Challenging the Superiority of Phonological Fluency
DEFF Research Database (Denmark)
Erz, Antonia; Christensen, Bo
2014-01-01
The results of three laboratory experiments contribute to our understanding of effects of phonological fluency on correct recognition and recall of novel brand names, being relevant to the areas of information processing, memory, and branding. Employing the full range of fluency, the results offer...
Brain bases of reading fluency in typical reading and impaired fluency in dyslexia.
Directory of Open Access Journals (Sweden)
Joanna A Christodoulou
Full Text Available Although the neural systems supporting single word reading are well studied, there are limited direct comparisons between typical and dyslexic readers of the neural correlates of reading fluency. Reading fluency deficits are a persistent behavioral marker of dyslexia into adulthood. The current study identified the neural correlates of fluent reading in typical and dyslexic adult readers, using sentences presented in a word-by-word format in which single words were presented sequentially at fixed rates. Sentences were presented at slow, medium, and fast rates, and participants were asked to decide whether each sentence did or did not make sense semantically. As presentation rates increased, participants became less accurate and slower at making judgments, with comprehension accuracy decreasing disproportionately for dyslexic readers. In-scanner performance on the sentence task correlated significantly with standardized clinical measures of both reading fluency and phonological awareness. Both typical readers and readers with dyslexia exhibited widespread, bilateral increases in activation that corresponded to increases in presentation rate. Typical readers exhibited significantly larger gains in activation as a function of faster presentation rates than readers with dyslexia in several areas, including left prefrontal and left superior temporal regions associated with semantic retrieval and semantic and phonological representations. Group differences were more extensive when behavioral differences between conditions were equated across groups. These findings suggest a brain basis for impaired reading fluency in dyslexia, specifically a failure of brain regions involved in semantic retrieval and semantic and phonological representations to become fully engaged for comprehension at rapid reading rates.
McCarthy, Michael
2009-01-01
This article re-examines the notion of spoken fluency. Fluent and fluency are terms commonly used in everyday, lay language, and fluency, or lack of it, has social consequences. The article reviews the main approaches to understanding and measuring spoken fluency and suggest that spoken fluency is best understood as an interactive achievement, and offers the metaphor of ‘confluence’ to replace the term fluency. Many measures of spoken fluency are internal and monologue-based, whereas evidence...
Kim, Young-Suk Grace
2015-01-01
The primary goal was to expand our understanding of text reading fluency (efficiency or automaticity)-how its relation to other constructs (e.g., word reading fluency and reading comprehension) changes over time and how it is different from word reading fluency and reading comprehension. We examined (1) developmentally changing relations among word reading fluency, listening comprehension, text reading fluency, and reading comprehension; (2) the relation of reading comprehension to text reading fluency; (3) unique emergent literacy predictors (i.e., phonological awareness, orthographic awareness, morphological awareness, letter name knowledge, vocabulary) of text reading fluency vs. word reading fluency; and (4) unique language and cognitive predictors (e.g., vocabulary, grammatical knowledge, theory of mind) of text reading fluency vs. reading comprehension. These questions were addressed using longitudinal data (two timepoints; Mean age = 5;24 & 6;08) from Korean-speaking children ( N = 143). Results showed that listening comprehension was related to text reading fluency at time 2, but not at time 1. At both times text reading fluency was related to reading comprehension, and reading comprehension was related to text reading fluency over and above word reading fluency and listening comprehension. Orthographic awareness was related to text reading fluency over and above other emergent literacy skills and word reading fluency. Vocabulary and grammatical knowledge were independently related to text reading fluency and reading comprehension whereas theory of mind was related to reading comprehension, but not text reading fluency. These results reveal developmental nature of relations and mechanism of text reading fluency in reading development.
Lexical factors and cerebral regions influencing verbal fluency performance in MCI.
Clark, D G; Wadley, V G; Kapur, P; DeRamus, T P; Singletary, B; Nicholas, A P; Blanton, P D; Lokken, K; Deshpande, H; Marson, D; Deutsch, G
2014-02-01
To evaluate assumptions regarding semantic (noun), verb, and letter fluency in mild cognitive impairment (MCI) and Alzheimer disease (AD) using novel techniques for measuring word similarity in fluency lists and a region of interest (ROI) analysis of gray matter correlates. Fifty-eight individuals with normal cognition (NC, n=25), MCI (n=23), or AD (n=10) underwent neuropsychological tests, including 10 verbal fluency tasks (three letter tasks [F, A, S], six noun categories [animals, water creatures, fruits and vegetables, tools, vehicles, boats], and verbs). All pairs of words generated by each participant on each task were compared in terms of semantic (meaning), orthographic (spelling), and phonemic (pronunciation) similarity. We used mixed-effects logistic regression to determine which lexical factors were predictive of word adjacency within the lists. Associations between each fluency raw score and gray matter volumes in sixteen ROIs were identified by means of multiple linear regression. We evaluated causal models for both types of analyses to specify the contributions of diagnosis and various mediator variables to the outcomes of word adjacency and fluency raw score. Semantic similarity between words emerged as the strongest predictor of word adjacency for all fluency tasks, including the letter fluency tasks. Semantic similarity mediated the effect of cognitive impairment on word adjacency only for three fluency tasks employing a biological cue. Orthographic similarity was predictive of word adjacency for the A and S tasks, while phonemic similarity was predictive only for the S task and one semantic task (vehicles). The ROI analysis revealed different patterns of correlations among the various fluency tasks, with the most common associations in the right lower temporal and bilateral dorsal frontal regions. Following correction with gray matter volumes from the opposite hemisphere, significant associations persisted for animals, vehicles, and a composite
Lanska, Meredith; Olds, Justin M.; Westerman, Deanne L.
2014-01-01
On a recognition memory test, both perceptual and conceptual fluency can engender a sense of familiarity and elicit recognition memory illusions. To date, perceptual and conceptual fluency have been studied separately but are they interchangeable in terms of their influence on recognition judgments? Five experiments compared the effect of…
Kim, Young-Suk Grace
2015-01-01
The primary goal was to expand our understanding of text reading fluency (efficiency or automaticity)—how its relation to other constructs (e.g., word reading fluency and reading comprehension) changes over time and how it is different from word reading fluency and reading comprehension. We examined (1) developmentally changing relations among word reading fluency, listening comprehension, text reading fluency, and reading comprehension; (2) the relation of reading comprehension to text readi...
