 2 patients (3.3%) with preoperative in sinus rythm were discharged in atrial fibrillation after operation. In one patient (1.6%), atrioventricular block appeared at late follow-up. There were no cases of bleeding, atrioventricular nodal dysfunction or intra-atrial shunting related to the approach. This approach provides excellent exposure of the mitral valve even in unfavorable situations such as a small left atrium, dense adhesions from previous procedures or a previously implanted aortic prosthesis, without damage to various cardiac structures due to excessive traction. No retractor or vena cava repair are required. These data support a wide application of the superior biatrial septotomy approach in mitral valve surgery.

  5. Superior mesenteric artery compression syndrome - case report

    Directory of Open Access Journals (Sweden)

    Paulo Rocha França Neto

    2011-12-01

    Full Text Available Superior mesenteric artery syndrome is an entity generally caused by the loss of the intervening mesenteric fat pad, resulting in compression of the third portion of the duodenum by the superior mesenteric artery. This article reports the case of a patient with irremovable metastatic adenocarcinoma in the sigmoid colon, that evolved with intense vomiting. Intestinal transit was carried out, which showed important gastric dilation extended until the third portion of the duodenum, compatible with superior mesenteric artery syndrome. Considering the patient's nutritional condition, the medical team opted for the conservative treatment. Four months after the surgery and conservative measures, the patient did not present vomiting after eating, maintaining previous weight. Superior mesenteric artery syndrome is uncommon and can have unspecific symptoms. Thus, high suspicion is required for the appropriate clinical adjustment. A barium examination is required to make the diagnosis. The treatment can initially require gastric decompression and hydration, besides reversal of weight loss through adequate nutrition. Surgery should be adopted only in case of clinical treatment failure.A síndrome da artéria mesentérica superior é uma entidade clínica causada geralmente pela perda do tecido adiposo mesentérico, resultando na compressão da terceira porção do duodeno pela artéria mesentérica superior. Esse artigo relata o caso clínico de uma paciente portadora de adenocarcinoma de cólon sigmoide metastático irressecável, que evoluiu com vômitos incoercíveis. Realizou-se, então, trânsito intestinal que evidenciou dilatação gástrica importante, que se prolongava até a terceira porção duodenal, quadro radiológico compatível com pinçamento da artéria mesentérica superior. Diante da condição nutricional da paciente, foi optado por iniciar medidas conservadoras (porções alimentares pequenas e mais frequentes, além de dec

  6. Enfermagem de nível superior no Brasil e vida associativa Enfermería de nivel superior en Brasil y vida asociativa Superior Nursing in Brazil and associative life

    Directory of Open Access Journals (Sweden)

    Suely de Souza Baptista

    2006-01-01

    Full Text Available Este estudo, de cunho histórico-crítico, discute as inter-relações entre a Associação Brasileira de Enfermagem e os cursos superiores de enfermagem na sociedade brasileira. A inserção da enfermagem na universidade brasileira iniciou-se no final da década de 30; em meados do século 20 tal movimento foi favorecido pela política federal de ensino superior, e veio a completar-se com a implantação da Reforma Universitária de 1968. O alcance de um maior grau de cientificização da enfermagem, como área de domínio do conhecimento, constituiu-se no maior desafio que a área de enfermagem teve que enfrentar para firmar sua reputação na comunidade científica nacional e internacional.Este estudio, de cuño histórico crítico, discute las interrelaciones entre la Asociación Brasileña de Enfermería (Aben y los cursos superiores de enfermería en la sociedad brasileña. La inserción de la enfermería en la universidad brasileña se inició a finales de la década del 30; a mediados del siglo 20 este movimiento fue favorecido por la política federal de la enseñanza superior, y vino a completarse con la implantación de la Reforma Universitaria de 1968. El alcance de un mayor grado científico de la enfermería, como área de dominio del conocimiento, se constituye en el mayor desafío que la area de enfermería tuve que enfrentar para signar su reputación en la comunidad científica nacional e internacional.This historical-critical study discusses the interrelations between the Brazilian Nursing Association and the baccalaureate nursing courses in the Brazilian society. The insertion of nursing in Brazilian university began in the late 1930's. Such a movement was favored by the federal policy of higher education in the mid-twentieth century and it was accomplished by the University Reform of 1968. The achievement of a higher degree in scientification of nursing, as a mastery of knowledge field, had become the biggest challenge the

  7. REFLEXIONES SOBRE EL FONDO DE LA EDUCACIÓN SUPERIOR PÚBLICA FEES

    Directory of Open Access Journals (Sweden)

    Vargas Alfaro Leiner

    2010-11-01

    Full Text Available Resumen:Este artículo plantea los avatares de la negociación del financiamiento de la educación superior pública costarricense para el Convenio (FEES; en el marco del proceso de crisis económica y reforma al sector público, considerando la situación de desbalance fiscal del período 2009-2010. Se trata de un ensayo cuyo argumento central descrito es el balance de los resultados de la negociación del Fondo Estatal para la Educación Supeior FEES. El resultado obtenido se considera positivo para el fortalecimiento de la educación superior estatal costarricense que logra crecer alrededor de un 100 por ciento en términos reales durante la década, a pesar de la angustiante situación fiscal y económica del país, lo que es reflejo de una política de Estado de mejora de la educación en el marco de la estrategia nacional de desarrollo vigente. Este resultado representa un avance respecto a las dos décadas anteriores, donde la negociación apenas y logro sostener el FEES en términos reales. El rezago de estas dos décadas representa un desafío importante a la inversión y acción universitarias, en tanto se debe mirar al futuro y reponer el recurso humano perdido, al mismo tiempo que se moderniza la Universidad de cara a los desafíos de la ciencia, la tecnología y la innovación de los próximos 50 años.Abstract: This paper discusses the ups and downs of negotiating the financing of public higher education in Costa Rica under the process of economic crisis and reform of the public sector, considering the situation of fiscal imbalance during the period 2009-2010. The key issue is that the results described in the negotiations show a positive balance for the strengthening of the Costa Rican public higher education was able to grow by around 100 percent in real terms, despite the desperate economic and fiscal situation of the country, which is a reflection of a state policy of improving education in the context of the current national

  8. A permeabilidade social das carreiras do ensino superior

    Directory of Open Access Journals (Sweden)

    Maria Ligia de Oliveira Barbosa

    Full Text Available Este artigo propõe-se a analisar as diferenças entre cursos pertencentes a três áreas de conhecimento (ciências biológicas, exatas e humanas quanto à sua capacidade para oferecer maior igualdade de oportunidades no momento de expansão e diversificação do ensino superior brasileiro. O estudo foi realizado a partir dos microdados do Exame Nacional de Desempenho dos Estudantes (ENADE, combinando a nota geral da prova às respostas do questionário socioeconômico dos alunos, de forma a avaliar as associações entre o financiamento dos estudos de graduação e o desempenho e permanência nos diferentes cursos. Ao mesmo tempo em que os resultados confirmam as diferenças entre as áreas de conhecimento, também indicam a importância desses mecanismos de custeio das despesas para a finalização dos cursos. Verificam-se diferenças significativas em cada curso quanto ao desempenho associado a cada tipo de bolsa e de financiamento.

  9. A Astronomia no Ensino Superior Brasileiro entre 1808 e 1889

    Science.gov (United States)

    Bretones, Paulo S.; Videira, Antonio A. P.

    2003-05-01

    Este artigo apresenta os principais eventos ocorridos na história do ensino de astronomia nos cursos superiores que existiram no Brasil desde a chegada da Família Real portuguesa em 1808 até o final do período monárquico. Para compor esse esboço histórico, utilizamos, principalmente, livros didáticos, regulamentos, decretos e leis responsáveis pelas organizações dos conteúdos oferecidos e das carreiras dos responsáveis pela disciplina. Na análise do material empregado, investigamos a presença de concepções filosóficas e científicas, que podem ter norteado os conteúdos disciplinares. Não realizamos nenhuma comparação com o ensino de astronomia em outros países. Concluímos mostrando que o estudo de astronomia, durante o período monárquico, foi mais direcionado para a formação d engenheiros do que astrônomos. Gostaríamos de observar que o presente artigo não tem a pretensão de abordar o assunto de maneira completa e detalhada.

  10. Los rumbos de la educación superior: tendencias y desafíos

    Directory of Open Access Journals (Sweden)

    Gilda Waldman Mitnick

    2000-01-01

    Full Text Available Este artículo analiza la educación superior de nuestros días a la luz de los más importantes cambios que recorren todos los ámbitos de la vida social de fin de siglo: la globalización económica, la redefinición del papel del Estado y la revolución científico-tecnológica. El texto se centra en las cinco palancas fundamentales que están transformando a la educación superior: la aplicación tecnológica a la vida académica, la movilidad real y virtual de estudiantes y profesores, el imperativo de la educación permanente, el acercamiento al ámbito laboral y el nuevo papel de maestros y alumnos en el proceso de enseñanza-aprendizaje. De igual me do, el artículo analiza algunas de las consecuencias de estas transformaciones y señala la importancia de los estudios de posgrado como eje clave de los nuevos rumbos de la educación superior

  11. Análisis de las megatendencias de educación superior

    Directory of Open Access Journals (Sweden)

    Fernando Barrios Ipenza

    2013-12-01

    Full Text Available Alvin Toffler, en su libro El shock del futuro en los años 70 (1, sostenía que el mundo estaba enfrentado al inicio de fuertes cambios en su sustrato tecnológico y social, y que se estaban gestando cambios significativos en las personas, en las organizaciones y en los grupos sociales; cuyas dinámicas imponían nuevos desafíos, especialmente a las instituciones de educación, y en particular a las universidades como las instituciones tradicionales generadoras y transmisoras de conocimiento, que están en el centro mismo de los “shocks”, puesto que son los instrumentos y las palancas en el camino hacia la nueva sociedad del conocimiento que se está generando a escala global y que está rediseñando el mapa político, comercial y productivo (2. Este tercer “shock” que enfrentan las sociedades, golpea particularmente a los sistemas universitarios y está promoviendo en América Latina una metamorfosis de los sistemas universitarios, una mutación expresada en la tercera reforma de la educación superior, la cual es, sin duda, la más compleja, generalizada y riesgosa por la dimensión del impacto, la cantidad de variables en juego y la vinculación con tantas áreas de la sociedad (2.

  12. SOLUCIÓN CREATIVA DE PROBLEMAS EN LA EDUCACIÓN SUPERIOR: SIGNIFICADO Y CREENCIAS

    Directory of Open Access Journals (Sweden)

    Efrain Duarte Briceño

    2012-01-01

    Full Text Available Este estudio tuvo como objetivo identificar el significado y las creencias que tienen docentes de educación superior acerca de la solución creativa de problemas. El estudio está planteado dentro del paradigma interpretativo. Participaron cuatro profesores del área de Ciencias Exactas e Ingenierías de una universidad pública , seleccionados según su experiencia como docentes. Se utilizó una guía de entrevista semiestructurada con cuatro apartados: Datos personales, Significado de la solución creativa de problemas, Desempeño docente bajo este modelo e Importancia de este modelo para el currículo. Los resultados muestran aspectos comunes solamente en cuanto a que la solución de problemas está vinculada con procesos de conducta y de pensamiento; asimismo, concordaron en que es deseable insertar la solución creativa de problemas en el currículo universitario y fomentar el desarrollo de habilidades de pensamiento en los estudiantes.

  13. Exploring the word superiority effect using TVA

    DEFF Research Database (Denmark)

    Starrfelt, Randi

    Words are made of letters, and yet sometimes it is easier to identify a word than a single letter. This word superiority effect (WSE) has been observed when written stimuli are presented very briefly or degraded by visual noise. It is unclear, however, if this is due to a lower threshold for perc...... simultaneously we find a different pattern: In a whole report experiment with six stimuli (letters or words), letters are perceived more easily than words, and this is reflected both in perceptual processing speed and short term memory capacity....

  14. de educación media superior

    Directory of Open Access Journals (Sweden)

    Enrique Cerón Ferrer

    2007-01-01

    Full Text Available El trabajo presenta los resultados obtenidos en relación al conocimiento y manejo que sobre matemáticas tienen los estudiantes de educación media superior, de los Centros de Estudios Tecnológicos y de Servicios del Distrito Federal, de diferentes carreras que se imparten en estos centros escolares, durante el año 2005. El instrumento de análisis es un cuestionario que contestaron los alumnos, la metodología utilizada es de tipo longitudinal y comparativa.

  15. MERCADO LABORAL, EDUCACIÓN SUPERIOR Y FORMACIÓN DOCENTE EN COSTA RICA

    Directory of Open Access Journals (Sweden)

    Luis Carlos Morales Zúñiga

    2011-01-01

    Full Text Available En este ensayo se analiza la relación que existe entre la educación superior, la dinámica del mercado laboral, y la formación de docentes, en un nuevo contexto histórico-social caracterizado por la liberalización de la economía, y el avance de una concepción mercantil de la educación en Costa Rica. Se describe la relación que existe entre la desregulación de la oferta de educación superior, sobre todo privada, y la consecuente saturación de profesionales en el mercado laboral. Se analiza con especial interés la situación de los profesionales de la educación en este contexto, sobre todo, las condiciones laborales que enfrenta este sector educativo, como consecuencia de la aplicación de la lógica de mercado.

  16. Qualidade da educação superior e contextos emergentes

    Directory of Open Access Journals (Sweden)

    Marilia Costa Morosini

    2014-07-01

    Full Text Available A qualidade da educação superior tem sido tema de frequentes produções científicas. Identifica-se a forte presença de posições em defesa do rankeamento e da garantia da qualidade de sistemas, instituições e cursos de educação superior defendendo um modelo universal de avaliação da qualidade, bem como posições que defendem a não comparabilidade entre tais elementos pela crença em diferentes identidades universitárias. Este texto tem como objetivo apresentar uma reflexão sobre o conceito de qualidade da educação superior, neste século, considerando como base para essa compreensão a noção de contextos emergentes. Retoma, resumidamente, as diferentes concepções de qualidade da educação superior apresentada em artigos anteriores (MOROSINI, 2001 e 2009 e identifica a consolidação da noção isomórfica, corroborada pelo processo de internacionalização transnacional; e a emergência de uma noção, mais substantiva e defensável, da equidade na qualidade da educação superior. Conclui pela complexidade da temática e reforça a relação entre contexto emergente e qualidade da educação superior, neste momento de transição, tensionada pela relação local-global.

  17. DEMANDA E POLÍTICAS PÚBLICAS PARA O ENSINO SUPERIOR NOS BRICS

    Directory of Open Access Journals (Sweden)

    Simon Schwartzman

    Full Text Available Este artigo analisa a expansão do ensino superior nos países chamados BRICS. A aspiração crescente pelo ensino superior obriga os governos a gerir os custos de funcionamento desse sistema. As respostas de cada país variam com sua história, cultura e regime político. Todos eles enfrentam problemas semelhantes, como escassez de recursos e o poder político de atores do sistema de ensino superior e fora dele. Cinco dilemas se apresentam aos países: 1 expansão, igualdade de acesso e diversificação das matrículas, taxas de participação, o número e os tipos de instituições; 2 limitações financeiras; 3 regulação do ensino superior privado; 4 como fazer com que as instituições de ensino superior prestem mais contas a seus alunos, funcionários e à sociedade como um todo; e 5 qualidade e relevância social da aprendizagem e pesquisa em instituições de ensino superior. Utilizando dados e evidências das pesquisas mais recentes, o artigo mostra respostas comuns, com algumas exceções em cada caso: diversificação institucional; políticas de ação afirmativa; crescimento das matrículas nas ciências sociais, humanidades, profissões sociais e Educação; pouco sucesso nas políticas de internacionalização.

  18. Pancreaticoduodenectomy with early superior mesenteric artery dissection

    Institute of Scientific and Technical Information of China (English)

    Yu-Fei Xu; Zuo-Jin Liu; Jian-Ping Gong

    2010-01-01

    BACKGROUND: Pancreatic adenocarcinoma remains the fourth leading cause of cancer-related death and is one of the most aggressive human tumors. At present, surgical resection is the only potentially curative treatment. Early neck division is inadequate when invasion of the superior mesenteric artery (SMA) is suspected or in cases of replaced or accessory right hepatic artery. Malignant periampullary tumors often invade retroperitoneal peripancreatic tissues and a positive resection margin is associated with a poor long-term survival. DATA SOURCES: English-language medical databases, PubMed, ELSEVIER and SPRINGERLINK, were searched for articles on"posterior approach pancreaticoduodenectomy","superior mesenteric artery ifrst approach", "retroperitoneal tissue","hanging maneuver", and related topics. RESULTS:The modiifcation allowed the surgeon to early identify the nonresectability of a replaced right hepatic artery if present, enabling complete dissection of the right side of the SMA and portal vein as well as complete excision of the retroportal pancreatic lamina. CONCLUSION: Pancreaticoduodenectomy with early retro-pancreatic dissection is a useful and safe technical variant, which is indicated for the improvement of the safety and curative effect of the procedure.

  19. Radiation treatment of superior sulcus lung carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Millar, J.; Ball, D.; Worotniuk, V.; Smith, J.; Crennan, E.; Bishop, M. [Peter MacCallum Cancer Inst., East Melbourne, VIC (Australia)

    1996-02-01

    The survival of patients with superior sulcus lung carcinoma and the effects of treatment were reviewed. From a prospective database of 4123 consecutive new patients with lung carcinoma, 131 (3.2%) cases of superior sulcus lung carcinoma were identified. Seventy-four patients were planned to receive radiation with palliative intent, 53 radical radiotherapy and one was observed only. The remaining three patients, with small-cell carcinoma, were treated with chemotherapy with or without radiotherapy. Of the 53 radically treated patients, nine were treated with pre-operative radiation prior to intended radical resection. Analysis was carried out on the effect on survival of performance status, nodal involvement, weight loss, vertebral body or rib involvement, treatment intent and radical combined modality treatment compared with radical radiation alone. The estimated median survival for the whole group was 7.6 months; for those treated radically it was 18.3 months, while for the palliatively treated patients it was 3.7 months. Radically treated patients with no initial nodal involvement had an estimated median survival of 22 months, while radically treated patients with nodal involvement had an estimated median survival of 8.4 months (P = 0.003). There were no statistically significant differences in survival between radically treated patients grouped according to initial weight loss, performance status, or vertebral body and rib involvement. Patients treated with pre-operative radiation did not survive significantly longer than patients treated with radiation alone, although the numbers are small. 33 refs., 2 tabs., 4 figs.

  20. Studies on zooplankton of Lago Paione Superiore

    Directory of Open Access Journals (Sweden)

    Patrizia COMOLI

    1999-08-01

    Full Text Available We report here the results of a three year study on the zooplankton of Lago Paione Superiore, an acid sensitive lake above the tree line in the Italian Alps. The research was carried out within MOLAR, an EC-founded Project on “Measuring and Modeling the dynamic response of remote mountain lakes ecosystems to environmental change”. This study comes after a series of investigations on the effects of acidification, in which we documented the changes occurred with decreasing water pHs, by comparing the recent situation with that in the literature of the 40s, and reconstructed the beginning of anthropogenic disturbance through an analysis of the past cladocera assemblages archived in the lake sediments. A characteristic pattern in seasonal periodicity is a transition from a community dominated by small zooplankton (August to a community where the large particle-feeder Daphnia longispina dominates. This is a typical pattern observed in fishless, copepod-cladocera lakes. Regardless from which food is able to exploit, Daphnia population of Lago Paione Superiore is composed by well-fed organisms, visually rich in lipids, able to produce more than one generation/ year of parthenogenetic females at density levels which are rather high in an oligotrophic high mountain lake.

  1. El espacio europeo de educación superior: visiones y realidades de un proceso deseable de convergencia

    Directory of Open Access Journals (Sweden)

    Ulrich Teichler

    2006-01-01

    Full Text Available Apoyando la afirmación de que la investigación sobre la educación superior debería buscar más bien explicaciones y hacerlo, además, con una actitud escéptica, el autor argumenta y documenta que, a principios del siglo XXI, la mayoría de europeos están convencidos de que la educación superior se ve mucho más fuertemente afectada que antes por el hecho de hallarse estrechamente incrustada en ambientes europeos y mundiales. En este orden de cosas, el panorama trazado de la situación actual de la educación superior y las políticas relacionadas con la misma en Europa se articula en torno a cinco propuestas de análisis que abundan en aspectos tales como: en las políticas nacionales de educación superior desde hace cincuenta años se ha prestado una atención cada vez mayor a los temas europeos e internacionales pero partir de la década de 1990 las políticas nacionales de este nivel son, al mismo tiempo, políticas europeas e internacionales y las políticas europeas e internacionales de educación superior en Europa son, al mismo tiempo, políticas nacionales. En la actualidad se tiende a configurar un sistema europeo de educación superior en un mundo globalizado aunque las viejas políticas no desaparecen por ello, con lo que las políticas europeas e internacionales de educación superior se vuelven crecientemente complejas. Con todo, la europeización de las políticas de educación superior de los países europeos o de los cuerpos europeos supranacionales en ningún momento contradijeron sustancialmente las políticas internacionales. Finalmente, las políticas de investigación de los países europeos occidentales y de las organizaciones supranacionales activas en Europa siempre fueron impulsadas por otras justificaciones racionales, aparte de las políticas de educación superior. Sin embargo, en la actualidad, no observamos ninguna integración real de las políticas de educación superior por lo que respecta al "proceso de

  2. Predicción de la Inclusión de Caninos Superiores en una Población Infantil

    OpenAIRE

    Gascón Pellicer, Jordi

    2015-01-01

    La tesis doctoral se ha realizado debido a la gran prevalencia de inclusión de caninos superiores en la población general. En la segunda fase de recambio dentario, el diente que provoca más problemas eruptivos es el canino permanente superior. Si este diente altera su trayecto eruptivo, el resultado puede ser una erupción ectópica del mismo o su retención por palatino. En ambos casos, el paciente necesitará tratamiento ortodóncico que suele ser largo y complejo. Por ese motivo, sería importan...

  3. Educação inclusiva no ensino superior: um novo desafio

    Directory of Open Access Journals (Sweden)

    Marian A. L. Dias Ferrari

    Full Text Available O crescente ingresso de alunos com necessidades educacionais especiais na rede regular de ensino torna necessário um aprofundamento na reflexão sobre a educação inclusiva. Este artigo tem por objetivo discutir os desafios da educação inclusiva no ensino superior. Com essa finalidade, retomamos a história da Universidade, verificamos seus objetivos e características principais, suas determinações nas instituições de ensino superior brasileiras e analisamos o percurso da educação inclusiva no cenário mundial e nacional. A partir daí, levantamos questões específicas da educação inclusiva no ensino superior e identificamos três níveis de desafios a serem enfrentados: a tomada de posição das instituições sobre os objetivos e a elegibilidade dos alunos para seus cursos, a necessidade de formação pedagógica dos professores do ensino superior para a educação inclusiva e, por fim, uma prática educativa que propicie a participação de alunos e professores no reconhecimento das diferenças e na criação de estratégias para a superação das dificuldades que surgirem.

  4. Educação inclusiva no ensino superior: um novo desafio

    Directory of Open Access Journals (Sweden)

    Marian A. L. Dias Ferrari

    Full Text Available O crescente ingresso de alunos com necessidades educacionais especiais na rede regular de ensino torna necessário um aprofundamento na reflexão sobre a educação inclusiva. Este artigo tem por objetivo discutir os desafios da educação inclusiva no ensino superior. Com essa finalidade, retomamos a história da Universidade, verificamos seus objetivos e características principais, suas determinações nas instituições de ensino superior brasileiras e analisamos o percurso da educação inclusiva no cenário mundial e nacional. A partir daí, levantamos questões específicas da educação inclusiva no ensino superior e identificamos três níveis de desafios a serem enfrentados: a tomada de posição das instituições sobre os objetivos e a elegibilidade dos alunos para seus cursos, a necessidade de formação pedagógica dos professores do ensino superior para a educação inclusiva e, por fim, uma prática educativa que propicie a participação de alunos e professores no reconhecimento das diferenças e na criação de estratégias para a superação das dificuldades que surgirem.

  5. Cochlear implant outcomes in patients with superior canal dehiscence

    NARCIS (Netherlands)

    Puram, Sidharth V.; Roberts, Daniel S.; Niesten, Marlien E F; Dilger, Amanda E.; Lee, Daniel J.

    2015-01-01

    Objective: To determine whether adult cochlear implant (CI) users with superior canal dehiscence syndrome (SCDS) or asymptomatic superior semicircular canal dehiscence (SCD) have different surgical, vestibular, and audiologic outcomes when compared to CI users with normal temporal bone anatomy. Meth

  6. Calidad de la educación superior: concepto y modelos

    OpenAIRE

    Luis Eduardo González; Oscar Espinoza

    2008-01-01

    El propósito del presente artículo es comprender el concepto de calidad desde diferentes perspectivas. Se constata que este concepto posee distintos alcances en educación superior, dependiendo del ámbito de acción en el cual se aplica: procesos de evaluación, gestión, y planificación estratégica, entre otros. El artículo provee distintas miradas sistémicas que se traducen en modelos de evaluación y gestión de la calidad en la educación superior, tales como: TQM, EFQM, CINDA y MEXA.

  7. Acreditación, mercado y educación superior

    OpenAIRE

    JUAN CARLOS SILAS CASILLAS

    2013-01-01

    El trabajo analiza los esquemas y referentes de calidad usados con frecuencia en México y Latinoamérica y se propone descubrir los argumentos de mercado que fundamentan las prácticas de acreditación y evaluación institucional. Se bosqueja, como conclusión, que el concepto de calidad en la educación superior es en sí mismo una construcción que obedece a un contexto dinámico en el cual están inmersos los actores de la educación superior y, en vez de acercarse a cuestiones filosóficas fundamenta...

  8. The Superior Transvelar Approach to the Fourth Ventricle and Brainstem

    OpenAIRE

    Ezer, Haim; Banerjee, Anirban Deep; Bollam, Papireddy; Guthikonda, Bharat; Nanda, Anil

    2012-01-01

    Objective The superior transvelar approach is used to access pathologies located in the fourth ventricle and brainstem. The surgical path is below the venous structures, through the superior medullary velum. Following splitting the tentorial edge, near the tentorial apex, the superior medullary velum is split in the cerebello-mesencephalic fissure. Using the supracerebellar infratentorial, transtentorial or parietal interhemispheric routes, the superior medullary velum is approached. Splittin...

  9. El horizonte estético

    OpenAIRE

    Perniola, Mario

    2004-01-01

    La existencia de un horizonte estético depende de la coexistencia de múltiples factores de distinta naturaleza que interactúan entre ellos. No bastan las reflexiones en torno a lo bello y al arte para crear un horizonte estético. La palabra “estética” es introducida en el Settecento por la filosofía para indicar una articulación disciplinar propia que pudiera ubicarse cerca de la lógica; esta circunstancia histórica, sin embargo, no debe hacernos olvidar que la filosofía es desde su nacimient...

  10. Maestros en educación superior: un estudio de egresados

    Directory of Open Access Journals (Sweden)

    Jorge A. Fernández Pérez

    2006-01-01

    Full Text Available Para lograr una educación de excelencia que lleve a formar a los profesionales del siglo XXI, es necesario fortalecer la cultura de superación y evaluación del proceso educativo por medio de instrumentos y mecanismos que permitan retroalimentar la calidad de este proceso; uno de ellos es a través de la caracterización de la práctica profesional, la cual es definida como la aplicación concreta y autónoma de una profesión, en un lugar, tiempo y circunstancias determinadas. En este sentido, corresponde un papel central a la educación, ya que los profesionistas formados en las instituciones de enseñanza superior tienen que demostrar sus capacidades, conocimientos, habilidades y responsabilidades en el ejercicio profesional, compitiendo en un espacio laboral inestable. El enfoque de la presente investigación fue cuantitativo, con la intención de detectar el impacto que han tenido los egresados de la Maestría en Educación Superior de la Benemérita Universidad Autónoma de Puebla. Este trabajo permitió obtener información significativa y relevante que conlleva a fortalecer el vínculo práctica profesional-formación profesional, lo que permitirá tener parámetros significativos para adecuar el plan de estudio que actualmente se desarrolla en la formación de Maestros en Educación Superior.

  11. 14 CFR 385.7 - Exercise of authority by superiors.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Exercise of authority by superiors. 385.7... Exercise of authority by superiors. Any assignment of authority to a staff member other than the Chief... Department's principle of management responsibility, the superior may choose to exercise the assigned power...

  12. Superiority: China Mobile in the competition

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The market share between China Mobile and China Unicom has stabilized since 2002.It is found that China Mobile has the superiority in the competition, for example, the scissors movement between its revenue and cost indicates that it has a strong profit generating ability and there is enough room for it to reduce the price.The ratio between its price (marginal income) and marginal cost indicates that there is a very distant limit for it to reduce the price.Its demand is obviously flexible with the price, but it does not use the price weapon abundantly.The reason for the stabilization of the market is that China Mobile withdrew from the competition.

  13. MRI manifestations of enlarged superior ophthalmic vein

    Institute of Scientific and Technical Information of China (English)

    WEI Rui-li; MA Xiao-ye; CAI Ji-ping; ZHU Huang

    2002-01-01

    Objective:To assess MRI in the evaluation of enlarged superior ophthalmic vein (SOV). Methods: MRI manifestations and etiology of forty-six patients with enlarged SOV were analyzed. Results: SOV enlargement was noted to occur in carotid-cavernous fistula, ophthalmic Graves'disease, Tolosa-Hunt syndrome, inflammation at the apex of the orbit, orbital pseudotumor and thrombosis of cavernous sinus. The dilated vein appeared as signal void tubular shadows on both T1 and T2 weighted images. The diameter of the enlarged vein was 3.5-6.0 mm. Extraocular muscle enlargement, orbital pathologies, enlarged carotid cavernous sinus etc were also revealed by MRI. Conclusion: The dilated SOV may be well demonstrated by MRI. The etiological diagnosis of enlarged SOV can be made in combination with the associated findings.

  14. Lightning activity during the 1999 Superior derecho

    Science.gov (United States)

    Price, Colin G.; Murphy, Brian P.

    2002-12-01

    On 4 July 1999, a severe convective windstorm, known as a derecho, caused extensive damage to forested regions along the United States/Canada border, west of Lake Superior. There were 665,000 acres of forest destroyed in the Boundary Waters Canoe Area Wilderness (BWCAW) in Minnesota and Quetico Provincial Park in Canada, with approximately 12.5 million trees blown down. This storm resulted in additional severe weather before and after the occurrence of the derecho, with continuous cloud-to-ground (CG) lightning occurring for more than 34 hours during its path across North America. At the time of the derecho the percentage of positive cloud-to-ground (+CG) lightning measured by the Canadian Lightning Detection Network (CLDN) was greater than 70% for more than three hours, with peak values reaching 97% positive CG lightning. Such high ratios of +CG are rare, and may be useful indicators of severe weather.

  15. Analgesia em modelo animal superior para ortopedia

    OpenAIRE

    Oliveira MT, Maria Teresa; Potes, José Alberto; Queiroga, Cristina; Castro, José António; Pereira, Alfredo; Reis, Joana

    2015-01-01

    O teste de novos biomateriais para aplicações clínicas em ortopedia, ou noutras áreas da medicina, em modelos animais vivos e sencientes, em prol do benefício humano, deve ser objecto de planeamento cuidado e ponderado, dado o conflito ético que se coloca. Compete-nos a nós, enquanto investigadores, garantir que as condições de vida, saúde e bem-estar são asseguradas. O uso de ovinos como modelo superior pré-clínico, para investigação em Ortopedia, tem-se evidenciado devido às suas caracterís...

  16. Superior vena cava syndrome in hemodialysis patient

    Directory of Open Access Journals (Sweden)

    Azeb Molhem

    2011-01-01

    Full Text Available Obstruction of blood flow in the superior vena cava (SVC results in symptoms and signs of SVC syndrome. SVC obstruction can be caused either by invasion or external compression of the SVC by contagious pathologic processes involving the right lung, lymph nodes, and other mediastinal structures, or by thrombosis of blood within the SVC. Occasionally, both mechanisms co-exist. We hereby report a case of a 28-year-old male, Saudi patient who was diagnosed with end-stage renal disease and was maintained on regular hemodiaysis via right jugular vein dual lumen catheter for ten months. Three years later, the patient presented with signs and symptoms suggestive of SVC obstruction that was successfully managed with SVC stenting.

  17. [Surgical treatment of superior thoracic outlet syndrome].

    Science.gov (United States)

    Gaibov, A D; Kakhorov, A Z; Sadriev, O N; Yunusov, Kh A

    2015-01-01

    The authors present immediate and long-term results of treatment of 117 patients with superior thoracic outlet syndrome (STOS). There were different reasons for compression of neu- rovascular fascicle in outlet of the thorax. The costaclavicular syndrome was a reason in 48 patients, additional cervical ribs had 36 patients. Skalenus syndrome was noted in 26 cases, rudimentary cervical ribs or hypertrophy of cervical vertebrae C7 had 7 patients. Raynaud's syndrome took place in 19 cases. The required volume of diagnostic procedures and surgical treatment of STOS were determined according to the cause of the syndrome. Differentiated approach to the different forms of STOS was used in relation to dominant symptoms of the disease and reasons for compression of neurovascular fascicle. This allowed getting positive results in majority of patients (90,4%) in long- term period.

  18. ANATOMIC RESEARCH OF SUPERIOR CLUNIAL NERVE TRAUMA

    Institute of Scientific and Technical Information of China (English)

    1999-01-01

    In order to find the mechanism of superior clunial nerve (SCN) trauma, we dissected and revealed SCN from 12 corpses (24 sides). Combining 100 sides of SCN trauma, we inspected the course of SCN, the relation between SCN and it's neighbour tissues with the situation of SCN when being subjected to force. We found that the following special anatomic characteristics and mechanical elements such as the course of SCN, it's turning angles, the bony fibrous tube at the iliac crest, the posterior layer of the lumbodorsal fascia and SCN neighbour adipose tissue, are the causes of external force inducing SCN trauma. The anatomic revealment is the guidance of SCN trauma treatment with edged needle.

  19. Superiorization: An optimization heuristic for medical physics

    CERN Document Server

    Herman, G T; Davidi, R; Censor, Y

    2012-01-01

    Purpose: To describe and mathematically validate the superiorization methodology, which is a recently-developed heuristic approach to optimization, and to discuss its applicability to medical physics problem formulations that specify the desired solution (of physically given or otherwise obtained constraints) by an optimization criterion. Methods: The underlying idea is that many iterative algorithms for finding such a solution are perturbation resilient in the sense that, even if certain kinds of changes are made at the end of each iterative step, the algorithm still produces a constraints-compatible solution. This property is exploited by using permitted changes to steer the algorithm to a solution that is not only constraints-compatible, but is also desirable according to a specified optimization criterion. The approach is very general, it is applicable to many iterative procedures and optimization criteria used in medical physics. Results: The main practical contribution is a procedure for automatically p...

  20. Utilização de marcadores moleculares RAPD e EST's SSR para estudo da variabilidade genética em cana-de-açúcar¹ Use of molecular markers RAPD, and ESTs SSR to study genetic variability in sugarcane

    Directory of Open Access Journals (Sweden)

    João Andrade Dutra Filho

    2013-03-01

    Full Text Available Marcadores moleculares dos tipos RAPD e EST's SSR foram utilizados como ferramentas para avaliar a variabilidade bem como estimar a divergência genética entre variedades comerciais e clones de cana-de-açúcar oriundos via autofecundação. Vinte e três genótipos foram utilizados neste estudo oriundos do Programa de Melhoramento Genético da Cana-de-açúcar da Rede Interuniversitária para o Desenvolvimento do Setor Sucroalcooleiro (PMGCA/RIDESA. A extração do DNA genômico seguiu a metodologia CTAB com modificações para cana-de-açúcar. Foram utilizados 11 oligonucleotídeos RAPD da operon Technologies e 7 EST's SRR obtidos através de uma extensa revisão de literatura. As análises da divergência genética foram realizadas com o auxílio do Programa GENES. Os marcadores RAPD detectaram um alto grau de polimorfismo genético, produzindo 61 bandas, das quais 58 foram polimórficas. Os marcadores EST's SSR amplificaram 38 alelos, sendo 34 polimórficos. Havendo a formação de três grupos, com a população estudada. A maior parte da variação genética foi mantida dentro das progênies, evidenciando a ocorrência de um alto grau de variabilidade genética entre os genótipos de cada progênie para fins de melhoramento. Através da divergência genética estimada foi possível identificar parentais divergentes para trabalhos de hibridação, visando a obtenção de clones superiores com caracteres de interesse à agroindústria canavieira. Os marcadores molecuares RAPD e EST's SSR foram igualmente eficientes para estimar a variabilidade genética nos genótipos testados e elaborar os cruzamentos a serem realizados nos programas de melhoramento.Molecular markers of the type RAPD and ESTs SSR were used as tools to evaluate the variability, and estimate the genetic divergence between commercial varieties and sugarcane clones from self-pollination. Twenty-three genotypes from the Program for the Genetic Improvement of Sugarcane of the

  1. Superior calcium homeostasis of extraocular muscles.

    Science.gov (United States)

    Zeiger, Ulrike; Mitchell, Claire H; Khurana, Tejvir S

    2010-11-01

    Extraocular muscles (EOMs) are a unique group of skeletal muscles with unusual physiological properties such as being able to undergo rapid twitch contractions over extended periods and escape damage in the presence of excess intracellular calcium (Ca(2+)) in Duchenne's muscular dystrophy (DMD). Enhanced Ca(2+) buffering has been proposed as a contributory mechanism to explain these properties; however, the mechanisms are not well understood. We investigated mechanisms modulating Ca(2+) levels in EOM and tibialis anterior (TA) limb muscles. Using Fura-2 based ratiometric Ca(2+) imaging of primary myotubes we found that EOM myotubes reduced elevated Ca(2+) ˜2-fold faster than TA myotubes, demonstrating more efficient Ca(2+) buffering. Quantitative PCR (qPCR) and western blotting revealed higher expression of key components of the Ca(2+) regulation system in EOM, such as the cardiac/slow isoforms sarcoplasmic Ca(2+)-ATPase 2 (Serca2) and calsequestrin 2 (Casq2). Interestingly EOM expressed monomeric rather than multimeric forms of phospholamban (Pln), which was phosphorylated at threonine 17 (Thr17) but not at the serine 16 (Ser16) residue. EOM Pln remained monomeric and unphosphorylated at Ser16 despite protein kinase A (PKA) treatment, suggesting differential signalling and modulation cascades involving Pln-mediated Ca(2+) regulation in EOM. Increased expression of Ca(2+)/SR mRNA, proteins, differential post-translational modification of Pln and superior Ca(2+) buffering is consistent with the improved ability of EOM to handle elevated intracellular Ca(2+) levels. These characteristics provide mechanistic insight for the potential role of superior Ca(2+) buffering in the unusual physiology of EOM and their sparing in DMD.