Neural correlates of rhyming vs. lexical and semantic fluency.
Kircher, Tilo; Nagels, Arne; Kirner-Veselinovic, André; Krach, Sören
2011-05-19
Rhyming words, as in songs or poems, is a universal feature of human language across all ages. In the present fMRI study a novel overt rhyming task was applied to determine the neural correlates of rhyme production. Fifteen right-handed healthy male volunteers participated in this verbal fluency study. Participants were instructed to overtly articulate as many words as possible either to a given initial letter (LVF) or to a semantic category (SVF). During the rhyming verbal fluency task (RVF), participants had to generate words that rhymed with pseudoword stimuli. On-line overt verbal responses were audiotaped in order to correct the imaging results for the number of generated words. Fewer words were generated in the rhyming compared to both the lexical and the semantic condition. On a neural level, all language tasks activated a language network encompassing the left inferior frontal gyrus, the middle and superior temporal gyri as well as the contralateral right cerebellum. Rhyming verbal fluency compared to both lexical and semantic verbal fluency demonstrated significantly stronger activation of left inferior parietal region. Generating novel rhyme words seems to be mainly mediated by the left inferior parietal lobe, a region previously found to be associated with meta-phonological as well as sub-lexical linguistic processes. Copyright © 2011 Elsevier B.V. All rights reserved.
Oral Reading Fluency as a Predictor of Silent Reading Fluency at Secondary and Postsecondary Levels
Seok, Soonhwa; DaCosta, Boaventura
2014-01-01
This research investigated oral reading fluency as a predictor of silent reading fluency at the secondary and postsecondary levels. Several measures were used, including the Gray Oral Reading Test, the Test of Silent Word Reading Fluency, the Test of Silent Contextual Reading Fluency, and the Reading Observation Scale. A total of 223 students…
Putting the Fun Back into Fluency Instruction
Cahill, Mary Ann; Gregory, Anne E.
2011-01-01
Based on recent research in fluency instruction, the authors present a scenario in which a teacher focuses her fluency instruction on authentic fluency tasks based in performance. Beginning with establishing a student-friendly definition of fluency and culminating with student engagement in fun fluency activities, this article explores the…
Forster, Michael; Leder, Helmut; Ansorge, Ulrich
2013-04-01
According to the processing-fluency explanation of aesthetics, more fluently processed stimuli are preferred (R. Reber, N. Schwarz, & P. Winkielman, 2004, Processing fluency and aesthetic pleasure: Is beauty in the perceiver's processing experience? Personality and Social Psychology Review, Vol. 8, pp. 364-382.). In this view, the subjective feeling of ease of processing is considered important, but this has not been directly tested in perceptual processing. In two experiments, we therefore objectively manipulated fluency (ease of processing) with subliminal perceptual priming (Study 1) and variations in presentation durations (Study 2). We assessed the impact of objective fluency on feelings of fluency and liking, as well as their interdependence. In line with the processing-fluency account, we found that objectively more fluent images were indeed judged as more fluent and were also liked more. Moreover, differences in liking were even stronger when data were analyzed according to felt fluency. These findings demonstrate that perceptual fluency is not only explicitly felt, it can also be reported and is an important determinant of liking. PsycINFO Database Record (c) 2013 APA, all rights reserved.
Shimada, K; Hirotani, M; Yokokawa, H; Yoshida, H; Makita, K; Yamazaki-Murase, M; Tanabe, H C; Sadato, N
2015-08-06
This functional magnetic resonance imaging (fMRI) study investigated the brain regions underlying language task performance in adult second language (L2) learners. Specifically, we identified brain regions where the level of activation was associated with L2 fluency levels. Thirty Japanese-speaking adults participated in the study. All participants were L2 learners of English and had achieved varying levels of fluency, as determined by a standardized L2 English proficiency test, the Versant English Test (Pearson Education Inc., 2011). When participants performed the oral sentence building task from the production tasks administered, the dorsal part of the left inferior frontal gyrus (dIFG) showed activation patterns that differed depending on the L2 fluency levels: The more fluent the participants were, the more dIFG activation decreased. This decreased activation of the dIFG might reflect the increased automaticity of a syntactic building process. In contrast, when participants performed an oral story comprehension task, the left posterior superior temporal gyrus (pSTG) showed increased activation with higher fluency levels. This suggests that the learners with higher L2 fluency were actively engaged in post-syntactic integration processing supported by the left pSTG. These data imply that L2 fluency predicts neural resource allocation during language comprehension tasks as well as in production tasks. This study sheds light on the neural underpinnings of L2 learning by identifying the brain regions recruited during different language tasks across different modalities (production vs. comprehension). Copyright © 2015 The Authors. Published by Elsevier Ltd.. All rights reserved.
Directory of Open Access Journals (Sweden)
Ilaria Bizzozero
2013-05-01
Full Text Available Background/Aims: In Alzheimer's dementia (AD, letter fluency is less impaired than category fluency. To check whether category fluency and letter fluency depend differently on semantics and attention, 53 mild AD patients were given animal and letter fluency tasks, two semantic tests (the Verbal Semantic Questionnaire and the BORB Association Match test, and two attentional tests (the Stroop Colour-Word Interference test and the Digit Cancellation test. Methods: We conducted a LISREL confirmatory factor analysis to check the extent to which category fluency and letter fluency tasks were related to semantics and attention, viewed as latent variables. Results: Both types of fluency tasks were related to the latent variable Semantics but not to the latent variable Attention. Conclusions: Our findings warn against interpreting the disproportionate impairment of AD patients on category and letter fluency as a contrast between semantics and attention.
Tuning by means of laser annealing of electronic and structural properties of nc-Si/a-Si:H
International Nuclear Information System (INIS)
Poliani, E.; Somaschini, C.; Sanguinetti, S.; Grilli, E.; Guzzi, M.; Le Donne, A.; Binetti, S.; Pizzini, S.; Chrastina, D.; Isella, G.