  2. The management of superior sulcus tumors

    Energy Technology Data Exchange (ETDEWEB)

    Komaki, Ritsuko; Cox, J.D.; Putnam, J.B. Jr [Texas Univ., Houston, TX (United States). Anderson Cancer Center] (and others)

    2001-09-01

    Superior sulcus tumors are a rare type of lung cancer arising in the apex of the lung above the sulcus and cause specific symptoms and signs depending on the location and whether the tumor extends into the surrounding structures. Because of the closeness of critical structures to the tumor (e.g., the subclavian artery for anterior lesions, the brachial plexus for lesions in the middle location, and the sympathetic stellate ganglion causing Horner's syndrome [Pancoast's tumor], the vertebral bodies, nerve foramen, and spinal cord for posterior lesions), superior sulcus tumors were often considered marginally respectable or unresectable. Therefore, for many years, preoperative radiation therapy was considered routine treatment for those tumors. However, with the evolution in our understanding of these tumors and modern imaging techniques such as computerized tomography (CT) and magnetic resonant imaging (MRI) and surgical techniques, there is now considerable debate about the roles and timing of surgical resection, radiation therapy, and chemotherapy in the treatment of patients with these tumors. If mediastinoscopy reveals microscopic mediastinal lymph node involvement, the patient can be treated with preoperative concurrent chemoradiotherapy followed by surgery. If there was a gross mediastinal lymph node involvement (N2) on CT, N3 or T4 lesions, the patient can be treated with concurrent chemoradiotherapy with a curative intent; the outcome of such treatment appears to be better than that of sequential chemotherapy followed by radiation therapy. Whenever possible, without compromising the patient's quality of life, surgery should be considered to improve outcome. (author)

  3. STEREO Superior Solar Conjunction Mission Phase

    Science.gov (United States)

    Ossing, Daniel A.; Wilson, Daniel; Balon, Kevin; Hunt, Jack; Dudley, Owen; Chiu, George; Coulter, Timothy; Reese, Angel; Cox, Matthew; Srinivasan, Dipak; hide

    2017-01-01

    With its long duration and high gain antenna (HGA) feed thermal constraint; the NASA Solar-TErestrial RElations Observatory (STEREO) solar conjunction mission phase is quite unique to deep space operations. Originally designed for a two year heliocentric orbit mission to primarily study coronal mass ejection propagation, after 8 years of continuous science data collection, the twin STEREO observatories entered the solar conjunction mission phase, for which they were not designed. Nine months before entering conjunction, an unforeseen thermal constraint threatened to stop daily communications and science data collection for 15months. With a 3.5 month long communication blackout from the superior solar conjunction, without ground commands, each observatory will reset every 3 days, resulting in 35 system resets at an Earth range of 2 AU. As the observatories will be conjoined for the first time in 8 years, a unique opportunity for calibrating the same instruments on identical spacecraft will occur. As each observatory has lost redundancy, and with only a limited fidelity hardware simulator, how can the new observatory configuration be adequately and safely tested on each spacecraft? Without ground commands, how would a 3-axis stabilized spacecraft safely manage the ever accumulating system momentum without using propellant for thrusters? Could science data still be collected for the duration of the solar conjunction mission phase? Would the observatories survive? In its second extended mission, operational resources were limited at best. This paper discusses the solutions to the STEREO superior solar conjunction operational challenges, science data impact, testing, mission operations, results, and lessons learned while implementing.

  4. Concepto de excelencia en enseñanza superior universitaria

    Directory of Open Access Journals (Sweden)

    Eduardo García-Jiménez

    2016-07-01

    Full Text Available La idea de excelencia es consustancial a la enseñanza superior universitaria. A pesar de la diversidad bajo la que se manifiesta, la excelencia está presente en las agendas de las universidades. Los propios cuestionamientos de la capacidad de las universidades para responder al reto de proporcionar una formación avanzada a millones de estudiantes en todo el mundo o para aportar valor añadido a la sociedad y la exigencia de que desarrollen sistemas internos de garantía de la calidad y se sometan a evaluaciones externas, no son sino evidencias de la que la excelencia debería formar parte del ADN de la enseñanza superior universitaria. El concepto de excelencia en la enseñanza es un constructo multidimensional que puede definirse en términos de proceso, producto y meta. En términos de proceso, la excelencia puede definirse a partir de elementos instruccionales vinculados a los métodos de enseñanza, a la evaluación y retroalimentación, a los recursos que hacen excelentes las experiencias de aprendizaje de los estudiantes o la integración de la enseñanza y la investigación. Pero, en la definición del concepto excelencia también intervienen otros elementos menos tangibles como el compromiso académico de estudiantes y profesores o el compromiso de los programas y cursos con la libertad académica y la igualdad. En términos de producto, la excelencia se define a través de indicadores de rendimiento, de satisfacción de los grupos de interés o de responsabilidad social. Pero, en todos los casos, la excelencia es la meta a partir de la que las instituciones universitarias realizan sus planes de futuro y su propia definición de enseñanza.

  5. DESAFÍOS DE LA EDUCACIÓN SUPERIOR EN LA ECONOMÍA DEL CONOCIMIENTO

    OpenAIRE

    Rodríguez-Ponce, Emilio; Palma-Quiroz,Álvaro

    2010-01-01

    En este trabajo se describen las características fundamentales de la sociedad del conocimiento y su impacto en la constitución de una nueva economía, denominada economía del conocimiento, en la cual el conocimiento es la fuente esencial de la ventaja competitiva de las naciones, las organizaciones y las personas. Así, en el contexto de una nueva economía, se propone una serie de desafíos estratégicos que emergen para las instituciones de educación superior. Dichos desafíos se asocian a la cre...

  6. Ventajas de la interdisciplinariedad en el aprendizaje: experiencias innovadoras en la educación superior

    OpenAIRE

    Blanco Sandía, María de los Ángeles; Corchuelo Martínez-Azua, Beatriz; Corrales Dios, Nuria; López Rey, María José

    2014-01-01

    Habiendo constatado que a los alumnos universitarios les cuesta integrar los conocimientos disciplinarios en el estudio de fenómenos económicos, se ha visto la necesidad de desarrollar, en su currículo formativo, aproximaciones interdisciplinarias. Para ello, un equipo de profesoras de la Universidad de Extremadura está realizando un proyecto financiado dentro del programa de consolidación del Espacio Europeo de Educación Superior. Se trata de una experiencia de innovación d...

  7. Radiografia intraoral e convencional da hemiarcada superior direita de gatos domésticos

    OpenAIRE

    2013-01-01

    A proposta com este trabalho foi avaliar a hemiarcada superior direita de gatos domésticos por meio de técnicas radiográficas odontológicas do paralelismo, empregando-se filmes intraorais aos posicionadores de Han Shin. As imagens obtidas por essa metodologia foram correlacionadas com as técnicas radiográficas convencionais (extraorais), com o intuito de se estabelecerem vantagens ou desvantagens para detectar possíveis afecções dentais e periodontais. Foram utilizados 30 gatos, sem raça defi...

  8. Ambrona (Soria : apuntes sobre la industria lítica del Complejo Superior

    Directory of Open Access Journals (Sweden)

    Susana Rubio Jara

    1996-01-01

    Full Text Available La finalidad de este trabajo, resumen de mi tesis de licenciatura, es caracterizar tecnomorfológicamente la industria lítica del Complejo Superior de Ambrona, de la que hasta el momento sólo se ha publicado el número total de piezas pese haber sido objeto de estudio entre los años 60 y 80.This paper, summary of my gradúate thesis, characterizes in a technomorphological frame, the lithic industry of «The Upper Complex» in Ambrona site. This industry although it was exposing between the sixties and eigthies, untll this moment it was unpublished.

  9. Sensibilidad paramétrica de modelos de circuitos equivalentes de orden superior de turbogeneradores

    OpenAIRE

    2010-01-01

    En este trabajo se presentan los resultados del análisis de sensibilidad paramétrica realizado a modelos de circuitos equivalentes de orden superior de un turbogenerador (150 MVA, 120 MW, 13.8 kV y 50 Hz). La representación del generador síncrono se hace en el espacio de estados, utilizando la teoría de dos ejes (d y q). El objetivo del estudio de sensibilidad es evaluar el impacto que tiene cada uno de los parámetros en la respuesta transitoria de los modelos analizados -circuitos equivalent...

  10. Sistemas ambientales de la cuenca superior del arroyo Langueyú (partido de Tandil, Argentina)

    OpenAIRE

    2008-01-01

    Estudios previos de zonificación ecológica de la cuenca superior del arroyo Langueyú (partido de Tandil) permitieron diferenciar y caracterizar seis sistemas ecológicos y definir unidades ecosistémicas de menor jerarquía escalar (componentes) en tres de ellos. El uso actual de las tierras del área está generalmente determinado por las potencialidades y restricciones ecológicas de los sistemas identificados. Estos usos diferenciales determinan a su vez distintos impactos en cada uno de los sis...

  11. de la enseñanza en el nivel medio superior

    Directory of Open Access Journals (Sweden)

    Leobano H. Mejía Serafín

    2008-01-01

    Full Text Available La práctica docente posee como elementos: un sujeto, un objetivo como materia de enseñanza, actividad y un significado. En este trabajo se establece la relación que existe entre la práctica docente y la calidad de la enseñanza en el marco del Curriculum de la Reforma del Bachillerato 2003 de la UAEM. Un elemento importante son las opiniones de alumnos, maestros y directivos que exponen la situación que prevalece en el Nivel Medio Superior.

  12. Empleo de historietas para reforzar el aprendizaje del nivel superior en UPIBI - IPN

    Directory of Open Access Journals (Sweden)

    Engelbert Eduardo Linares González

    2016-05-01

    Full Text Available Las estrategias de enseñanza-aprendizaje son instrumentos en los que se apoya el docente para mejorar el aprendizaje de los estudiantes. Las historietas pueden ser una herramienta pedagógica que favorezca el aprendizaje, ya que se basan en la narración de una historia a través de una sucesión de ilustraciones que se complementan con un texto. El objetivo de la historieta en el nivel superior es contextualizar el tema que se está estudiando en clase.

  13. Educación superior y transiciones políticas en México

    OpenAIRE

    Roberto Rodríguez Gómez

    2014-01-01

    Este ensayo reflexiona en torno a los efectos de las transiciones políticas mexicanas en la educación superior del país, en el periodo que se extiende de la década de los años ochenta al presente. El texto procede, en primer lugar, a delimitar algunos ejes analíticos relevantes al tema, en particular, los problemas abordados por la literatura académica en torno a los aspectos de la delimitación de facultades y atribuciones, competencia por recursos, control y coordinación sistémicas, en el ma...

  14. El aprendizaje significativo y los desafíos de la educación superior

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Restrepo R.

    2009-07-01

    Full Text Available La reflexión pedagógica a nivel de la educación superior ha estado muy limitada y concentrada en el análisis de los diseños curriculares. Sin embargo, la experiencia en el aula está aún poco estudiada. Esta investigación buscó caracterizar algunas estrategias de aprendizaje utilizadas por docentes de la Facultad de Administración de Empresas de la Universidad Externado. Cada una de las estrategias fue analizada desde el enfoque del aprendizaje significativo.

  15. Crioterapia e cinesioterapia no membro superior espástico no acidente vascular cerebral

    OpenAIRE

    Correia,Andreza de Cássia Souza; Silva,Jonathan Danilo Santos; Silva,Lícia Vasconcelos Carvalho da; Oliveira,Daniella Araujo de; Cabral,Etenildo Dantas

    2010-01-01

    INTRODUÇÃO: A espasticidade no paciente com sequela de Acidente Vascular Cerebral (AVC) acarreta limitações nas atividades de vida diária e torna-se um importante fator de risco para o desenvolvimento de deformidades estáticas quando não tratada. OBJETIVO: Avaliar o efeito da crioterapia associada à cinesioterapia no padrão postural flexor e no grau de espasticidade do membro superior de pacientes com AVC. METODOLOGIA: Participaram desta pesquisa sete voluntários que apresentavam espasticidad...

  16. Patentes en Instituciones de Educación Superior en México

    OpenAIRE

    Guadalupe Calderón-Martínez

    2014-01-01

    El objetivo de la presente investigación es analizar los elemen - tos que en México influyen en la producción de patentes en las Universidades e Instituciones de Educación Superior ( ies ). Las patentes académicas están recibiendo una atención creciente como vía de transferencia de conocimiento; a partir de la revisión de la literatura internacional sobre los principales factores que explican la producción de patentes, se ha construido una base de datos para 60 universidades mexicanas y se ha...

  17. El impacto del diseño de actividades en el plagio de Internet en educación superior

    OpenAIRE

    Gómez Espinosa, María; Francisco, Virginia; Moreno Ger, Pablo

    2016-01-01

    El objetivo de este trabajo es comprender mejor la naturaleza del plagio en la Educación Superior. Analizamos una serie de actividades en un curso on-line de nivel universitario, con el objetivo de encontrar qué tareas llevan más naturalmente al plagio. Este análisis concluye que las actividades que tienen una menor tasa de plagio son actividades que fomentan la participación, la originalidad y la creatividad. Posteriormente, reformulamos la tarea que presenta la mayor tasa de plagio...

  18. El impacto del diseño de actividades en el plagio de Internet en educación superior

    OpenAIRE

    2016-01-01

    El objetivo de este trabajo es comprender mejor la naturaleza del plagio en la Educación Superior. Analizamos una serie de actividades en un curso on-line de nivel universitario, con el objetivo de encontrar qué tareas llevan más naturalmente al plagio. Este análisis concluye que las actividades que tienen una menor tasa de plagio son actividades que fomentan la participación, la originalidad y la creatividad. Posteriormente, reformulamos la tarea que presenta la mayor tasa de plagio, teniend...

  19. El Espacio Europeo de Educación Superior: técnicas y herramientas colaborativas en el Derecho

    OpenAIRE

    Holgado Sáez, Christina; Ríos Corbacho, José Manuel

    2009-01-01

    La implantación del Espacio Europeo de Educación Superior está posibilitando la introducción de algunos cambios en los procesos de enseñanza-aprendizaje en las aulas universitarias. Este artículo tiene como principal objetivo contribuir con una propuesta docente, que cumpla con la adaptación europea en la materia de Derecho Penal: la técnica del puzzle como trabajo colaborativo a través de pequeños grupos en la enseñanza presencial y su virtualización en las webquests, como ...

  20. ¿Educación inclusiva en la Enseñanza Superior?: el caso del alumnado con discapacidad

    OpenAIRE

    Anabel Moriña Díez; Víctor Hugo Perera Rodríguez

    2015-01-01

    Este artículo presenta los resultados de una investigación (Barreras y ayudas que los estudiantes con discapacidad identifican en la Universidad, Ministerio de Ciencia e Innovación de España, ref. EDU 2010-16264) en curso que está siendo desarrollada en la Universidad de Sevilla. El propósito de ésta es analizar desde la perspectiva del alumnado con discapacidad cuáles son las barreras y ayudas que encuentran en la Enseñanza Superior (ES). Para realizar el estudio se ha hecho uso del método b...

  1. Análisis cinemático de un exoesqueleto para rehabilitación del miembro superior

    OpenAIRE

    De Lima Briceño, Helen Andreina

    2016-01-01

    Este trabajo de fin de maestría se basa en el análisis cinemático de un nuevo exoesqueleto para rehabilitación de miembro superior, desarrollado en Aura Innovative Robotics, ésta órtesis es ajustable a diferentes estaturas, presenta materiales ligeros y cuenta con 6 servomotores que proporcionan un sistema de 6 grados de libertad. Dentro de este proyecto, se evalúa el espacio de trabajo del exoesqueleto a partir del estudio de la manipulabilidad del mismo. Para ello, se ha realizado una i...

  2. Análisis cinemático de un exoesqueleto para rehabilitación del miembro superior

    OpenAIRE

    De Lima Briceño, Helen Andreina

    2017-01-01

    Este trabajo de fin de maestría se basa en el análisis cinemático de un nuevo exoesqueleto para rehabilitación de miembro superior, desarrollado en Aura Innovative Robotics, ésta órtesis es ajustable a diferentes estaturas, presenta materiales ligeros y cuenta con 6 servomotores que proporcionan un sistema de 6 grados de libertad. Dentro de este proyecto, se evalúa el espacio de trabajo del exoesqueleto a partir del estudio de la manipulabilidad del mismo. Para ello, se ha realizado una i...

  3. La reestructuración de la educación superior en Colombia 1991-1950

    OpenAIRE

    Gómez, Orlando Salinas

    2015-01-01

    RESUMENLa reestructuración de la Educación Superior en Colombia está inmersa en el proyecto cultural denominado modernidad que “conlleva el cambio en el concepto de realidad, el imaginar nuevos modelos sociales, la desacralización de la conciencia, la quiebra de todos los dogmatismos; la apertura, por lo tanto, al cambio continuo, el estímulo  hacia lo nuevo y la aceptación de la utopía como una dimensión de la realidad que dinamice la creación  de un hombre nuevo. 

  4. Análisis cinemático de un exoesqueleto para rehabilitación del miembro superior

    OpenAIRE

    De Lima Briceño, Helen Andreina

    2016-01-01

    Este trabajo de fin de maestría se basa en el análisis cinemático de un nuevo exoesqueleto para rehabilitación de miembro superior, desarrollado en Aura Innovative Robotics, ésta órtesis es ajustable a diferentes estaturas, presenta materiales ligeros y cuenta con 6 servomotores que proporcionan un sistema de 6 grados de libertad. Dentro de este proyecto, se evalúa el espacio de trabajo del exoesqueleto a partir del estudio de la manipulabilidad del mismo. Para ello, se ha realizado una i...

  5. La reestructuración de la educación superior en Colombia 1991-1950

    Directory of Open Access Journals (Sweden)

    Orlando Salinas Gómez

    1993-05-01

    Full Text Available RESUMEN La reestructuración de la Educación Superior en Colombia está inmersa en el proyecto cultural denominado modernidad que “conlleva el cambio en el concepto de realidad, el imaginar nuevos modelos sociales, la desacralización de la conciencia, la quiebra de todos los dogmatismos; la apertura, por lo tanto, al cambio continuo, el estímulo  hacia lo nuevo y la aceptación de la utopía como una dimensión de la realidad que dinamice la creación  de un hombre nuevo.

  6. 2001 Hydrologic Survey of Lake Estes

    Data.gov (United States)

    US Bureau of Reclamation, Department of the Interior — The Bureau of Reclamation (Reclamation) surveyed Lake Estes in August of 2001 to develop a topographic map and compute a present storage-elevation relationship...

  7. Distalizador de molares superiores con pistones de níquel–titanio. Informe de un caso

    Directory of Open Access Journals (Sweden)

    Rafael J. Prato

    2007-12-01

    Full Text Available Para distalizar los molares superiores en pacientes con maloclusiones clase II, se han utilizado diversos aparatos. Se ha visto que la mayoría de ellos tienden a rotar e inclinar las coronas de los primeros molares. En este trabajo se presenta un aparato fijo capaz de distalizar los molares con muy poca rotación e inclinación, que no requiere el uso de fuerzas extra-orales. La aplicación de fuerzas ligeras y constantes mediante pistones de níquel-titanio optimizan los movimientos y disminuyen el tiempo de tratamiento. Otra ventaja de este dispositivo reside en que por estar cementado no se necesita cooperación por parte del paciente.

  8. Complicaciones en la tracción ortodóntica del canino superior izquierdo. Retratamiento.

    OpenAIRE

    Castillo Cáceres, Milton; Especialista en Ortodoncia de la Universidad Peruana Cayetano Heredia

    2015-01-01

    La impactación o la erupción ectópica de un canino maxilar tienen etiología multifactorial. La erupción ectópica de caninos superiores puede estar asociada con la reabsorción de la raíz de los dientes adyacentes.Para obtener un buen tratamiento es imprescindible un correcto diagnóstico ya que de este modo se reducirían subsecuentes complicaciones. Este reporte describe y analiza un caso complejo de retratamiento de un paciente de 15 años de edad, con una Maloclusión Clase I, con canino superi...

  9. A caminho da estética

    Directory of Open Access Journals (Sweden)

    Amaral Filho, Fausto dos Santos

    2007-01-01

    Full Text Available O presente estudo tenta compreender, ainda que de maneira sumária, quais os caminhos que a Estética tomou; desde Hegel e a dedução filosófica dos conceitos, até a corrente, influenciada por Wittgenstein, da análise da liguagem comum, acabando por apontar, diante das dificuldades dos referidos caminhos, para a Estética da circularidade; tanto a de Heidegger quanto a de George Dickie

  10. La educación superior en América Latina: perspectivas frente al siglo XXI

    Directory of Open Access Journals (Sweden)

    Sonia Comboni Salinas

    1997-01-01

    Full Text Available Este artículo trata del papel que juega la educación superior en América Latina para favorecer el crecimiento económico y el desarrollo social para el siglo XXI. Para esto se requiere fortalecer la relación con el mundo productivo y una mayor contribución al desarrollo sustentable. La globalización desborda los límites de la economía y se atrinchera en la educación, campo de competencia entre los países agrupados en los diferentes bloques económicos existentes y los futuros. En este marco internacional la calidad de la educación superior es fundamental, por ello, las tareas de investigación constituyen un requisito previo de gran importancia social y de calidad académica y científica

  11. El espacio europeo de educación superior: visiones y realidades de un proceso deseable de convergencia

    OpenAIRE

    Ulrich Teichler

    2006-01-01

    Apoyando la afirmación de que la investigación sobre la educación superior debería buscar más bien explicaciones y hacerlo, además, con una actitud escéptica, el autor argumenta y documenta que, a principios del siglo XXI, la mayoría de europeos están convencidos de que la educación superior se ve mucho más fuertemente afectada que antes por el hecho de hallarse estrechamente incrustada en ambientes europeos y mundiales. En este orden de cosas, el panorama trazado de la situación actual de la...

  12. El mercado de créditos para la educación superior: pensar México desde Chile

    OpenAIRE

    Patricia Gascón Muro; José Luis Cepeda Dovola

    2008-01-01

    Este trabajo se presenta como respuesta a la invitación al diálogo que la Ministra de Educación Pública de México hizo a los críticos del modelo de créditos educativos para la educación superior. Para fundamentar nuestra crítica, en el presente artículo realizamos una evaluación del modelo de educación superior chileno que promovió el autofi-nanciamiento de las universidades públicas. Este modelo, que se originó en el régimen de Pinochet y que continúa vigente, aplica una política neoliberal ...

  13. ESAP plus: a web-based server for EST-SSR marker development.

    Science.gov (United States)

    Ponyared, Piyarat; Ponsawat, Jiradej; Tongsima, Sissades; Seresangtakul, Pusadee; Akkasaeng, Chutipong; Tantisuwichwong, Nathpapat

    2016-12-22

    Simple sequence repeats (SSRs) have become widely used as molecular markers in plant genetic studies due to their abundance, high allelic variation at each locus and simplicity to analyze using conventional PCR amplification. To study plants with unknown genome sequence, SSR markers from Expressed Sequence Tags (ESTs), which can be obtained from the plant mRNA (converted to cDNA), must be utilized. With the advent of high-throughput sequencing technology, huge EST sequence data have been generated and are now accessible from many public databases. However, SSR marker identification from a large in-house or public EST collection requires a computational pipeline that makes use of several standard bioinformatic tools to design high quality EST-SSR primers. Some of these computational tools are not users friendly and must be tightly integrated with reference genomic databases. A web-based bioinformatic pipeline, called EST Analysis Pipeline Plus (ESAP Plus), was constructed for assisting researchers to develop SSR markers from a large EST collection. ESAP Plus incorporates several bioinformatic scripts and some useful standard software tools necessary for the four main procedures of EST-SSR marker development, namely 1) pre-processing, 2) clustering and assembly, 3) SSR mining and 4) SSR primer design. The proposed pipeline also provides two alternative steps for reducing EST redundancy and identifying SSR loci. Using public sugarcane ESTs, ESAP Plus automatically executed the aforementioned computational pipeline via a simple web user interface, which was implemented using standard PHP, HTML, CSS and Java scripts. With ESAP Plus, users can upload raw EST data and choose various filtering options and parameters to analyze each of the four main procedures through this web interface. All input EST data and their predicted SSR results will be stored in the ESAP Plus MySQL database. Users will be notified via e-mail when the automatic process is completed and they can

  14. Aspectos actitudinales en el EEES (Espacio Europeo de Educación Superior

    Directory of Open Access Journals (Sweden)

    Eliseudo Salvino Gomes

    2009-12-01

    Full Text Available En este artículo, se intenta aproximar los objetivos del Espacio Europeo de Edu- cación Superior a uno de los objetivos de la logoterapia de Viktor Frankl, con el fin de definir o reflexionar acerca del «sentido de la vida» como propuesta para elaborar los planes de educación a partir de valores actitudinales. A nuestro parecer este tema se correlaciona fundamentalmente con la percepción de mundo y de la persona, constituyendo así una categoría clave en la com- prensión más adecuada con la idea de educación. En base a esto proporcionaremos reflexiones a la manera de diseñar los planes de mejora para los estudiantes, respetando los objetivos indi- viduales, grupales y el concepto legítimo de escuela como espacio favorable al desarrollo de competencias. En el plano lógico, este artículo intenta explicitar la discusión entre los valores actitudinales y los objetivos de «Bolonia». De esta manera los métodos pedagógicos deben tener en cuenta las opiniones de los alumnos en cualquier decisión sobre su educación. En fin, dese- amos con este artículo defender las propuestas del EEES a partir de las aportaciones teóricas de la logoterapia.

  15. Expansão, privatização e diferenciação da educação superior no Brasil pós - LDBEN/96: evidências e tendências Expansión, privatización y diferenciación de la educación de nivel superior en Brasil pos - LDBEN/96: evidencias y tendencias Expansion, privatizacion and differences in higher education in Brazil pos - LDBEN/96: evidences and tendencies

    Directory of Open Access Journals (Sweden)

    Stella Cecilia Duarte Segenreich

    2009-03-01

    Full Text Available A proposta do presente trabalho é, com base nos Censos da Educação Superior de 1996 a 2006, aprofundar questões relativas à privatização e à diferenciação do sistema brasileiro de educação superior, no contexto de sua expansão, explorando as categorias referentes a instituições, cursos e corpo discente. A análise assumiu como marco divisório o Plano Nacional de Educação de 2001, que vem servindo de parâmetro para as tendências de evolução do sistema. Verificou-se que as políticas públicas de expansão para este nível de ensino estão tendendo a enfatizar a diferenciação do sistema com ênfase na esfera pública, seja por meio de novos tipos de curso/instituições - cursos superiores de tecnologia nos Institutos Federais de Educação, Ciência e Tecnologia, - seja pela institucionalização da educação a distância pela Universidade Aberta do Brasil. O processo de privatização continua, menos acelerado, sob outras formas tais como a concessão de bolsas do MEC para o ProUni.La propuesta del presente trabajo es, con base en los Censos de la Educación Superior de 1996 a 2006, profundizar cuestiones relativas a la privatización y a la diferenciación del sistema brasileño de educación superior, en el contexto de su expansión. El análisis asumió como marco divisorio el Plan Nacional de Educación de 2001, que viene sirviendo de parámetro para las tendencias de evolución del sistema. Se identificó que las políticas públicas de expansión para este nivel de enseñanza han inclinado para resaltar la diferenciación del sistema con énfasis en la esfera pública, sea por medio de nuevos tipos de curso/instituciones - cursos superiores de tecnología en los Institutos Federales de Educación, Ciencia y Tecnología - sea por la institucionalización de la educación a distancia en las universidades federales - Universidade Aberta de Brasil. El proceso de privatización sigue, menos acelerado y bajo otras formas

  16. La inclusión en la educación superior: desde la voz de estudiantes chilenos con discapacidad

    OpenAIRE

    Salinas Alarcón, Marcela; Lissi, María-Rosa; Medrano Polizzi, Daniela; Zuzulich Pavez, María-Soledad; Hojas Loret, Ana-María

    2013-01-01

    En este artículo se presentan los resultados de un estudio sobre las experiencias en la educación superior de los estudiantes con discapacidad y las principales condiciones que facilitan u obstaculizan el proceso de inclusión. La metodología utilizada fue cualitativa, basada en los principios de la teoría fundamentada. Los participantes entrevistados fueron catorce estudiantes con discapacidad, pertenecientes a dos universidades chilenas. Entre los resultados destacan influencias sociales sig...

  17. Economics derived from detailed and definitive design of Superior's Circlar Grate Retort for an 18,000 BPD oil shale demonstration plant

    Energy Technology Data Exchange (ETDEWEB)

    Lilley, D.F.; Fishback, J.W.

    1983-04-01

    Superior Oil Company has continued efforts to reduce to practice the Superior retorting technology as applied to oil shale. From February 1981 to October 1982, Superior has participated in a cost sharing agreement with the Department of Energy for detailed design of the Superior Circular Grate Retort, definitive design of retort ancillaries, auxiliaries and offsites, and mining, and for capital and operating cost estimates for a nominal 18,000 BPD oil shale plant. The terms, detailed design and definitive design, are defined. The design documents are described in sufficient detail to render an overview to the reader of the basis used for project cost estimates and economic analysis.

  18. Lake Superior Coastal Wetland Fish Assemblages and ...

    Science.gov (United States)

    The role of the coastal margin and the watershed context in defining the ecology of even very large lakes is increasingly being recognized and examined. Coastal wetlands are both important contributors to the biodiversity and productivity of large lakes and important mediators of the lake-basin connection. We explored wetland-watershed connections and their relationship to wetland function and condition using data collected from 37 Lake Superior wetlands spanning a substantial geographic and geomorphic gradient. While none of these wetlands are particularly disturbed, there were nevertheless clear relationships between watershed landuse and wetland habitat and biota, and these varied consistently across wetland type categories that reflected the strength of connection to the watershed. For example, water clarity and vegetation structure complexity declined with decreasing percent natural land cover, and these effects were strongest in riverine wetlands (having generally large watersheds and tributary-dominated hydrology) and weakest in lagoon wetlands (having generally small watersheds and lake-dominate hydrology). Fish abundance and species richness both increased with decreasing percent natural land cover while species diversity decreased, and again the effect was strongest in riverine wetlands. Lagoonal wetlands, which lack any substantial tributary, consistently harbored the fewest species of fish and a composition different from the more watershed-lin

  19. La desigualdad social en el nivel medio superior de educación de la Ciudad de México

    Directory of Open Access Journals (Sweden)

    Emilio BLANCO

    2014-01-01

    Full Text Available El acceso y la finalización del nivel medio superior de educación son dos eventos educativos cruciales y relativamente poco estudiados en México. Mediante los resultados de una encuesta retrospectiva realizada a jóvenes entre 18 y 29 años de la Ciudad de México en 2010, este artículo analiza detalladamente estos eventos y sus condicionantes. Los resultados muestran que la transición del nivel secundario al medio superior todavía está lejos de ser universal, que los jóvenes de sectores sociales bajos tienen mucha menor probabilidad de experimentarla y que la razón principal sería que los propios estudiantes deciden no intentarlo. Asimismo, un análisis de regresión logística sobre la probabilidad de finalizar el nivel medio superior reveló que otros factores tienen una incidencia significativa, además del origen social. Entre ellos destacan el tipo de escuela de educación media superior, el haber trabajado en algún momento antes de los 19 años y el haber tenido un hijo en algún momento antes de los 20 años de edad.

  20. Políticas educativas, educación superior y proceso de Bolonia en Latinoamérica

    Directory of Open Access Journals (Sweden)

    César Geronimo Tello

    2015-10-01

    Full Text Available En Latinoamérica el proceso de Bolonia se presenta como una provocación para pensar y reflexionar sobre la necesidad de consolidación del espacio de Educación Superior en nuestra región. Del mismo modo, este proceso europeo fue asumiendo un rol director en la globalización neoliberal en la Educación Superior de nuestros contextos académicos. Por lo tanto en este artículo argumentamos que la Educación Superior Europea en el marco del proceso de Bolonia ha sido considerada un gran éxito para aquellas latitudes, sin embargo, del mismo modo que algunos investigadores y profesores europeos nosotros lo conceptualizamos como el proceso de estandarización y homogenización de la potencialidad del conocimiento. A diferencia de Bolonia, pensamos en un proceso de integración de la Educación Superior como un proceso de intercambio desde la solidaridad académica

  1. Turismo y estética formativa

    Directory of Open Access Journals (Sweden)

    Clara Inés Sánchez Arciniegas

    2002-11-01

    Full Text Available ¿Existe alguna armonía entre el conocimiento y la estética? Sin duda alguna el hombre con conocimiento y sin virtud de la estética es un autómata; este necesita de las diferentes manifestaciones en las que se encuentra plasmada y necesita recordarlas continuamente. La estética como doctrina de conocimiento no es reciente, en el siglo xviii cuando por primera vez se define teóricamente hasta nuestros días en la Universidad actual. Esta última aparentemente menos evidente debido a las nuevas formas de aprendizaje con herramientas tecnológicas muy avanzadas y contraria a la imagen del universitario que hace dos siglos como complemento a su educación se distraía a través del Gran Tour, partida que tiene el turismo para fomentar el goce estético. ¿Cuál es entonces la relación entre distracción y formación? Se debe entonces reflexionar y comprender que el conocimiento interdisciplinario y la metodología debe procurar en los hombres actitudes adecuadas frente a la cultura y el arte a través del conocimiento.

  2. El examen de seis músculos individuales: Puede representar un enfoque diagnóstico de trastornos neuropáticos de los miembros superiores?

    OpenAIRE

    Jørgen Riis Jepsen; Jose Hernán Alfonso

    2014-01-01

    Antecedentes: Se ha demostrado anteriormente que un examen neurológico exhaustivo de la función muscular individual de los miembros superiores, de la sensación en zonas inervadas homónimas y la alodinia en nervios y tronco es confiable y el resultado refleja los síntomas. Debido a que este enfoque puede parecer complicado y que requiere mucho tiempo, este estudio se ocupa de la validez de un examen que se limita al chequeo manual de sólo seis músculos. Métodos: Dos examinadores cegados al est...

  3. El valor agregado de la educación superior en la formación en segunda lengua en Colombia

    OpenAIRE

    2016-01-01

    En este documento se presenta un modelo para medir el valor agregado de la educación superior en Colombia, discriminado por áreas de conocimiento de los programas académicos. Este es utilizado para evaluar la calidad del sistema educativo en este nivel, específicamente en la competencia del idioma inglés; teniendo como marco normativo el Programa Nacional de Bilingüismo 2004-2019 y el Marco Común Europeo de Referencia. Para llevar a cabo esta medición se emplea una estimación de un modelo lin...

  4. La estética cibercultural

    OpenAIRE

    Fajardo-Fajardo, Carlos

    2003-01-01

    El autor explica cómo el objeto tecno-virtual reina y se convierte en la mayor ilusión y utopía en el mundo contemporáneo, comprometiendo al sueño estético a ser un registro de olvido. Las representaciones del sujeto-artista y su dominio de lo real por parte del arte, pasan a un segundo plano. El objeto toma la delantera, aunque no sea un objeto lleno de ilusión estética, pues está despojado de toda metaforización poética; es un “objeto puro”, sin mediación del lenguaje simbólico, desim...

  5. Importancia de aprender a ser ciudadano: un reto para la formación de la educación superior en Colombia

    Directory of Open Access Journals (Sweden)

    Sandra Milena Rojas Padilla

    2015-10-01

    Full Text Available El objetivo de este artículo pretende evidenciar la importancia de la enseñanza de competencias ciudadanas en la educación superior, que está tomada de manera tangencial tanto por el Estado Colombiano como por las Instituciones de Educación Superior (IES aunque existe un mandato constitucional y legal que lo dispone. Partiendo del hecho de que no hay estándares básicos de competencias ciudadanas para la Educación Superior pero a pesar de ello éstas serán evaluadas por el ICFES en las pruebas Saber Profesional (Saber Pro. Una democracia se hace con ciudadanos, y para formar ciudadanos, es una responsabilidad de la familia, la sociedad y el Estado, para que pueda conocer tanto sus derechos como sus deberes, al formar parte de un Estado social de derecho con democracia participativa, resolver los conflictos de manera pacífica y tomar decisiones conscientes y responsables en el ejercicio y fortalecimiento de la democracia participativa; y es por ello, que las IES se convierten en eje fundamental para el cambio cultural. Para este propósito se realizó una revisión de lo que se ha escrito sobre competencias ciudadanas para la educación superior, en libros y en especial en bases de datos tales como ProQuest, EBSCO Academic Search Complete y Dialnet Plus, entre otras.

  6. PANORAMA DOS PROGRAMAS DE BOLSAS DE EXTENSÃO EXISTENTES NAS INSTITUIÇÕES DE ENSINO SUPERIOR PÚBLICAS BRASILEIRAS

    Directory of Open Access Journals (Sweden)

    Ana Inês Souza

    2003-12-01

    Full Text Available O presente trabalho teve como objetivos traçar um panorama dos programas de bolsas de extensão existentes nas Instituições de Ensino Superior (IES Públicas Brasileiras, no ano de 2001, e identificar como as Universidades Públicas estão financiando suas atividades de extensão.

  7. La mercantilización de la educación como escenario mundial del espacio Europeo de educación superior

    Directory of Open Access Journals (Sweden)

    Florentino Sanz Fernández

    2006-01-01

    Full Text Available En la actualidad, las políticas sociales y de servicios públicos están sometidas a fuertes presiones. La universidad, por su parte, se orienta cada vez más hacia el modelo de mercado. Todos los países están sometidos a grandes presiones para poder satisfacer la demanda de conocimiento superior que necesitan los sistemas productivos. Los centros de formación superior son cada día más conscientes de que se están dirigiendo a consumidores que pueden elegir los mejores cursos existentes en el mercado. En Europa, el Espacio Europeo de Educación Superior también se orienta en este sentido y esto se ve en la documentación que aparece sobre enseñanza superior. Sin embargo, las universidades deben enseñar también a pensar y por qué no a imaginar, a sentir y a soñar, porque aunque estas capacidades no se necesiten para producir, se necesitan para vivir con dignidad.

  8. Límites de la educación superior basada en competencias

    Directory of Open Access Journals (Sweden)

    Carlos Diego Martínez Cinca

    2011-01-01

    Full Text Available La Educación Basada en Competencias (EBC constituye un nuevo enfoque de la educación superior que ha gozado de gran predicamento en Europa desde su aprobación en el "Proceso de Bolonia". Sin embargo, la EBC arrastra una serie de dificultades importantes que en este trabajo se ponen de manifiesto. Su sentido técnico-utilititarista constituye un obstáculo para el desarrollo del pensamiento crítico-moral, dada la reducción virtual de toda razón práctica a razón instrumental. Pero, además, las objeciones contra la enseñanza universitaria tradicional basada en contenidos teóricos se apoyan, en el caso de algunos proponentes de la EBC, en argumentaciones sofísticas que se analizan en la segunda parte de este trabajo. Por último, la recuperación de algunas destrezas y habilidades olvidadas de la ética aristotélica señala la necesidad del conocimiento teórico en el desarrollo del espíritu emprendedor e innovador que debería alentar la educación superior.

  9. Analisis situacional de la Educación Superior en Colombia

    Directory of Open Access Journals (Sweden)

    Láster Alfonso Gutiérrez Cuadro

    2009-07-01

    Full Text Available Resumen:El análisis que se presenta en este trabajo tiene como propósito, proporcionar a los lectores la realidad de la EducaciónSuperior en Colombia; a para partir de esas realidades se puede emprender un estudio sobre las fortalezasy debilidades de las organizaciones o instituciones de educación superior, de tal manera que permita identificar lasamenazas y oportunidades que están presentes en el mercado, y que a partir de la observación y análisis de ellas,se presente procesos innovadores y de creación para ofrecer nuevas propuestas de formación con flexibilidad,subsidiaridad y un alto grado de desarrollo de competencias y habilidades propias de un mercado laboral cada díamás exigente y competitivo.Palabras Claves:Amenazas, Oportunidades, Flexibilidad Curricular, Subsidiaridad.Abstract:The analysis presented in this job provided readers the real state of higher education in Colombia using these statescan undertake a study on the strengths and weaknesses of the organizations or institutions of higher education inorder to identify the threats and opportunities that are present in the market, and from the observation and analysisof them, this innovative and creative processes offer a new training proposals with flexibility, and a high degreedevelopment of skills and abilities for an increasingly demanding and competitive labor market.Key Words:Desertion, strengths, weaknesses, threats, opportunities, academic offerings, environmental realities.

  10. Absent right superior caval vein in situs solitus

    DEFF Research Database (Denmark)

    Lytzen, Rebekka; Sundberg, Karin; Vejlstrup, Niels

    2015-01-01

    no postnatal complications. All children were found to have healthy hearts at follow-up. CONCLUSIONS: In all cases, the findings proved to be a benign condition with no clinical manifestations or complications. Although isolated absent right superior caval vein does not seem to affect the outcome, associated......Introduction In up to 0.07% of the general population, the right anterior cardinal vein obliterates and the left remains open, creating an absent right superior caval vein and a persistent left superior caval vein. Absent right superior caval vein is associated with additional congenital heart...... disease in about half the patients. We wished to study the consequences of absent right superior caval vein as an incidental finding on prenatal ultrasonic malformation screening. Material and methods This is a retrospective case series study of all foetuses diagnosed with absent right superior caval vein...

  11. The Business Value of Superior Energy Performance

    Energy Technology Data Exchange (ETDEWEB)

    McKane, Aimee; Scheihing, Paul; Evans, Tracy; Glatt, Sandy; Meffert, William

    2015-08-04

    Industrial facilities participating in the U.S. Department of Energy’s (US DOE) Superior Energy Performance (SEP) program are finding that it provides them with significant business value. This value starts with the implementation of ISO 50001-Energy management system standard, which provides an internationally-relevant framework for integration of energy management into an organization’s business processes. The resulting structure emphasizes effective use of available data and supports continual improvement of energy performance. International relevance is particularly important for companies with a global presence or trading interests, providing them with access to supporting ISO standards and a growing body of certified companies representing the collective knowledge of communities of practice. This paper examines the business value of SEP, a voluntary program that builds on ISO 50001, inviting industry to demonstrate an even greater commitment through third-party verification of energy performance improvement to a specified level of achievement. Information from 28 facilities that have already achieved SEP certification will illustrate key findings concerning both the value and the challenges from SEP/ISO 50001 implementation. These include the facilities’ experience with implementation, internal and external value of third-party verification of energy performance improvement; attractive payback periods and the importance of SEP tools and guidance. US DOE is working to bring the program to scale, including the Enterprise-Wide Accelerator (SEP for multiple facilities in a company), the Ratepayer-Funded Program Accelerator (supporting tools for utilities and program administrators to include SEP in their program offerings), and expansion of the program to other sectors and industry supply chains.

  12. Bioinformatics of the sugarcane EST project

    Directory of Open Access Journals (Sweden)

    Telles Guilherme P.

    2001-01-01

    Full Text Available The Sugarcane EST project (SUCEST produced 291,904 expressed sequence tags (ESTs in a consortium that involved 74 sequencing and data mining laboratories. We created a web site for this project that served as a ?meeting point? for receiving, processing, analyzing, and providing services to help explore the sequence data. In this paper we describe the information pathway that we implemented to support this project and a brief explanation of the clustering procedure, which resulted in 43,141 clusters.

  13. Formação de classes funcionais de estímulos musicais

    Directory of Open Access Journals (Sweden)

    Alex Roberto Machado

    2009-04-01

    Full Text Available O objetivo deste experimento foi verificar o efeito do treino discriminativo sobre a formação de classes funcionais de melodias em andamentos e modos diferentes. Nove estudantes universitários do 2° período da graduação em Psicologia foram divididos em três grupos: Modo, Andamento ou Misto. O software SomPsi, produzido especialmente para este estudo, treinou os participantes e gerou relatórios com informações sobre os desempenhos, nas quatro fases do procedimento. O treino proposto mostrou-se eficiente para a formação das classes funcionais de estímulos sonoros musicais. Observou-se que agrupamentos de estímulos pela propriedade andamento foram mais facilmente discriminados que os agrupados pela melodia. A manipulação combinada das duas propriedades, em condição convergente, permitiu desempenho superior dos participantes. A rápida formação de classes funcionais e equivalentes de estímulos musicais, a partir de procedimentos de ensino automatizado de relações condicionais entre estímulos musicais, indica a possibilidade de uso desse procedimento na iniciação à música.

  14. Autologous chondrocyte implantation: superior biologic properties of hyaline cartilage repairs.

    Science.gov (United States)

    Henderson, Ian; Lavigne, Patrick; Valenzuela, Herminio; Oakes, Barry

    2007-02-01

    Information regarding the quality of autologous chondrocyte implantation repair is needed to determine whether the current autologous chondrocyte implantation surgical technology and the subsequent biologic repair processes are capable of reliably forming durable hyaline or hyaline-like cartilage in vivo. We report and analyze the properties and qualities of autologous chondrocyte implantation repairs. We evaluated 66 autologous chondrocyte implantation repairs in 57 patients, 55 of whom had histology, indentometry, and International Cartilage Repair Society repair scoring at reoperation for mechanical symptoms or pain. International Knee Documentation Committee scores were used to address clinical outcome. Maximum stiffness, normalized stiffness, and International Cartilage Repair Society repair scoring were higher for hyaline articular cartilage repairs compared with fibrocartilage, with no difference in clinical outcome. Reoperations revealed 32 macroscopically abnormal repairs (Group B) and 23 knees with normal-looking repairs in which symptoms leading to arthroscopy were accounted for by other joint disorders (Group A). In Group A, 65% of repairs were either hyaline or hyaline-like cartilage compared with 28% in Group B. Autologous chondrocyte repairs composed of fibrocartilage showed more morphologic abnormalities and became symptomatic earlier than hyaline or hyaline-like cartilage repairs. The hyaline articular cartilage repairs had biomechanical properties comparable to surrounding cartilage and superior to those associated with fibrocartilage repairs.

  15. Coronary artery bypass and superior vena cava syndrome.

    OpenAIRE

    Thomas, T V; Masrani, K; Thomas, J.L.

    1999-01-01

    Superior vena cava syndrome is the obstruction of the superior vena cava or its main tributaries by benign or malignant lesions. The syndrome causes edema and engorgement of the vessels on the face, neck, and arms, nonproductive cough, and dyspnea. We discuss the case of a 48-year-old obese diabetic woman who was admitted with unstable angina. She had previously been diagnosed with superior vena cava syndrome. Urgent coronary artery bypass grafting was necessary Although thousands of coronary...

  16. Superiorization of incremental optimization algorithms for statistical tomographic image reconstruction

    Science.gov (United States)

    Helou, E. S.; Zibetti, M. V. W.; Miqueles, E. X.

    2017-04-01

    We propose the superiorization of incremental algorithms for tomographic image reconstruction. The resulting methods follow a better path in its way to finding the optimal solution for the maximum likelihood problem in the sense that they are closer to the Pareto optimal curve than the non-superiorized techniques. A new scaled gradient iteration is proposed and three superiorization schemes are evaluated. Theoretical analysis of the methods as well as computational experiments with both synthetic and real data are provided.

  17. 77 FR 48856 - Safety Zone; Superior Bay, Duluth, MN

    Science.gov (United States)

    2012-08-15

    ... spectators during the Superior Man Triathlon. DATES: This rule is effective from 6 a.m. to 8:30 a.m. on... Triathlon, which are discussed further below. Under 5 U.S.C. 553(d)(3), the Coast Guard finds that good... inaugural Superior Man Triathlon will occur along the Bay of Lake Superior. The 1.2 mile swim leg of...

  18. Diversificación institucional y educación superior en Baja California en 2000

    Directory of Open Access Journals (Sweden)

    Patricia Moctezuma Hernández

    2005-01-01

    Full Text Available Este artículo aborda la diversificación del Sistema Estatal de Educación Superior (sees de Baja California, según la especialización económica regional existente y el proceso histórico de su conformación. El estudio concluye que la percepción de los usuarios sobre la educación superior es obra más bien de los esfuerzos individuales de las instituciones, que de la coordinación estatal, debido a que la opinión de los distintos actores sobre la definición de la política gubernamental es limitada. Para llegar a esta conclusión, se efectuó una evaluación del sees mediante una encuesta a estudiantes, y entrevistas a rectores y directores de las diferentes instituciones de educación superior (ies, de la entidad, durante el primer trimestre de 2000. Los criterios utilizados fueron la equidad y calidad.

  19. ANTECEDENTES INTERNACIONALES Y NACIONALES DE LAS TIC A NIVEL SUPERIOR: SU TRAYECTORIA EN PANAMÁ

    Directory of Open Access Journals (Sweden)

    Olda María Cano Lassonde

    2012-01-01

    Full Text Available El presente documento recoge los aportes de una investigación titulada: "Modelo de Aprendizaje en Entornos Virtuales en la Educación Superior" que se está desarrollando para el Doctorado en Investigación con énfasis en las Ciencias Sociales en la Universidad Autónoma de Chiriquí (UNACHI, David, Chiriquí, República de Panamá, cuyo Programa Doctoral se realiza de acuerdo con el convenio firmado entre UNACHI y la Universidad del Mar, Chile. Se destacan las gestiones más sobresalientes y las acciones dirigidas hacia la implementación de las TIC para mejorar la calidad de la educación a nivel superior. Se describen los cambios generados por las nuevas Tecnologías de la Información y de la Comunicación en el sistema educativo a nivel mundial, vaticinando la transformación del proceso de enseñanza-aprendizaje, y la forma en que docentes y alumnos acceden al conocimiento y la información. Finalmente, se puntualiza el esfuerzo que realiza el Estado Panameño en la introducción de las TIC a nivel superior con una descripción de la trayectoria de la educación virtual en diferentes instituciones a nivel nacional.

  20. Determinantes de la demanda por educación superior en Colombia.

    Directory of Open Access Journals (Sweden)

    Sebastian Acevedo

    2010-05-01

    Full Text Available Este artículo estudia los factores que en Colombia determinan la decisión de las personas de ingresar a la educación superior. Se utiliza información del Ministerio de Educación Nacional, del Instituto Colombiano de Crédito Educativo y Estudios Técnicos en el Exterior (Icetex y de la Encuesta Continua de Hogares (ECH para estimar un modelo de datos de panel al nivel de cada institución de educación superior (IES, para las 13 principales ´áreas metropolitanas, en el período 2000-2006. Los principales resultados del estudio sugieren que la oferta educativa tiene una gran influencia sobre las tasas de matrícula en las IES, particularmente en el sector publico. A su vez, la dinámica del empleo, especialmente el de las personas con educación secundaria, desempeña un papel significativo en las decisiones de los individuos para ingresar a los estudios superiores y en la escogencia del nivel educativo.

  1. EFEITOS DA BUROCRACIA NA AVALIAÇÃO DA EDUCAÇÃO SUPERIOR

    Directory of Open Access Journals (Sweden)

    Glades Tereza Félix

    2014-01-01

    Full Text Available Este artigo situa-se na fronteira do debate geral das políticas de educação superior. Tais políticas estão vinculadas às estratégias de inserção da economia nas grandes transformações em âmbito mundial. Nesse contexto, são instaurados processos de avaliação da educação superior que contribuem para a redefinição da relação entre o Estado e o sistema de ensino superior. É nessa perspectiva que se situa o objeto deste estudo – identificar o modelo de gestão pública que conduziu a incorporação formal e definitiva da avaliação como ato regulatório e compulsório no primeiro Governo FHC (1995-2002. De caráter descritivo, com uma abordagem qualitativa, na revisão de literatura destacamos as características do Estado Burocrático e do Estado Gerencial. Igualmente, estudamos o conceito e o significado de eficiência no plano administrativo de ambos os Estados. Os resultados mostraram que o modelo de gestão pública estava em transição, quando a política pública denominada avaliação da educação superior tornou-se regulatória, definitiva e compulsória no país, pois mesmo tendo a base no modelo Gerencial, tal concretização só foi possível por meio de ações burocráticas ancoradas no excesso de legislações. Conclui-se que a emergência da avaliação da educação superior na década de 90 ampliou a burocracia.

  2. Superior Mesenteric Artery Syndrome: An Infrequent Complication of Scoliosis Surgery

    Directory of Open Access Journals (Sweden)

    Metin Keskin

    2014-01-01

    Full Text Available Superior mesenteric artery syndrome is a rare condition that causes a proximal small intestinal obstruction due to contraction of the angle between the superior mesenteric artery and the aorta. Scoliosis surgery is one of the 15 reasons for superior mesenteric artery syndrome, which can present with acute or chronic manifestations. Although conservative treatment is usually possible, surgical treatment is required in certain cases that cannot be treated using conservative methods. In this paper, we describe a patient who developed superior mesenteric artery syndrome after scoliosis surgery and was treated with duodenojejunostomy due to failure and complications of conservative treatment.

  3. Superior Vena Cava Thrombosis in a Case of Lung Adenocarcinoma

    Directory of Open Access Journals (Sweden)

    Santanu Ghosh

    2013-01-01

    Full Text Available Superior vena cava syndrome is a common presentation of bronchogenic carcinoma. The mechanism of obstruction is by compression of superior vena cava by the bronchogenic tumor itself or enlarged mediastinal lymph nodes. However obstruction due to intravascular thrombosis is extremely uncommon. Here, we report a rare case of a 65-year-old male smoker who presented with superior vena cava syndrome and bilateral pleural and pericardial effusion with thrombotic occlusion of the superior vena cava in adenocarcinoma of the lung. He was given chemotherapy with carboplatin and gemcitabine with anticoagulant therapy.

  4. Relatório de Estágio Curricular - Banco Espírito Santo (Guimarães)

    OpenAIRE

    Baptista, Bruna

    2012-01-01

    De acordo com o programa curricular do curso de Gestão da Escola Superior de Tecnologia e Gestão do Instituto Politécnico da Guarda, os alunos têm de realizar um estágio curricular ao qual está associada a elaboração de um relatório. Este é o fruto do meu estágio efetuado no Banco Espírito Santo, no balcão de Guimarães Sul, decorrido entre 16 de Agosto e 11 de Novembro de 2011. O presente relatório tem por finalidade dar a conhecer a instituição bancária, o local e as atividades desenvolvi...

  5. El Trípode en la distalización unilateral de molares superiores: Cambios oclusales The tripod in the unilateral distalization of superior molars: Occlusal changes

    Directory of Open Access Journals (Sweden)

    Ania Moreno Véliz

    2008-06-01

    Full Text Available OBJETIVO: aumentar los conocimientos en los tratamientos distalizadores, se realizó este estudio con una técnica distalizadora novedosa: el Trípode. MÉTODOS: el estudio incluyó 6 pacientes con clase II de Angle por mesogresión de los molares superiores y con ausencia clínica del segundo molar superior. Se evaluaron las modificaciones a nivel dental producidas por el trípode. RESULTADOS: los primeros molares superiores se distalizaron (3.36 mm, además, el molar sufrió una inclinación distal; las segundas bicúspides siguieron al molar en su movimiento distal, mientras que, la primera bicúspide del lado de la distalización se mesializó; los incisivos resultaron vestibularizados y la anchura transversal, medida a nivel de los primeros molares y primeras bicúspides, disminuyó, mientras que, en las segundas bicúspides aumentó. CONCLUSIONES: los cambios producidos con esta aparatología a nivel dental han sido: distalización de los primeros molares superiores (3.36 mm, además, el molar sufrió una inclinación distal; las segundas bicúspides siguieron al primer molar en su movimiento distal, mientras que, la primera bicúspide del lado de la distalización se mesializó; los incisivos resultaron vestibularizados; la anchura transversal medida a nivel de los primeros molares y primeras bicúspides disminuyó, mientras que, en las segundas bicúspides aumentóOBJECTIVE: to enhance the knowledge of the distalizing treatments, a study was conducted with a distalizing novel technique: the tripod. METHODS: the study included 6 patients with Angle class II due to mesogression of the superior molars and with clinical absence of the second superior molar. The modifications produced by the tripod at the dental level were evaluated. RESULTS: The first superior molars were distalized (3.36 mm. The molar also suffered a distal inclination, the second bicuspids followed the molar in its distal movement, whereas the first bicuspid of the side of

  6. An EST database from saffron stigmas

    Directory of Open Access Journals (Sweden)

    Chiusano Maria Luisa

    2007-10-01

    Full Text Available Abstract Background Saffron (Crocus sativus L., Iridaceae flowers have been used as a spice and medicinal plant ever since the Greek-Minoan civilization. The edible part – the stigmas – are commonly considered the most expensive spice in the world and are the site of a peculiar secondary metabolism, responsible for the characteristic color and flavor of saffron. Results We produced 6,603 high quality Expressed Sequence Tags (ESTs from a saffron stigma cDNA library. This collection is accessible and searchable through the Saffron Genes database http://www.saffrongenes.org. The ESTs have been grouped into 1,893 Clusters, each corresponding to a different expressed gene, and annotated. The complete set of raw EST sequences, as well as of their electopherograms, are maintained in the database, allowing users to investigate sequence qualities and EST structural features (vector contamination, repeat regions. The saffron stigma transcriptome contains a series of interesting sequences (putative sex determination genes, lipid and carotenoid metabolism enzymes, transcription factors. Conclusion The Saffron Genes database represents the first reference collection for the genomics of Iridaceae, for the molecular biology of stigma biogenesis, as well as for the metabolic pathways underlying saffron secondary metabolism.

  7. [Catheter in the superior vena cava for hemodialysis as a last resort in superior hemithorax].

    Science.gov (United States)

    Restrepo Valencia, C A; Buritica Barragán, C M; Arango, A

    2010-01-01

    We report four patients with chronic kidney disease undergoing haemodialysis therapy, which had exhausted conventional venous access (internal jugular, subclavian) and non-conventional access (axillary, innominate) in the upper hemithorax for haemodialysis. This was primarily due to thrombosis of these veins caused by previous catheterisation. These patients did not qualify for peritoneal dialysis. Using the technique recommended by Archundia et al., 4 indwelling catheters were implanted directly in the superior vena cava in each of the patients with subsequent subcutaneous tunneling. The catheters operated correctly and are currently permeable after being used for an average of 19 months.

  8. La variabilidad tecnológica del Paleolítico superior final en el sur de Cataluña: la cueva de la Mallada (Perelló, Tarragona y el abrigo de l’Areny (Vilanova d’Escornalbou, Tarragona

    Directory of Open Access Journals (Sweden)

    García Catalán, Sergio

    2015-06-01

    Full Text Available We present the first technological study of the lithic assemblages from the cave of La Mallada (Perelló, Tarragona and the rockshelter of Areny (Vilanova d’Escornalbou, Tarragona, both belonging to the final Upper Palaeolithic. After defining their differences and similarities, we compared them to other sites of the same time period in southern Catalonia. Our results document the variability of core reduction strategies during the final Upper Palaeolithic.En este artículo se presenta el primer estudio tecnológico de los conjuntos líticos de la cueva de la Mallada (Perelló, Tarragona y el abrigo de l’Areny (Vilanova d’Escornalbou, Tarragona, ambos incluidos en el Paleolítico superior final. Tras definir sus similitudes y diferencias, se han comparado con otros yacimientos con dataciones localizados principalmente en el sur de Cataluña e incluidos en este periodo cronológico. Los resultados ponen de manifiesto la variabilidad de las estrategias de explotación de núcleos al final del Paleolítico Superior.

  9. El estudio de la educación superior privada en México: un tema pendiente

    Directory of Open Access Journals (Sweden)

    angélica buendía espinosa

    2009-01-01

    Full Text Available En México, el estudio de la Educación Superior Privada (esp no ha ocupado un lugar preponderante en las agendas de investigación, a pesar de la relevancia que las instituciones particulares han recobrado, tanto por la expansión en el número de matrícula estudiantil atendida, a partir de la décadade los ochenta, como por el debate en torno a la comercialización de la educación superior. Este trabajo presenta un resumen de las líneas de investigación sobre el sector privado de la educación superior en México, así como sus principales exponentes. Concluye que el abordaje de la esp a nivel internacional, y en particular en nuestro país, ha sido limitado si lo comparamos con los estudios sobre la educación superior pública y propone algunos temas de investigación que fortalecerían el conocimiento de la educación superior.

  10. Doença de Behçet cursando com trombose de veia cava superior Behçet's disease presenting with superior vena cava thrombosis

    Directory of Open Access Journals (Sweden)

    Otacílio Figueiredo da Silva Júnior

    2006-03-01

    Full Text Available A trombose venosa é o principal acometimento do sistema vascular na doença de Behçet, sendo uma complicação freqüente na evolução clínica dessa patologia, e está mais associada ao sexo masculino. Os autores relatam o caso de uma paciente do sexo feminino que apresentou início da doença há 3 anos com úlceras orais, além de úlceras genitais, e que vem cursando com episódios recorrentes de trombose venosa, sendo a primeira uma trombose venosa profunda no membro inferior direito; a segunda, de jugular interna esquerda; e, por último, uma trombose da veia cava superior.Venous thrombosis is the main hazard to the vascular system in Behçet's disease. It is a frequent complication throughout the clinical evolution of this illness, which is more associated with the male gender. The authors report the case of a female patient with disease onset 3 years ago, showing oral and genital ulcers presenting with recurring episodes of venous thrombosis. The first one was a deep venous thrombosis in the right leg; the second was in the left internal jugular vein; and finally a superior vena cava thrombosis.

  11. ENVIRONMENTAL AND SUSTAINABLE TECHNOLOGY EVALUATION: BIOMASS CO-FIRING IN INDUSTRIAL BOILERS--UNIVERSITY OF IOWA

    Science.gov (United States)

    The U.S. EPA operates the Environmental and Sustainable Technology Evaluation (ESTE) program to facilitate the deployment of innovative technologies through performance verification and information dissemination. This ESTE project involved evaluation of co-firing common woody bio...

  12. Fatal pericardial tamponade after superior vena cava stenting.

    NARCIS (Netherlands)

    Ploegmakers, M.J.M.; Rutten, M.J.C.M.

    2009-01-01

    We discuss a fatal complication of percutaneous superior vena cava (SVC) self-expandable stent placement in a patient with superior vena cava syndrome (SVCS). The SVCS was caused by a malignant mediastinal mass with total occlusion of the SVC. Twenty-four hours after the procedure, the patient died

  13. 33 CFR 117.495 - Superior Oil Canal.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Superior Oil Canal. 117.495 Section 117.495 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.495 Superior Oil Canal. The draw of the S82 bridge, mile 6.3, in Cameron...

  14. [Superior vena cava syndrome--surgical solution--case report].

    Science.gov (United States)

    Galie, N; Vasile, R; Savu, C; Petreanu, C; Grigorie, V; Tabacu, E

    2010-01-01

    The patient of 52-year-old smoker was admitted in emergency with headaches, dyspnea, oedema and cyanosis of the cephalic extremity and of the superior members. This signs and symptoms suggest a superior vena cava sindrom. Thoracic CT scan shows the thrombosis of the superior vena cava and a tumor localized in the Bariety's Lodge of about 30/40 mm witch is around the right lateral wall of the traheea.This tumor is also tangent to the superior the superior vena cava. The patient was operated by total median sternotomy. By this approach we performed a complete excision of the mediastinal tumor mass. After that we effected a longitudinal cavotomy, we took out the endoluminal clot and we sutured the superior vena cava. The histological diagnosis of the mediastinal tumor was adenocarcinoma tubular-papillary moderately differentiated. The evolution post operative period was favorable the superior vena cava sindrom was a complet remission. The thoracic CT scan control after 9 months later didn't show a local relapse and blood flow was normally throw the superior vena cava.

  15. Fatal pericardial tamponade after superior vena cava stenting.

    NARCIS (Netherlands)

    Ploegmakers, M.J.M.; Rutten, M.J.C.M.

    2009-01-01

    We discuss a fatal complication of percutaneous superior vena cava (SVC) self-expandable stent placement in a patient with superior vena cava syndrome (SVCS). The SVCS was caused by a malignant mediastinal mass with total occlusion of the SVC. Twenty-four hours after the procedure, the patient died

  16. Pegada ecológica de uma instituição do ensino superior portuguesa

    Directory of Open Access Journals (Sweden)

    Susana Paixão

    2012-06-01

    Full Text Available O equilíbrio entre a vida humana e o ambiente só é possível se, entre outros aspetos, a vivência dos seres humanos for realizada em simbiose ambiental, ou seja, da forma mais ecológica possível. De forma a constatar a existência dessa simbiose, criaram-se diversas ferramentas para avaliar a sustentabilidade, tal como a Pegada Ecológica (PE. O presente estudo tem como principal objetivo o cálculo da PE da Escola Superior de Tecnologia da Saúde de Coimbra (ESTeSC, comparando os valores obtidos com os dois estudos anteriormente efetuados com o mesmo âmbito. O questionário que foi disponibilizado à amostra foi adaptado do existente na plataforma www.myfootprint.org. Comparando os resultados obtidos com anos anteriores, é possível verificar que a PE da ESTeSC desde 2009 tem vindo a diminuir na generalidade dos grupos estudados. Apenas o grupo dos docentes aumentou a sua PE desde o ano de 2010, sendo que a média da ESTeSC no ano de 2011 foi de 4,8 hectares globais.

  17. Perceções sobre criatividade: Estudo com estudantes do Ensino Superior

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Morais

    2016-01-01

    Full Text Available En el mundo actual la universidad tiene un pap el crucial en la formación de ciudadanos capaces de innovar. La creatividad es, pues, un concepto a valorar en la educación superior, pero esta valoración implica cambios en la vida cotidiana educativa. Una fuente de información relevante para la promoción de las habilidades creativas en los estudiantes universitarios es auscultar lo que piensan acerca de estas habilidades. En este sentido, a partir del cuestionario " Universidad y Competencias Creativas" , se analizaron las percepciones de 582 estudiantes de una universidad portuguesa acerca de la conceptualización y de la valoración de la creatividad en el contexto académico. Las percepciones se analizaron de acuerdo con el área cu rricular de formación y el género, encontrando dif ere ncias esta dísticamente significativas en funció n de ambas las variab les. Los resultados permiten refle xiones hacia una mayor pr ofund ización de este estudio, p ero también señalan orientaciones para cu idados y refuerzos sobre las prácti cas educativas en este nivel de ense ñanza.

  18. Equidad en la educación superior mexicana: el reto persistente

    Directory of Open Access Journals (Sweden)

    MARISOL SILVA LAYA

    2014-01-01

    Full Text Available El artículo analiza la equidad en la educación superior en México. Propone una nueva conceptualización de la equidad educativa fundamentada en un principio de justicia social que contempla: el acceso efectivo, la compensación de desigualdades, asegurar la permanencia y la obtención de resultados significativos. Con este marco, examina los avances en la materia y advierte que pese a las políticas dirigidas a democratizar este bien público, el sistema educativo mexicano sigue excluyendo a miles de jóvenes pertenecientes a estratos de bajos recursos. Al mismo tiempo, no brinda una atención adecuada a quienes vencen múltiples obstáculos y logran inscribirse en alguna institución. El texto hace patente cómo el acceso y la permanencia están asociados a los antecedentes socioeconómicos y culturales. Concluye con una reflexión sobre la necesidad de apuntalar una concepción más radical de la equidad educativa que privilegie la distribución de recursos de manera proporcional a las necesidades de los jóvenes.

  19. Dramatización creativa en docencia superior de ciencias

    Directory of Open Access Journals (Sweden)

    Alberto Domingo

    2013-11-01

    Full Text Available La dramatización creativa es una estrategia didáctica con muchos antecedentes (Ward, W. Creative Dramatics. D. Appleton & Co., N.Y. 1930, pero poco conocida en la enseñanza superior de ciencias (Scherr, R.E., et al. PER Conference 2010, 1289:293-296. Es una estrategia educativa sin finalidad de exhibición y percibida como improvisada por los participantes, los cuales interpretan y recrean un proceso con sus acciones guiadas sobre la marcha por un instructor. Su propósito no es formar actores ni actuar para otros, sino facilitar la adquisición de un conocimiento desde la vivencia interna y la autoobservación. En humanidades suele consistir en la interpretación de roles humanos o sociales en situaciones determinadas, pero en ciencias es una representación figurada de un proceso científico complejo, donde los participantes asumen el papel de distintos componentes o elementos que intervienen, teniendo que representar objetos o conceptos abstractos y alejados de la percepción real o de la escala humana. La dramatización facilita el aprendizaje significativo y la clarificación de conceptos abstractos, así como la comprensión de procesos complejos a través de una toma de consciencia “desde dentro” de los propios elementos que juegan un papel en los mismos (Michael, J. In pursuit of meaningful learning. Advances in Physiology Education, 2001, 25:145-158; Dee Fink, L. Creating Significant Learning Experiences: An Integrated Approach to Designing College Courses. 2003, Josey-Bass, Wiley. San Francisco, CA 94103-1741. Esta actividad promueve un aprendizaje mediante la autoobservación, aprovechando la capacidad humana natural de representar la propia percepción de fenómenos complejos para comprenderlos. La dramatización creativa estimula el pensamiento lógico e intuitivo, interioriza el conocimiento y genera un placer estético que facilita un aprendizaje significativo y memorable. En esta comunicación se presentan ejemplos pr

  20. La educación superior a distancia y el e-Learning en las prisiones en Portugal

    Directory of Open Access Journals (Sweden)

    2017-04-01

    Full Text Available La enseñanza superior en Europa ha venido experimentando grandes transformaciones gracias a los avances tecnológicos y a los cambios derivados del proceso de Bolonia, que prevé la creación de condiciones para que todos tengan acceso al aprendizaje, independientemente de factores de exclusión social, como la reclusión. La subsiguiente masificación del acceso a la Enseñanza Superior exige una oferta educativa flexible, centrada en el estudiante e inclusiva: son estas las prioridades de la Educación a Distancia de la Universidade Aberta en Portugal. Este artículo tiene como objetivo conocer las impresiones de veintiséis individuos (estudiantes, candidatos a estudiantes y técnicos superiores de reeducación sobre la realidad de la Enseñanza Superior en la modalidad de Educación a Distancia y aprendizaje virtual (e-Learning en una cárcel portuguesa. Este estudio se encuadra en un paradigma no positivista y hace hincapié en la percepción de los individuos, recurriendo a una metodología de carácter cualitativo. Los resultados, obtenidos mediante entrevistas, revelan la existencia de enormes debilidades y limitaciones en el proceso educativo, debido, sobre todo, a la falta de instalaciones y medios, recursos pedagógicos y tecnológicos, y apoyo de los profesores. Se ha concluido que es fundamental crear mejores condiciones de asistencia a distancia en las cárceles, porque esta formación superior puede ser una oportunidad de cualificación profesional y desarrollo personal, que incrementa sus perspectivas de éxito en el futuro.

  1. EST Pipeline System: Detailed and Automated EST Data Processing and Mining

    Institute of Scientific and Technical Information of China (English)

    Hao Xu; Liang Zhang; Hong Yu; Yan Zhou; Ling He; Yuanzhong Zhu; Wei Huang; Lijun Fang; Lin Tao; Yuedong Zhu; Lin Cai; Huayong Xu

    2003-01-01

    Expressed sequence tags (ESTs) are widely used in gene survey research these years. The EST Pipeline System, software developed by Hangzhou Genomics Institute (HGI), can automatically analyze different scalar EST sequences by suitable methods. All the analysis reports, including those of vector masking, sequence assembly, gene annotation, Gene Ontology classification, and some other analyses,can be browsed and searched as well as downloaded in the Excel format from the web interface, saving research efforts from routine data processing for biological rules embedded in the data.

  2. Las notas graves de la sonata de los estímulos y la nota final

    Directory of Open Access Journals (Sweden)

    OSCAR COMAS RODRÍGUEZ

    2013-01-01

    Full Text Available Este ensayo plantea la necesidad de identificar los efectos del devenir, a lo largo de casi treinta años, de una política estatal en educación superior destinada a premiar económicamente los productos del trabajo académico. El cambio generacional, y las transformaciones del contexto, hacen ineludible proponer estrategias para el resurgimiento de la vida académica y hacer frente a las fisuras de metas y compromisos institucionales que se han visto alteradas, a partir de beneficios económicos no incorporados salarialmente a la normativa institucional.

  3. The superior transvelar approach to the fourth ventricle and brainstem.

    Science.gov (United States)

    Ezer, Haim; Banerjee, Anirban Deep; Bollam, Papireddy; Guthikonda, Bharat; Nanda, Anil

    2012-06-01

    Objective The superior transvelar approach is used to access pathologies located in the fourth ventricle and brainstem. The surgical path is below the venous structures, through the superior medullary velum. Following splitting the tentorial edge, near the tentorial apex, the superior medullary velum is split in the cerebello-mesencephalic fissure. Using the supracerebellar infratentorial, transtentorial or parietal interhemispheric routes, the superior medullary velum is approached. Splitting this velum provides a detailed view of the fourth ventricle and its floor. Materials and Methods A total of 10 formalin-fixed specimens were dissected in a stepwise manner to simulate the superior transvelar approach to the fourth ventricle. The exposure gained the distance from the craniotomy site and the ease of access was assessed for each of the routes. We also present an illustrative case, operated by the senior author (AN). Results The superior transvelar approach provides access to the entire length of the fourth ventricle floor, from the aqueduct to the obex, when using the parietal interhemispheric route. In addition, this approach provides access to the entire width of the floor of the fourth ventricle; however, this requires retracting the superior cerebellar peduncle. Using the supracerebellar infratentorial route gives a limited exposure of the superior part of the fourth ventricle. The occipital interhemispheric route is a compromise between these two. Conclusion The superior transvelar approach to the fourth ventricle provides a route for approaching the fourth ventricle from above. This approach does not require opening the posterior fossa in the traditional way, and provides a reasonable alternative for accessing the superior fourth ventricle.