2009-01-01
We report the effect of laser annealing on the structural and electronic properties of nc-Si/a-Si:H samples grown close to the amorphous to nanocrystalline transition. The nc-Si/a-Si:H thin films were produced by low-energy plasma-enhanced chemical vapor deposition through a gas discharge containing SiH 4 . The samples were subjected to different laser fluencies and were characterized for changes in their structural and electronic properties via Raman spectroscopy and photoluminescence measurements. The laser annealing effects are twofold: i) the nanocrystalline phase grows, during the laser treatment, respect to the amorphous phase; ii) the photoluminescence spectra show the suppression, after laser annealing, of the frequencies above the crystalline Si band-gap.
Directory of Open Access Journals (Sweden)
Ali Akbar Farahani
2018-03-01
Full Text Available Objective fluency judgment has always been a formidable task in language testing. Nonetheless, temporal fluency is the type of fluency which can be measured and quantified. Given that, temporal fluency is also known as temporal measures of fluency (Luoma, 2004. Furthermore, it has aroused considerable interest in analyzing speech of language learners in terms of quantitative measures (Kormos & Denes, 2004; Freed, 1995; Riggenbach, 1991; Lennon, 1990. They suggested that certain measures of fluency can more objectively specify fluency level and that perceptual understanding of fluency to a high extent correlate with these measures. Following these studies, the present study was an endeavor to relate quantitative measures of fluency and assessment of fluency in oral speech of L2 learners. To do so 30 advanced EFL learners whose speaking score on TOEFL iBT scale was between 19 to 22, i.e. B2 on CEFR scale, were selected. Then, they were given a picture strip as the elicitation task and asked to make up a story based on that. Their voice was recorded, transcribed and further analyzed by voice analysis software called PRAAT to calculate seven measures of fluency. Meanwhile, two trained listeners were required to rate the recordings, scoring them from 1 to 9. Finally, the relationship between these variables was calculated. The results showed that judge listeners’ ratings of fluency were highly correlated with speech rate, phonation time ratio, and mean length of runs. Moreover, among the measures of temporal fluency speech rate proved significantly correlated with articulation rate, phonation time ratio, and mean length of runs.
Sexual-orientation-related differences in verbal fluency.
Rahman, Qazi; Abrahams, Sharon; Wilson, Glenn D
2003-04-01
This study examined the performance of 60 heterosexual men, 60 gay men, 60 heterosexual women, and 60 lesbians on 3 tests of verbal fluency known to show gender differences: letter, category, and synonym fluency. Gay men and lesbians showed opposite-sex shifts in their profile of scores. For letter fluency, gay men outperformed all other groups; lesbians showed the lowest scores. For category fluency, gay men and heterosexual women jointly outperformed lesbians and heterosexual men. Finally, gay men outperformed all other groups on synonym fluency, whereas lesbians and heterosexual men performed similarly. A difference between heterosexual men and women was demonstrated on category and synonym fluency only. The findings implicate within-sex differences in the functioning of the prefrontal and temporal cortices.
MOF derived Ni/Co/NC catalysts with enhanced properties for oxygen evolution reaction
Hu, Jiapeng; Chen, Juan; Lin, Hao; Liu, Ruilai; Yang, Xiaobing
2018-03-01
Designing efficient electrocatalysts for oxygen evolution reaction (OER) is very important for renewable energy storage and conversion devices. In this paper, we introduced a new strategy to synthesize Ni doped Co/NC catalysts (NC is the abbreviation of nitrogen-doped graphitic carbon), which were derived from ZIF-67. All catalysts were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscope (TEM) and oxygen evolution reaction (OER). The results show that Ni was well doped in the Ni/Co/NC catalysts and the doping of Ni has great influence on the OER activity of Ni/Co/NC catalysts. Among these catalysts, 0.50Ni/Co/NC exhibits the highest OER activity. The onset potential of 0.50Ni/Co/NC is 1.47 V, which is superior than the onset potential of Co/NC (1.54 V), 0.25Ni/Co/NC (1.48 V), 1.00Ni/Co/NC (1.53 V). The excellent OER activity of 0.50Ni/Co/NC catalyst makes its potential to be used on renewable energy storage.
Directory of Open Access Journals (Sweden)
Aiswarya Liz Varghese
2018-05-01
Full Text Available It is common in literature to relate stuttering with some other deficit that interferes with communicative functions. Working memory comprises the system of human memory dedicated to both temporary storages of phonological detail and allocation of cognitive resources necessary for forming lasting memories. In this study we have analyzed the performance of individuals with stuttering on various working memory tasks. The aim of study is to compare the working memory abilities in individuals with stuttering and individuals with normal fluency on various working memory tasks. A total of 30 individuals with stuttering and 30 individuals with normal fluency in the age range of 18 – 40 years participated in the study. The Working Memory domain will be assessed using The Manipal Manual for Cognitive Linguistic Abilities (MMCLA which consists of auditory word retrieval, auditory letter and number recall, auditory word list recall, auditory delayed sentence recall, visual practice recall, visual letter and number recall, visual word list recall and visual delayed sentence recall. Results revealed that the individuals with normal fluency had superior performance compared to the individuals with stuttering. Hence, it’s helpful to understand the involvement of working memory in stuttering and incorporate working memory training along with the conventional fluency therapy.
Does Emotional Arousal Influence Swearing Fluency?
Stephens, Richard; Zile, Amy
2017-08-01
This study assessed the effect of experimentally manipulated emotional arousal on swearing fluency. We hypothesised that swear word generation would be increased with raised emotional arousal. The emotional arousal of 60 participants was manipulated by having them play a first-person shooter video game or, as a control, a golf video game, in a randomised order. A behavioural measure of swearing fluency based on the Controlled Oral Word Association Test was employed. Successful experimental manipulation was indicated by raised State Hostility Questionnaire scores after playing the shooter game. Swearing fluency was significantly greater after playing the shooter game compared with the golf game. Validity of the swearing fluency task was demonstrated via positive correlations with self-reported swearing fluency and daily swearing frequency. In certain instances swearing may represent a form of emotional expression. This finding will inform debates around the acceptability of using taboo language.