  4. Development of a EST dataset and characterization of EST-SSRs in a traditional Chinese medicinal plant, Epimedium sagittatum (Sieb. Et Zucc. Maxim

    Directory of Open Access Journals (Sweden)

    Fei Zhangjun

    2010-02-01

    Full Text Available Abstract Background Epimedium sagittatum (Sieb. Et Zucc. Maxim, a traditional Chinese medicinal plant species, has been used extensively as genuine medicinal materials. Certain Epimedium species are endangered due to commercial overexploition, while sustainable application studies, conservation genetics, systematics, and marker-assisted selection (MAS of Epimedium is less-studied due to the lack of molecular markers. Here, we report a set of expressed sequence tags (ESTs and simple sequence repeats (SSRs identified in these ESTs for E. sagittatum. Results cDNAs of E. sagittatum are sequenced using 454 GS-FLX pyrosequencing technology. The raw reads are cleaned and assembled into a total of 76,459 consensus sequences comprising of 17,231 contigs and 59,228 singlets. About 38.5% (29,466 of the consensus sequences significantly match to the non-redundant protein database (E-value Epimedium EST dataset. Trinucleotide SSR is the dominant repeat type (55.2% followed by dinucleotide (30.4%, tetranuleotide (7.3%, hexanucleotide (4.9%, and pentanucleotide (2.2% SSR. The dominant repeat motif is AAG/CTT (23.6% followed by AG/CT (19.3%, ACC/GGT (11.1%, AT/AT (7.5%, and AAC/GTT (5.9%. Thirty-two SSR-ESTs are randomly selected and primer pairs are synthesized for testing the transferability across 52 Epimedium species. Eighteen primer pairs (85.7% could be successfully transferred to Epimedium species and sixteen of those show high genetic diversity with 0.35 of observed heterozygosity (Ho and 0.65 of expected heterozygosity (He and high number of alleles per locus (11.9. Conclusion A large EST dataset with a total of 76,459 consensus sequences is generated, aiming to provide sequence information for deciphering secondary metabolism, especially for flavonoid pathway in Epimedium. A total of 2,810 EST-SSRs is identified from EST dataset and ~1580 EST-SSR markers are transferable. E. sagittatum EST-SSR transferability to the major Epimedium germplasm is up to

  5. La estética en Marcuse

    OpenAIRE

    Cuevas Ruíz, Rafael

    2014-01-01

    Trabajo de Fin de Máster. Máster Universitario en Filosofía Teórica y Práctica. Especialidad de Filosofía Práctica El presente trabajo tiene por objeto recapitular y sistematizar dentro de la obra de Marcuse, aquellos materiales que configuran su reflexión en el campo de la estética. Para ello y por orden cronológico, hemos ido realizando distintos recesos, deteniéndonos con más hincapié en los textos que consideramos más determinantes en cuanto a su importancia en este tema: Acerca del ca...

  6. La estética en Marcuse

    OpenAIRE

    Cuevas Ruíz, Rafael

    2014-01-01

    Trabajo de Fin de Máster. Máster Universitario en Filosofía Teórica y Práctica. Especialidad de Filosofía Práctica El presente trabajo tiene por objeto recapitular y sistematizar dentro de la obra de Marcuse, aquellos materiales que configuran su reflexión en el campo de la estética. Para ello y por orden cronológico, hemos ido realizando distintos recesos, deteniéndonos con más hincapié en los textos que consideramos más determinantes en cuanto a su importancia en este tema: Acerca del ca...

  7. REDVET está indexada en REBIUM

    Directory of Open Access Journals (Sweden)

    Redaccion Veterinaria.org

    2007-12-01

    Full Text Available REBIUM es el nombre abreviado de la REd de BIbliotecas UNiversitarias de España que reune el Catálogo Colectivo de Red de Bibliotecas Universitarias Españolas. El Catálogo Colectivo de Red de Bibliotecas Universitarias Españolas (REBIUN es un servicio propiedad de la Conferencia de Rectores de Universidades Españolas (CRUE actualmente gestionado y mantenido por BARATZ. Servicios de Teledocumentación, cuya principal característica es la disponibilidad en Internet, soportados por un servidor absysNET y en un servidor absysNET Z39.50, lo que permite que esté disponible las 24 horas para su consulta desde cualquier parte del mundo. El Catálogo se actualiza seis veces al año a partir de los registros enviados por la diferentes universidades. La versión actual del Catálogo Colectivo de Red de Bibliotecas Universitarias Españolas (REBIUN está disponible para el público en general, y está formada por 7.888.812 catalogaciones de monografías o, de forma más precisa, no series (pertenecientes a 17.559.783 ubicaciones en Universidades diferentes y 292.371 catalogaciones de series (pertenecientes a 588.661 localizaciones, en total compila los datos procedentes de 67 bibliotecas universitarias españolas. REDVET está indexada en REBIUM y se puede localizar de la siguiente manera.

  8. Estética, Subjetividad y Conocimiento

    Directory of Open Access Journals (Sweden)

    López Avendaño, Olimpia

    2002-12-01

    Full Text Available Este artículo trata de la tradicional dicotomía conocimiento objetivo-subjetivo. En él se analiza la posición de diferentes autores en búsqueda de los elementos que conducen al nacimiento de un nuevo paradigma, integrador, que supere la antinomia y permita visualizar al conocimiento pero sobre todo al individuo que lo produce, integralmente.

  9. A Estética do Marketing

    Directory of Open Access Journals (Sweden)

    Euler Alves Brandão

    2010-10-01

    Full Text Available A despeito da predominância das perspectivas inseridas no paradigma funcionalista, fruto de seu domínio no campo das ciências sociais, a constituição de uma teoria em marketing abriga, nos últimos anos, uma maior abertura para abordagens diferenciadas, dentre as quais o marketing estratégico ganha especial destaque. Numa visão normativa, o marketing estratégico prescreve como as decisões estratégicas de uma empresa devem ser tomadas, e, utilitariamente, como os melhores resultados e práticas devem ser perseguidos.Com isso, a abertura para a ocorrência de um movimento multidisciplinar para o desenvolvimento de novas perspectivas que tragam eficácia é incentivada, e nesse contexto resgata-se o debate acerca da estética, termo facilmente confundido com algo secundário e periférico, em virtude de não ser normalmente compreendido em sua plenitude.Este artigo apresenta a análise da experiência estética, resgatando-a a partir de sua origem filosófica, e demonstra seu poder de contribuição estratégica à prática do marketing, destacando-a como elemento constituinte da capacidade de julgamento, como potente ferramenta na obtenção de resultados.

  10. Upgrading Unconventional Oil Resources with the EST Process

    Energy Technology Data Exchange (ETDEWEB)

    Delbianco, Alberto; Meli, Salvatori; Panariti, Nicolleta; Rispoli, Giacomo

    2007-07-01

    We strongly believe that unconventional oils will play a much larger role in the growth of supply than is currently recognized. As a matter of fact, whereas the earth's conventional proven world oil reserves are 1.3 trillion barrels, extra-heavy plus bitumen resources amount to about 4 trillion barrels. The unconventional oils are characterized by low API gravity (<10), high viscosity and high concentration of poisons such as sulphur, nitrogen, metals, and asphaltenes. For this reason, a key role for the full exploitation of these hydrocarbon resources is played by the downstream processes that are required to upgrade and convert them into valuable products. In this scenario, Eni has developed a novel hydrocracking process (EST: Eni Slurry Technology) which is particularly well-suited for the conversion and upgrading of heavy feedstocks (conventional vacuum residues, extra-heavy oils and bitumen). EST employs nano-sized hydrogenation catalysts and an original process scheme that allow complete feedstock conversion to an upgraded synthetic crude oil (SCO) with an API gravity gain greater than 20 and avoid the production of residual by-products, such as pet-coke or heavy fuel oil. A Commercial Demonstration Unit (CDP) of 1200 bbl/d capacity is successfully operating in the Eni's Taranto refinery since November 2005. (auth)

  11. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...contig.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/LATEST/acestcontig....zip File size: 1.34MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acestcontig#en Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  12. Robot-assisted partial nephrectomy: Superiority over laparoscopic partial nephrectomy.

    Science.gov (United States)

    Shiroki, Ryoichi; Fukami, Naohiko; Fukaya, Kosuke; Kusaka, Mamoru; Natsume, Takahiro; Ichihara, Takashi; Toyama, Hiroshi

    2016-02-01

    Nephron-sparing surgery has been proven to positively impact the postoperative quality of life for the treatment of small renal tumors, possibly leading to functional improvements. Laparoscopic partial nephrectomy is still one of the most demanding procedures in urological surgery. Laparoscopic partial nephrectomy sometimes results in extended warm ischemic time and severe complications, such as open conversion, postoperative hemorrhage and urine leakage. Robot-assisted partial nephrectomy exploits the advantages offered by the da Vinci Surgical System to laparoscopic partial nephrectomy, equipped with 3-D vision and a better degree in the freedom of surgical instruments. The introduction of the da Vinci Surgical System made nephron-sparing surgery, specifically robot-assisted partial nephrectomy, safe with promising results, leading to the shortening of warm ischemic time and a reduction in perioperative complications. Even for complex and challenging tumors, robotic assistance is expected to provide the benefit of minimally-invasive surgery with safe and satisfactory renal function. Warm ischemic time is the modifiable factor during robot-assisted partial nephrectomy to affect postoperative kidney function. We analyzed the predictive factors for extended warm ischemic time from our robot-assisted partial nephrectomy series. The surface area of the tumor attached to the kidney parenchyma was shown to significantly affect the extended warm ischemic time during robot-assisted partial nephrectomy. In cases with tumor-attached surface area more than 15 cm(2) , we should consider switching robot-assisted partial nephrectomy to open partial nephrectomy under cold ischemia if it is imperative. In Japan, a nationwide prospective study has been carried out to show the superiority of robot-assisted partial nephrectomy to laparoscopic partial nephrectomy in improving warm ischemic time and complications. By facilitating robotic technology, robot-assisted partial nephrectomy

  13. [Acupoint catgut-embedding therapy: superiorities and principles of application].

    Science.gov (United States)

    Zhang, Xuan-Ping; Jia, Chun-Sheng; Wang, Jian-Ling; Shi, Jing; Zhang, Xin; Li, Xiao-Feng; Xu, Xiao-Kang; Qin, Liang; Zhang, Mei-Ling; Kang, Su-Gang; Duan, Xiao-Dong

    2012-10-01

    To analyze the superiorities of acupoint catgut-embedding therapy, discuss its law of clinical application and provide scientific decision-making for clinical treatment. Literatures on acupoint catgut-embedding therapy in the recent 40 years were selected, input, examined and verified, picked up and analyzed by establishing database with the modern computer technology. (1) One thousand and seventy-five literatures were input. It shows that the acupoint catgut-embedding therapy has an extensive application in all departments, especially in the internal department, accounting for 48.54% (50/103) of the total disease category. It has the most extensive application on treatment of epigastric pain, with the frequency of 102 times, and obesity of 74 times. The next is surgery, accounting for 14.56% (15/103). The major application is on low back pain and leg pain with the frequency of 79 times. Psoriasis, with the frequency of 30 times, holds the major application in dermatological department. And blepharoplasty, with the frequency of 30 times, gains the most application in department of ophthalmology and otorhinolaryngology. (2) In the included literatures, selection of adjacent acupoints and distal acupoints are held as the major method of acupoint selection. The adjusted lumbar puncture needle is taken as the major tool for the acupoint catgut-embedding therapy. And catguts of different sizes are adopted for the operation. (3) Analysis of the therapeutic effect shows that acupoint catgut-embedding therapy has obvious effect in all departments, especially in surgery and dermatology, with the total effective rate over 90%. Epigastric pain, obesity, epilepsy, asthma, abdominal pain, facial paralysis and constipation of the internal medicine, low back pain and leg pain of the surgical department, psoriasis of the dermatological department and blepharoplasty of the department of ophthalmology and otorhinolaryngology are considered as the dominant diseases for acupoint

  14. O tratamento contábil do capital intelectual em empresas com valor de mercado superior ao valor contábil

    Directory of Open Access Journals (Sweden)

    Joel Marques de Oliveira

    2003-08-01

    Full Text Available Este artigo tem por objetivo sintetizar o resultado da pesquisa sobre o tratamento contábil que é aplicado ao capital intelectual, sob a ótica do processo de gestão, representado pelos conceitos e técnicas que são utilizados e que dão suporte à ação da administração, em empresas com valor de mercado superior ao valor contábil. Para atingir este propósito, o artigo consubstancia-se em uma pesquisa realizada em duas empresas de capital aberto, de Santa Catarina, que apresentam valor de mercado, considerado o valor das ações superior ao seu valor contábil. Observou-se que, embora as empresas pesquisadas possuam todas as características das organizações voltadas ao conhecimento e domínio tecnológico, o tratamento contábil do capital intelectual é algo ainda muito incipiente, e que, os critérios utilizados para mensurar, registrar e evidenciar as informações referentes ao capital humano, capital estrutural e capital de clientes, com vistas ao processo de gestão, é algo que ainda carece de uma sistematização, para que se possa refletir, por meio das demonstrações contábeis, alguma posição nesse sentido. Concluiu-se que as empresas pesquisadas, mesmo não possuindo as informações sistematizadas sobre as iniciativas de mensuração do capital intelectual, têm consciência da sua importância. No entanto, para que os gestores desses empreendimentos possam, efetivamente, utilizá-las como um diferencial competitivo no processo de gestão, as informações sistematizadas sobre o capital intelectual devem fazer parte dos relatórios gerados para a tomada de decisões.The objective of this article si to summarize the result of the research about the accounting treatment which is applied to the intellectual capital, through the management viewpoint, in companies with a market value superior than the accounting value. In order to reach this intention, the article is substantiated on a research carried out in two open

  15. Gestion, evaluacion y calidad en la diversificacion de la Educacion Superior en America Latina

    Directory of Open Access Journals (Sweden)

    Sergio Martínez Romo

    2007-12-01

    Full Text Available La participación de la Sociedad Académica y sus grupos constituyentes como 'tribus' o grupos de interés en función del conocimiento (Martínez Romo, 1992, 2005 en la gestión, diseño y operación de la política pública en educación superior y la evaluación y acreditación de la calidad del posgrado y en el entrenamiento en investigación, por medio de agencias gubernamentales em México (Martínez Romo y Reséndiz, 2007 logra influir en el diseño de lãs políticas públicas y la gestión en educación superior, y aparentemente, mejores resultados al introducir explícitamente el valor conocimiento -y SUS aplicaciones- a través de los grupos o tribus -diría Becher (1989- en La gestión y los procesos de evaluación en el posgrado. Los datos obtenidos señalan que este valor parece dar a los indicadores y estándares de gestión y calidad de tipo gerencial, un sentido más trascendente que la eficacia y eficiencia esperada tradicionalmente en los modelos privado - empresariales o de servicio público en el sentido tradicional, de la noción de estado de bienestar (que en ocasiones situa la noción en términos de uso privado de bienes públicos. La investigación reportada pone en perspectiva algunas características significativas en la constitución de la Sociedad Académica en México, La distingue del Estado y de la Sociedad Civil (Martínez Romo, 1992, y caracteriza y documenta su participación en la hechura y gestión de lãs políticas para la educación superior y a través de ésta última, en la producción, promoción y difusión de la Ciencia y la Tecnología. Acciones todas ellas de contribución para el desarrollo, en un entorno de diversificación e internacionalización de la educación superior y sus instituciones.

  16. Crystal structure of hyperthermophilic esterase EstE1 and the relationship between its dimerization and thermostability properties

    Directory of Open Access Journals (Sweden)

    Koh Eunhee

    2007-07-01

    Full Text Available Abstract Background EstE1 is a hyperthermophilic esterase belonging to the hormone-sensitive lipase family and was originally isolated by functional screening of a metagenomic library constructed from a thermal environmental sample. Dimers and oligomers may have been evolutionally selected in thermophiles because intersubunit interactions can confer thermostability on the proteins. The molecular mechanisms of thermostabilization of this extremely thermostable esterase are not well understood due to the lack of structural information. Results Here we report for the first time the 2.1-Å resolution crystal structure of EstE1. The three-dimensional structure of EstE1 exhibits a classic α/β hydrolase fold with a central parallel-stranded beta sheet surrounded by alpha helices on both sides. The residues Ser154, Asp251, and His281 form the catalytic triad motif commonly found in other α/β hydrolases. EstE1 exists as a dimer that is formed by hydrophobic interactions and salt bridges. Circular dichroism spectroscopy and heat inactivation kinetic analysis of EstE1 mutants, which were generated by structure-based site-directed mutagenesis of amino acid residues participating in EstE1 dimerization, revealed that hydrophobic interactions through Val274 and Phe276 on the β8 strand of each monomer play a major role in the dimerization of EstE1. In contrast, the intermolecular salt bridges contribute less significantly to the dimerization and thermostability of EstE1. Conclusion Our results suggest that intermolecular hydrophobic interactions are essential for the hyperthermostability of EstE1. The molecular mechanism that allows EstE1 to endure high temperature will provide guideline for rational design of a thermostable esterase/lipase using the lipolytic enzymes showing structural similarity to EstE1.

  17. Liderazgo de las TIC en educación superior: estudio de caso múltiple en Colombia

    Directory of Open Access Journals (Sweden)

    Gary Cifuentes Álvarez

    2015-07-01

    Full Text Available En este artículo analizamos la integración de las TIC en instituciones de educación superior. Nos centramos en las prácticas de liderazgo en políticas sobre TIC, un campo de investigación que no ha recibido mucha atención en los estudios sobre educación superior. Usando un enfoque de liderazgo distribuido se analizó dicha práctica en instituciones de educación superior en Colombia, un país donde una política de incorporación de las TIC llevó a promover la elaboración de planes estratégicos en dichas instituciones. En particular, la investigación buscó entender cómo el liderazgo de las TIC es distribuido en diferentes ambientes de educación superior. A partir de un estudio de caso múltiple que incluyó entrevistas semiestructuradas con líderes y miembros de equipos, grupos focales con profesores, análisis documental y una encuesta aplicada a profesores, fueron investigadas las prácticas de liderazgo de las TIC y sus implicaciones. Los resultados indican un conjunto de tensiones que los líderes deben enfrentar cuando incorporan un plan estratégico de TIC, por ejemplo, la ausencia de regulaciones institucionales o la necesidad de promocionar el cambio educativo a pesar de las resistencias. De hecho, el liderazgo de las TIC es una práctica retadora y aún poco explorada en educación superior. Este artículo es un intento sistemático por demostrar este enunciado y sus implicaciones. Estos hallazgos son de particular relevancia para el trabajo de los diseñadores de políticas, coordinadores de TIC y líderes en educación superior de todo el mundo.

  18. Mediastinal and pulmonary entomophthoromycosis with superior vena cava syndrome: case report Entomoftoromicose mediastinal e pulmonar com síndrome de veia cava superior: registro de caso

    Directory of Open Access Journals (Sweden)

    João Carlos Coelho Filiio

    1989-12-01

    Full Text Available The first case of mediastinal and pulmonary entomophthoromycosis with supe rior vena cava syndrome is reported. The patient presented with a history of edema of the face, neck and upper limbs as well as collateral circulation in the anterior wall of the chest. Histological examination of tissue from mediastinum revealed a granulomatous reaction with microabscesses surrounded by eosinophilic amorphous material and with broad hyphae in the center. Culture was not performed because a preliminary diagnosis of nonHodgkin's malignant lymphoma was made. Surgical correction of the obstructed area was performed and the patient was sucessfully treated with potassium iodide. The authors propose that mediastinal entomoph thoromycosis must be considered in the differential diagnosis of diseases causing superior vena cava syndrome in tropical and sub-tropical regions. This case enlarges the spectrum of clinical manifestations of the zigomycosis caused by Entomoph-thoraceae.O primeiro caso de entomoftoromicose mediastinal e pulmonar com síndorme de veia cava superior, é descrito. A paciente apresentou-se com historia de edema facial, cervical e de membros superiores, bem como circulação colateral na parede anterior do tórax. O estudo histopatológico do tecido do mediastino, próximo à veia cava, revelou reação granulomatosa com microabscesses, circundados por material amorfo, eosinofílico e com hifas largas no centro. Cultura não foi realizada porque o diagnóstico clínico foi de doença de Hodgkin ou de um linfoma não-Hodgkin. Correção cirúrgica da área obstruída foi realizada e a paciente tratada com iodeto de potássio, nas doses preconizadas, obtendo-se sucesso. Os autores propõem que a entomoftoro-micose mediastinal deva ser considerada no diagnóstico diferencial de doença causando síndrome de veia cava superior em regiões tropicais e subtropicais. Este caso aumenta o espectrum de manifestações clínicas das zigomicoses causadas

  19. Influence of superior cervical ganglionectomy on hippocampal neurogenesis and learning and memory in adult rats

    Institute of Scientific and Technical Information of China (English)

    Yanping Ding; Baoping Shao; Shiyuan Yu; Shanting Zhao; Jianlin Wang

    2009-01-01

    BACKGROUND: Studies have shown that neurogenesis in the dentate gyrus plays an important role in learning and memory. However, studies have not determined whether the superior cervical ganglion or the sympathetic nerve system influences hippocampal neurogenesis or learning and memory in adult rats. OBJECTIVE: To observe differences in dentate gyrus neurogenesis, as well as learning and memory, in adult rats following superior cervical ganglionectomy. DESIGN, TIME AND SETTING: A randomized, controlled, animal study was performed at the Immunohistochemistry Laboratory of the School of Life Sciences in Lanzhou University from July 2006 to July 2007.MATERIALS: Doublecortin polyclonal antibody was provided by Santa Cruz Biotechnology, USA;avidin-biotin-peroxidase complex was purchased from Zhongshan Goldenbride Biotechnology, China;Morris water maze was bought from Taimeng Technology, China. METHODS: A total of 20 adult, male, Wistar rats were randomly divided into surgery and control groups, with 10 rats in each group. In the surgery group, the bilateral superior cervical ganglions were transected. In the control group, the superior cervical ganglions were only exposed, but no ganglionectomy was performed. MAIN OUTCOME MEASURES: To examine distribution, morphology, and number of newborn neurons in the dentate gyrus using doublecortin immunohistochemistry at 36 days following surgical procedures. To examine ability of learning and memory in adult rats using the Morris water maze at 30 days following surgical procedures. RESULTS: Doublecortin immunohistochemical results showed that a reduction in the number of doublecortin-positive neurons in the surgery group compared to the control group (P<0.05), while the distribution of doublecortin-positive neurons was identical in the two groups. The surgery group exhibited significantly worse performance in learning and spatial memory tasks compared to the control group (P<0.05). CONCLUSION: Superior cervical ganglionectomy

  20. Rendimientos de la educación superior en el mercado laboral. El caso de Perú

    Directory of Open Access Journals (Sweden)

    Gustavo Yamada

    2009-01-01

    Full Text Available Perú ha experimentado en los decenios recientes un significativo incremento en su cobertura de educación, en general, y de la educación superior, en particular. Sin embargo, las altas tasas de desempleo y subempleo existentes siembran dudas acerca del rendimiento de las inversiones en educación realizadas. Este artículo estima la evolución de los rendimientos de la educación en los pasados dos decenios en Perú y encuentra pruebas mixtas acerca de la rentabilidad de la educación superior en el mercado laboral peruano. Gracias a la convexificación de los rendimientos, la educación universitaria ofrece actualmente tasas promedio de rendimiento privado y social en términos reales estimadas entre 12 y 15%. Por lo contrario, la educación superior no universitaria otorga tasas de rendimiento privado y social en promedio poco atractivas, y hasta cercanas a 0, por lo que parece justificada una profunda evaluación de la efectividad y pertinencia de este estrato educativo.

  1. Psicologia Organizacional e do Trabalho: Relato de Experiência em Estágio Supervisionado

    Directory of Open Access Journals (Sweden)

    Priscilla de Oliveira Martins-Silva

    Full Text Available Resumo Trata-se de relato de experiência em estágio supervisionado em Psicologia Organizacional e do Trabalho (POT envolvendo um grupo de alunos de uma Instituição de Educação Superior (IES localizada no Estado do Espírito Santo. O objetivo central foi discutir os aspectos teóricos e práticos que influenciaram na formação profissional do discente em Psicologia, tendo como foco o estágio supervisionado. Além de relatar a experiência, foi realizado um levantamento junto aos ex-alunos sobre as contribuições do estágio na sua formação educacional e profissional. Da experiência relatada foi possível verificar que: a instituição das Diretrizes Curriculares Nacionais (DCN constituiu-se em um marco na flexibilização curricular dos cursos; o estágio é um componente curricular de integração entre ensino, pesquisa e prática; e o estágio em POT requer dos discentes conhecimentos multidisciplinares. Além desses aspectos, observou-se que a prática do estágio supervisionado indica o rompimento com a imagem negativa do psicólogo que atua em POT, limitada à aplicação de testes e psicotécnicas. De fato, a atividade do psicólogo em POT mostrou-se muito mais ampla e complexa, sobretudo em termos dos impactos de sua intervenção no ambiente organizacional.

  2. Evaluación estética de seis tipos de coronas para dientes primarios

    Directory of Open Access Journals (Sweden)

    Héctor Alejandro Ramírez Peña

    2017-03-01

    Full Text Available Objetivo: Evaluar las preferencias estéticas en relación con el color y la forma de coronas primarias utilizadas para dientes incisivos superiores primarios, mediante la realización de una encuesta a miembros de la Academia Mexicana de Odontología Pediatrica (AMOP. Material y Métodos: Se establecieron seis grupos de estudio con seis coronas diferentes: grupo 1, coronas de zirconia EZ-Pedo; grupo 2, coronas de zirconia NuSmile Zr; grupo 3, coronas estéticas hechas en el consultorio; grupo 4, coronas de fundas de celuloide; grupo 5, coronas estéticas prefabricadas NuSmile signature; y grupo 6, coronas estéticas fenestradas. Se llevaron a cabo encuestas con la finalidad de conocer las preferencias estéticas de estas diferentes coronas, con la finalidad de conocer cuál es la mejor opción para su uso en el consultorio dental. Resultados: Noventa miembros de la AMOP realizaron una encuesta válida, y se determinó que el grupo 4 fue el mejor evaluado, seguido de los grupos 2, 5, 1, 6 y 3. Se identificaron diferencias significativas entre los diferentes grupos. Conclusiones: Las coronas de fundas de celuloide fueron seleccionadas como mejor alternativa de uso en los dientes primarios anteriores, por parte de los miembros de la AMOP; asimismo, se consideró a las coronas de zirconia como una buena opción terapéutica. Es recomendable que se implemente el tratamiento estético en dientes primarios, para realizar un tratamiento integral.

  3. Acquired Brown Syndrome Treated With Traction of Superior Oblique Tendon.

    Science.gov (United States)

    Shin, Kwang Hoon; Paik, Hae Jung; Chi, Mijung

    2016-03-01

    Brown syndrome is a rare strabismic disease characterized by a limited elevation in adduction of the eye. The lengthening/weakening of superior oblique muscle is the main way of surgical intervention for this disease. A 7-year-old boy was diagnosed as having acquired Brown syndrome in his right eye after injury in his face. We experienced successful release of this Brown syndrome through mere pulling outward of superior oblique tendon during surgical exploration. We briefly discuss why this manipulation of superior oblique tendon that we performed was successful.

  4. Right superior vena cava draining into the left atrium

    Energy Technology Data Exchange (ETDEWEB)

    Calcagni, Giulio; Sidi, Daniel; Bonnet, Damien [University Rene Descartes-Paris 5, Department of Paediatric Cardiology, Hopital Necker-Enfants Malades, Paris (France); Batisse, Alain [Institut de Puericulture et de Perinatalogie, Paris (France); Vouhe, Pascal [University Rene Descartes-Paris 5, Department of Paediatric Cardiac Surgery, Hopital Necker-Enfants Malades, Paris (France); Ou, Phalla [University Rene Descartes-Paris 5, Department of Paediatric Cardiology, Hopital Necker-Enfants Malades, Paris (France); University Rene Descartes-Paris 5, Department of Pediatric Radiology, Hopital Necker-Enfants Malades, Paris (France)

    2008-08-15

    The right superior vena cava draining into the left atrium is a rare malformation causing cyanosis and clubbing in patients in whom no other signs of congenital heart defect are present. Diagnosis may be difficult as cyanosis may be mild and the anomaly is not always easily detectable by echocardiography. For this reason we report a 13-month-old male in whom we confirmed the clinical and echocardiographic suspicion of anomalous drainage of the right superior vena cava using multidetector CT. This allowed successful surgical reconnection of the right superior vena cava to the right atrium. (orig.)

  5. Jóvenes titulados superiores en la encrucijada de la crisis

    Directory of Open Access Journals (Sweden)

    Alessandro Gentile

    2015-04-01

    Full Text Available Normal 0 21 false false false MicrosoftInternetExplorer4 La educación superior es una opción estratégica que ha asumido relevancia creciente entre los jóvenes españoles para evitar la precariedad provocada por la crisis y para prepararse mejor a la hora de buscar un empleo de calidad. De esta forma, se ha consolidado un segmento de jóvenes altamente formados que acudieron a los estudios post-obligatorios para encontrar trabajos acorde con su titulación. Sin embargo, una vez acabados los estudios, la situación ocupacional de los universitarios no mejora automáticamente y tampoco según sus expectativas de partida, porque la coyuntura económica negativa está perjudicando su integración social. Se asiste, pues, a una correspondencia incompleta e inadecuada entre la cualificación formal de los jóvenes y su colocación laboral. La devaluación de los títulos educativos y su limitada orientación a las exigencias prácticas del mercado de trabajo no favorece la estabilidad y tampoco la promoción de carreras ordenadas y coherentes. Por otra parte, el mismo mercado de trabajo expulsa a los jóvenes que tienen un nivel de estudio bajo y posiciona los que disponen de una preparación académica en empleos que necesitan una formación inferior. Además, el sistema productivo español no es plenamente receptivo para una mano de obra muy cualificada: el crecimiento económico se ha estancado, el sector público de servicios ha comenzado una profunda reestructuración a partir del adelgazamiento y del desmantelamiento de sus plantillas, y la inversión en innovación y en sectores avanzados es netamente inferior a la que se registra en los demás países europeos.Los jóvenes titulados superiores en nuestro país viven el presente con mucha inestabilidad y con poca seguridad para el futuro. Cada vez más, están conscientes de que la formación se extiende a lo largo de toda la vida, pero que no necesariamente les permitirá integrarse en la

  6. El mercado de créditos para la educación superior: pensar México desde Chile

    Directory of Open Access Journals (Sweden)

    Patricia Gascón Muro

    2008-01-01

    Full Text Available Este trabajo se presenta como respuesta a la invitación al diálogo que la Ministra de Educación Pública de México hizo a los críticos del modelo de créditos educativos para la educación superior. Para fundamentar nuestra crítica, en el presente artículo realizamos una evaluación del modelo de educación superior chileno que promovió el autofi-nanciamiento de las universidades públicas. Este modelo, que se originó en el régimen de Pinochet y que continúa vigente, aplica una política neoliberal en la educación terciaria que ha significado la privatización de las instituciones públicas, que autogeneran el 60% de sus ingresos, y el consecuente fortalecimiento de las privadas. En este proceso las universidades "del estado" han perdido su identidad y sentido mientras que la sociedad debate en las calles, desde hace varios años y a fuerza de enfrentamientos, el proyecto educativo que presupone un proyecto de nación. Una de las principales fuentes de ingresos de las universidades públicas chilenas es el cobro de matrícula y aranceles: para el pago de estos rubros en Chile se diseñó un sistema de créditos educativos, que colapsó.

  7. La red de educación y el espacio Europeo de educación superior

    Directory of Open Access Journals (Sweden)

    Aurelio Villa

    2004-01-01

    Full Text Available En el campo educativo, la construcción de la Unión Europea presenta una corta e intensa historia. Entre la firma del Tratado de Roma (1957 y el de Niza (2001, la evolución que ha vivido la política educativa ha desembocado en la creación de un espacio universitario europeo, el cual pretende promocionar una enseñanza superior competitiva y de calidad. Entre las muchas tareas que deben llevarse a cabo en las universidades españolas está la adecuación de nuestro mapa de titulaciones a las nuevas exigencias del emergente Espacio Europeo de la Educación Superior. Sin embargo, nuestro actual sistema universitario presenta serias dificultades para adecuarse al espacio europeo, ya que tenemos una estructura que difiere de la mayoría de los otros países. En este texto se examina el proceso desarrollado para la adaptación de las titulaciones de Educación en aquél espacio y se avanzan algunas conclusiones. Enmarcados en este área se presentaron dos propuestas diferentes, avaladas por grupos de universidades que configuraban dos redes distintas, la Red de Magisterio y la Red de Educación que se dirige a otros profesionales de la educación, bajo los títulos de Pedagogía y Educación Social.

  8. O Ensino Superior Tecnológico em Gastronomia em São Paulo: Um Estudo sobre Formação, Perfil do Egresso e Áreas de Atuação / The Technological Higher Education in Gastronomy in São Paulo: A Study on Training, Graduates' profile and Areas of Practice

    Directory of Open Access Journals (Sweden)

    Luciana Moura de Abreu

    2015-04-01

    Full Text Available Normal 0 21 false false false PT-BR X-NONE X-NONE MicrosoftInternetExplorer4 Diante das necessidades do novo mercado de trabalho para a área de alimentos e bebidas, que necessita de um profissional articulado, com capacidade crítica e possibilidade de interação com o meio com o qual se relaciona, torna-se importante a reflexão sobre a formação do aluno egresso dos Cursos Tecnológicos em Gastronomia, pensando-se numa educação abrangente que valorize a experiência individual, as expectativas do mercado que se reflitam no conteúdo dos currículos. O presente trabalho teve como objetivo investigar, com base em pesquisa exploratório-descritiva, a matriz curricular de três cursos tecnológicos presenciais do Estado de São Paulo, analisando a proposta de formação contida nos seus documentos, o perfil dos egressos e a visão dos coordenadores, aos quais se aplicou roteiro de entrevista semiestruturada. Apresenta-se, ainda, a contextualização e trajetória da educação formal e do ensino tecnológico em Gastronomia, no Brasil. Como principais resultados observou-se que a pressão do mercado é bastante forte na elaboração dos currículos dos cursos, assim como a percepção dos coordenadores deixa entrever as limitações para a formação mais abrangente de um profissional oriundo dos cursos tecnológicos em Gastronomia. The Technological Higher Education in Gastronomy in São Paulo: A Study on Training, Graduates' profile and Areas of Practice - The job market for the field of foods and beverages requires a professional that is articulated, critical and with ability to interact with the environment. In that way, it is important to reflect about the formation of Food Technology Courses in terms of education, individual experience, market expectations and curriculum. The present study investigated based on an exploratory-descriptive research, the curriculum of three technology courses in the State of São Paulo, analyzing its

  9. El derecho a la educación superior frente a la ancianidad y la discapacidad en Argentina

    Directory of Open Access Journals (Sweden)

    Sebastian Ariel Rositto

    2011-12-01

    Full Text Available La humanidad a lo largo de su historia ha decidido quiénes tienen la hegemonía para reconocer el derecho a la vida, a la salud, al trabajo, a la educación, etc. Los que no integran el grupo dominante, quedan relegados a formar parte de las minorías o grupos vulnerables. Entre ellos, encontramos a los ancianos y las personas con discapacidad, que más allá de no ser idénticos, presentan problemáticas similares: la falta de acceso a la salud, al trabajo, a la educación y la discriminación, a través de actitudes sociales y de los obstáculos materiales del entorno. La educación es uno de los desafíos más importantes de este tiempo y de ello nos ocuparemos en este trabajo.Tanto desde el punto de vista etimológico como filosófico se advierte que la educación nos permite desenvolvernos como persona y nos constituye como sujetos. Hoy incluso se tiende a considerar que la educación del hombre debe, no cesar nunca, transformándose solamente de acuerdo con las diversas edades, capacidades, intereses, etc.Desde el Derecho se observa que sin condiciones materiales y normativas específicamente referidas a la educación de las personas vulnerables resulta difícil garantizar el proceso de personalización que ella genera con su práctica.En Argentina las personas de edad y aquellas que están en situación de discapacidad son las más excluidas de la educación en el nivel universitario, afectando ello su afán de progreso y disminuyendo su calidad de vida de manera radical. La causal de este fenómeno de exclusión educativa es la existencia de barreras: físicas, en la comunicación, tecnológicas y psico-socio-culturales, tan arraigadas en el inconsciente colectivo, que ni siquiera la ley en ciertas ocasiones ha podido eliminar, impidiendo así, el ejercicio del derecho a la educación superior a los fines del cumplimiento del valor justicia.En este trabajo abordaremos el estudio de las razones que sostienen la disociación que hoy

  10. REDVET está indexada en Scirus

    Directory of Open Access Journals (Sweden)

    veterinaria.org

    2009-01-01

    Full Text Available ResumenA veces, la búsqueda en Internet de artículos científicos se convierte en una pesadilla, por lo que es conveniente recurrir a buscadores temáticos y en este aspecto Scirus es una buena opción ya que es uno de los mejores buscadores de temática científica de la Red pues busca en más de 450 millones de páginas web científicas con una búsqueda muy rápida y con resultados sorprendentes.