Wise, Justin C; Sevcik, Rose A; Morris, Robin D; Lovett, Maureen W; Wolf, Maryanne; Kuhn, Melanie; Meisinger, Beth; Schwanenflugel, Paula
2010-07-01
The purpose of this study was to examine whether different measures of oral reading fluency relate differentially to reading comprehension performance in two samples of second-grade students: (a) students who evidenced difficulties with nonsense-word oral reading fluency, real-word oral reading fluency, and oral reading fluency of connected text (ORFD), and (b) students who evidenced difficulties only with oral reading fluency of connected text (CTD). Participants (ORFD, n = 146 and CTD, n = 949) were second-grade students who were recruited for participation in different reading intervention studies. Data analyzed were from measures of nonsense-word oral reading fluency, real-word oral reading fluency, oral reading fluency of connected text, and reading comprehension that were collected at the pre-intervention time point. Correlational and path analyses indicated that real-word oral reading fluency was the strongest predictor of reading comprehension performance in both samples and across average and poor reading comprehension abilities. Results of this study indicate that real-word oral reading fluency was the strongest predictor of reading comprehension and suggest that real-word oral reading fluency may be an efficient method for identifying potential reading comprehension difficulties.
Muller, T; Brown, P; Herder, S
2014-01-01
In EFL contexts, an absence of chances to develop fluency in the language classroom can lead to marked limitations in English proficiency. This volume explores fluency development from a number of different perspectives, investigating measurements and classroom strategies for promoting its development.
Semantic, phonologic, and verb fluency in Huntington's disease
Directory of Open Access Journals (Sweden)
Mariana Jardim Azambuja
Full Text Available Abstract Verbal fluency tasks have been identified as important indicators of executive functioning impairment in patients with frontal lobe dysfunction. Although the usual evaluation of this ability considers phonologic and semantic criteria, there is some evidence that fluency of verbs would be more sensitive in disclosing frontostriatal physiopathology since frontal regions primarily mediate retrieval of verbs. Huntington's disease usually affects these circuitries. Objective: To compare three types of verbal fluency task in the assessment of frontal-striatal dysfunction in HD subjects. Methods: We studied 26 Huntington's disease subjects, divided into two subgroups: mild (11 and moderate (15 along with 26 normal volunteers matched for age, gender and schooling, for three types of verbal fluency: phonologic fluency (F-A-S, semantic fluency and fluency of verbs. Results: Huntington's disease subjects showed a significant reduction in the number of words correctly generated in the three tasks when compared to the normal group. Both controls and Huntington's disease subjects showed a similar pattern of decreasing task performance with the greatest number of words being generated by semantic elicitation followed by verbs and lastly phonologic criteria. We did not find greater production of verbs compared with F-A-S and semantic conditions. Moreover, the fluency of verbs distinguished only the moderate group from controls. Conclusion: Our results indicated that phonologic and semantic fluency can be used to evaluate executive functioning, proving more sensitive than verb fluency. However, it is important to point out that the diverse presentations of Huntington's disease means that an extended sample is necessary for more consistent analysis of this issue.
Action verbal fluency in Parkinson’s patients
Directory of Open Access Journals (Sweden)
Inês Tello Rodrigues
2015-06-01
Full Text Available We compared the performance of 31 non-demented Parkinson´s disease (PD patients to 61 healthy controls in an action verbal fluency task. Semantic and phonemic fluencies, cognitive impairment and behavioural dysfunction were also assessed. The mean disease duration of PD was 9.8 years (standard deviation (SD = 6.13. There were no age (U = 899.5, p = 0.616, gender(chi-square = 0.00, p = 1.00 or literacy (U = 956, p = 0.96 differences between the two groups. A significant difference was observed between the two groups in the action verbal fluency task (U = 406.5, p < 0.01 that was not found in the other fluency tasks. The education level was the only biographical variable that influenced the action (verb fluency outcomes, irrespective of disease duration. Our findings suggest a correlation between the disease mechanisms in PD and a specific verb deficit, support the validity of the action (verb fluency as an executive function measure and suggest that this task provides unique information not captured with traditional executive function tasks.
Possible origin of superior corrosion resistance for electrodeposited nanocrystalline Ni
International Nuclear Information System (INIS)
Roy, I.; Yang, H.W.; Dinh, L.; Lund, I.; Earthman, J.C.; Mohamed, F.A.
2008-01-01
We present here for the first time observations that grain boundaries in electrodeposited (ED) nanocrystalline (nc) Ni are predominantly of Σ3 character. The results presented are based on orientation imaging microscopy (OIM) performed to produce electron backscatter diffraction (EBSD) maps. This large volume fraction of coherent low sigma coincidence site lattice (CSL) boundaries appears to be consistent with the superior corrosion resistance of ED nc-Ni in comparison with its coarse-grained counterpart
Visiting digital fluency for pre-service teachers in Turkey
Directory of Open Access Journals (Sweden)
Kadir Demir
2015-04-01
Full Text Available Digital literacy is to know how to use digital tools, however digital fluency is a new concept. Beyond the digital literacy, digital fluency requires skills to know when to use the technology and even why to use the technology. The technology advances rapidly; as a result, education and instruction are getting digitalized. So it could be estimated that; pre-service teachers who are future teachers, should have digital skills. This is the main point of this study which aims to visit pre-service teachers in Turkey from the perspective of digital fluency, give insights about digital fluency, scrutinize its difference from digital literacy and provide literature review on the previous studies about digital fluency. Accordingly; a through literature review was performed. At first, the connection between digital fluency and the 21st century analyzed, then the differences between digital literacy and digital fluency are described. Worldwide and specifically Turkish literature review revealed that, certain studies foresaw the increasing importance of digital fluency based on development of digital devices, and Turkish literature was limited to some scale development and descriptive studies solely determining the digital literacy level of the participants. Thus, it could be stated that further and up-to-date studies are required, which would be conducted with pre-service teachers and current assessment instruments should be developed to determine digital fluency level, considering the rapid advances in technology.
Processing fluency and impressions of joy and pride
Directory of Open Access Journals (Sweden)
Kravchenko Yu.E.
2017-12-01
Full Text Available The mere exposure effect consists in the increasing of affective preference (sympathy/ liking for a previously encountered stimulus. Many researches connect it with processing fluency and effort savings (hedonic marking hypothesis [17]. The present study investigates, whether processing fluency connects with other positive emotions. We supposed higher processing fluency correlates with grater intensity of pride and joy. In 1 Experiment participants (n = 98 recognize 10 well-known proverbs in guessing game. Then they marked proverbs about that they would brag to their friends and ranked all proverbs from the most to the lest pleasant. In 2 Experiment 4 groups each of that concluded 24 different complicated joy statements were pairwise compared. Participants (n = 55 chosen most funny and marked unfunny statements. Results shows most sympathy is connect with higher processing fluency, but pride and joy appear more often in connection with more complicated stimuli required lower processing fluency.
Das, Debajyoti; Mondal, Praloy
2017-09-01
Growth of highly conducting nanocrystalline silicon (nc-Si) thin films of optimum crystalline volume fraction, involving dominant crystallographic preferred orientation with simultaneous low fraction of microstructures at a low substrate temperature and high growth rate, is a challenging task for its promising utilization in nc-Si solar cells. Utilizing enhanced electron density and superior ion flux densities of the high frequency (∼27.12 MHz) SiH4 plasma, improved nc-Si films have been produced by simple optimization of H2-dilution, controlling the ion damage and enhancing supply of atomic-hydrogen onto the growing surface. Single junction nc-Si p-i-n solar cells have been prepared with i-nc-Si absorber layer and optimized. The physical parameters of the absorber layer have been systematically correlated to variations of the solar cell parameters. The preferred alignment of crystallites, its contribution to the low recombination losses for conduction of charge carriers along the vertical direction, its spectroscopic correlation with the dominant growth of ultra-nanocrystalline silicon (unc-Si) component and corresponding longer wavelength absorption, especially in the neighborhood of i/n-interface region recognize scientific and technological key issues that pave the ground for imminent advancement of multi-junction silicon solar cells.
Lexical-Semantic Search Under Different Covert Verbal Fluency Tasks: An fMRI Study
Directory of Open Access Journals (Sweden)
Yunqing Li
2017-08-01
Full Text Available Background: Verbal fluency is a measure of cognitive flexibility and word search strategies that is widely used to characterize impaired cognitive function. Despite the wealth of research on identifying and characterizing distinct aspects of verbal fluency, the anatomic and functional substrates of retrieval-related search and post-retrieval control processes still have not been fully elucidated.Methods: Twenty-one native English-speaking, healthy, right-handed, adult volunteers (mean age = 31 years; range = 21–45 years; 9 F took part in a block-design functional Magnetic Resonance Imaging (fMRI study of free recall, covert word generation tasks when guided by phonemic (P, semantic-category (C, and context-based fill-in–the-blank sentence completion (S cues. General linear model (GLM, Independent Component Analysis (ICA, and psychophysiological interaction (PPI were used to further characterize the neural substrate of verbal fluency as a function of retrieval cue type.Results: Common localized activations across P, C, and S tasks occurred in the bilateral superior and left inferior frontal gyrus, left anterior cingulate cortex, bilateral supplementary motor area (SMA, and left insula. Differential task activations were centered in the occipital, temporal and parietal regions as well as the thalamus and cerebellum. The context-based fluency task, i.e., the S task, elicited higher differential brain activity in a lateralized frontal-temporal network typically engaged in complex language processing. P and C tasks elicited activation in limited pathways mainly within the left frontal regions. ICA and PPI results of the S task suggested that brain regions distributed across both hemispheres, extending beyond classical language areas, are recruited for lexical-semantic access and retrieval during sentence completion.Conclusion: Study results support the hypothesis of overlapping, as well as distinct, neural networks for covert word generation when
Reading Fluency Techniques from the Bottom-up: A Grounded Theory
Directory of Open Access Journals (Sweden)
Seyyed Ali Ostovar-Namaghi
2015-09-01
Full Text Available In many EFL contexts, including language education milieu in Iran, reading fluency is usually taken for granted since language education in public high schools mainly focuses on reading comprehension. Taking the detrimental effect of fluency deficiency into account, some practitioners foreground reading fluency and try to develop it early on. To give voice to their theories of practice, this qualitative study interviewed teachers who were willing to share their experience with the researchers. In line with grounded theory, the iterative process of data collection and analysis continued until the conceptualization of fluency development techniques was saturated. The techniques emerged are conducive to fluency development and as such the findings have clear implications for practitioners and policy makers nation-wide.
Personality traits prospectively predict verbal fluency in a lifespan sample.
Sutin, Angelina R; Terracciano, Antonio; Kitner-Triolo, Melissa H; Uda, Manuela; Schlessinger, David; Zonderman, Alan B
2011-12-01
In a community-dwelling sample (N = 4,790; age range 14-94), we examined whether personality traits prospectively predicted performance on a verbal fluency task. Open, extraverted, and emotionally stable participants had better verbal fluency. At the facet level, dispositionally happy and self-disciplined participants retrieved more words; those prone to anxiety and depression and those who were deliberative retrieved fewer words. Education moderated the association between conscientiousness and fluency such that participants with lower education performed better on the fluency task if they were also conscientious. Age was not a moderator at the domain level, indicating that the personality-fluency associations were consistent across the life span. A disposition toward emotional vulnerability and being less open, less happy, and undisciplined may be detrimental to cognitive performance.
Performances on five verbal fluency tests in a healthy, elderly Danish sample
DEFF Research Database (Denmark)
Stokholm, Jette; Jørgensen, Kasper; Vogel, Asmus
2013-01-01
Verbal fluency tests are widely used as measures of language and executive functions. This study presents data for five tests; semantic fluency (animals, supermarket items and alternating between cities and professions), lexical fluency (s-words), and action fluency (verbs) based on a sample of 100...
Evaluating lexical characteristics of verbal fluency output in schizophrenia.