  11. Internacionalização ou transnacionalização da educação superior: entre a formação de um campo social global e um mercado de ensino mundializado

    Directory of Open Access Journals (Sweden)

    Mario Luiz Neves de Azevedo

    2015-10-01

    Full Text Available Este artigo tem por objetivo analisar os fenômenos da internacionalização e da transnacionalização da educação superior. Metodologicamente, baseado na teoria dos campos de Pierre Bourdieu, explora-se a contradição entre “união” e “interseção” de campos sociais de educação superior.

  12. Acreditação e qualidade da educação superior : abrindo a caixa-preta do sistema de acreditação de cursos superiores do Mercosul

    OpenAIRE

    Serikawa, Leonardo Kazuo dos Santos

    2014-01-01

    Criada em 2009, a Rede de Agências Nacionais de Acreditação (RANA) tem como função aprofundar a integração do MERCOSUL por meio do Sistema de Acreditação de Cursos Superiores (ARCU-SUL). Ante a importância dessa rede, o objetivo principal desta dissertação é conhecer o papel desempenhado por ela no reconhecimento da qualidade da educação superior no MERCOSUL. Entre seus alvos estão estabelecer critérios regionais de qualidade de cursos de graduação para a melhoria permanente da formação super...

  13. 2010 Great Lakes Restoration Initiative Bathymetric Lidar: Lake Superior

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The data contained in this file contain hydrographic and topographic data collected by the Fugro LADS Mk II system along the Lake Superior coast of Minnessota,...

  14. 28 CFR 2.60 - Superior program achievement.

    Science.gov (United States)

    2010-07-01

    ... OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2... or a case with both superior program achievement and minor disciplinary infraction(s)). Advancements...

  15. Coronary artery bypass and superior vena cava syndrome.

    Science.gov (United States)

    Thomas, T V; Masrani, K; Thomas, J L

    1999-01-01

    Superior vena cava syndrome is the obstruction of the superior vena cava or its main tributaries by benign or malignant lesions. The syndrome causes edema and engorgement of the vessels on the face, neck, and arms, nonproductive cough, and dyspnea. We discuss the case of a 48-year-old obese diabetic woman who was admitted with unstable angina. She had previously been diagnosed with superior vena cava syndrome. Urgent coronary artery bypass grafting was necessary Although thousands of coronary artery bypasses are performed every year, there are not many reports on patients with superior vena cava syndrome who successfully undergo cardiopulmonary bypass and coronary artery grafting with an internal mammary artery as the conduit. The results of the case and alternative recommended methods are discussed.

  16. AUMENTO DE COROA CLÍNICA ESTÉTICO SUPERIOR COM FRENOPLASTIA LABIAL

    Directory of Open Access Journals (Sweden)

    Hanna Alves Magalhães

    2017-08-01

    Full Text Available A odontologia estética vem ganhando cada vez mais espaço. Problemas de gengiva são classificados de forma muito negativa para os pacientes. Sendo considerado uma condição desagradável, o sorriso gengival representa uma situação onde a gengiva aparece de forma excessiva quando o paciente sorri, e pode ser causado por alguns fatores, como a erupção passiva alterada. Além do sorriso gengival, a inserção baixa do freio também pode resultar em defeitos estéticos e mudanças na estrutura periodontal. Os tratamentos de eleição para estes problemas são respectivamente: aumento de coroa clínico estético com ou sem osteotomia e frenoplastia/frenectomia. Uma revisão de literatura com relato de caso. Procedimento cirúrgico feito na ABO de Montes Claros, em um único tempo clínico, sob supervisão dos professores coordenadores, e realizada pelas alunas de aperfeiçoamento de Cirurgia Periodontal. A cirurgia de aumento de coroa clinica estético superior com osteotomia do dente 14 ao 24, e prévia frenoplastia, em um único tempo cirúrgico. Com ganho de inserção de 2 mm pela osteotomia em quase todos os dentes, além do aumento da coroa clinica pela gengivectomia. Para a correção do sorriso gengival, o aumento de coroa clínico estético com osteotomia, se mostrou muito benéfico, assim como para o tratamento da inserção baixa do freio, a frenoplastia. Assim como, esses problemas influenciam na autoestima dos pacientes, a sua resolução, os deixam bastante satisfeitos, como neste relato de caso.

  17. Maestros en educación superior: un estudio de egresados

    Directory of Open Access Journals (Sweden)

    Torres Luna, Oliva

    2006-12-01

    Full Text Available Resumen:Para lograr una educación de excelencia que lleve a formar a los profesionales del siglo XXI, es necesario fortalecer la cultura de superación y evaluación del proceso educativo por medio de instrumentos y mecanismos que permitan retroalimentar la calidad de este proceso; uno de ellos es a través de la caracterización de la práctica profesional, la cual es definida como la aplicación concreta y autónoma de una profesión, en un lugar, tiempo y circunstancias determinadas. En este sentido, corresponde un papel central a la educación, ya que los profesionistas formados en las instituciones de enseñanza superior tienen que demostrar sus capacidades, conocimientos, habilidades y responsabilidades en el ejercicio profesional, compitiendo en unespacio laboral inestable.El enfoque de la presente investigación fue cuantitativo, con la intención de detectar el impacto que han tenido los egresados de la Maestría en Educación Superior de la Benemérita Universidad Autónoma de Puebla. Este trabajo permitió obtener información significativa y relevante que conlleva a fortalecer el vínculo práctica profesional-formación profesional, lo que permitirá tener parámetros significativos para adecuar el plan de estudio que actualmente se desarrolla en la formación de Maestros en Educación Superior.Abstract:To achieve an excellence education that takes to form the professionals of the XXI century, it is necessary to strengthen the superation culture and evaluation of the educational process by means of instruments and mechanisms that allow feedback the quality of this process; one of them is through the characterization of the professional practice, which is defined as the concrete and autonomous application of a profession, in a place, time and certain circumstances. In this sense, it corresponds a central paper to the education, since the professional formed in the higher education institutions has to demonstrate their capacities

  18. Educación en Derechos Humanos y Educación Superior: una perspectiva controversial

    Directory of Open Access Journals (Sweden)

    Abraham Magendzo Kolstrein

    2015-01-01

    Full Text Available Este artículo, a partir de una postura crítica, muestra la importancia de introducir y reforzar —como desafío ético y político— la educación en derechos humanos en la educación superior. Para formar profesionales que contribuyan, desde sus campos de acción, a crear una cultura ciudadana y respetuosa de los derechos humanos. La sugerencia es incorporar los derechos humanos en el currículum, la pedagogía, la didáctica y la evaluación en una perspectiva controversial, que permita profundizar en las tensiones que tienen los derechos para de esta manera, formar sujetos dialogantes, empoderados y transformadores de la sociedad.

  19. El uso del utillaje en piedra en el final del Paleolítico Superior Peninsular

    Directory of Open Access Journals (Sweden)

    Juan José Ibañez Estévez

    2005-01-01

    Full Text Available En este artículo se presenta un balance de los estudios sobre la función del utillaje de piedra tallado en el final del paleolítico superior, en el ámbito pirenaico y cantábrico. En él se discuten los distintos niveles de inferencia en los que participa esta información desde las tecnicas (el reconocimiento de útiles usados, las relaciones entre forma y función, la organización tecnologica de la industria litica, los procesados en otras materias hasta la organización social y económica de los grupos de cazadores-recolectores (gestión del espacio, funcionalidad de las ocupaciones, planificación de las actividades, etc.

  20. Nuevos objetivos de la educacion superior: idealidad y realidad de la universidad publica en Mexico

    Directory of Open Access Journals (Sweden)

    Jimenez Gomez, E.

    2004-01-01

    Full Text Available Este ensayo plantea en términos generales que la educación como compromiso fundamental del estado no ha estado a la altura del reto del tercer milenio. Se pone énfasis en la educación superior pública sobre dos aspectos fundamentales: el meramente financiero al no contar con los recursos suficientes para satisfacer la demanda nacional; y el más importante desde el punto de vista del autor y que se refiere a la conceptualización de la propia universidad, su función social tradicional y los nuevos objetivos que el autor propone para un auténtico Sistema Nacional de Educación que contribuya a resolver los problemas más urgentes de nuestra sociedad.

  1. Frenectomia labial superior : variação de técnica cirúrgica

    OpenAIRE

    Puricelli,Edela

    2001-01-01

    A autora apresenta modificação da técnica de ARCHER para tratamento cirúrgico do freio ou frênulo labial superior hipertrófico (FLS). Foram modificados os sítios de incisão, através do uso de pinça de Halstead reta e curva. Associando-se a fricção intra-septal por compressa de gaze na fenda mediana, possibilita-se a remoção vestíbulo-palatina dos resíduos teciduais do freio, periósteo e fibra transseptais. Se necessário, permite a osteotomia no mesmo ato cirúrgico. Está indicada como terapia ...

  2. Frenectomia labial superior : variação de técnica cirúrgica

    OpenAIRE

    Puricelli, Edela

    2001-01-01

    A autora apresenta modificação da técnica de ARCHER para tratamento cirúrgico do freio ou frênulo labial superior hipertrófico (FLS). Foram modificados os sítios de incisão, através do uso de pinça de Halstead reta e curva. Associando-se a fricção intra-septal por compressa de gaze na fenda mediana, possibilita-se a remoção vestíbulo-palatina dos resíduos teciduais do freio, periósteo e fibra transseptais. Se necessário, permite a osteotomia no mesmo ato cirúrgico. Está indicada como terapia ...

  3. Reformas sin mejora: las leyes de fiscalización superior en Jalisco

    Directory of Open Access Journals (Sweden)

    Aimée Figueroa Neri

    2013-01-01

    Full Text Available En este trabajo se analiza la evolución del ordenamiento jurídico de la fiscalización superior de Jalisco, México, del año 2000 al 2009 en materia de rendición de cuentas, con el referente de la legislación federal de ese mismo periodo y el contexto nacional. El objetivo es valorar si las reformas a las normas jurídicas jaliscienses apuntaron hacia la mejora de la estructura y sistema de rendición de cuentas. También se incluyen los principales avances detectados, los retrocesos y las áreas de riesgo para el control de los recursos públicos.

  4. A (In Constitucionalidade da Súmula 385 Superior Tribunal de Justiça

    Directory of Open Access Journals (Sweden)

    Valmir

    2013-07-01

    Full Text Available O presente artigo busca analisar, à luz do fundamento da dignidade da pessoa humana e dos direitos e garantias fundamentais consagrados pela Constituição Federal de 1988, a constitucionalidade da Súmula 385, editada do Superior Tribunal de Justiça (STJ. Este enunciado veda ao consumidor que possua pelo menos um registro legítimo em órgão de proteção crédito exigir judicialmente indenização por dano moral em face de posterior anotação, ainda esta última seja irregular. O método de abordagem utilizado nesta pesquisa é o dedutivo, de procedimento cientifico, com utilização de técnicas de pesquisas bibliográfica e jurisprudencial.

  5. Diseño de un plan de comunicación organizacional interna y externa para una institución de educación superior

    OpenAIRE

    Bermúdez Santana, Daniela Judith

    2015-01-01

    1. Introducción. -- 2. Planteamiento de la Propuesta de Trabajo. -- 3. Marco Teórico. -- 4. Metodología. -- 5. Resultados. -- 6. Conclusiones y Recomendaciones Este trabajo de investigación tiene como objetivo fundamental Diseñar un Plan de Comunicación Organizacional Interna y Externa para una Institución de Educación Superior, planteamiento que surge de la necesidad de afrontar los continuos procesos de cambio que atraviesan las instituciones de educación superior, al presentarse nuevos ...

  6. Visión general de las percepciones regionales sobre el rol de la educación superior para el desarrollo humano y social

    OpenAIRE

    Sanyal, Bikas C; López Segrera, Francisco

    2008-01-01

    Nuestro informe ha estudiado en su Parte I temas globales seleccionados acerca del rol de la educación superior para el desarrollo humano y social. Este trabajo es una síntesis de las perspectivas regionales -África Subsahariana, Estados Árabes, Asia y el Pacífico, Europa, América del Norte y América Latina y el Caribe- acerca del rol de la educación superior para el desarrollo humano y social basado en la contribución de los autores en cinco áreas claves: una de ellas es el estado de la ...

  7. Caracterización del desempeño en actividades de la vida diaria en adultos con lesión de miembro superior

    OpenAIRE

    Bernal Salamanca, Andrea Estefanía; Fuquen Fraile, Diana Marcela; Valenzuela Murillo, Edwin Alfonso

    2013-01-01

    Los antecedentes investigativos en torno a la rehabilitación de miembro superior han evidenciado que existe un mínimo abordaje de las actividades de la vida diaria tras la alteración funcional de este segmento por lesión, por lo cual el objetivo de la investigación es caracterizar el desempeño ocupacional de los adultos con lesión de miembro superior en el laboratorio de Terapia Ocupacional – área de tecnología y autonomía personal (TAP) de la Universidad Nacional de Colombia, ...

  8. Perfiles psicológicos vinculados a la ansiedad escénica entre diferentes conservatorios superiores de música españoles

    OpenAIRE

    Francisco Javier Zarza Alzugaray; Óscar Casanova López; Santos Orejudo Hernández

    2016-01-01

    Se expone una investigación que analiza las diferencias encontradas en distintas variables psicológicas y de corte personal en función del centro de estudios al que pertenecen alumnos españoles de Grado Superior de Música. La muestra está compuesta por 482 estudiantes de 5 centros superiores, obtenida a partir de un criterio de disponibilidad muestral. Para la evaluación de los diferentes constructos psicológicos y variables contextuales y pedagógicas, se ha empleado un cuestionario realizado...

  9. A qualidade da educação superior e o complexo exercício de propor indicadores

    Directory of Open Access Journals (Sweden)

    MARILIA COSTA MOROSINI

    2016-01-01

    Full Text Available Este artículo sintetiza algunas reflexiones acerca de la calidad de la educación superior realizadas por el Projeto Observatório da Educação Superior, de sarrollado por la Rede Sulbrasileira de Investigadores de Educação Superior – RIES/CAPES/INEP. La metodología, con diferentes procedimientos cuanti-cualitativos, apunta la complejidad de proponerse indicadores de evaluación que asumen el carácter contextualizado y temporal de la universidad y la multirreferencialidad como valor. La análisis de los datos es acompañada de interpretación teórica general del proyecto y específica de ejes que relacionan la calidad de la educación superior a los temas de internacionalización, gestión, enseñanza de grado, innovación, formación y desarrollo profesional docente. De esta manera, se construyen indicadores que auxilian la percepción acerca de la calidad y ofrecen contribuciones.

  10. Las licenciaturas en Jalisco, México: crecimiento, diversificación y complejización de la educación superior y su impacto en la pertinencia

    OpenAIRE

    María Luisa Chavoya Peña; Sonia Reynaga Obregón

    2011-01-01

    Este artículo tiene como objetivo fundamental dar cuenta de la pertinencia de la formación de estudiantes de nivel superior, a partir del trabajo de campo que realizamos sobre la educación superior en Jalisco, uno de los estados más importantes de México. El tema de la pertinencia se ha establecido como una de las políticas que el gobierno federal ha promovido, algunas veces, de manera insistente. Asimismo, hemos visto que esta política está íntimamente relacionada con la cobertura, y la dive...

  11. Análise da dieta das larvas de 4º estádio de Cricotopus sp. (Diptera: Chironomidae, em diferentes substratos artificiais e fases hídricas, no trecho superior do rio Paraná - DOI: 10.4025/actascibiolsci.v31i4.3522 Diet analysis of Cricotopus sp. larvae (Diptera: Chironomidae, fourth stage, in different artificial substrates and hydrological phases, in the upper Paraná river - DOI: 10.4025/actascibiolsci.v31i4.3522

    Directory of Open Access Journals (Sweden)

    Alice Michiyo Takeda

    2009-08-01

    Full Text Available No Brasil, estudos sobre hábitos alimentares das larvas de Chironomidae ainda são escassos e estas informações são importantes para entender a estrutura trófica e a organização dos ecossistemas aquáticos. Neste estudo, teve-se como objetivo identificar os principais itens alimentares ingeridos por Cricotopus sp. e comparar as possíveis diferenças na dieta das larvas em diferentes substratos artificiais e fases hídricas. Foram utilizados quatro tipos de substratos artificiais: madeira em forma de X (MADX, placas de nitacetal em forma de X (NITX, PVC em forma de tubo (PVCT e metal galvanizado em forma de tubo (METT, cada um com três réplicas. As coletas foram realizadas quinzenalmente, entre os meses de agosto de 2004 e dezembro de 2005. A dieta de Cricotopus sp. foi constituída por detritos, algas e hifas de fungos. Detrito foi o principal item alimentar, com valores superiores a 50% do total consumido. Os resultados indicaram que Cricotopus sp. é uma espécie coletora e, independentemente do substrato, as larvas alimentam-se dos recursos disponíveis no ambiente. Entretanto, mudanças no regime hidrológico do rio Paraná podem influenciar a disponibilidade de alimento, principalmente algumas diatomaceas como Melosira sp., consumidas em maior quantidade apenas na fase de águas baixasIn Brazil, studies on the diet of Chironomidae larvae are still scarce and these data are important to understand the trophic structure and organization of aquatic ecosystems. In this study, we identified the main food items consumed by Cricotopus sp. and compared possible differences in the larval diet at different artificial substrates and hydrological phases. We used four types of artificial substrates: X-shaped wood (MADX; X-shaped nitacetal plates (NITX; tube-shaped PVC (PVCT and tube-shaped galvanized metal (METT, each with three replicates. Samplings were undertaken fortnightly, between August 2004 and December 2005. Cricotopus sp. diet was

  12. Superior memorizers employ different neural networks for encoding and recall.

    Science.gov (United States)

    Mallow, Johannes; Bernarding, Johannes; Luchtmann, Michael; Bethmann, Anja; Brechmann, André

    2015-01-01

    Superior memorizers often employ the method of loci (MoL) to memorize large amounts of information. The MoL, known since ancient times, relies on a complex process where information to be memorized is bound to landmarks along mental routes in a previously memorized environment. However, functional magnetic resonance imaging data on groups of trained superior memorizer are rare. Based on the memorizing strategy reported by superior memorizers, we developed a scheme of the processes successively employed during memorizing and recalling digits and relate these to brain activation that is specific for the encoding and recall period. In the examined superior memorizers several regions, suggested to be involved in mental navigation and digit-to-word processing, were specifically activated during encoding: bilateral early visual cortex, retrosplenial cortex, left parahippocampus, left visual cortex, and left superior parietal cortex. Although the scheme suggests that some steps during encoding and recall seem to be analog, none of the encoding areas were specifically activated during the recall. Instead, we found strong activation in left anterior superior temporal gyrus, which we relate to recalling the sequential order of the digits, and right motor cortex that may be related to reciting the digits.

  13. Superior Memorizers Employ Different Neural Networks for Encoding and Recall

    Directory of Open Access Journals (Sweden)

    Johannes eMallow

    2015-09-01

    Full Text Available Superior memorizers often employ the method of loci (MoL to memorize large amounts of information. The method of loci, known since ancient times, relies on a complex process where information to be memorized is bound to landmarks along mental routes in a previously memorized environment. However, fMRI data on groups of trained superior memorizer are rare. Based on the memorizing strategy reported by superior memorizers we developed a scheme of the processes successively employed during memorizing and recalling digits and relate these to brain activation that is specific for the encoding and recall period. In the examined superior memorizers several regions, suggested to be involved in mental navigation and digit-to-word processing, were specifically activated during encoding: bilateral early visual cortex, retrosplenial cortex, left parahippocampus, left visual cortex, and left superior parietal cortex. Although the scheme suggests that some steps during encoding and recall seem to be analog, none of the encoding areas were specifically activated during the recall. Instead, we found strong activation in left anterior superior temporal gyrus, which we relate to recalling the sequential order of the digits, and right motor cortex that may be related to reciting the digits.

  14. Differential diagnosis of cervical radiculopathy and superior pulmonary sulcus tumor

    Institute of Scientific and Technical Information of China (English)

    GU Rui; KANG Ming-yang; GAO Zhong-li; ZHAO Jian-wu; WANG Jin-cheng

    2012-01-01

    Background The result would be disastrous if the superior pulmonary sulcus tumor (Pancoast tumor) was misdiagnosed as degenerative cervical spine diseases.The aim of this study was to investigate the differential diagnosis methods of cervical radiculopathy and superior pulmonary sulcus tumor.Methods Clinical manifestations,physical,and radiological findings of 10 patients,whose main complaints were radiating shoulder and arm pain and later were diagnosed with superior pulmonary sulcus tumor,were reviewed and compared with those of cervical radiculopathy.Results Superior pulmonary sulcus tumor patients have shorter mean history and fewer complaints of neck pain or limitation of neck movement.Physical examination showed almost normal cervical spine range of motion.Spurling's neck compression test was negative in all patients.Anteroposterior cervical radiographs showed the lack of pulmonary air at the top of the affected lung in all cases and first rib encroachment in one case.The diagnosis of superior pulmonary sulcus tumor can be further confirmed by CT and MRI.Conclusions By the method of combination of history,physical examination,and radiological findings,superior pulmonary sulcus tumor can be efficiently differentiated from cervical radiculopathy.Normal motion range of the cervical spine,negative Spurling's neck compression test,and the lack of pulmonary air at the top of the affected lung in anteroposterior cervical radiographs should be considerad as indications for further chest radiograph examinations.

  15. Signaling pathways in a Citrus EST database

    Directory of Open Access Journals (Sweden)

    Angela Mehta

    2007-01-01

    Full Text Available Citrus spp. are economically important crops, which in Brazil are grown mainly in the State of São Paulo. Citrus cultures are attacked by several pathogens, causing severe yield losses. In order to better understand this culture, the Millenium Project (IAC Cordeirópolis was launched in order to sequence Citrus ESTs (expressed sequence tags from different tissues, including leaf, bark, fruit, root and flower. Plants were submitted to biotic and abiotic stresses and investigated under different development stages (adult vs. juvenile. Several cDNA libraries were constructed and the sequences obtained formed the Citrus ESTs database with almost 200,000 sequences. Searches were performed in the Citrus database to investigate the presence of different signaling pathway components. Several of the genes involved in the signaling of sugar, calcium, cytokinin, plant hormones, inositol phosphate, MAPKinase and COP9 were found in the citrus genome and are discussed in this paper. The results obtained may indicate that similar mechanisms described in other plants, such as Arabidopsis, occur in citrus. Further experimental studies must be conducted in order to understand the different signaling pathways present.

  16. La mujer colombiana en la ciencia y la tecnología ¿Se está cerrando la brecha?

    Directory of Open Access Journals (Sweden)

    Tovar Rojas, Patricia

    2008-10-01

    Full Text Available This document presents quantitative and qualitative evidence of gender disparities in Colombia, in relation to access to higher education, and to the science and technology system. It shows the results of a project that collected the main statistical indicators, such as access to research resources, decision-making positions, salaries, scholarships, raises, and in general growing possibilities that women scientist have in their careers, vis-a-vis men. In addition to statistical data, the article analyzes ethnographic material gathered in relation to the personal trajectories, training, work development, and family issues affecting women, as a way to identify and eliminate the main obstacles they face in their careers as scientists. One of the findings of the project was that despite the fact that major bias and prejudice against women is almost gone from the science and technology system in Colombia, low level, micro discriminative practices are still very common.Este documento presenta evidencia cuantitativa y cualitativa sobre las desigualdades de género en el acceso a la educación superior y al sistema de ciencia y tecnología en Colombia. Se presentan los resultados de un proyecto donde se recogieron los principales indicadores, como el acceso a los recursos para la investigación, a los puestos de decisión, los salarios, las becas, los ascensos y en general las posibilidades de crecimiento que tienen las mujeres frente a los hombres, en sus carreras como científicas. Además de la información estadística se recogieron datos etnográficos relacionados con las trayectorias personales, entrenamiento, desarrollo laboral, y los asuntos relacionados con la familia y cómo éstos las afectan; con el fin de identificar los principales obstáculos que ellas encuentran en su trabajo científico. Uno de los hallazgos de este proyecto fue que a pesar de que los grandes prejuicios y sesgos de género están casi fuera del sistema de ciencia y

  17. EL FOMENTO DE ESTILOS DE VIDA SALUDABLES ENTRE LOS ESTUDIANTES DE LA EDUCACIÓN SUPERIOR

    Directory of Open Access Journals (Sweden)

    Mario Enrrique Haro Salazar

    2016-07-01

    Full Text Available  La promoción de la salud constituye una estrategia fundamental que contribuye a preparar al individuo para alcanzar un estado de salud y de bienestar óptimos, a través de actuaciones que mejoren los determinantes de la salud, como son los estilos de vida y los entornos saludables. Este propósito se logra a través de una educación que propicie la transmisión de contenidos relacionados con el cuidado de la salud y el comportamiento ante situaciones de riesgo, el control de las enfermedades, los cambios de conductas y hábitos de vida, de modo tal que se potencie la asunción de estilos de vidas saludables. En el artículo se analiza la importancia de este aspecto y las condiciones que permiten su despliegue en las instituciones de educación superior. PALABRAS CLAVE: promoción de la salud; estilos de vidas; educación superior. THE PROMOTION OF HEALTHY LIFESTYLES BETWEEN HIGHER EDUCATION STUDENTS ABSTRACT The promotion of health is a fundamental strategy that contributes to prepare the individual to reach an optimal state of health and well-being, through actions that improve the determinants of health, such as lifestyles and healthy environments. This purpose is achieved through an education that facilitates the transmission of contents related to health care and behavior in situations of risk, disease control, behavior changes and life habits, so that Enhance the assumption of healthy lifestyles. The article analyzes the importance of this aspect and the conditions that allow its deployment in institutions of higher education. KEYWORDS: health promotion; Lifestyles; higher education.

  18. Motivación para Estudiar en Jóvenes de Nivel Medio Superior

    Directory of Open Access Journals (Sweden)

    Ariadna Crisantema Martínez-Hernández

    2010-01-01

    Full Text Available El propósito de esta investigación fue identificar cuáles eran los motivos por los que los estudiantes de nivel medio superior -de una Universidad Privada situada en la ciudad de León Guanajuato- deseaban continuar estudiando. Con este fin, se les solicitó que dieran respuesta a la pregunta ¿cuáles son las razones por las que quieres seguir estudiando? -perteneciente a una ficha sociodemográfica- seleccionando de una lista de opciones aquellas que correspondían a su situación personal. La encuesta se aplicó a 961 estudiantes de primer ingreso de nivel medio superior de los cuales 411 eran hombres (medadH=15.19 +.53 y 540 eran mujeres (medadM=15.09 +.39. Para el análisis de la información en primer lugar se construyeron las distribuciones de frecuencia y posteriormente se calculó la prueba de independencia de variables Ji Cuadrada. En los resultados se observa primero, que los participantes se encuentran dentro de lo que se considera una trayectoria educativa normal. Segundo, los principales motivos por los que los estudiantes desean continuar estudiando son: deseo de superación, deseo de ganar bien cuando sean profesionistas, tener interés en el estudio, obtener prestigio en el largo plazo e independizarse de la familia. Tercero, el género matiza el orden en que se eligen los motivos. De lo anterior se concluye que existe un perfil motivacional para dar continuidad a los estudios, este perfil es diferenciado por el sexo y se mantiene la idea de que un mayor nivel de escolaridad proveerá en el futuro una mejor calidad de vida.

  19. Do discurso e das condicionalidades do Banco Mundial, a educação superior "emerge" terciária

    Directory of Open Access Journals (Sweden)

    Raquel Goulart Barreto

    2008-01-01

    Full Text Available El artículo discute los cambios en la educación superior producidos por la recontextualización del discurso del Banco Mundial en Brasil, considerando los modos por los cuales las condiciones establecidas han sido convertidas en prácticas políticas. Está estructurado en dos partes. La primera, centrada en la materialidad del discurso, analiza las publicaciones que el banco identifica como clave para la educación superior, a partir de las marcas designadas del "discurso de las emergencias". La segunda parte aborda la materialidad del nuevo imperialismo, explícita las contradicciones que lo sustentan y enfoca las condiciones de producción del dislocamiento del modelo universitario para el terciario.

  20. La Fiscalización Superior en México: una propuesta en el contexto de la gobernanza

    Directory of Open Access Journals (Sweden)

    Guajardo-Cantú, Gerardo

    2011-08-01

    Full Text Available En la presente ponencia se analizará la función de fiscalización superior en México desde la perspectiva de la autonomía que tienen dichas entidades para el ejercicio de dicha función y de las facultades sancionatorias que le otorgan las leyes en la materia. La ponencia identifica la necesidad de reformar las leyes de fiscalización en México con instrumentos que incrementen la efectividad del trabajo de las EFS y con esquemas que privilegien la participación ciudadana en dicha función. Asimismo, en este documento se expone la pertinencia de analizar esta función desde la perspectiva académica, como un medio de identificar y proponer mejoras para configurar en México una propuesta de un nuevo modelo de fiscalización superior en el contexto de la gobernanza.

  1. Expansão e oligopolização da educação superior no Brasil

    OpenAIRE

    Marques, Waldemar

    2013-01-01

    Este texto analisa a expansão da educação superior no Brasil num período que cobre mais de meio século, com destaque para os governos que se seguem ao golpe militar de 1964 até os dias atuais. Aborda o crescimento constante do setor privado da educação superior no país destacando seu processo de concentração em grandes grupos educacionais, configurando-se como oligopólios que extrapolam fronteiras nacionais e ampliam seu poder mediante operações na bolsa de valores. Aborda também o papel do E...

  2. Veia cava superior esquerda anômala com ausência de veia cava superior direita: achados de imagem Persistent left superior vena cava with absent right superior vena cava: image findings

    Directory of Open Access Journals (Sweden)

    Cyrillo Rodrigues de Araújo Júnior

    2003-10-01

    Full Text Available A persistência da veia cava superior esquerda com ausência da veia cava superior direita é uma anomalia rara, com menos de 150 casos descritos na literatura. A não-obliteração e regressão da veia cardinal anterior esquerda durante o desenvolvimento embriológico promove uma variação sistêmica de retorno venoso ao coração, com persistência da veia cava superior esquerda. Sua incidência varia de 0,3% em pacientes sem alterações cardíacas congênitas concomitantes a 4,3% naqueles com cardiopatias. Na maioria das vezes coexiste a veia cava superior direita, porém se houver regressão e degeneração da veia cardinal anterior direita, implicará a sua ausência e a drenagem venosa para o coração será feita pela veia cava superior esquerda ao átrio direito, através do seio coronariano. Mostramos um caso de um paciente submetido a radiografia de tórax e tomografia computadorizada para avaliação de doença pulmonar obstrutiva crônica, tendo como achado a persistência da veia cava superior esquerda com ausência da direita, sem qualquer cardiopatia associada e com a drenagem cardíaca sendo feita, através do seio coronariano, para o átrio direito.Persistent left superior vena cava with absent right superior vena cava is a rare anomaly, with less than 150 cases reported in the literature. Congenitally persistent left superior vena cava is the most common variant of systemic venous return to the heart, resulting embryologically from failure of the left anterior cardinal vein to become obliterated. Its incidence varies from 0.3% in patients with otherwise normal heart to 4.3% in patients with congenital heart disease. In the majority of the patients, a right superior vena cava is present as well, but rarely the right anterior cardinal vein degenerates resulting in the absence of the normal right superior vena cava. The blood from the right side is carried by the persistent left superior vena cava to the right atrium through the

  3. Gestión de proyectos digitales bajo el estándar PMBOK®

    OpenAIRE

    García Vas, Ricardo

    2016-01-01

    The objective of this final degree project is introduce the PMBOK® standard for the management of a project in a communication and technology company. El siguiente proyecto final de carrera tiene como objetivo la implementación del estándar PMBOK® para la gestión de un proyecto en una empresa de comunicación y tecnología. El següent projecte final de carrera té com a objectiu la implementació de l'estàndard PMBOK® per a la gestió d'un projecte en una empresa de comunicació i tecnologia....

  4. Actualización sobre aplicaciones de la toxina botulínica en estética facial

    Directory of Open Access Journals (Sweden)

    J.M. Alcolea López

    Full Text Available En la actualidad, la toxina botulínica (TB es parte importante en los tratamientos médico-estéticos de la cara. Este trabajo hace una aproximación didáctica, con fines prácticos formativos, sobre el manejo de la TB para el rejuvenecimiento facial en el ejercicio de la Cirugía Plástica y Estética. Entender la anatomía del envejecimiento es clave para manejar de forma integral la TB junto con otras técnicas de la especialidad destinadas a combatir el envejecimiento, considerándolo en su conjunto. Resumimos los conocimientos actuales sobre el empleo de las inyecciones de TB en el tercio superior de la cara.

  5. Clinical evidence for the superior efficacy of a dentifrice containing 8.0% arginine and calcium carbonate in providing instant and lasting relief of dentin hypersensitivity.

    Science.gov (United States)

    Cummins, D

    2011-01-01

    This paper briefly discusses recent scientific and clinical research validating the effectiveness of a toothpaste containing 8.0% arginine and calcium carbonate, known as Pro-Argin technology, including clinical evidence for the superior efficacy of this toothpaste versus a potassium-based desensitizing toothpaste. It also introduces new clinical data which prove that a toothpaste containing 8.0% arginine and calcium carbonate delivers superior instant and lasting relief of dentin hypersensitivity compared to a toothpaste containing 8% strontium acetate.

  6. LA FISCALIZACIÓN SUPERIOR A NIVEL SUBNACIONAL EN MÉXICO. UNA EVALUACIÓN DEL DESEMPEÑO DE LAS ENTIDADES DE FISCALIZACIÓN SUPERIOR (EFS) LOCALES

    OpenAIRE

    Anahí Gutiérrez Luna

    2015-01-01

    Actualmente, las Entidades de Fiscalización Superior (EFS) locales en México presentan diferencias importantes no sólo en su diseño institucional y en su evolución estructural, sino en el desempeño de sus capacidades, cobertura y efectividad. Por ello, el objetivo principal de este texto es explicar los factores que determinan las diferencias en el desempeño de las EFS a nivel subnacional. Se parte de la hipótesis de que esas diferencias se explican a partir de factores externos e internos a ...

  7. O “engavetamento” de modelos de ensino superior dentro da universidade pública

    Directory of Open Access Journals (Sweden)

    Silvia Beatriz Adoue

    2014-11-01

    Full Text Available Este artigo trata das contradições entre modelos de educação superior que se sucedem no Brasil e que convivem de maneira conflitante hoje na universidade brasileira. O conglomerado de instituições isoladas, a universidade integrada e multifuncional e a universidade-empresa, prestadora de serviços. Esse último modelo tenta integrar as instituições de ensino superior às cadeias produtivas dominadas pelo grande capital. As universidades públicas estariam destinadas a prestar serviços de inovação e formar os quadros pesquisadores para tal atividade. A formação de força de trabalho especializada seria tarefa fundamentalmente das universidades privadas. Mas, em todo caso, o ônus dessa formação recairia sobre os estudantes. Esse modelo vem sendo impulsionado a partir dos anos de 1990, com os “manuais de instruções” do Banco Mundial, e nos anos 2000, com as recomendações do FMI e, no caso das universidades ibero-americanas, pela Fundação Universia, patrocinada pelo Banco Santander. A questão que permanece é se a universidade conseguirá organizar as forças produtivas das quais dispõe em torno de objetivos de pesquisa e formação de quadros para um desenvolvimento independente.

  8. Fauna de mamiferos del pleistoceno superior del yacimiento de las Majolicas (Granada

    Directory of Open Access Journals (Sweden)

    Alberdi, Mª T.

    2004-12-01

    Full Text Available In this paper we describe the fossils of macromarnmals provided by Las Majolicas site (Granada, Spain. This site was excavated in the 50's by E. Aguirre. The high frecuency of cervids with 469 fossils identified out of 558 is remarkable. We have compared Cervus elaphus from Las Majolicas with others that belong to the Cantabrian Range and we can conclude that they have smaller sizes, a fact which can be related to the more meridional situation of the site. According to the fauna that appears in Las Majolicas this site might be located in the Upper Pleistocene.En este trabajo se describen los fósiles de macromamíferos del yacimiento de Las Majolicas (Granada, España, excavado en la década de los cincuenta por E. Aguirre. En él predominan los cérvidos, con 469 restos identificados de un total de 558. Los restos de Cervus elaphus al compararlos con otros ejemplares del Pleistoceno superior de la Cordillera Cantábrica presentan un menor tamaño, lo cual podría indicar una reducción de la talla en relación al nivel más meridional de esta localidad. La fauna presente en Las Majolicas indica su posible asignación al Pleistoceno Superior

  9. EVALUACIÓN DE COMPETENCIAS PROFESIONALES EN EDUCACIÓN SUPERIOR: RETOS E IMPLICACIONES

    Directory of Open Access Journals (Sweden)

    José Tejada Fernández

    2016-01-01

    Full Text Available En el contexto de cambio paradigmático en la educación superior, propi - ciado entre otras afectaciones por el proceso de convergencia europeo en la formación de profesionales, se ha erigido el perfil y las competencias profe - sionales como referentes de la formación de los mismos, conllevando automá - ticamente nuevos planteamientos en el diseño, desarrollo y evaluación de la misma. Con independencia de los mismos, en este artículo queremos centrar la mirada sencillamente, a modo de objetivo, en cuatro retos, entre otros, que conlleva particularmente la evaluación de las competencias profesionales, que van desde diferentes dimensiones (conceptual, desarrollo-reconstructiva, estratégica y operativa y a la vez considerar algunas implicaciones sobre los mismos. Es por ello, la necesidad de partir previamente de una conceptualización de competencias profesionales en la actualidad, clave para afrontar no solo su formación y desarrollo, sino también su propia evaluación, dando pie a nue - vas estrategias y dispositivos de evaluación de competencias profesionales so - bre los que se reflexiona y especifica en el contexto de la educación superior.