Juhasz, Barbara J; Chambers, Destinee; Shesler, Leah W; Haber, Alix; Kurtz, Matthew M
2012-12-30
Standardized lexical analysis of verbal output has not been applied to verbal fluency tasks in schizophrenia. Performance of individuals with schizophrenia on both a letter (n=139) and semantic (n=137) fluency task was investigated. The lexical characteristics (word frequency, age-of-acquisition, word length, and semantic typicality) of words produced were evaluated and compared to those produced by a healthy control group matched on age, gender, and Wechsler Adult Intelligence Scale-Third Edition (WAIS-III) vocabulary scores (n=20). Overall, individuals with schizophrenia produced fewer words than healthy controls, replicating past research (see Bokat and Goldberg, 2003). Words produced in the semantic fluency task by individuals with schizophrenia were, on average, earlier acquired and more typical of the category. In contrast, no differences in lexical characteristics emerged in the letter fluency task. The results are informative regarding how individuals with schizophrenia access their mental lexicons during the verbal fluency task. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.
Perceptual fluency and judgments of vocal aesthetics and stereotypicality.
Babel, Molly; McGuire, Grant
2015-05-01
Research has shown that processing dynamics on the perceiver's end determine aesthetic pleasure. Specifically, typical objects, which are processed more fluently, are perceived as more attractive. We extend this notion of perceptual fluency to judgments of vocal aesthetics. Vocal attractiveness has traditionally been examined with respect to sexual dimorphism and the apparent size of a talker, as reconstructed from the acoustic signal, despite evidence that gender-specific speech patterns are learned social behaviors. In this study, we report on a series of three experiments using 60 voices (30 females) to compare the relationship between judgments of vocal attractiveness, stereotypicality, and gender categorization fluency. Our results indicate that attractiveness and stereotypicality are highly correlated for female and male voices. Stereotypicality and categorization fluency were also correlated for male voices, but not female voices. Crucially, stereotypicality and categorization fluency interacted to predict attractiveness, suggesting the role of perceptual fluency is present, but nuanced, in judgments of human voices. © 2014 Cognitive Science Society, Inc.
Affect intensity and processing fluency of deterrents.
Holman, Andrei
2013-01-01
The theory of emotional intensity (Brehm, 1999) suggests that the intensity of affective states depends on the magnitude of their current deterrents. Our study investigated the role that fluency--the subjective experience of ease of information processing--plays in the emotional intensity modulations as reactions to deterrents. Following an induction phase of good mood, we manipulated both the magnitude of deterrents (using sets of photographs with pre-tested potential to instigate an emotion incompatible with the pre-existent affective state--pity) and their processing fluency (normal vs. enhanced through subliminal priming). Current affective state and perception of deterrents were then measured. In the normal processing conditions, the results revealed the cubic effect predicted by the emotional intensity theory, with the initial affective state being replaced by the one appropriate to the deterrent only in participants exposed to the high magnitude deterrence. In the enhanced fluency conditions the emotional intensity pattern was drastically altered; also, the replacement of the initial affective state occurred at a lower level of deterrence magnitude (moderate instead of high), suggesting the strengthening of deterrence emotional impact by enhanced fluency.
Mere exposure effect: A consequence of direct and indirect fluency-preference links.
Willems, Sylvie; Van der Linden, Martial
2006-06-01
In three experiments, picture quality between test items was manipulated to examine whether subjects' expectations about the fluency normally associated with these different stimuli might influence the effects of fluency on preference or familiarity-based recognition responses. The results showed that fluency due to pre-exposure influenced responses less when objects were presented with high picture quality, suggesting that attributions of fluency to preference and familiarity are adjusted according to expectations about the different test pictures. However, this expectations influence depended on subjects' awareness of these different quality levels. Indeed, imperceptible differences seemed not to induce expectations about the test item fluency. In this context, fluency due to both picture quality and pre-exposure influenced direct responses. Conversely, obvious, and noticed, differences in test picture quality did no affect responses, suggesting that expectations moderated attributions of fluency only when fluency normally associated with these different stimuli was perceptible but difficult to assess.
Reading Fluency in the Middle and Secondary Grades
Directory of Open Access Journals (Sweden)
David D. PAIGE
2014-10-01
Full Text Available In this article we discuss the specifics of reading fluency and provide suggestions for identifying when reading is fluent and when it is not. We then discuss the important role that reading fluency plays in the attainment of literacy achievement and briefly review research results that highlight the relationship between fluency and comprehension. This is followed by a discussion of reading fluency and comprehension data gathered by one of the authors in India that highlight the possibilities for the acquisition of fluent reading in those learning English as a second language. Following a review of strategies to assist middle and secondary teachers with the development of fluent reading in their students, we conclude with a discussion of word study strategies that promote syllabic and morphemic analysis. Such strategies aid readers in the development of word automaticity and encourage the development of fluent reading.
Facilitating English-Language Learners' Oral Reading Fluency with Digital Pen Technology
Chen, Chih-Ming; Tan, Chia-Chen; Lo, Bey-Jane
2016-01-01
Oral reading fluency is an indicator of overall reading competence. Many studies have claimed that repeated reading can promote oral reading fluency. Currently, novel Web- or computer-based reading technologies offer interactive digital materials that promote English oral reading fluency using the repeated reading strategy; however, paper-based…
Developing Mathematical Fluency: Comparing Exercises and Rich Tasks
Foster, Colin
2018-01-01
Achieving fluency in important mathematical procedures is fundamental to students' mathematical development. The usual way to develop procedural fluency is to practise repetitive exercises, but is this the only effective way? This paper reports three quasi-experimental studies carried out in a total of 11 secondary schools involving altogether 528…
Auditory hindsight bias: Fluency misattribution versus memory reconstruction.
Higham, Philip A; Neil, Greg J; Bernstein, Daniel M
2017-06-01
We report 4 experiments investigating auditory hindsight bias-the tendency to overestimate the intelligibility of distorted auditory stimuli after learning their identity. An associative priming manipulation was used to vary the amount of processing fluency independently of prior target knowledge. For hypothetical designs, in which hindsight judgments are made for peers in foresight, we predicted that judgments would be based on processing fluency and that hindsight bias would be greater in the unrelated- compared to related-prime context (differential-fluency hypothesis). Conversely, for memory designs, in which foresight judgments are remembered in hindsight, we predicted that judgments would be based on memory reconstruction and that there would be independent effects of prime relatedness and prior target knowledge (recollection hypothesis). These predictions were confirmed. Specifically, we found support for the differential-fluency hypothesis when a hypothetical design was used in Experiments 1 and 2 (hypothetical group). Conversely, when a memory design was used in Experiments 2 (memory group), 3A, and 3B, we found support for the recollection hypothesis. Together, the results suggest that qualitatively different mechanisms create hindsight bias in the 2 designs. The results are discussed in terms of fluency misattributions, memory reconstruction, anchoring-and-adjustment, sense making, and a multicomponent model of hindsight bias. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Possin, Katherine L; Chester, Serana K; Laluz, Victor; Bostrom, Alan; Rosen, Howard J; Miller, Bruce L; Kramer, Joel H
2012-09-01
On tests of design fluency, an examinee draws as many different designs as possible in a specified time limit while avoiding repetition. The neuroanatomical substrates and diagnostic group differences of design fluency repetition errors and total correct scores were examined in 110 individuals diagnosed with dementia, 53 with mild cognitive impairment (MCI), and 37 neurologically healthy controls. The errors correlated significantly with volumes in the right and left orbitofrontal cortex (OFC), the right and left superior frontal gyrus, the right inferior frontal gyrus, and the right striatum, but did not correlate with volumes in any parietal or temporal lobe regions. Regression analyses indicated that the lateral OFC may be particularly crucial for preventing these errors, even after excluding patients with behavioral variant frontotemporal dementia (bvFTD) from the analysis. Total correct correlated more diffusely with volumes in the right and left frontal and parietal cortex, the right temporal cortex, and the right striatum and thalamus. Patients diagnosed with bvFTD made significantly more repetition errors than patients diagnosed with MCI, Alzheimer's disease, semantic dementia, progressive supranuclear palsy, or corticobasal syndrome. In contrast, total correct design scores did not differentiate the dementia patients. These results highlight the frontal-anatomic specificity of design fluency repetitions. In addition, the results indicate that the propensity to make these errors supports the diagnosis of bvFTD. (JINS, 2012, 18, 1-11).
Update on Didactic and Clinical Education in Fluency Disorders: 2013-2014.
Scott Yaruss, J; Lee, Jieun; Kikani, Kaya B; Leslie, Paula; Herring, Caryn; Ramachandar, Sujini; Tichenor, Seth; Quesal, Robert W; McNeil, Malcolm R
2017-02-01
This study surveyed didactic and clinical education in fluency disorders at undergraduate and graduate institutions in the United States that provide education in speech-language pathology to determine whether a previously observed reduction in requirements has continued since prior surveys (Yaruss, 1999; Yaruss & Quesal, 2002). The study involved a detailed questionnaire that was sent to 282 communication science and disorders departments. Questions examined didactic and clinical education, as well as faculty knowledge about fluency disorders. Comparisons with prior surveys revealed several findings, including (a) on average, programs have increased academic coursework and incorporated more practical sessions and competency-based testing in the classroom; (b) the number of faculty who possess extensive clinical experience with fluency disorders has decreased; and (c) although an increase in clinical requirements in fluency disorders was detected, the number of programs providing minimal education about fluency disorders remains high. Given an expanding scope of practice, many programs have continued to try to provide adequate education about fluency disorders. Still, direct clinical experiences are limited, and faculty expertise in this area has continued to decrease. To raise students' confidence and competence in fluency disorders, efforts beyond graduate work-or systemic changes in the profession-may be necessary.
Reber, Rolf; Wurtz, Pascal; Zimmermann, Thomas D
2004-03-01
Perceptual fluency is the subjective experience of ease with which an incoming stimulus is processed. Although perceptual fluency is assessed by speed of processing, it remains unclear how objective speed is related to subjective experiences of fluency. We present evidence that speed at different stages of the perceptual process contributes to perceptual fluency. In an experiment, figure-ground contrast influenced detection of briefly presented words, but not their identification at longer exposure durations. Conversely, font in which the word was written influenced identification, but not detection. Both contrast and font influenced subjective fluency. These findings suggest that speed of processing at different stages condensed into a unified subjective experience of perceptual fluency.
A Cognitive Assessment of Highly Superior Autobiographical Memory
LePort, Aurora K.R.; Stark, Shauna M.; McGaugh, James L.; Stark, Craig E.L.
2017-01-01
Highly Superior Autobiographical Memory (HSAM) is characterized as the ability to accurately recall an exceptional number of experiences and their associated dates from events occurring throughout much of one’s lifetime. The source of this ability has only begun to be explored. The present study explores whether other enhanced cognitive processes may be critical influences underlying HSAM abilities. We investigated whether enhanced abilities in the domains of verbal fluency, attention/inhibition, executive functioning, mnemonic discrimination, perception, visual working memory, or the processing of and memory for emotional details might contribute critically to HSAM. The results suggest that superior cognitive functioning is an unlikely basis of HSAM, as only modest advantages were found in only a few tests. In addition, we examined HSAM subjects’ memory of the testing episodes. Interestingly, HSAM participants recalled details of their own experiences far better than those experiences that the experimenter shared with them. These findings provide additional evidence that HSAM involves, relatively selectively, recollection of personal, autobiographical material. PMID:26982996
A cognitive assessment of highly superior autobiographical memory.
LePort, Aurora K R; Stark, Shauna M; McGaugh, James L; Stark, Craig E L
2017-02-01
Highly Superior Autobiographical Memory (HSAM) is characterised as the ability to accurately recall an exceptional number of experiences and their associated dates from events occurring throughout much of one's lifetime. The source of this ability has only begun to be explored. The present study explores whether other enhanced cognitive processes may be critical influences underlying HSAM abilities. We investigated whether enhanced abilities in the domains of verbal fluency, attention/inhibition, executive functioning, mnemonic discrimination, perception, visual working memory, or the processing of and memory for emotional details might contribute critically to HSAM. The results suggest that superior cognitive functioning is an unlikely basis of HSAM, as only modest advantages were found in only a few tests. In addition, we examined HSAM subjects' memory of the testing episodes. Interestingly, HSAM participants recalled details of their own experiences far better than those experiences that the experimenter shared with them. These findings provide additional evidence that HSAM involves, relatively selectively, recollection of personal, autobiographical material.