  10. Competencias profesionales de los académicos en la educación superior

    Directory of Open Access Journals (Sweden)

    Guillermo Yáber Oltra

    2011-01-01

    Full Text Available El desarrollo profesional de los profesores y los líderes universitarios es un proceso continuo en la educación superior. Docencia, investigación, servicio, desarrollo personal y gestión son las competencias profesionales que un académico puede desarrollar durante su carrera. Se desarrolló un instrumento de auto-reporte que permite analizar la discrepancia entre la maestría que el personal académico y directivo aprecia de sus competencias académicas, personales y de gestión así como la importancia que la institución les asigna. Se presentan dos casos de instituciones donde estos instrumentos se aplicaron a gerentes y académicos. Se analiza el uso de este instrumento para el desarrollo de políticas y prácticas de gestión del talento académico y gerencial de las instituciones de Educación Superior.

  11. MODELOS DE REDES DE EDUCACIÓN SUPERIOR A DISTANCIA EN MÉXICO

    Directory of Open Access Journals (Sweden)

    Rocío Amador Bautista

    2010-01-01

    Full Text Available Este artículo tiene como propósito analizar los sistemas de educación superior a distancia, en el contexto de los problemas de la educación superior en México, desde la perspectiva estructural del análisis social de las redes institucionales. El concepto de redes se aborda como una construcción simbólica o metafórica de la organización social, una construcción analítica y sintética de las estructuras de las relaciones e interacciones humanas y una construcción operativa y funcional de los sistemas de comunicación e información. El aporte del artículo es la construcción de tres modelos de redes a partir del análisis de los rasgos característicos de estos sistemas en tres universidades públicas.

  12. EL INTERÉS SUPERIOR DEL NIÑO EN LAS ADOPCIONES HOMOPARENTALES

    Directory of Open Access Journals (Sweden)

    Marianela Noel Sangalli

    2015-09-01

    Full Text Available En el presente trabajo nos propusimos analizar la posibilidad de las parejas homosexuales de adoptar niños. A pesar de no existir ningún elemento legal que lo impida, nuestro objetivo fue estudiarlo desde la perspectiva del interés superior del niño. A través de una investigación en torno a la legislación vigente, tanto a nivel nacional como internacional, así como también de ​diversos artículos doctrinarios y entrevistas realizadas, intentamos plasmar las diferentes visiones que imperan sobre la cuestión, algo que nos pareció muy interesante rescatar en esta época donde muchos antiguos paradigmas están cediendo lugar a los nuevos. Partiendo de la definición de conceptos como “familia” e “interés superior del niño”, pretendemos aportar una visión amplia de las distintas cuestiones en juego en una temática tan vigente.

  13. Radiografia intraoral e convencional da hemiarcada superior direita de gatos domésticos

    Directory of Open Access Journals (Sweden)

    A.C. Nepomuceno

    2013-02-01

    Full Text Available A proposta com este trabalho foi avaliar a hemiarcada superior direita de gatos domésticos por meio de técnicas radiográficas odontológicas do paralelismo, empregando-se filmes intraorais aos posicionadores de Han Shin. As imagens obtidas por essa metodologia foram correlacionadas com as técnicas radiográficas convencionais (extraorais, com o intuito de se estabelecerem vantagens ou desvantagens para detectar possíveis afecções dentais e periodontais. Foram utilizados 30 gatos, sem raça definida, 17 machos e 13 fêmeas, faixa etária entre um e três anos, confinados em gatis do Departamento de Zootecnia da Universidade Federal de Lavras/MG. Com os animais sob anestesia geral, foram realizadas radiografias da hemiarcada superior direita, incluindo três incisivos, um canino, três pré-molares e um molar em radiografias intraorais e extraorais. As imagens radiográficas foram analisadas e efetuaram-se comparações qualitativas entre pares intraorais e convencionais dos mesmos animais. Para se estabelecer a técnica radiográfica dental mais bem adaptada, foram realizadas análises estatísticas pelo teste de McNemar (qui-quadrado modificado. A técnica intraoral mostrou ser superior à extraoral (P<0,05, para achados referentes a espaço periodontal aumentado, canal radicular amplo e arredondamento de ápice, e também para a avaliação mais bem detalhada de dentes caninos, pré-molares e molares em gatos.

  14. A Estética do Marketing

    Directory of Open Access Journals (Sweden)

    Euler Alves Brandão

    2010-10-01

    Full Text Available

    A despeito da predominância das perspectivas inseridas no paradigma funcionalista, fruto de seu domínio no campo das ciências sociais, a constituição de uma teoria em marketing abriga, nos últimos anos, uma maior abertura para abordagens diferenciadas, dentre as quais o marketing estratégico ganha especial destaque. Numa visão normativa, o marketing estratégico prescreve como as decisões estratégicas de uma empresa devem ser tomadas, e, utilitariamente, como os melhores resultados e práticas devem ser perseguidos.

    Com isso, a abertura para a ocorrência de um movimento multidisciplinar para o desenvolvimento de novas perspectivas que tragam eficácia é incentivada, e nesse contexto resgata-se o debate acerca da estética, termo facilmente confundido com algo secundário e periférico, em virtude de não ser normalmente compreendido em sua plenitude.

    Este artigo apresenta a análise da experiência estética, resgatando-a a partir de sua origem filosófica, e demonstra seu poder de contribuição estratégica à prática do marketing, destacando-a como elemento constituinte da capacidade de julgamento, como potente ferramenta na obtenção de resultados.

  15. Revolución Cubana y educación superior The Cuban Revolution and higher education

    OpenAIRE

    Sinesio C. Santos Gutiérrez; Francisco López Segrera

    2007-01-01

    Los autores elaboran un panorama de la educación superior cubana de los últimos años, subrayando los desafíos económicos y políticos debidos a las dificultades que el gobierno de Cuba está enfrentando desde 1989 (la desaparición del campo socialista; el recrudecimiento del bloqueo de EE.UU, la crisis económica y social del Sur; la "victoria del neoliberalismo", la necesidad de insertarse en un nuevo tipo de mercado mundial global). El artículo analiza las demandas e indicadores de la educació...

  16. ANÁLISE DO ESPORTE COMO FERRAMENTA DE MARKETING NAS INSTITUIÇÕES DE ENSINO SUPERIOR: O CASO ULBRA

    OpenAIRE

    Leonardo Silva de Lima

    2007-01-01

    O esporte, com sua característica de envolvimento emocional e prazeroso com diferentes públicos, é constantemente utilizado no marketing envolvendo diferenciação, aproximação com clientes específicos e buscando desenvolver valores importantes fundamentais para o ambiente competitivo. Desta forma, este estudo objetivou analisar como o esporte foi inserido nas instituições de ensino superior e de que forma ele é utilizado no marketing, através do estudo de caso da Universidade Luterana do Brasi...

  17. La educación media superior a distancia en México y sus efectos para la equidad educativa

    OpenAIRE

    Francisco Javier Chávez Maciel; Ma. Trinidad Murguía Ángeles

    2010-01-01

    En este artículo se presenta una síntesis de la experiencia de la implantación de la educación media superior a distancia en México y sus efectos en la equidad para las poblaciones cuyas características geográficas, demográficas y sociales las marginan de la oferta educativa convencional. El estudio se enmarca en las políticas nacionales cuyos objetivos y estrategias se orientan hacia la ampliación de la oferta educativa con equidad, pertinencia y calidad, y con procedimientos relacionados co...

  18. UN ACERCAMIENTO, DESDE LA COMUNICACIÓN EDUCATIVA, AL USO DE LAS TIC EN LA EDUCACIÓN SUPERIOR.

    OpenAIRE

    Margarita Espinosa Meneses; Caridad García Hernández

    2014-01-01

    Las tecnologías digitales han irrumpido en los diversos ámbitos denuestras vidas. En elámbito educativo, estas herramientas han sido vistas como una opción que permiteincrementar la cobertura educativa a nivel superior en México, así como la calidadeducativa. Sin embargo diversos estudiosreflejan que su uso y adopción no ha sido deltodo satisfactoria. A partir de ello, este textorevisa un caso específico: el ámbito de losdocentes de laUAM.Se registra (con base en 36 entrevistas) que los docen...

  19. Autorregulación de aprendizajes en educación superior mediante la escritura de blogs

    OpenAIRE

    Portillo Vidiella, Maria Cinta; Pilar IRANZO GARCÍA; Rosselló Ramón, Maria Rosa

    2013-01-01

    La importancia de mecanismos de regulación de los propios aprendizajes por parte de los estudiantes, así como de la calidad de la retroalimentación y de la evaluación formativa por parte de los profesores está en las agendas internacionales de la calidad de la enseñanza superior. El uso de herramientas de lectura, escritura e interacción web 2.0 se enmarca claramente en ese propósito general. El artículo ofrece resultados de una investigación-acción interuniversitaria sobre la evaluación de c...

  20. Inclusâo de pessoas com deficência visual em instituiçôes de ensino superior

    OpenAIRE

    Ziesmann, Cleusa Inês

    2015-01-01

    Este artigo tem como proposta discutir e compreender a inclusão de deficientes visuais e cegos no Ensino Superior a partir do movimento dos docentes universitários e suas ações na sala de aula, seus entendimentos sobre a educação inclusiva e a sua atuação enquanto professores de acadêmicos com tal deficiência. O objetivo central é entender como acontece o processo de inclusão do acadêmico cego em uma universidade pública do interior do Rio Grande do Sul. Inicialmente procuramos...

  1. O regime militar brasileiro, a Escola Superior de Guerra e a geopolítica na Amazônia

    OpenAIRE

    Santos, Nelvio Paulo Dutra; Universidade Federal de Roraima. Curso de História

    2015-01-01

    Este artigo discorre sobre medidas do regime militar brasileiro (1964-1985) na Amazônia visando seu desenvolvimento e proteção, bem como suas origens ideológicas. Demonstra-se que as intervenções na região Amazônica tem origens remotas, mas que foram os militares que traçaram e executaram grandes Planos estruturantes, baseados em teorias geopolíticas, centradas nos pensadores da Escola Superior de Guerra. O contexto histórico mundial é o da Guerra Fria e o dos diferentes momentos por que pass...

  2. EL DEVENIR DE LA EDUCACIÓN MEDIA SUPERIOR. EL CASO DEL ESTADO DE MÉXICO

    OpenAIRE

    2009-01-01

    El referente principal de este trabajo es el nivel medio superior en México, conocido como bachillerato o preparatoria. Me propongo describir las formas en que se definen las políticas educativas en las últimas décadas a nivel nacional y cómo se modifican, como resultado de la presión ejercida por organismos internacionales de tendencias neoliberales, y cómo éstas finalmente se aplican y toman formas concretas en contextos regionales y locales, como es el caso de las escuelas preparatorias en...

  3. Onde está a antropologia?

    Directory of Open Access Journals (Sweden)

    Peirano Mariza G. S.

    1997-01-01

    Full Text Available Este artigo examina o cenário da antropologia contemporânea mediante o contraste entre quatro livros publicados nos últimos anos, dois nos Estados Unidos (After the Fact, de Clifford Geertz, e Making PCR, de Paul Rabinow e dois na Índia (Pathways, de T. N. Madan, e Critical Events, de Veena Das. A comparação é realizada no contexto de uma breve etnografia das livrarias norte-americanas, na qual se avaliam algumas publicações recentes, assim como a reclassificação de disciplinas tradicionais. O papel indispensável dos autores e obras considerados clássicos é examinado no contexto atual, finalizando com uma agenda para reflexão sobre as possibilidades de comunicação entre antropólogos de várias origens e vertentes.

  4. Judy Estes Hall (1940-2015).

    Science.gov (United States)

    Sammons, Morgan T; Boucher, Andrew

    2016-01-01

    Presents an obituary for Judy Estes Hall, who passed away on November 24, 2015. Hall served as the Executive Officer of the National Register of Health Service Psychologists until her retirement in 2013. She is a recognized expert in the development of education and training standards for the profession of psychology, she also made significant contributions in the field of international psychology, where she was a renowned expert in cross-national credentialing and an advocate for commonality in licensing standards. She was the coauthor of one edited volume and author of more than 60 journal articles, book chapters, and professional publications. A passionate advocate for the advancement of women in psychology, a devoted mother and grandmother, a connoisseur of wine and international traveler extraordinaire, she touched the personal and professional lives of many. (PsycINFO Database Record

  5. Claude Lévi-Strauss est mort…

    Directory of Open Access Journals (Sweden)

    Claude Dubar

    2009-11-01

    Full Text Available Ce mardi 3 novembre 2009 est jour de deuil dans la communauté des sciences humaines et sociales du monde entier et au-delà. Claude Lévi-Strauss vient de mourir alors qu’il allait avoir 101 ans. Il fut un des plus grands esprits du XXe siècle, à la fois anthropologue, philosophe, écrivain et humaniste. Il fait partie de ceux qui parvinrent à révolutionner la conception du temps des penseurs évolutionnistes occidentaux enfermés dans une pensée « progressiste » du temps issue de la philosophie d...

  6. Este mundo de la injusticia globalizada

    OpenAIRE

    Saramago, José

    2014-01-01

    La campana siguió sonando unos minutos más, y finalmente calló. Instantes después se abría la puerta y un campesino aparecía en el umbral. Pero, no siendo éste el hombre encargado de tocar habitualmente la campana, se comprende que los vecinos le preguntasen dónde se encontraba el campanero y quién era el muerto. «El campanero no está aquí, soy yo quien ha hecho sonar la campana», fue la respuesta del campesino. «Pero, entonces, ¿no ha muerto nadie?», replicaron los vecinos, y el campesino re...

  7. Análisis de la transformación digital de las Instituciones de Educación Superior. Un marco de referencia teórico

    OpenAIRE

    Fernando Almaraz Menéndez; Alexander Maz Machado; Carmen López Esteban

    2016-01-01

    En este artículo se proporcionan una serie de argumentos que apoyan la tesis de que las universidades están experimentando, o pueden experimentar en un futuro próximo, un conjunto de importantes cambios inducidos por las tendencias tecnológicas y sociales hacia la digitalización. Se aporta una definición básica de la Trasformación Digital de las Instituciones de Educación Superior para cuyo estudio riguroso se plantea un marco de referencia teórico que desglosa el proceso de transformación di...

  8. Análisis de la transformación digital de las Instituciones de Educación Superior. Un marco de referencia teórico

    OpenAIRE

    Almaraz Menéndez, Fernando Enrique; Maz-Machado,Alexander; Carmen LÓPEZ ESTEBAN

    2017-01-01

    En este artículo se proporcionan una serie de argumentos que apoyan la tesis de que las universidades están experimentando, o pueden experimentar en un futuro próximo, un conjunto de importantes cambios inducidos por las tendencias tecnológicas y sociales hacia la digitalización. Se aporta una definición básica de la Trasformación Digital de las Instituciones de Educación Superior para cuyo estudio riguroso se plantea un marco de referencia te...

  9. Análisis institucional y educación superior. Aportes teóricos y resultados empíricos

    OpenAIRE

    Ma. Angélica Buendía Espinosa

    2011-01-01

    El objetivo de este trabajo es presentar una aproximación a las principales contribuciones del nuevo institucionalismo sociológico y el análisis organizacional en el estudio de los fenómenos y problemas que enfrentan las organizaciones educativas. El trabajo está dividido en cuatro partes. La primera aborda el nuevo institucionalismo sociológico y el análisis organizacional en el campo educativo. En la segunda se presenta un análisis breve de la política educativa de nivel superior en México ...

  10. REFLEXIONES ACERCA DE LOS DESAFÍOS EN LA FORMACIÓN DE COMPETENCIAS PARA LA INVESTIGACIÓN EN EDUCACIÓN SUPERIOR

    OpenAIRE

    Jensy Campos Céspedes; Alexis Chinchilla Jiménez

    2009-01-01

    El objetivo principal de este ensayo es reflexionar en torno a la importancia de replantear y resignificar, tanto en el nivel teórico como práctico, la formación sistemática de competencias para la investigación, así como la necesidad de asumir este proceso como un elemento clave y articulador en el desarrollo de los programas académicos de educación superior. Los cambios políticos, económicos y socioculturales, agudizados por el advenimiento de las tecnologías de la información y la comunica...

  11. Marketing! Onde está o Paradigma?

    Directory of Open Access Journals (Sweden)

    Deosir Flávio Lobo de Castro Júnior

    2015-09-01

    Full Text Available O debate quantitativo-qualitativo, não é uma discussão recente. O objetivo desse trabalho, portanto, é verificar por meio do conceito de paradigma, novas perspectivas de compreender as pesquisas acadêmicas em marketing, a evolução do pensamento de marketing e as metodologias utilizadas nos estudos da qualidade de serviço. Sem a pretensão de esgotar este assunto e apresentar uma conclusão final, são apresentadas pesquisas que apontam para a necessidade e a importância da pesquisa qualitativa, uma vez que auxilia ao pesquisador uma melhor compreensão da natureza complexa do mundo social em que vivemos. Segundo Santana e Gomes (2007, após análise da discussão de Hegel e Kant, concluem que a razão e a própria epistemologia são construções históricas e evoluem a partir de contradições. O presente artigo está dividido em cinco momentos. Na primeira parte apresenta-se além da introdução a constituição dos objetivos desse ensaio teórico. Na segunda parte apresenta-se uma breve discussão a respeito do conceito de paradigma e o marketing. Na terceira parte apresenta-se uma retrospectiva histórica do marketing e sua evolução de suas escolas a partir dos estudos de Miranda e Arruda (2004. Na quarta parte, são apresentadas as metodologias dos estudos sobre qualidade de serviços e finalmente na quinta parte apresenta-se as considerações finais.

  12. Etnicidad, género y educación superior. Trayectorias de dos mujeres arhuacas en Colombia

    Directory of Open Access Journals (Sweden)

    Angela Santamaria

    2016-01-01

    Full Text Available Nos preguntamos en este texto, ¿cómo han enfrentado estas lideresas las restricciones culturales frente a las exigencias de la vida pública? ¿Cómo han creado una amalgama de capitales y saberes diversos en el marco de sus liderazgos? Los principales elementos teóricos utilizados en este trabajo son: la perspectiva sociológica y la Teoría de los campos de Bourdieu, los estudios sobre interseccionalidad de Lorde (1984 y Pratt-Clarke (2010, los estudios de Gil (2005, Choque (2015 y Mato (2015 sobre educación superior intercultural, y finalmente los estudios sobre liderazgos femeninos de Lumby y Coleman (2007. Metodológicamente trabajamos a partir de la reconstrucción de dos trayectorias personales escolares y profesionales desde una perspectiva interseccional.

  13. Nuevos entornos en la formación superior: una propuesta de educación patrimonial en el museo

    Directory of Open Access Journals (Sweden)

    Carmen Gómez Redondo

    2014-01-01

    Full Text Available Aunque el término patrimonio aparece como uno de los contenidos en los currículos de sistema educativo actual, su presencia y su enfoque metodológico no quedan patentes en la formación de los educadores. Así pues, se abre una brecha en torno a este ámbito y su enfoque educacional en la formación superior. A través de este artículo se pretende dar luz a una de las distintas propuestas en torno a la educación patrimonial que se comienzan a emprender en el ámbito universitario. A continuación se revisan y proponen las bases metodológicas del área, para posteriormente plantear la propuesta educativa, así como algunos de los resultados y conclusiones más reseñables.

  14. EVER-EST: a virtual research environment for Earth Sciences

    Science.gov (United States)

    Marelli, Fulvio; Albani, Mirko; Glaves, Helen

    2016-04-01

    There is an increasing requirement for researchers to work collaboratively using common resources whilst being geographically dispersed. By creating a virtual research environment (VRE) using a service oriented architecture (SOA) tailored to the needs of Earth Science (ES) communities, the EVEREST project will provide a range of both generic and domain specific data management services to support a dynamic approach to collaborative research. EVER-EST will provide the means to overcome existing barriers to sharing of Earth Science data and information allowing research teams to discover, access, share and process heterogeneous data, algorithms, results and experiences within and across their communities, including those domains beyond Earth Science. Researchers will be able to seamlessly manage both the data involved in their computationally intensive disciplines and the scientific methods applied in their observations and modelling, which lead to the specific results that need to be attributable, validated and shared both within the community and more widely e.g. in the form of scholarly communications. Central to the EVEREST approach is the concept of the Research Object (RO) , which provides a semantically rich mechanism to aggregate related resources about a scientific investigation so that they can be shared together using a single unique identifier. Although several e-laboratories are incorporating the research object concept in their infrastructure, the EVER-EST VRE will be the first infrastructure to leverage the concept of Research Objects and their application in observational rather than experimental disciplines. Development of the EVEREST VRE will leverage the results of several previous projects which have produced state-of-the-art technologies for scientific data management and curation as well those which have developed models, techniques and tools for the preservation of scientific methods and their implementation in computational forms such as

  15. ¿ES NECESARIA LA RED EUROPEA DE EDUCACIÓN SUPERIOR?

    Directory of Open Access Journals (Sweden)

    Miguel Pérez Ferra

    2010-01-01

    Full Text Available Desde esta colaboración se pretende justificar la importancia que tiene la Red Europea de Educación Superior para llegar a la consecución de una ciudadanía europea, a través de la movilidad. Partimos de la consideración de una realidad cultural estática, dinamizada por los procesos formativos que se generan en la Universidad y que puede responder a esos referentes esenciales, a partir de los cuales se inicie el desarrollo de una ciudadanía común. Se hace alusión a los desencuentros habidos para determinar los referentes culturales de la Red y a su necesidad para definir el desarrollo de su plataforma conceptual, básica y previa para establecer el desarrollo de acciones organizativopedagógicas. Del mismo modo, se hace referencia a la dejación de liderazgo que ha hecho la Universidad a la hora de comandar este proceso de cambio, así como las consecuencias que puede tener para las universidades de tradición napoleónica la imposición de una cultura anglosajona.

  16. DETERMINANTES DEL LOGRO ESCOLAR EN MÉXICO. Primeros resultados utilizando la prueba ENLACE media superior

    Directory of Open Access Journals (Sweden)

    Rafael E. de Hoyos

    2012-01-01

    Full Text Available Aunque los años de escolaridad de los mexicanos aumentaron significativamente en los pasados 20 años, la calidad del sistema educativo —un determinante importante del crecimiento económico de largo plazo— dista mucho de ser satisfactorio. Utilizando los resultados de la primera prueba estandarizada en educación media superior (ENLACE-MS, este estudio muestra que un modelo que incluye las características del hogar, individuales, institucionales y escolares puede explicar más de 40% de las diferencias observadas en las calificaciones de matemáticas. Desde el punto de vista de la política pública, los resultados de este trabajo sugieren que, a fin de aumentar la calidad de la educación, las autoridades educativas deberían concentrarse en mejorar la infraestructura escolar, la calidad de los docentes y la relación entre los estudiantes y las autoridades escolares.

  17. La cabeza de felino del Magdaleniense superior/final de Atxeta (Forua, Vizcaya.

    Directory of Open Access Journals (Sweden)

    Juan M. Apellaniz

    1988-01-01

    Full Text Available El autor analiza una cabeza probablemente de felino realizada sobre un canto descubierto en el nivel E de la cueva de Atxeta (Bizkaia, clasificado como perteneciente al Magdaleniense V-VI. El análisis lleva al autor a señalar las características del trabajo artístico: austeridad representativa, ambigüedad, esquematismo elemental. El trabajo intenta relacionar la representación con los sentimientos estéticos comtemporáneos, comparándola con diversas esculturas de un artista vasco contemporáneo como es el caso de J. Oteiza, en el que la similitud formal es clara. La enumeración de los estilos artísticos representados por los grabados de Santimamiñe, Lumentxa, Ekain, Torre, etc. permite sugerir que durante el período Magdaleniense superior/final se producen unos sentimientos estéticos muy similares a los de la actualidad.

  18. The conserved Est1 protein stimulates telomerase DNA extension activity

    Science.gov (United States)

    DeZwaan, Diane C.; Freeman, Brian C.

    2009-01-01

    The first telomerase cofactor identified was the budding yeast protein Est1, which is conserved through humans. While it is evident that Est1 is required for telomere DNA maintenance, understanding its mechanistic contributions to telomerase regulation has been limited. In vitro, the primary effect of Est1 is to activate telomerase-mediated DNA extension. Although Est1 displayed specific DNA and RNA binding, neither activity contributed significantly to telomerase stimulation. Rather Est1 mediated telomerase upregulation through direct contacts with the reverse transcriptase subunit. In addition to intrinsic Est1 functions, we found that Est1 cooperatively activated telomerase in conjunction with Cdc13 and that the combinatorial effect was dependent upon a known salt-bridge interaction between Est1 (K444) and Cdc13 (E252). Our studies provide insights into the molecular events used to control the enzymatic activity of the telomerase holoenzyme. PMID:19805136

  19. Development of EST-derived markers in Dendrobium from EST of related taxa

    Directory of Open Access Journals (Sweden)

    Narisa Juejun

    2013-04-01

    Full Text Available Public databases are useful for molecular marker development. The major aim of this study was to develop expressedsequence tag (EST-derived markers in Dendrobium from available ESTs of Phalaenopsis and Dendrobium. A total of 6063sequences were screened for simple sequence repeats (SSRs and introns. Primers flanking these regions were generated andtested on genomic DNAs of Phalaenopsis and Dendrobium. Twenty-three percent of amplifiable Phalaenopsis EST-derivedmarkers were cross-genera transferable to Dendrobium. Forty-one markers from both Phalaenopsis and Dendrobium thatamplified in Dendrobium were assessed on six commercial cultivars and six wild accessions. All of them were transferableamong Dendrobium species. High polymorphism and heterozygosity were observed within wild accessions. Sixteen polymorphic markers were evaluated for linkage analysis on an F1 segregating population. Seven markers were mapped into threelinkage groups, two of which showed syntenic relationship between dendrobium and rice. This relationship will facilitatefurther quantitative trait loci (QTL mapping and comparative genomic studies of Dendrobium. Our results indicate thatPhalaenopsis EST-derived markers are valuable tools for genetic research and breeding applications in Dendrobium.

  20. Estudios de estética medioeval. La estética de la luz

    Directory of Open Access Journals (Sweden)

    Anónimo Anónimo

    1959-10-01

    Full Text Available Reproducción parcial del capítulo I, Libro 1 V -El Siglo XIII - de la obra "Estudios de Estética Medioeval" de Edgar De Bruyne. Biblioteca Hispánica de Filosofía. Editorial Credo. Madrid, 1959, para la versión castellana.

  1. Instituciones de educación superior con ánimo de lucro en Colombia

    Directory of Open Access Journals (Sweden)

    Alexander Guzmán

    2016-03-01

    Full Text Available La educación superior ha sido tradicionalmente ofertada por instituciones públicas y privadas sin ánimo de lucro. Sin embargo, algunos países permiten la existencia de instituciones de educación superior con ánimo de lucro, las cuales cada vez se consolidan más al incrementar el número de estudiantes que atienden, su presencia geográfica y su crecimiento. Discutir sobre una posible creación de este tipo de organizaciones en Colombia convoca hacia el entendimiento de esta posibilidad con el propósito de dimensionar algunos beneficios y desventajas relacionados con la misma. Este artículo presenta una reflexión sobre las posibles implicaciones de las instituciones de educación superior con ánimo de lucro en la educación en general y la investigación en particular. Luego de revisar la experiencia de otros países, discutir la forma de producir nuevo conocimiento en la actualidad y las posibles implicaciones de la aprobación de estas instituciones en Colombia, se concluye que, de aprobarse su funcionamiento en el país en el futuro, se ampliarían las posibilidades de formación técnica, tecnológica y continua. Sin embargo, el desarrollo de la investigación básica y aplicada y la oferta de programas de posgrado relacionados con la investigación, como las maestrías y los doctorados, deberían seguir a cargo de la Universidad tradicional sin ánimo de lucro. Además, se resalta la importancia de un marco regulatorio que salvaguarde los recursos que el gobierno piensa destinar al desarrollo de la ciencia en el país y garantice la calidad de la educación impartida en las nuevas instituciones.

  2. Competencias emergentes del docente ante las demandas del Espacio Europeo de Educación Superior

    Directory of Open Access Journals (Sweden)

    María del Carmen Ortega Navas

    2010-01-01

    Full Text Available El inicio del proceso de Convergencia Europea ha tenido un impacto importante en el desarrollo de las competencias en el marco de la actual Sociedad del Conocimiento. En este contexto la entrada al Espacio Europeo de Educación Superior plantea dilemas para el docente universitario respecto a un nuevo concepto de enseñanza basado en dichas habilidades al que deberá adaptarse y habituarse de tal forma que le permitan dar respuesta a los nuevos retos y exigencias educativas y sociales que se plantean en el siglo XXI. El propósito de este artículo es comenzar comprendiendo qué son las competencias y cómo se clasifican para posteriormente entender cuál es el papel que deberán desempeñar los docentes en la universidad actual. Estudiaremos una de las competencias esenciales en la educación superior en nuestros días, aprender a lo largo de la vida, y terminaremos con una breve reflexión de los cambios en el papel del docente en la educación superior.The beginning of the process of European Convergence has had an important impact in the development of the competencesin the context of current knowledge society.In this context the entrance to the European Higher Education Area outlines dilemmas for the university teacher with respectto a new concept of teaching based on these abilities to which should be adapted and to be accustomed in such a way that allow to give answer to the new challenges and educational and social demands that are presented in the 21st century. The purpose of this article is to begin understandingwhat are the competences and how they are classified for subsequently understand which is the role that the teachers should perform in the current university.We will study one of the essential competencesin the higher education in our days, lifelong learning, and will finish with a brief reflectionofthe changes in the role ofthe teacherin the higher education.

  3. Superior Canal Dehiscence Syndrome: Lessons from the First 20 Years

    Directory of Open Access Journals (Sweden)

    Bryan K. Ward

    2017-04-01

    Full Text Available Superior semicircular canal dehiscence syndrome was first reported by Lloyd Minor and colleagues in 1998. Patients with a dehiscence in the bone overlying the superior semicircular canal experience symptoms of pressure or sound-induced vertigo, bone conduction hyperacusis, and pulsatile tinnitus. The initial series of patients were diagnosed based on common symptoms, a physical examination finding of eye movements in the plane of the superior semicircular canal when ear canal pressure or loud tones were applied to the ear, and high-resolution computed tomography imaging demonstrating a dehiscence in the bone over the superior semicircular canal. Research productivity directed at understanding better methods for diagnosing and treating this condition has substantially increased over the last two decades. We now have a sound understanding of the pathophysiology of third mobile window syndromes, higher resolution imaging protocols, and several sensitive and specific diagnostic tests. Furthermore, we have a treatment (surgical occlusion of the superior semicircular canal that has demonstrated efficacy. This review will highlight some of the fundamental insights gained in SCDS, propose diagnostic criteria, and discuss future research directions.

  4. CUENCA SUPERIOR DEL ARROYO COVUNCO: FISIOGRAFÍA Y USOS DEL SUELO

    Directory of Open Access Journals (Sweden)

    Marcos Mare

    2005-12-01

    Full Text Available La metodología aplicada está centrada en el análisis holístico del medio biofísico mediante la definición de unidades fisiográficas o sistemas físiográfícos, a los efectos de evaluar aptitudes y limitaciones en relación a usos de suelo existentes en un territorio determinado. En este sentido, se toman como base los lincamientos generales de la metodología australiana Land System o su equivalente holandesa de estudios integrados y ecología del paisaje1, con la introducción de modificaciones en función del grado de complejidad territorial del área de estudio y de los alcances y limitaciones propios de un trabajo de tesis de licenciatura. La cuenca hidrográfica del arroyo Covunco se localiza en el centro de la pro­vincia del Neuquén, en la transición entre los ambientes húmedos cordilleranos y las mesetas semiáridas que caracterizan al norte de la Patagonia. El sector superior de la cuenca se desarrolla hacia el oeste de la localidad de Zapala y su límite oriental coinci­de, aproximadamente, con el emplazamiento de las rutas nacionales número 22 y 40. Asimismo, el área es atravesada en sentido este - oeste por las ratas provinciales núme­ro 46 y 13 por lo que constituye un área de tránsito para el turismo con destino a la región cordillerana, en el departamento Aluminé.

  5. La imagen de calidad de la educación superior privada en el diario El Universal

    Directory of Open Access Journals (Sweden)

    Yazmín Margarita Cuevas Cajiga

    2011-01-01

    Full Text Available Actualmente el tema de las Instituciones de Educación Superior Privada (iesp ha retomado importancia dado que existe una gran diversidad de instituciones que ofrecen planes y programas de estudio con niveles muy dispares en lo que concierne a la calidad académica que ofertan. Con el fin de ahondar sobre esta problemática se realizó un estudio que tuvo como objetivo detectar las representaciones sociales acerca de la calidad de las iesp que circulan en los medios de comunicación, especialmente en la prensa escrita. Lo que se presenta en este texto es un análisis que se llevó a cabo teniendo como corpus de estudio 30 artículos (notas informativas, artículos de opinión y reportajes sobre el tema de las iesp que fueron publicados en el diario El Universal. A partir de este análisis se pudieron identificar dos representaciones sociales de este tipo de instituciones: las universidades patito y las verdaderas universidades de paga. La identificación y análisis de estas dos representaciones sociales develó que para El Universal la calidad académica está sedimentada en una idea muy importante para la sociedad contemporánea: la originalidad de una marca comercial.

  6. Monitoreo del Clima Espacial desde Colombia mediante Radio-receptores Butterworth de Orden Superior

    Directory of Open Access Journals (Sweden)

    Andrés Felipe Jaramillo Alvarado

    2017-01-01

    Full Text Available Contexto: las fulguraciones solares y las eyecciones de masa coronal liberan al espacio grandes cantidades de radiación que, al alcanzar las capas exteriores de la atmósfera terrestre, alteran sus características eléctricas. El conjunto de fenómenos derivados de esta interacción se conoce como clima espacial y sus consecuencias incluyen fallas en los sistemas de geolocalización, las telecomunicaciones, las operaciones vía satélite, el seguimiento espacial, la radionavegación y la sobrecarga de redes eléctricas. Método: en este trabajo se presenta el desarrollo de un radio receptor que permite adelantar el monitoreo del clima espacial desde Colombia. Además, se describe una metodología novedosa para el diseño de filtros analógicos de orden superior de característica Butterworth, a partir de la interconexión en paralelo de bancos de filtros de primero y segundo orden, obteniéndose la función de transferencia deseada. Resultados: el radio receptor desarrollado se instaló en la estación de monitoreo del clima espacial del Observatorio Astronómico de la Universidad Tecnológica de Pereira (OAUTP, Colombia, entrando en operación en diciembre de 2015. Desde esa fecha, el sistema ha registrado la actividad solar de forma ininterrumpida, detectando cuatro potentes explosiones solares clase C presentadas los días 15, 16 y 17 del mes de abril de 2016. Las señales recibidas por el radio receptor son enviadas a la base de datos global del Stanford Solar Center, de Stanford University, con el código UTP 0383. Conclusiones: el radio telescopio desarrollado permite al Observatorio Astronómico OAUTP adelantar el monitoreo del clima espacial y de la actividad solar, enviando la información recibida a repositorios de acceso público a nivel mundial. No existen otros receptores de radio de este tipo operando en la actualidad en países ecuatoriales, una región de la Tierra donde los efectos de la actividad solar pueden conducir a

  7. Rapid cloning and bioinformatic analysis of spinach Y chromosome-specific EST sequences

    Indian Academy of Sciences (India)

    Chuan-Liang Deng; Wei-Li Zhang; Ying Cao; Shao-Jing Wang; Shu-Fen Li; Wu-Jun Gao; Long-Dou Lu

    2015-12-01

    The genome of spinach single chromosome complement is about 1000 Mbp, which is the model material to study the molecular mechanisms of plant sex differentiation. The cytological study showed that the biggest spinach chromosome (chromosome 1) was taken as spinach sex chromosome. It had three alleles of sex-related , m and . Many researchers have been trying to clone the sex-determining genes and investigated the molecular mechanism of spinach sex differentiation. However, there are no successful cloned reports about these genes. A new technology combining chromosome microdissection with hybridization-specific amplification (HSA) was adopted. The spinach Y chromosome degenerate oligonucleotide primed-PCR (DOP-PCR) products were hybridized with cDNA of the male spinach flowers in florescence. The female spinach genome was taken as blocker and cDNA library specifically expressed in Y chromosome was constructed. Moreover, expressed sequence tag (EST) sequences in cDNA library were cloned, sequenced and bioinformatics was analysed. There were 63 valid EST sequences obtained in this study. The fragment size was between 53 and 486 bp. BLASTn homologous alignment indicated that 12 EST sequences had homologous sequences of nucleic acids, the rest were new sequences. BLASTx homologous alignment indicated that 16 EST sequences had homologous protein-encoding nucleic acid sequence. The spinach Y chromosome-specific EST sequences laid the foundation for cloning the functional genes, specifically expressed in spinach Y chromosome. Meanwhile, the establishment of the technology system in the research provided a reference for rapid cloning of other biological sex chromosome-specific EST sequences.

  8. Design of a fifth generation air superiority fighter

    Science.gov (United States)

    Atique, Md. Saifuddin Ahmed; Barman, Shuvrodeb; Nafi, Asif Shahriar; Bellah, Masum; Salam, Md. Abdus

    2016-07-01

    Air Superiority Fighter is considered to be an effective dogfighter which is stealthy & highly maneuverable to surprise enemy along with improve survivability against the missile fire. This new generation fighter aircraft requires fantastic aerodynamics design, low wing loading (W/S), high thrust to weight ratio (T/W) with super cruise ability. Conceptual design is the first step to design an aircraft. In this paper conceptual design of an Air Superiority Fighter Aircraft is proposed to carry 1 crew member (pilot) that can fly at maximum Mach No of 2.3 covering a range of 1500 km with maximum ceiling of 61,000 ft. Payload capacity of this proposed aircraft is 6000 lb that covers two advanced missiles & one advanced gun. The Air Superiority Fighter Aircraft was designed to undertake all the following missions like: combat air petrol, air to air combat, maritime attack, close air support, suppression, destruction of enemy air defense and reconnaissance.

  9. Temporal Bone Fracture Causing Superior Semicircular Canal Dehiscence

    Directory of Open Access Journals (Sweden)

    Kevin A. Peng

    2014-01-01

    Full Text Available Importance. Superior semicircular canal dehiscence (SCD is a third window lesion of the inner ear causing symptoms of vertigo, autophony, tinnitus, and hearing loss. A “two-hit” hypothesis has traditionally been proposed, whereby thinly developed bone overlying the superior canal is disrupted by a sudden change in intracranial pressure. Although the symptoms of SCD may be precipitated by head injury, no previous reports have described a temporal bone fracture directly causing SCD. Observations. Two patients sustained temporal bone fractures after closed head trauma, and developed unilateral otologic symptoms consistent with SCD. In each instance, computed tomography imaging revealed fractures extending through the bony roof of the superior semicircular canal. Conclusions and Relevance. Temporal bone fractures, which are largely treated nonoperatively, have not previously been reported to cause SCD. As it is a potentially treatable entity, SCD resulting from temporal bone fracture must be recognized as a possibility and diagnosed promptly if present.

  10. Partial anomalous pulmonary venous connection to the superior vena cava.

    Science.gov (United States)

    Aramendi, José I; Rey, Estibaliz; Hamzeh, Gadah; Crespo, Alejandro; Luis, Maite; Voces, Roberto

    2011-04-01

    We describe the surgical technique of reimplantation of the right superior pulmonary vein into the left atrium in 2 patients with partial anomalous pulmonary venous connection to the superior vena cava without atrial septal defect. A right axillary minithoracotomy is done through the fourth intercostal space. The pulmonary vein is detached from its origin in the superior vena cava. This is sutured with 6-0 reabsorbable polydioxanone suture (Ethicon, Somerville, NJ). A lateral clamp is applied to the left atrium, and the pulmonary vein is reimplanted. The patient is extubated in the operating room. Neither cardiopulmonary bypass nor blood transfusion was required. It is simple, safe, and reproducible. Copyright © 2011 The Society of Thoracic Surgeons. Published by Elsevier Inc. All rights reserved.

  11. Isolated abscess in superior rectus muscle in a child

    Directory of Open Access Journals (Sweden)

    Sushank Ashok Bhalerao

    2015-01-01

    Full Text Available Pyomyositis is a primary bacterial infection of striated muscles nearly always caused by Staphylococcus aureus. Development of the intramuscular abscess involving the extra-ocular muscles (EOMs remains an extremely rare process. We herein present a case of isolated EOM pyomyositis involving superior rectus muscle in a 2-year male child who was referred with complaints of swelling in left eye (LE and inability to open LE since last 1-month. Orbital computed tomography (CT scan showed a well-defined, hypo-dense, peripheral rim-enhancing lesion in relation to left superior rectus muscle suggestive of left superior rectus abscess. The abscess was drained through skin approach. We concluded that pyomyositis of EOM should be considered in any patient presenting with acute onset of orbital inflammation and characteristic CT or magnetic resonance imaging features. Management consists of incision and drainage coupled with antibiotic therapy.

  12. Anthropogenic climate change has altered primary productivity in Lake Superior

    Science.gov (United States)

    O'Beirne, M. D.; Werne, J. P.; Hecky, R. E.; Johnson, T. C.; Katsev, S.; Reavie, E. D.

    2017-06-01

    Anthropogenic climate change has the potential to alter many facets of Earth's freshwater resources, especially lacustrine ecosystems. The effects of anthropogenic changes in Lake Superior, which is Earth's largest freshwater lake by area, are not well documented (spatially or temporally) and predicted future states in response to climate change vary. Here we show that Lake Superior experienced a slow, steady increase in production throughout the Holocene using (paleo)productivity proxies in lacustrine sediments to reconstruct past changes in primary production. Furthermore, data from the last century indicate a rapid increase in primary production, which we attribute to increasing surface water temperatures and longer seasonal stratification related to longer ice-free periods in Lake Superior due to anthropogenic climate warming. These observations demonstrate that anthropogenic effects have become a prominent influence on one of Earth's largest, most pristine lacustrine ecosystems.

  13. INFORMATION ASSURANCE - INTELLIGENCE - INFORMATION SUPERIORITY RELATIONSHIP WITHIN NATO OPERATIONS

    Directory of Open Access Journals (Sweden)

    Gheorghe BOARU, Ioan-Mihai ILIEŞ

    2011-01-01

    Full Text Available There is a tight relationship between information assurance, the intelligence cycle and information superiority within NATO operations. The intelligence cycle has a discrete architecture and provides on-time and relevant intelligence products to the joint force commanders and to other authorized users in a specifi c joint area of operations. The intelligence cycle must follow the evolution of the operation. A permanent intelligence estimate will be performed during the military decision making process and operations execution. Information superiority is one of the most powerful intelligence cycle achievements. and decisively infuences the success of NATO joint operations. Information superiority must be preserved and enhanced through information assurance. Information assurance is an information operation that must be planned by the military in charge of operation security or by non-military experts, executed by all personnel during the entire intelligence cycle life time and employed during the planning and execution of NATO joint operations.

  14. Status of the shortjaw cisco (Coregonus zenithicus) in Lake Superior

    Science.gov (United States)

    Hoff, Michael H.; Todd, Thomas N.

    2004-01-01

    The shortjaw cisco (Coregonus zenithicus) was historically found in Lakes Huron, Michigan, and Superior, but has been extirpated in Lakes Huron and Michigan apparently as the result of commercial overharvest. During 1999-2001, we conducted an assessment of shortjaw cisco abundance in five areas, spanning the U.S. waters of Lake Superior, and compared our results with the abundance measured at those areas in 1921-1922. The shortjaw cisco was found at four of the five areas sampled, but abundances were so low that they were not significantly different from zero. In the four areas where shortjaw ciscoes were found, abundance declined significantly by 99% from the 1920s to the present. To increase populations of this once economically and ecologically important species in Lake Superior, an interagency rehabilitation effort is needed. Population monitoring is recommended to assess population trends and to evaluate success of rehabilitation efforts.

  15. Social and organizational impacts of the electronic processing system of the brazilian superior tribunal of justice

    Directory of Open Access Journals (Sweden)

    Christiana Soares de Freitas

    2015-10-01

    Full Text Available This paper presents a study on the social and organizational impacts of the Electronic Processing System (EPS implemented in 2008 by the Brazilian Superior Tribunal of Justice (STJ. This system is part of a wider transformation process involving the implementation of a new management model at the STJ. The theoretical framework is based on the Technology Enactment Theory and other studies on the role of technological innovations in public organizations (Fountain, 2005; Freitas, 2012. The main goal of the research is to identify the most significant factors facilitating or inhibiting the innovation adoption. Results show different impacts of the EPS on professional groups and organizations. Political, cultural and economic aspects influence stakeholders’ perceptions of the innovation, including its sustainability, time and costs savings that impact the rate of adoption and the realization of benefits both to users and the organization investing in its development.

  16. Primer registro de aves fósiles (Pelecaniformes: Pelecanidae y un probable Odontopterygiformes: Pelagornithidae para el Mioceno Superior de Costa Rica

    Directory of Open Access Journals (Sweden)

    Ana L. Valerio

    2013-12-01

    Full Text Available Se registran por primera vez para Costa Rica restos de dos aves marinas fósiles (Aves: Pelecaniformes y Odontopterygiformes procedentes de la Formación Curré de edad Mioceno Superior. Estos hallazgos están asociados a sedimentos marino someros y concuerdan con otros vertebrados fósiles marinos asociados como cetáceos, tiburones y rayas.

  17. La evolución del Ciclo Superior de Administración y finanzas, y su adaptación a la actualidad empresarial

    OpenAIRE

    Moro-Guijarro, Marta María

    2012-01-01

    En este trabajo se realiza el análisis del cambio curricular del Ciclo Superior LOGSE de Administración y Finanzas a Ciclo LOE, partiendo de su evolución previa y de su situación actual, con el fin de valorar si las modificaciones que presenta son más adecuadas a las necesidades actuales de la empresa y pueden favorecer la introducción de sus titulados en el mercado laboral.

  18. La imagen visual en los videojuegos: un acercamiento desde el arte y la estética

    Directory of Open Access Journals (Sweden)

    Mónica Isabel Tamayo Acevedo

    2013-01-01

    Full Text Available Este texto es producto del proyecto de investigación interinstitucional e internacional “Percepciones artísticas y estéticas que tienen los estudiantes de comunicación de la Universidad de Colima- México y de la Universidad de Medellín- Colombia, sobre el valor artístico y estético de la imagen visual en los videojuegos”, el cual tiene como objetivos ofrecer un análisis del con- texto histórico y socio cultural dentro del cual se crea y se observa la imagen visual como portadora de valores artísticos y estéticos en los videojuegos, establecer el proceso de recepción de la imagen visual en los videojuegos para caracterizar su valor artístico y estético acorde con las diversas concepciones históricas sobre arte y estética, y apoyar la reinterpretación y resignificación de valores artísticos y estéticos en la recepción de imágenes visuales en los videojuegos. En el texto se hace un acercamiento a las investigaciones sobre videojuegos relacionadas con el arte y la estética, y a los artistas contemporáneos que se han apropiado de éste como medio para ex- presar ideas, pensamientos y sentimientos, interviniendo o re-creando videojuegos comerciales o haciendo sus propias creaciones. De igual forma, a partir de algunas teorías estéticas, se aborda la imagen vi- sual de los videojuegos comerciales y se establecen relaciones que permiten evidenciar su estatus de manifestación artística y estética. En sus conclusiones, el texto atiende a la necesidad de incluir en los currículos académicos de educación superior reflexiones en torno a los videojuegos como nuevos productos culturales, en incrementar investigaciones, desde el campo del arte, la comunicación y la edu- cación, en torno a los mismos, y en valorar las posibilidades que tienen las imágenes visuales de los videojuegos comerciales como portadores de valores artísticos y estéticos y por ende, generadoras de experiencia estética.

  19. Le discours fantastique est-il rationnel ?

    Directory of Open Access Journals (Sweden)

    Anouck Linck

    2011-01-01

    Full Text Available L’importance de la contradiction dans la composition du discours fantastique a été signalée par la critique et le carré sémiotique de Greimas assigne au fantastique une place de choix – non reconnue encore à ce jour. Le rôle structurant de la contradiction est confirmé par notre méthode d’investigation, qui envisage l’acte de lecture sur le mode de l’élaboration d’un acte démonstratif. Cette méthode, appliquée à trois textes emblématiques du discours fantastique, aboutit en effet à l’élaboration de théories inconsistantes (contenant une contradiction du type p  p mais non triviales, au sein desquelles le principe aristotélicien de non-contradiction n’est pas valable. Nous touchons là aux limites de la raison classique, d’où notre questionnement : le discours fantastique est-il rationnel ? Plutôt que de répondre par la négative, nous montrons que la non-absurdité du discours fantastique invite au dépassement des limites de la raison classique et à une extension de cette dernière, car il se place sous l’égide d’une logique formelle moins contraignante et plus générale que la logique classique : la logique paraconsistante de Newton da Costa.La crítica ha señalado la importancia de la contradicción en lo que se refiere a la composición de la narrativa fantástica y ésta tiene su lugar asignado dentro del cuadrado semiótico de Greimas – un lugar hasta ahora no identificado como tal. Al considerar el acto de lectura como elaboración un acto demostrativo, nuestro método de investigación resalta ese papel fundamental de la contradicción. Dicho método, aplicado a tres textos emblemáticos de la narrativa fantástica, desemboca en efecto en la elaboración de teorías inconsistentes (que contienen una contradicción de tipo p  p pero no triviales, dentro de las cuales el principio aristotélico de no-contradicción no es válido. Con esto llegamos al límite de la racionalidad

  20. A interiorização da educação superior no Brasil: caso de Mato Grosso

    Directory of Open Access Journals (Sweden)

    Arno Rieder

    2011-09-01

    Full Text Available Aborda-se a interiorização e expansão da Educação Superior Pública Estadual no Mato Grosso(MT, Brasil. Em 1978 nasce o Instituto de Ensino Superior de Cáceres-IESC; estadualizado em 1985. Até 1990 atende apenas Cáceres. Depois se expande, interiorizandose para outras regiões de MT, então com o nome de Fundação de Ensino Superior de Mato Grosso (FESMAT. Em 1993 assume o nome de Universidade do Estado de Mato Grosso (UNEMAT, sendo credenciado como tal em 1999. Em Cáceres está a sede Administrativa e o Campus pioneiro. Entre 1990-2002, através de estrutura multi-Campi atende Sinop, Colider, Alta Floresta, Luciara, Nova Xavantina, Alto Araguaia, Barra do Bugres, Tangará da Serra, Pontes e Lacerda. Entre 1998-2002 implanta um processo de expansão-2 de áreas e formatos ofertados. A partir dos Campi, atende outros municípios, através de programas e turmas especiais. A UNEMAT começou do sonho de um povo sofrido, mas determinado e audaz; faz 30 anos, cuja consolidação, teve vários episódios de luta de classes, idéias e ideais, sempre, na hora certa, com respaldo de seu povo. Graças a existência da Educação Superior(ES no interior de MT, há progressão sustentada do desenvolvimento local. É a primeira de MT, que implantou Licenciatura Plena em Computação e ES Indígena.

  1. The postdiction superiority effect in metacomprehension of text.

    Science.gov (United States)

    Pierce, B H; Smith, S M

    2001-01-01

    Metacomprehension accuracy for texts was greater after, rather than before, answering test questions about the texts-a postdiction superiority effect. Although postdiction superiority was found across successive sets of test questions and across successive texts, there was no improvement in metacomprehension accuracy after participants had taken more tests. Neither prediction nor postdiction gamma correlations with test performance improved with successive tests. Although the results are consistent with retrieval hypotheses, they contradict predictions made by test knowledge hypotheses, which state that increasing knowledge of the nature of the tests should increase metacomprehension accuracy.

  2. Imaging Evaluation of Superior Labral Anteroposterior (SLAP) Tears.

    Science.gov (United States)

    Grubin, Jeremy; Maderazo, Alex; Fitzpatrick, Darren

    2015-10-01

    Superior labral anteroposterior (SLAP) tears are common injuries that are best evaluated with magnetic resonance arthrography (MRA), as it provides the most detailed evaluation of the bicipital labral complex. Given the variety and complexity of SLAP tears, distention of the joint with intra-articular dilute gadolinium contrast properly separates the intra-articular biceps tendon, superior labrum, glenoid cartilage and glenohumeral ligaments to optimize assessment of these structures. This allows for increased diagnostic confidence of the interpreting radiologist and provides a better road map for the surgeon prior to arthroscopy. Indirect MRA and high-field magnetic resonance imaging are sensitive and specific alternative modalities if MRA cannot be performed.

  3. SUPERIOR MESENTERIC ARTERY SYNDROME - AN UNUSUAL CAUSE OF DUODENAL OBSTRUCTION

    OpenAIRE

    Sahu SK, , , , , , ,; Singh PK; Ray J; Uniyal M; Sharma C; Sekhar C; Kapruwan H; Sachan PK

    2012-01-01

    Superior mesenteric artery (SMA) arising from aorta at the level of first lumbar vertebra usually takes an angular downward course from ventral surface of aorta. It is through this vascular angle that the 3rd part of duodenum passes at the level of 4th lumbar vertebra. Fat and lymphatics around SMA maintains the angle at 25° to 60° with a mean of 450 and provide protection against duodenal compression. In Superior Mesenteric Artery Syndrome, the SMA-aorta angle in narrowed down to 7° to 22° w...

  4. Batería luria inicial y desarrollo de las funciones psicológicas superiores

    Directory of Open Access Journals (Sweden)

    Yaser Ramírez Benítez

    2014-06-01

    Full Text Available La batería neuropsicológica Luria Inicial es un instrumento válido para evaluar y seguir el desarrollo de las funciones psicológicas superiores en la edad preescolar. El modelo neuropsicológico de Luria ofrece la posibilidad para conocer las funciones superiores del niño. Metodología: La investigación pretende determinar la utilidad clínica del instrumento Luria Inicial en la población cubana preescolar con alteraciones del neurodesarrollo. El objetivo se cumplió con la revisión de los trabajos científicos publicados en la fecha 2006-2013 en bases de datos electrónica (Scielo, EBSCO host, LILACS, Medigraphic. Resultados: El instrumento tiene una efectiva utilidad clínica para conocer el perfil neuropsicológico del niño preescolar con alteraciones del neurodesarrollo. Los resultados en varias poblaciones (TDAH, bajo peso al nacer, desórdenes metabólicos informan que el acto motor con intencionalidad, la inhibición conductual y la organización espacial son habilidades diana a cualquier evento que interrumpan el neurodesarrollo. La adquisición de la función reguladora del habla predice las condiciones preacadémicas del niño en conjunto con el estado real de las funciones superiores. La utilidad clínica del instrumento está en la posibilidad de describir-explicar el estado real de las funciones superiores y su potencial: el niño puede ejecutar e imitar movimientos, dibujar, reconocer los colores y hablar (estado real, pero si no organiza esas ejecuciones a través de la función reguladora del habla (estado potencial estará sujeto a errores y a no aprender por orientaciones del adulto en la etapa escolar. La línea de pensamiento que ofrece Luria para estudiar a los niños es válida y confiable para diagnosticar y rehabilitar las secuelas del sistema nervioso en desarrollo.

  5. In silco mapping of ESTs from the turkey (Meleagris gallopavo).

    Science.gov (United States)

    Reed, Kent M; Knutson, Todd P; Krueth, Stacy B; Sullivan, Laura R; Chaves, Lee D

    2005-01-01

    Sequence similarity was used to predict the position of expressed sequence tags (ESTs) in the genome of the turkey (Meleagris gallopavo). Turkey EST sequences were compared with the draft assembly of the chicken whole-genome sequence and the chicken EST database by BLASTN. Among the 877 ESTs examined, 788 had significant matches in the chicken genome sequence. Position of orthologous sequences in the chicken genome and the predicted position of the EST loci in the turkey genome are presented Genetic assignments suggest a high level of accuracy for the COMPASS predictions.

  6. Generation and analysis of expressed sequence tags (ESTs) for marker development in yam (Dioscorea alata L.).

    Science.gov (United States)

    Narina, Satya S; Buyyarapu, Ramesh; Kottapalli, Kameswara Rao; Sartie, Alieu M; Ali, Mohamed I; Robert, Asiedu; Hodeba, Mignouna J D; Sayre, Brian L; Scheffler, Brian E

    2011-02-09

    Anthracnose (Colletotrichum gloeosporioides) is a major limiting factor in the production of yam (Dioscorea spp.) worldwide. Availability of high quality sequence information is necessary for designing molecular markers associated with resistance. However, very limited sequence information pertaining to yam is available at public genome databases. Therefore, this collaborative project was developed for genetic improvement and germplasm characterization of yams using molecular markers. The current investigation is focused on studying gene expression, by large scale generation of ESTs, from one susceptible (TDa 95-0310) and two resistant yam genotypes (TDa 87-01091, TDa 95-0328) challenged with the fungus. Total RNA was isolated from young leaves of resistant and susceptible genotypes and cDNA libraries were sequenced using Roche 454 technology. A total of 44,757 EST sequences were generated from the cDNA libraries of the resistant and susceptible genotypes. Greater than 56% of ESTs were annotated using MapMan Mercator tool and Blast2GO search tools. Gene annotations were used to characterize the transcriptome in yam and also perform a differential gene expression analysis between the resistant and susceptible EST datasets. Mining for SSRs in the ESTs revealed 1702 unique sequences containing SSRs and 1705 SSR markers were designed using those sequences. We have developed a comprehensive annotated transcriptome data set in yam to enrich the EST information in public databases. cDNA libraries were constructed from anthracnose fungus challenged leaf tissues for transcriptome characterization, and differential gene expression analysis. Thus, it helped in identifying unique transcripts in each library for disease resistance. These EST resources provide the basis for future microarray development, marker validation, genetic linkage mapping and QTL analysis in Dioscorea species.

  7. Generation and analysis of expressed sequence tags (ESTs for marker development in yam (Dioscorea alata L.

    Directory of Open Access Journals (Sweden)

    Robert Asiedu

    2011-02-01

    Full Text Available Abstract Background Anthracnose (Colletotrichum gloeosporioides is a major limiting factor in the production of yam (Dioscorea spp. worldwide. Availability of high quality sequence information is necessary for designing molecular markers associated with resistance. However, very limited sequence information pertaining to yam is available at public genome databases. Therefore, this collaborative project was developed for genetic improvement and germplasm characterization of yams using molecular markers. The current investigation is focused on studying gene expression, by large scale generation of ESTs, from one susceptible (TDa 95-0310 and two resistant yam genotypes (TDa 87-01091, TDa 95-0328 challenged with the fungus. Total RNA was isolated from young leaves of resistant and susceptible genotypes and cDNA libraries were sequenced using Roche 454 technology. Results A total of 44,757 EST sequences were generated from the cDNA libraries of the resistant and susceptible genotypes. Greater than 56% of ESTs were annotated using MapMan Mercator tool and Blast2GO search tools. Gene annotations were used to characterize the transcriptome in yam and also perform a differential gene expression analysis between the resistant and susceptible EST datasets. Mining for SSRs in the ESTs revealed 1702 unique sequences containing SSRs and 1705 SSR markers were designed using those sequences. Conclusion We have developed a comprehensive annotated transcriptome data set in yam to enrich the EST information in public databases. cDNA libraries were constructed from anthracnose fungus challenged leaf tissues for transcriptome characterization, and differential gene expression analysis. Thus, it helped in identifying unique transcripts in each library for disease resistance. These EST resources provide the basis for future microarray development, marker validation, genetic linkage mapping and QTL analysis in Dioscorea species.

  8. REDVET está indexada en LIBRIS

    Directory of Open Access Journals (Sweden)

    Veterinaria.org

    2008-03-01

    Full Text Available ResumenLIBRIS es el catálogo conjunto de la bibliotecas académicas y de investigación de Suecia suministrado en linea por el Departamento de la Biblioteca Nacional de Suecia. En la actualidad, la base de datos LIBRIS contiene cerca de 6 millones de títulos entre libros, revistas, artículos, mapas, carteles, música impresa, recursos electrónicos, etc. En cualquiera de los resultados obtenidos tras una búsqueda concreta en LIBRIS se puede ver el título, autor, año de publicación, etc, y la frecuencia con la que se presentó información adicional, tales como tablas de contenidos, resúmenes, ilustraciones y enlaces a documentos en texto completo. El Departamento de la Biblioteca Nacional de Suecia es el responsable de la operación y el desarrollo de este servicio de búsqueda en línea.

  9. Abandono na educação superior: um estudo do tipo Estado do Conhecimento = Leavers in higher education: a study of type State of Knowledge

    Directory of Open Access Journals (Sweden)

    Santos, Pricila Kohls dos

    2014-01-01

    Full Text Available Este trabalho trata de uma pesquisa do tipo Estado do Conhecimento que versa sobre a temática do Abandono na Educação Superior presencial e a distância, tendo como objetivos identificar como a evasão está sendo apresentada em pesquisas acadêmicas, verificar os critérios de medição da evasão e evidenciar políticas de permanência nas pesquisas relacionadas à evasão na Educação Superior. O levantamento de dados se deu por meio de pesquisas no Portal de Teses da CAPES e nas Reuniões Anuais da ANPED, ambos no período entre 2000 a 2012. A análise realizada aponta para a necessidade de estudos voltados para a permanência dos estudantes na Educação Superior, bem como estudos que corroborem a necessidade de um olhar mais atento para a qualidade da oferta e do comprometimento institucional e também dos estudantes para com a Educação Superior

  10. A avaliação de curso superior: o caso do curso superior de Tecnologia em Agronegócio da Universidade Federal do Pampa - UNIPAMPA

    Directory of Open Access Journals (Sweden)

    Sebastião Ailton da Rosa Cerqueira-Adão

    2011-05-01

    Full Text Available Este artigo teve como objetivo identificar a percepção dos discentes e docentes do Curso Superior de Tecnologia em Agronegócio da Universidade Federal do Pampa - UNIPAMPA no que tange às atividades de ensino, pesquisa, extensão, gestão e infraestrutura. O estudo foi desenvolvido sob a forma de pesquisa de opinião, com a utilização da abordagem quantitativa e utilização de instrumento de coleta de dados eletrônico contendo questões fechadas. De um modo geral os resultados apontaram que docentes e discentes avaliam a maioria dos indicadores elencados na pesquisa como sendo de bom a muito bom. Por fim conclui-se que esta primeira auto-avaliação do Curso de Agronegócio poderá orientar o coordenador de curso, bem como a alta gestão, em ações que assegurem a manutenção dos pontos positivos, assim como orientar ações acerca de aspectos que deverão ser melhorados ao longo dos próximos semestres.

  11. Síndrome de veia cava superior Superior vena cava syndrome

    Directory of Open Access Journals (Sweden)

    SAMUEL ZUÍNGLIO DE BIASI CORDEIRO

    2002-09-01

    Full Text Available A obstrução ao fluxo sanguíneo na VCS e suas manifestações clínicas têm hoje como causa principal o câncer de pulmão. A história relata que no século XVIII a sífilis e a tuberculose eram responsáveis por 40% dos casos conhecidos. O conhecimento das alterações hemodinâmicas compreendidas nesta síndrome assim como a apuração das técnicas de diagnóstico de imagem e de citopatologia permitem hoje que o médico possa tratar de seu paciente com mais segurança e conforto do que há 10 anos. A TC contrastada e a RM auxiliam no diagnóstico de localização da obstrução e técnicas mais antigas como a cavografia puderam ser abandonadas. O diagnóstico de obstrução da VCS e o estudo por Doppler realizado à beira do leito em muito contribuem para a realização de procedimentos de desobstrução como a angioplastia transluminal percutânea nos casos de trombose ou estenose do vaso. Também a utilização de próteses como PTFE é de importância fundamental na condução de casos de lesão traumática da VCS durante cirurgias para câncer pulmonar ou mediastinal. No campo da radioterapia, a técnica de fracionamento permite que altas doses de irradiação sejam administradas aos pacientes portadores de neoplasias malignas, com benefícios em 70% dos casos.Lung cancer is now the main cause of blood flow obstruction in the superior vena cava and of its clinical manifestations. History tells that in the 18th Century, syphilis and tuberculosis were responsible for 40% of the known cases. The knowledge of hemodynamic changes seen in this syndrome and the improvement of diagnostic and cytopathologic techniques allow for a safer and more comfortable treatment of the patient than 10 years ago. Contrast CT and MR added to the identification and location of the obstruction, and older techniques such as cavography could be abandoned. SVC obstruction diagnosis and Doppler studies carried out at the bed of the patient contribute to

  12. Kohvik-restoran C'est La Vie = Cafe-restaurant C'est La Vie

    Index Scriptorium Estoniae

    2008-01-01

    Kohvik-restorani C'est La Vie (Suur-Karja 5, Tallinn) sisekujundusest. Sisearhitekt: Maile Grünberg, kes kavandas ka valdavalt mööbli. Laevalgusti disainis Tõnis Vellama. Skulptuuride (koopiad) autor on keraamik Ülle Rajasalu. Maile Grünbergist, tema viimased tööd. Keldrikorruse ja I korruse plaan, 8 värv. vaadet, foto M. Grünbergist

  13. Kohvik-restoran C'est La Vie = Cafe-restaurant C'est La Vie

    Index Scriptorium Estoniae

    2008-01-01

    Kohvik-restorani C'est La Vie (Suur-Karja 5, Tallinn) sisekujundusest. Sisearhitekt: Maile Grünberg, kes kavandas ka valdavalt mööbli. Laevalgusti disainis Tõnis Vellama. Skulptuuride (koopiad) autor on keraamik Ülle Rajasalu. Maile Grünbergist, tema viimased tööd. Keldrikorruse ja I korruse plaan, 8 värv. vaadet, foto M. Grünbergist

  14. Genes associated with hypersensitive response (HR in the citrus EST database (CitEST

    Directory of Open Access Journals (Sweden)

    Simone Guidetti-Gonzalez

    2007-01-01

    Full Text Available Plants are continuously exposed to pathogen attack, but successful infection is rare because they protect themselves against pathogens using a wide range of response mechanisms. One of them is the hypersensitive response (HR, which is a form of cell death often associated with plant resistance to pathogen infection to prevent the spreadsebpg@cnpq.br sebpg@cnpq.br of the potential pathogen from infected to uninfected tissues. Cell death is activated by recognition of pathogen-derived molecules by the resistance (R gene products, and is associated with the massive accumulation of reactive oxygen species (ROS, salicylic acid (SA, and other pro-death signals such as nitric oxide (NO. The analysis of the citrus EST (CitEST database revealed the presence of putative genes likely to be involved in HR through their products, like metacaspases, lipoxygenases, phospholipases, pathogenesis-related proteins, glutathione transferases/peroxidases, enzymes involved in the phenylpropanoid pathway and in the formation and detoxification of ROS, as well as those involved in the formation and regulation of ion channels, SA and NO. By analysis of the EST database of Citrus, it was possible to identify several putative genes that code for key enzymes involved in HR triggering and also in plant defense against biotic and abiotic stress.

  15. EST Express: PHP/MySQL based automated annotation of ESTs from expression libraries.

    Science.gov (United States)

    Smith, Robin P; Buchser, William J; Lemmon, Marcus B; Pardinas, Jose R; Bixby, John L; Lemmon, Vance P

    2008-04-10

    Several biological techniques result in the acquisition of functional sets of cDNAs that must be sequenced and analyzed. The emergence of redundant databases such as UniGene and centralized annotation engines such as Entrez Gene has allowed the development of software that can analyze a great number of sequences in a matter of seconds. We have developed "EST Express", a suite of analytical tools that identify and annotate ESTs originating from specific mRNA populations. The software consists of a user-friendly GUI powered by PHP and MySQL that allows for online collaboration between researchers and continuity with UniGene, Entrez Gene and RefSeq. Two key features of the software include a novel, simplified Entrez Gene parser and tools to manage cDNA library sequencing projects. We have tested the software on a large data set (2,016 samples) produced by subtractive hybridization. EST Express is an open-source, cross-platform web server application that imports sequences from cDNA libraries, such as those generated through subtractive hybridization or yeast two-hybrid screens. It then provides several layers of annotation based on Entrez Gene and RefSeq to allow the user to highlight useful genes and manage cDNA library projects.

  16. EST Express: PHP/MySQL based automated annotation of ESTs from expression libraries

    Directory of Open Access Journals (Sweden)

    Pardinas Jose R

    2008-04-01

    Full Text Available Abstract Background Several biological techniques result in the acquisition of functional sets of cDNAs that must be sequenced and analyzed. The emergence of redundant databases such as UniGene and centralized annotation engines such as Entrez Gene has allowed the development of software that can analyze a great number of sequences in a matter of seconds. Results We have developed "EST Express", a suite of analytical tools that identify and annotate ESTs originating from specific mRNA populations. The software consists of a user-friendly GUI powered by PHP and MySQL that allows for online collaboration between researchers and continuity with UniGene, Entrez Gene and RefSeq. Two key features of the software include a novel, simplified Entrez Gene parser and tools to manage cDNA library sequencing projects. We have tested the software on a large data set (2,016 samples produced by subtractive hybridization. Conclusion EST Express is an open-source, cross-platform web server application that imports sequences from cDNA libraries, such as those generated through subtractive hybridization or yeast two-hybrid screens. It then provides several layers of annotation based on Entrez Gene and RefSeq to allow the user to highlight useful genes and manage cDNA library projects.

  17. AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available ). Link to Uniprot is provided in TogoDB. Align length The alignment length between the query and the... blastx search against TrEMBL (release 39.9). Link to Uniprot is provided in TogoDB. Align length The alignment length between the...List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...n number Tissue type Name of the tissue from which the sequence is derived Developmental stage Developmental

  18. EN CAPITAL HUMANO. El logro educativo superior durante la década perdida en México

    Directory of Open Access Journals (Sweden)

    Pablo A. Peña

    2013-01-01

    Full Text Available Este artículo documenta una respuesta agregada negativa del logro educativo su-perior (más de 12 años de escolaridad en México a la recesión de 1982-1983 y el estancamiento que le siguió. La respuesta no fue homogénea entre géneros, re-giones y entornos familiares. Los hombres experimentaron una caída en el logro mientras que las mujeres experimentaron un crecimiento más lento. En promedio, los estados con un mayor logro antes del choque experimentaron mayores caídas. La respuesta entre distintos entornos familiares no presenta un patrón claro. Sin embargo, el efecto negativo en el logro se observa incluso entre hermanos. La evi-dencia sugiere que la explicación está en la demanda: la caída en el ingreso de los hogares parece ser el determinante de la caída-desaceleración del logro educativo superior. La conclusión es que la recesión y la falta de crecimiento que le siguió tuvieron un efecto negativo importante y duradero en la formación de capacidades en México.

  19. African Journal of Science and Technology

    African Journals Online (AJOL)

    PROMOTING ACCESS TO AFRICAN RESEARCH ... The African Journal of Science and Technology (AJST) is a biannual technical publication ... Le Journal Africain de Science et de Technologie est une revue scientifique du Journal Africain ...

  20. Biological Motion Task Performance Predicts Superior Temporal Sulcus Activity

    Science.gov (United States)

    Herrington, John D.; Nymberg, Charlotte; Schultz, Robert T.

    2011-01-01

    Numerous studies implicate superior temporal sulcus (STS) in the perception of human movement. More recent theories hold that STS is also involved in the "understanding" of human movement. However, almost no studies to date have associated STS function with observable variability in action understanding. The present study directly associated STS…

  1. Organizational Self-Awareness in the Key to Knowledge Superiority

    Science.gov (United States)

    2015-12-01

    a divisionalized bureaucracy (Mintzberg 1981). Designed as an innovation center, it is responsible for, among other things, forecasting and...the system, which prioritizes the needs and selection criteria for that system. 14. SUBJECT TERMS knowledge superiority, innovation , organizational...competitive advantage, knowledge is the critical element needed for any organization to innovate and succeed (Porter and Millar 1985). Its timely and

  2. Radiologic classification of superior canal dehiscence : Implications for surgical repair

    NARCIS (Netherlands)

    Lookabaugh, Sarah; Kelly, Hillary R.; Carter, Margaret S.; Niesten, Marlien E F; McKenna, Michael J.; Curtin, Hugh; Lee, Daniel J.

    2015-01-01

    Objective: Surgical access to repair a superior canal dehiscence (SCD) is influenced by the location of the bony defect and its relationship to surrounding tegmen topography as seen on computed tomography. There are currently no agreed-upon methods of characterizing these radiologic findings. We

  3. Mnemonic Training Reshapes Brain Networks to Support Superior Memory

    NARCIS (Netherlands)

    Dresler, M.; Shirer, W.R.; Konrad, B.N.; Muller, N.C.J.; Wagner, I.; Fernandez, G.S.E.; Czisch, M.; Greicius, M.D.

    2017-01-01

    Memory skills strongly differ across the general population; however, little is known about the brain characteristics supporting superior memory performance. Here we assess functional brain network organization of 23 of the world's most successful memory athletes and matched controls with fMRI

  4. Perturbation resilience and superiorization methodology of averaged mappings

    Science.gov (United States)

    He, Hongjin; Xu, Hong-Kun

    2017-04-01

    We first prove the bounded perturbation resilience for the successive fixed point algorithm of averaged mappings, which extends the string-averaging projection and block-iterative projection methods. We then apply the superiorization methodology to a constrained convex minimization problem where the constraint set is the intersection of fixed point sets of a finite family of averaged mappings.

  5. Measurement of ocular torsion variation following superior oblique tenectomy

    Directory of Open Access Journals (Sweden)

    Bruna Lana Ducca

    2014-12-01

    Full Text Available Purposes: To objectively evaluate the torsional effect of the superior oblique muscle-weakening surgery using the tenectomy technique proposed by Souza-Dias. Methods: The present prospective study included 10 patients (20 eyes with horizontal strabismus, bilateral superior oblique overaction and A-pattern of 15 to 30 prism diopters who underwent superior oblique tenectomy. Objective assessment of ocular torsion was performed by retinography immediately before and one month after surgery. The amount of ocular torsion was determined by measuring the angle formed by a horizontal line drawn across the geometric center of the optic disc and a second line connecting this point to the fovea. Results: The median preoperative angle was 5.56° in the right eyes and -3.43° in the left eyes. The median postoperative angle was 1.84° in the right eyes and -3.12° in the left eyes. The angle variation was statistically significant in both eyes (p=0.012 and p=0.01, respectively. Conclusion: The present study suggests that superior oblique tenectomy has an extorter effect, decreasing the intorsion detected on overaction of this muscle.

  6. Superior Mesenteric Artery Syndrome in a Young Military Basic Trainee

    Science.gov (United States)

    2013-03-01

    patients with severe anorexia nervosa .10 Severe cases may require surgery or parenteral feeding because of food avoidance leading to further loss of...2012. 10. Gwee K, Teh A, Huang C: Acute superior mesenteric artery syndrome and pancreatitis in anorexia nervosa . Australas Psychiatry 2010; 18(6): 523

  7. Morphological variation of siscowet lake trout in Lake Superior

    Science.gov (United States)

    Bronte, C.R.; Moore, S.A.

    2007-01-01

    Historically, Lake Superior has contained many morphologically distinct forms of the lake trout Salvelinus namaycush that have occupied specific depths and locations and spawned at specific times of the year. Today, as was probably the case historically, the siscowet morphotype is the most abundant. Recent interest in harvesting siscowets to extract oil containing omega-3 fatty acids will require additional knowledge of the biology and stock structure of these lightly exploited populations. The objective of this study was to determine whether shape differences exist among siscowet populations across Lake Superior and whether these shape differences can be used to infer stock structure. Morphometric analysis (truss protocol) was used to differentiate among siscowets sampled from 23 locations in Lake Superior. We analyzed 31 distance measurements among 14 anatomical landmarks taken from digital images of fish recorded in the field. Cluster analysis of size-corrected data separated fish into three geographic groups: The Isle Royale, eastern (Michigan), and western regions (Michigan). Finer scales of stock structure were also suggested. Discriminant function analysis demonstrated that head measurements contributed to most of the observed variation. Cross-validation classification rates indicated that 67–71% of individual fish were correctly classified to their region of capture. This is the first study to present shape differences associated with location within a lake trout morphotype in Lake Superior.

  8. El contexto virtual en la educación superior

    National Research Council Canada - National Science Library

    Vera Quintana, Mercedes

    2015-01-01

    ... técnicos, organizativos y metodológicos, por tanto, la virtualización de la educación superior durante su relativa corta vida, ha sido ese nuevo paradigma educativo resultante del uso de las tecnologías...

  9. Evaluation of the Superior Gluteal Nerve During Proximal Femoral Nailing

    Directory of Open Access Journals (Sweden)

    Mehmet Sonmez

    2017-05-01

    Full Text Available Aim: The superior gluteal nerve may be compromised during hip surgery. We retrospectively evaluated the patients who underwent proximal femoral nailing for unstable trochanteric fractures in order to investigate the presence of superior gluteal nerve injury and its clinical findings. Material and Method: Twenty five patients (14 women, 11 men were included in the study who had femoral nailing between January 2004 and March 2010 at Hamidiye Sisli Etfal Training and Research Hospital Department of Orthopaedics. Two different types of nails which have similar designs and surgical techniques were used for fracture fixation. Patients who had a history of cerebrovascular disease, electromyography findings of polyneuropathy, or degenerative vertebral disease were excluded from the study. Patients were evaluated clinically and radiologically. Findings related to acute denervation in the gluteus medius muscle and motor unit action potential changes were accepted as signs of superior gluteal nerve injury. Results: Eight patients were using support during walking and three of these patients had positive Trendelenburg sign, but only one patient had acute denervation signs of the superior gluteal nerve. Discussion: Based on the present study the incidence of iatrogenic nerve injury is a rare complication of proximal femoral nailing. Elderly patients, regardless of whether they have nerve injury, may limp and need to use a walking support.

  10. The effect of superior auditory skills on vocal accuracy

    Science.gov (United States)

    Amir, Ofer; Amir, Noam; Kishon-Rabin, Liat

    2003-02-01

    The relationship between auditory perception and vocal production has been typically investigated by evaluating the effect of either altered or degraded auditory feedback on speech production in either normal hearing or hearing-impaired individuals. Our goal in the present study was to examine this relationship in individuals with superior auditory abilities. Thirteen professional musicians and thirteen nonmusicians, with no vocal or singing training, participated in this study. For vocal production accuracy, subjects were presented with three tones. They were asked to reproduce the pitch using the vowel /a/. This procedure was repeated three times. The fundamental frequency of each production was measured using an autocorrelation pitch detection algorithm designed for this study. The musicians' superior auditory abilities (compared to the nonmusicians) were established in a frequency discrimination task reported elsewhere. Results indicate that (a) musicians had better vocal production accuracy than nonmusicians (production errors of 1/2 a semitone compared to 1.3 semitones, respectively); (b) frequency discrimination thresholds explain 43% of the variance of the production data, and (c) all subjects with superior frequency discrimination thresholds showed accurate vocal production; the reverse relationship, however, does not hold true. In this study we provide empirical evidence to the importance of auditory feedback on vocal production in listeners with superior auditory skills.

  11. Visuospatial Superiority in Developmental Dyslexia: Myth or Reality?

    Science.gov (United States)

    Brunswick, Nicola; Martin, G. Neil; Marzano, Lisa

    2010-01-01

    Anecdotal evidence indicates that dyslexia is positively associated with superior visuospatial ability but empirical evidence is inconsistent. We explicitly tested the hypothesis that dyslexia is associated with visuospatial advantage in 20 dyslexic and 21 unimpaired adult readers using paper-and-pencil measures and tests of "everyday"…

  12. Early detection of non-indigenous fishes in Lake Superior

    Science.gov (United States)

    Invasive species pose a serious threat to the ecological stability of the Great Lakes warranting continual monitoring for the arrival of new species. Three locations in Lake Superior were identified as “high risk” for new introductions: St. Louis River near Duluth, M...

  13. Preference for concentric orientations in the mouse superior colliculus

    NARCIS (Netherlands)

    Ahmadlou, Mehran; Heimel, J Alexander

    2015-01-01

    The superior colliculus is a layered structure important for body- and gaze-orienting responses. Its superficial layer is, next to the lateral geniculate nucleus, the second major target of retinal ganglion axons and is retinotopically organized. Here we show that in the mouse there is also a

  14. Funciones superiores en pacientes con accidente cerebro vascular

    National Research Council Canada - National Science Library

    Felipe Rodríguez; Alfonso Urzúa

    2009-01-01

    .... Con base a esto el objetivo de esta investigación fue elaborar un perfil de deterioro neuropsicológico de las diversas funciones cerebrales superiores causado por un ACV, en un grupo de 50 pacientes de la Unidad de Medicina...

  15. Absence of the superior petrosal veins and sinus: Surgical considerations

    Directory of Open Access Journals (Sweden)

    Ken Matsushima

    2015-01-01

    Conclusions: In cases in which the superior petrosal sinus and veins are absent, care should be directed to preserving the collateral drainage through the galenic and tentorial tributaries. Although surgical strategies for intraoperative management and preservation of venous structures are still controversial, knowledge of the possible anatomical variations is considered to be essential to improve surgical outcomes.

  16. Lake Superior supports novel clusters of cyanobacterial picoplankton.

    Science.gov (United States)

    Ivanikova, Natalia V; Popels, Linda C; McKay, R Michael L; Bullerjahn, George S

    2007-06-01

    Very little is known about the biodiversity of freshwater autotrophic picoplankton (APP) in the Laurentian Great Lakes, a system comprising 20% of the world's lacustrine freshwater. In this study, the genetic diversity of Lake Superior APP was examined by analyzing 16S rRNA gene and cpcBA PCR amplicons from water samples. By neighbor joining, the majority of 16S rRNA gene sequences clustered within the "picocyanobacterial clade" consisting of freshwater and marine Synechococcus and Prochlorococcus. Two new groups of Synechococcus spp., the pelagic Lake Superior clusters I and II, do not group with any of the known freshwater picocyanobacterial clusters and were the most abundant species (50 to 90% of the sequences) in samples collected from offshore Lake Superior stations. Conversely, at station Portage Deep (PD), located in a nearshore urbanized area, only 4% of the sequences belonged to these clusters and the remaining clones reflected the freshwater Synechococcus diversity described previously at sites throughout the world. Supporting the 16S rRNA gene data, the cpcBA library from nearshore station PD revealed a cosmopolitan diversity, whereas the majority of the cpcBA sequences (97.6%) from pelagic station CD1 fell within a unique Lake Superior cluster. Thus far, these picocyanobacteria have not been cultured, although their phylogenetic assignment suggests that they are phycoerythrin (PE) rich, consistent with the observation that PE-rich APP dominate Lake Superior picoplankton. Lastly, flow cytometry revealed that the summertime APP can exceed 10(5) cells ml-1 and suggests that the APP shifts from a community of PE and phycocyanin-rich picocyanobacteria and picoeukaryotes in winter to a PE-rich community in summer.

  17. [Examination of the hypothesis 'the factors and mechanisms of superiority'].

    Science.gov (United States)

    Sierra-Fitzgerald, O; Quevedo-Caicedo, J; López-Calderón, M G

    INTRODUCTION. The hypothesis of Geschwind and Galaburda suggests that specific cognitive superiority arises as a result of an alteration in development of the nervous system. In this article we review the co existence of superiority and inferiority . PATIENTS AND METHODS. A study was made of six children aged between 6 and 8 years old at the Instituto de Belles Artes Antonio Maria Valencia in Cali,Columbia with an educational level between second and third grade at a primary school and of medium low socio economic status. The children were considered to have superior musical ability by music experts, which is the way in which the concept of superiority was to be tested. The concept of inferiority was tested by neuropsychological tests = 1.5 DE below normal for the same age. We estimated the perinatal neurological risk in each case. Subsequently the children s general intelligence and specific cognitive abilities were evaluated. In the first case the WISC R and MSCA were used. The neuropsychological profiles were obtained by broad evaluation using a verbal fluency test, a test using counters, Boston vocabulary test, the Wechster memory scale, sequential verbal memory test, super imposed figures test, Piaget Head battery, Rey Osterrieth complex figure and the Wisconsin card classification test. The RESULTS showed slight/moderate deficits in practical construction ability and mild defects of memory and concept abilities. In general the results supported the hypothesis tested. The mechanisms of superiority proposed in the classical hypothesis mainly involve the contralateral hemisphere: in this study the ipsilateral mechanism was more important.

  18. Los aspectos psicológicos y pedagógicos del ámbito cultural creativo de las instituciones de educación superior

    Directory of Open Access Journals (Sweden)

    Larisa Ordina

    2013-11-01

    Full Text Available En el artículo se trata de los aspectos psicológicos y pedagógicos del ámbito cultural creativo (en adelante es ACC de las instituciónes de educación superior (en adelante una universidad, a saber: está analizada la génesis del concepto del ACC como un fenómeno pedagógico, están definidos los enfoques metodológicos, que permiten influir positivamente sobre el desarrollo de la personalidad cultural creativa en la institución educativa; están motivados los principios que determinan el éxito de la creación del ACC; están revelados el contenido y la secuencia de las orientaciones axiológicas del ámbito cultural creativo de las instituciones de educación superior, que incluyen el grupo de los valores ya configurados. El ACC de una universidad muelda un tipo de personalidad humanista, que no sólo consume los valores culturales, sino también los multiplica, y el moldeo de una personalidad creativa, su autodesarrollo en la educación, junto con la aparición de numerosos innovadores modelos de formación marca un cambio radical en el tipo de herencia socio-cultural, lo que proporciona una ventaja sobre una nueva copia de lo desactualizado.

  19. Estudio de la prevalencia de un tercer conducto en primeros premolares superiores mediante diafanización

    Directory of Open Access Journals (Sweden)

    Katherine Stephanie De la Rosa Fernández

    2016-09-01

    Full Text Available Existen fracasos endodónticos que son relacionados por diferentes causas como: obturación incompleta, filtración coronal y fallos por parte del clínico en identificar o localizar los conductos radiculares y sus ramificaciones. Por este motivo, es básico la noción de la anatomía interna dental y sobre todo es importante tener en cuenta las variaciones que pueden existir en las distintas piezas dentales. Objetivo: El propósito del presente estudio es conocer la cantidad de conductos existentes en los primeros premolares superiores y saber si existe el tercer conducto en dichas piezas. Materiales y métodos: Se utilizaron 100 primeros premolares superiores donados por la Cátedra de Endodoncia de la Facultad de Odontología de la Universidad Central del Ecuador, los cuales fueron divididos en tres grupos según la cantidad de raíces que presentaban y sometidos a diafanización para poder observar su morfología interna. Resultados: Se encontró en la muestra de dientes evaluados la presencia de tres conductos en el 7%, la presencia de dos conductos en el 72% y de un conducto en el 21%. Conclusiones: Los primeros premolares superiores presentan uno, dos y tres conductos. La presencia de tres conductos tiene una baja prevalencia.

  20. Los nuevos desafíos de la enseñanza superior agropecuaria en Centroamérica

    Directory of Open Access Journals (Sweden)

    Prof. Dr. Enrique Rimbaud;

    2005-05-01

    Full Text Available ...Centroamérica tiene una tradición universitaria secular, universidades como la Universidad de San Carlos de Guatemala (1671, la Universidad Nacional Autónoma de Nicaragua de León en Nicaragua (1812, o la Universidad de El Salvador (1841 portan los orgullosos estandartes de mas de una centuria dedicados a la formación superior de profesionales, estableciendo una tradición universitaria del mas alto rango a nivel internacional.No obstante, la formación superior agropecuaria es historia reciente, registrándose como una de las mas antiguas, la Universidad Nacional Agraria, de Nicaragua, que data de 1929, en Guatemala, que data de 1950, y Costa Rica, la Universidad de Heredia desde 1973, hasta este ultimo quinquenio en el que hemos asistido a una multiplicación de ofertas académicas dado el nacimiento de decenas y decenas de Escuelas y Facultades de Enseñanza Superior Agropecuaria...

  1. La evaluacion de la docencia ante el reto del espacio europeo de educación superior (EEES

    Directory of Open Access Journals (Sweden)

    Carmen Calderón Patier

    2008-01-01

    Full Text Available El principal objetivo del proceso de convergencia de la enseñanza superior que estamos viviendo, en el marco del Espacio Europeo de Educación Superior (EEES, es convertir a los sistemas universitarios europeos en un referente internacional por la calidad de la enseñanza impartida. Ello exige una revisión, actualización y adaptación de las actuales metodologías docentes y de su organización, así como del establecimiento de técnicas y prácticas que permitan evaluar integralmente la enseñanza. En este contexto, el presente trabajo se analizan los tres pilares de la evaluación de la educación superior: en primer lugar, la evaluación del alumnado (o del aprendizaje según las diferentes formas alternativas de evaluación de los resultados de los alumnos, en segundo lugar, la evaluación de la actividad docente, analizando las ventajas e inconvenientes de las encuestas de opinión, y por último la evaluación institucional de la docencia

  2. LA INVESTIGACIÓN EN EL CONTEXTO DE LA EDUCACIÓN SUPERIOR: UNA EXPERIENCIA EN EL SUR DEL BRASIL

    Directory of Open Access Journals (Sweden)

    María Piedad Rangel Meneses

    2006-01-01

    Full Text Available Tras una descripción del contexto brasileño en el cual desarrollo mi quehacer investigador abordo en este trabajo las dinámicas de la vida académica en la educación superior y la organización de la investigación en el país, los mecanismos para obtener aprobación y financiación para investigación, así como los criterios para la calificación de programas de educación superior según la vinculación de docentes y alumnos en las actividades de investigación, según su productividad y la divulgación de la investigación, con el fin de profundizar en el papel de la educación superior en la producción de conocimiento, para favorecer los procesos de investigación, su articulación con el currículo y el conocimiento de experiencias que inspiren procesos investigativos.

  3. A influência do membro superior na marcha de indivíduos com hemiparesia: revisão

    Directory of Open Access Journals (Sweden)

    Lauren Giustti Mazzei

    2016-07-01

    Full Text Available A compreensão da influência do membro superior na marcha de indivíduos hemiparéticos é de extrema importância. Sendo assim, o trabalho objetivou-se no estudo da importância que o membro superior tem na marcha de pacientes após acidente vascular encefálico (AVE. Foi realizada uma revisão bibliográfica na qual buscou-se artigos científicos nas bases de dados, LILACS, BIREME, SciELO e Cochrane. A pesquisa levou em consideração trabalhos publicados no período de 2002 a 2014. De acordo com os artigos encontrados, concluiu-se que a biomecânica da marcha está diretamente relacionada ao membro superior, sendo assim, qualquer disfunção poderá alterar a marcha de pacientes após AVE.

  4. Modelo de vinculación entre las Instituciones de Educación Superior y las empresas: gestión del conocimiento

    Directory of Open Access Journals (Sweden)

    Clara Escamilla Santana

    2012-03-01

    Full Text Available The aim of this paper is to determine whether the knowledge acquired through collaboration processes between higher education institutions and businesses is managed, in a way in which its benefits in terms of technological developments and impacts are useful. Collaboration processes will be understood as mechanisms and tools of collaboration and mutual benefit established between higher education institutions and businesses. The research is based on a study of 11 companies in the State of Guanajuato. An academic collaboration model between IES and businesses is proposed in an attempt to promote parallel knowledge management through different projects. This document emphasizes the importance of knowledge inside organizations, since the moment in which it is created to the moment in which it is made public, considering its growth, permanence and competitiveness.Este trabajo tiene por objetivo conocer si se gestiona el conocimiento generado por un proceso de vinculación Instituciones de Educación Superior (IES-Empresa, así como el impacto del mismo en el desarrollo tecnológico de las organizaciones, entendiéndose la vinculación como los mecanismos e instrumentos de colaboración y el beneficio mutuo que se han establecido entre las mismas. A partir de un trabajo realizado con 11 empresas del estado de Guanajuato, se propone un modelo de vinculación IES-Empresa que paralelamente permita la gestión del conocimiento que se genera gracias a las actividades y proyectos que lo componen. El trabajo parte de la premisa de la importancia que el conocimiento tiene hoy en día para las organizaciones, ya que de su creación, sistematización y difusión dependen entre otros factores como su permanencia, crecimiento y competitividad.

  5. Los contextos de la investigación, la educación superior y el nuevo valor del conocimiento en América Latina

    Directory of Open Access Journals (Sweden)

    González Bolaños, Ondina

    2000-08-01

    Full Text Available This article analyzes the relevance of the professional and scientifical contexts in the study and research systems in Latin America. The international situation in the framework of the present scientific and technological revolution and the new value of knowledge is studied, as well as its impact on the region and the need to understand the turn in orden to comprehend the crisis of higher education and the solutions proposed. The need to foster an endogeneous human development as the axis of a democratic and national building, as well as relationships based on equality and freedom with the rest of the world, is also analyzed.

    En este artículo se analiza la importancia de los contextos de la práctica profesional y científica en los sistemas de formación e investigación en América Latina. Así, se aborda la situación internacional que establece la actual revolución científica y tecnológica y el nuevo valor del conocimiento, su impacto en la región y la necesidad de comprensión del giro para entender la crisis de la educación superior y las salidas propuestas. La necesidad de impulsar un desarrollo endógeno, humano sostenible como eje de una construcción democrática y nacional, y de las relaciones de equidad, igualdad y libertad con el resto del mundo.

  6. Didáctica de la Educación Superior: nuevos desafíos en el siglo XXI

    Directory of Open Access Journals (Sweden)

    Tiburcio Moreno Olivos

    2011-06-01

    Full Text Available El artículo analiza la problemática conceptual y práctica de la didáctica general en el contexto de la educación superior contemporánea. En la primera parte se recuperan los orígenes y el desarrollo de la didáctica, pues revisar el proceso histórico que esta disciplina ha tenido resulta fundamental para comprender su situación en el presente y sus futuros desafíos. También se aborda la especificidad del objeto de la didáctica, cuya complejidad ha generado debates y controversias en distintas épocas. La segunda parte se ocupa de los principales cambios que afronta la educación superior actual y en este marco se busca identificar algunos retos de la enseñanza superior; así como los ajustes que se tendrían que producir en las instituciones educativas para afrontar esta nueva realidad de forma adecuada. Estos cambios están permeando el proceso de enseñanza-aprendizaje, haciéndolo mucho más complejo que antes, lo que ha generado que los docentes tengan que adquirir nuevos conocimientos y desarrollar o reaprender nuevas competencias, habilidades y actitudes. El foco se centra en el papel del docente actual y en cómo la didáctica general como disciplina, puede ser una valiosa herramienta que le sirva para intervenir de forma más efectiva en la mejora del proceso educativo.

  7. Los aspectos psicológicos y pedagógicos del ámbito cultural creativo de las instituciones de educación superior

    OpenAIRE

    Larisa Ordina

    2013-01-01

    En el artículo se trata de los aspectos psicológicos y pedagógicos del ámbito cultural creativo (en adelante es ACC) de las instituciónes de educación superior (en adelante una universidad), a saber: está analizada la génesis del concepto del ACC como un fenómeno pedagógico, están definidos los enfoques metodológicos, que permiten influir positivamente sobre el desarrollo de la personalidad cultural creativa en la institución educativa; están motivados los principios que determinan el éxito d...

  8. Las TICs en la enseñanza superior

    OpenAIRE

    Rosanigo, Zulema Beatriz; Paur, Alicia Beatriz; Bramati, Pedro; Bramati, Hernán

    2006-01-01

    Nuestro objetivo general es la investigación continua de nuevos medios de educación que puedan servir para optimizar el proceso de enseñanza aprendizaje sabiendo que la sociedad actual exige la formación de un futuro profesional apto en el manejo de las últimas tecnologías y capaz de procesar y elaborar activamente los nuevos conocimientos. En este artículo se presentan los temas de investigación, desarrollo y experimentación sobre los que este grupo de la Universidad Nacional de la Patago...

  9. Bioaccumulation of toxaphene congeners in the lake superior food web

    Science.gov (United States)

    Muir, D.C.G.; Whittle, D.M.; De Vault, D. S.; Bronte, C.R.; Karlsson, H.; Backus, S.; Teixeira, C.

    2004-01-01

    The bioaccumulation and biotransformation of toxaphene was examined in the food webs of Lake Superior and Siskiwit Lake (Isle Royale) using congener specific analysis as well as stable isotope ratios of carbon and nitrogen to characterize food webs. Toxaphene concentrations (calculated using technical toxaphene) in lake trout (Salvelinus namaycush) from the western basin of Lake Superior (N = 95) averaged (±SD) 889 ± 896 ng/g wet wt and 60 ± 34 ng/g wet wt in Siskiwit Lake. Major congeners in lake trout were B8-789 (P38), B8-2226 (P44), B9-1679 (P50), and B9-1025 (P62). Toxaphene concentrations were found to vary seasonally, especially in lower food web organisms in Lake Superior and to a lesser extent in Siskiwit Lake. Toxaphene concentrations declined significantly in lake herring (Coregonus artedii), rainbow smelt (Omerus mordax), and slimy sculpin (Cottus cognatus) as well as in zooplankton (> 102 &mn;m) and Mysis (Mysis relicta) between May and October. The seasonal variation may reflect seasonal shifts in the species abundance within the zooplankton community. Trophic magnification factors (TMF) derived from regressions of toxaphene congener concentrations versus δ15N were > 1 for most octa- and nonachlorobornanes in Lake Superior except B8-1413 (P26) and B9-715. Log bioaccumulation factors (BAFs) for toxaphene congeners in lake trout (ng/g lipid/ng/L dissolved) ranged from 4.54 to 9.7 and were significantly correlated with log octanol-water partition coefficients. TMFs observed for total toxaphene and congener B9-1679 in Lake Superior were similar to those in Arctic lakes, as well as to previous studies in the Great Lakes, which suggests that the bioaccumulation behavior of toxaphene is similar in pelagic food webs of large, cold water systems. However, toxaphene concentrations were lower in lake trout from Siskiwit Lake and lakes in northwestern Ontario than in Lake Superior possibly because of shorter food chains and greater reliance on zooplankton or

  10. Apuntes en torno al TLC Centroamérica/Estados Unidos y sus implicaciones para la educación superior

    Directory of Open Access Journals (Sweden)

    Luis Muñoz Varela

    2005-01-01

    Full Text Available El presente artículo tiene como propósito realizar una breve aproximación analítica a los aspectos que, en el marco de la propuesta de Tratado de Libre Comercio entre Centroamérica y Estados Unidos, conciernen o implican a la educación superior y, en especial, a la educación superior pública. El artículo aborda dos ejes de análisis. El primero de ellos, está referido específicamente a los lineamientos y estipulaciones que involucra el texto del TLC Centroamérica/Estados Unidos, en lo relativo a las implicaciones que derivan de esa propuesta para las instituciones de educación superior y, en particular, para la educación superior pública. El segundo eje, por su parte, consiste en una breve revisión de trabajos elaborados por especialistas en torno a los alcances que, en su caso, presentan para la educación superior algunas de las estipulaciones contenidas en el Acuerdo General sobre Comercio de Servicios (AGCS, de la Organización Mundial del Comercio.

  11. Aspectos tecnológicos e sensoriais do guandu [Cajanus cajan (L. Millsp.] enlatado em diferentes estádios de maturação Technological and sensorial aspects of pigeon pea [Cajanus cajan (L. Millsp.] canned at different stages of maturation

    Directory of Open Access Journals (Sweden)

    M.F.P. BARCELOS

    1999-01-01

    Full Text Available O objetivo deste trabalho é viabilizar a introdução do guandu verde enlatado no mercado brasileiro. Foram realizadas três colheitas de grãos ainda verdes da cultivar IAC Fava Larga obtidos no 44º, 57º e 62º dia após a floração (DAF e finalmente no 92º DAF, quando os grãos já possuíam cor pardo-amarelada. Para todos os lotes, após otimização das condições de enlatamento, 121ºC durante 5 a 6 minutos, efetuaram-se estudos quanto ao acúmulo de matéria seca, composição dos grãos, cor, textura e aceitação sensorial. Conclui-se, através do acúmulo de matéria seca do grão, que a maturidade fisiológica ocorreu em torno do 62º DAF, quando também apresentou as melhores características para o enlatamento. As cores dos grãos pós-enlatamento, vermelha e amarela (unidades Lab Hunter apresentaram estáveis até o 62º DAF. A textura foi gradativamente mais firme com o avanço do amadurecimento tendo verificado correlação positiva (r = 0,96 entre medidas de texturas sensorial e instrumental. A aceitação do guandu enlatado cultivar IAC Fava Larga foi apenas regular.The objective of this work is to enable the introduction of canned green pigeon pea in Brazilian market. Three harvests of still green grains of the cultivar IAC Fava Larga, obtained on the 44th, 57th and 62nd days after flowering, DAF, and finally on the 92nd DAF when the grains already possessed yellowish dusky color, were undertaken. To all the lots, after optimization of canning conditions, 121ºC for 5 to 6 minutes, studies concerning the accumulation of dry matter, grain composition, color, texture and sensorial acceptance were carried out. It was concluded through the accumulation of dry matter of the grain, that the physiological maturity occurred around the 62nd DAF. The texture was gradually firmer with advancing maturation, and positive correlation having been found (r = 0,96 between sensorial and instrumental texture measures was noticed. The

  12. Ratio superior, ratio inferior y el agustinismo de Tomás de Aquino

    Directory of Open Access Journals (Sweden)

    Moya Cañas, Patricia

    2013-12-01

    Full Text Available This article discusses Aquinas’ reception of the Augustinian distinction between ratio inferior and superior. Though not a central aspect of Aquinas’ thought, it is a signifi cant pointer to the presence of Augustinian patterns of thought in a non-theological part of his work. After a general survey of the presence of this distinction in the opera omnia of Aquinas, his use of this topic in some specific instances is discussed: the distinction between contemplative and active life, the division of human faculties, and the moral problem of peevish delight.El artículo discute la recepción que hace Tomás de Aquino de la distinción agustiniana entre razón superior e inferior. Si bien no se trata de uno de los tópicos centrales de la doctrina tomasiana, es un elemento significativo a la hora de considerar dentro de la obra de Tomás la presencia de patrones agustinianos de pensamiento que no sean primordialmente teológicos. Tras discutir de modo general la presencia de esta distinción en la obra del aquinate, y los estudios previos sobre este binomio, se procede a discutir su uso por parte de Tomás de Aquino ante tres problemas específicos: la distinción entre géneros de vida, la división de las facultades humanas, y el problema moral de la delectación morosa.

  13. Ensino superior: o momento crítico Higher education: the critical moment

    Directory of Open Access Journals (Sweden)

    Christophe Charle

    2004-10-01

    Full Text Available Com a aplicação da reforma dita do "LMD" (Licence, Master, Doctorat,1 as universidades francesas iniciaram um processo que, segundo seus idealizadores, vai facilitar a harmonização dos currículos europeus e a mobilidade internacional dos estudantes. Ora, uma análise mais aprofundada revela que essa reforma é norteada por outras lógicas que favorecem mais particularmente o desenvolvimento da concorrência entre estabelecimentos e uma maior "mercadorização" do ensino superior. Com essa reforma, a preocupação pela democratização do ensino superior parece ter completamente desaparecido e o lugar concedido a uma pesquisa livre e autônoma - que, entretanto, está na própria base da idéia de universidade -, parece ter sido reduzido ao estrito mínimo, em virtude, entre outras coisas, do desenvolvimento de uma concepção utilitarista e mercantil tanto do ensino como da pesquisa.With the introduction of the reform called 'LMD' (Licence, Master, Doctorat, the French universities started a process that, in according to its idealizing, will facilitate de harmonization of the European curriculum and the international mobility of the students. However, one more deep analysis shows that this reform is guided by others logic that support, more particularly, the development of the business competition among the educational institutions and the commodification of the higher education. With this reform, the preoccupation about democratization of the higher education looks to be completely disappeared and the place given to the free and autonomous research, that in the other hand is in the basis of the idea about university, to be reduced to the strict minimum, owing to, among other things, the development of an utilitarian and commercial conception of both, education and research.

  14. Formación centrada en competencias estudiantiles en educación superior

    Directory of Open Access Journals (Sweden)

    Rafaela Herrero Martínez

    2015-01-01

    Full Text Available Con la creación del Espacio Europeo de Educación Superior (EEES, se establece para las universidades una serie de modificaciones en las aulas, de tipo metodológico, y surgen nuevos escenarios que sitúan como principal protagonista del proceso de enseñanza-aprendizaje al alumnado. El presente artículo se focaliza en conocer la adquisición de competencias estudiantiles en el proceso didáctico del alumnado de educación superior. Se recurre a un diseño de carácter no experimental y descriptivo basado en estudios de encuesta, con aplicación de un cuestionario a una población de 146 estudiantes de la especialidad de Educación Primaria del Centro de Magisterio “Sagrado Corazón” de Córdoba, España. Los resultados muestran las valoraciones obtenidas del nivel de adquisición de competencias genéricas y específicas (profesionales y académicas en el alumnado universitario de este Centro. Se concluye que las competencias genéricas que obtienen mejores puntuaciones son las de tipo sistémico y, en cuanto a las específicas, son las actitudinales. Finalmente, hay que señalar que no existe un reparto equitativo de competencias a lo largo de las materias ni en los cursos, lo que demuestra la necesidad de una revisión de las guías docentes de las materias y una graduación de las mismas.

  15. La filosofía para niños en el fortalecimiento del pensamiento superior

    Directory of Open Access Journals (Sweden)

    Ramiro Llanos Bolívar

    2015-08-01

    Full Text Available ResumenEste artículo muestra que a través de la filosofía para niños se puede dar una educación distinta a la ofrecida cotidianamente, y con la cual niños y jóvenes mientras participan activamente en el programa construyen sus propias herramientas para vivir en comunidad, es decir, van creando espacios necesarios para la formación de un nuevo ciudadano: disertación, diálogo y comunicación; el trabajo, además, presenta la implementación del proyecto en una institución educativa, Escuela Normal Superior del Distrito de Barranquilla, considerándola como centro de formación en ciernes de un arquetipo de maestros. AbstractThis paper shows that through philosophy for children, an education which is different from the one offered daily can be taught. With this type of education, children and young people alike can participate actively in the program while they build their own tools to live together; that is to say, they create spaces necessary for the formation of a new citizen: lecture, dialogue and communication. Furthermore, the work also presents the implementation of the project at “Escuela Normal Superior del Distrito” in Barranquilla, considering it as a training center in the making of an archetype of teachers.

  16. Lesões do membro superior no esporte Sports injuries of the upper limb

    Directory of Open Access Journals (Sweden)

    Rogerio Teixeira da Silva

    2010-01-01

    Full Text Available As lesões esportivas do membro superior são muito comuns da prática de atividades físicas e, por isso, devem ser estudadas detalhadamente, levando-se em consideração aspectos específicos da modalidades esportiva praticada. Especial atenção deve ser dada à dinâmica da articulação do ombro e toda cintura escapular, pois somente assim poderemos tratar de forma mais adequada os atletas, atuando também na prevenção das recidivas, que podem ocorrer em alguns casos devido ao fato de o atleta procurar sempre o retorno ao mesmo nível esportivo anterior à lesão. Este artigo vai focar principalmente o manejo das lesões tendíneas do membro superior, da fisiopatologia até os novos métodos de tratamento das lesões de maior prevalência na prática esportiva em nosso país.Sports injuries of the upper limbs are very common in physical activities, and need to be studied in detail, taking into consideration specific aspects of the types of sports practiced. Special attention should be paid to the dynamics of the shoulder girdle and scapular belt, as this will enable us to treat athletes more adequately, also helping prevent recurrences that can occur in some cases, due to the fact that the athlete always attempts to return to their pre-injury level of sport. This review focuses primarily on the management of upper limb tendon sports injuries, from the physiopathology through to the more common new methods of treatment in sports practice in our country.

  17. Air Superiority at Red Flag: Mass, Technology, and Winning the Next War

    Science.gov (United States)

    2009-10-01

    improved their estimate. In The Art of Wargaming, Peter Perla suggests that adding exercise analysis could help. He recommends a “continuous cycle...Survey, 44. 45. Ibid., 27–28. 46. “Desert Shield Tactical Air Force Combat Losses, Damage, and Muni- tions Consumption.” 47. Ibid. 48. Perla , Art of...Williamson. Strategy for Defeat: The Luftwaffe, 1933– 1945, 1983. Reprint. Maxwell AFB, AL: Air University Press, 2007. Perla , Peter P. The Art of Wargaming

  18. Novel active stabilization technology in highly crosslinked UHMWPEs for superior stability

    Science.gov (United States)

    Oral, Ebru; Neils, Andrew L.; Wannomae, Keith K.; Muratoglu, Orhun K.

    2014-12-01

    Radiation cross-linked ultrahigh molecular weight polyethylene (UHMWPE) is the bearing of choice in joint arthroplasty. The demands on the longevity of this polymer are likely to increase with the recently advancing deterioration of the performance of alternative metal-on-metal implants. Vitamin E-stabilized, cross-linked UHMWPEs are considered the next generation of improved UHMWPE bearing surfaces for improving the oxidation resistance of the polymer. It was recently discovered that in the absence of radiation-induced free radicals, lipids absorbed into UHMWPE from the synovial fluid can initiate oxidation and result in new free radical-mediated oxidation mechanisms. In the presence of radiation-induced free radicals, it is possible for the polymer to oxidize through both existing free radicals at the time of implantation and through newly formed free radicals in vivo. Thus, we showed that reducing the radiation-induced free radicals in vitamin E-stabilized UHMWPE would increase its oxidative stability and presumably lead to improved longevity. We describe mechanical annealing and warm irradiation of irradiated vitamin E blends as novel methods to eliminate 99% of radiation-induced free radicals without sacrificing crystallinity. These are significant improvements in the processing of highly cross-linked UHMWPE for joint implants with improved longevity.

  19. The Mediterranean Crucible, 1942-1943: Did Technology or Tenets Achieve Air Superiority

    Science.gov (United States)

    2012-06-01

    position in the Mediterranean and “demonstrate his equality and independence” from Germany, Benito Mussolini pursued a failed attempt to invade and...dispatched the Italian invaders and in the process humiliated Mussolini and infuriated Hitler. The blunders by Mussolini forced Hitler to reconsider his...was concentrating aircraft at an airfield at Castel Benito (Tripoli, Libya), the XII Bomber Command struck with 13 B-17s escorted by 33 P-38s

  20. Superior visual performance in nocturnal insects: neural principles and bio-inspired technologies

    Science.gov (United States)

    Warrant, Eric J.

    2016-04-01

    At night, our visual capacities are severely reduced, with a complete loss in our ability to see colour and a dramatic loss in our ability to see fine spatial and temporal details. This is not the case for many nocturnal animals, notably insects. Our recent work, particularly on fast-flying moths and bees and on ball-rolling dung beetles, has shown that nocturnal animals are able to distinguish colours, to detect faint movements, to learn visual landmarks, to orient to the faint pattern of polarised light produced by the moon and to navigate using the stars. These impressive visual abilities are the result of exquisitely adapted eyes and visual systems, the product of millions of years of evolution. Nocturnal animals typically have highly sensitive eye designs and visual neural circuitry that is optimised for extracting reliable information from dim and noisy visual images. Even though we are only at the threshold of understanding the neural mechanisms responsible for reliable nocturnal vision, growing evidence suggests that the neural summation of photons in space and time is critically important: even though vision in dim light becomes necessarily coarser and slower, it also becomes significantly more reliable. We explored the benefits of spatiotemporal summation by creating a computer algorithm that mimicked nocturnal visual processing strategies. This algorithm dramatically increased the reliability of video collected in dim light, including the preservation of colour, strengthening evidence that summation strategies are essential for nocturnal vision.