Directory of Open Access Journals (Sweden)
Shane R. Jimerson
2013-01-01
Full Text Available Students’ oral reading fluency growth from first through fourth grade was used to predict their achievement on the Stanford Achievement Test (9th ed.; SAT-9 Reading using a latent growth model. Two conditional variables related to student status were used to determine the effects on reading performance - English language learners (ELLs with low socioeconomic status and low socioeconomic (SES status alone. Results revealed that both types of student status variables reliably predicted low performance on initial first grade oral reading fluency, which later predicted fourth grade performance on the SAT-9. However, the reading fluency trajectories of the ELLs and monolingual English students were not significantly different. In addition, when both student status variables and letter naming fluency were used to predict initial oral reading fluency, letter naming fluency dominated the prediction equation, suggesting that an initial pre-reading skill, letter naming fluency, better explained fourth grade performance on the SAT-9 than either ELL with low SES or low SES alone. The discussion focuses on how to better enable these readers and how oral reading fluency progress monitoring can be used to assist school personnel in determining which students need additional instructional assistance.
Cui, Jiaxin; Georgiou, George K; Zhang, Yiyun; Li, Yixun; Shu, Hua; Zhou, Xinlin
2017-02-01
Rapid automatized naming (RAN) has been found to predict mathematics. However, the nature of their relationship remains unclear. Thus, the purpose of this study was twofold: (a) to examine how RAN (numeric and non-numeric) predicts a subdomain of mathematics (arithmetic fluency) and (b) to examine what processing skills may account for the RAN-arithmetic fluency relationship. A total of 160 third-year kindergarten Chinese children (83 boys and 77 girls, mean age=5.11years) were assessed on RAN (colors, objects, digits, and dice), nonverbal IQ, visual-verbal paired associate learning, phonological awareness, short-term memory, speed of processing, approximate number system acuity, and arithmetic fluency (addition and subtraction). The results indicated first that RAN was a significant correlate of arithmetic fluency and the correlations did not vary as a function of type of RAN or arithmetic fluency tasks. In addition, RAN continued to predict addition and subtraction fluency even after controlling for all other processing skills. Taken together, these findings challenge the existing theoretical accounts of the RAN-arithmetic fluency relationship and suggest that, similar to reading fluency, multiple processes underlie the RAN-arithmetic fluency relationship. Copyright © 2016 Elsevier Inc. All rights reserved.
Specialty Board on Fluency Disorders
... or large groups of speech-language pathologists. Speech-language pathologists who are Board Certified Specialists in Fluency may be found on this website by searching name, city(location) or zip code. ...
Linguistic Skills and Speaking Fluency in a Second Language
De Jong, Nivja H.; Steinel, Margarita P.; Florijn, Arjen; Schoonen, Rob; Hulstijn, Jan H.
2013-01-01
This study investigated how individual differences in linguistic knowledge and processing skills relate to individual differences in speaking fluency. Speakers of Dutch as a second language ("N" = 179) performed eight speaking tasks, from which several measures of fluency were derived such as measures for pausing, repairing, and speed…
Comparison of Animal, Action and Phonemic Fluency in Aphasia
Faroqi-Shah, Yasmeen; Milman, Lisa
2018-01-01
Background: The ability to generate words that follow certain constraints, or verbal fluency, is a sensitive indicator of neurocognitive impairment, and is impacted by a variety of variables. Aims: To investigate the effect of post-stroke aphasia, elicitation category and linguistic variables on verbal fluency performance. Methods &…
33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...
Messinis, L; Kosmidis, M H; Vlahou, C; Malegiannaki, A C; Gatzounis, G; Dimisianos, N; Karra, A; Kiosseoglou, G; Gourzis, P; Papathanasopoulos, P
2013-01-01
The strategies used to perform a verbal fluency task appear to be reflective of cognitive abilities necessary for successful daily functioning. In the present study, we explored potential differences in verbal fluency strategies (switching and clustering) used to maximize word production by patients with relapsing-remitting multiple sclerosis (RRMS) versus patients with secondary progressive multiple sclerosis (SPMS). We further assessed impairment rates and potential differences in the sensitivity and specificity of phonological versus semantic verbal fluency tasks in discriminating between those with a diagnosis of MS and healthy adults. We found that the overall rate of impaired verbal fluency in our MS sample was consistent with that in other studies. However, we found no differences between types of MS (SPMS, RRMS), on semantic or phonological fluency word production, or the strategies used to maximize semantic fluency. In contrast, we found that the number of switches differed significantly in the phonological fluency task between the SPMS and RRMS subtypes. The clinical utility of semantic versus phonological fluency in discriminating MS patients from healthy controls did not indicate any significant differences. Further, the strategies used to maximize performance did not differentiate MS subgroups or MS patients from healthy controls.
Neurophysiological evidence that perceptions of fluency produce mere exposure effects.
Leynes, P Andrew; Addante, Richard J
2016-08-01
Recent exposure to people or objects increases liking ratings, the "mere exposure effect" (Zajonc in American Psychologist, 35, 117-123, 1968), and an increase in processing fluency has been identified as a potential mechanism for producing this effect. This fluency hypothesis was directly tested by altering the trial-by-trial image clarity (i.e., fluency) while Event-Related Potentials (ERPs) were recorded. In Experiment 1, clarity was altered across two trial blocks that each had homogenous trial-by-trial clarity, whereas clarity varied randomly across trials in Experiment 2. Blocking or randomizing image clarity across trials was expected to produce different levels of relative fluency and alter mere exposure effects. The mere exposure effect (i.e., old products liked more than new products) was observed when stimulus clarity remained constant across trials, and clear image ERPs were more positive than blurry image ERPs. Importantly, these patterns were reversed when clarity varied randomly across test trials, such that participants liked clear images more than blurry (i.e., no mere exposure effect) and clear image ERPs were more negative than blurry image ERPs. The findings provide direct experimental support from both behavioral and electrophysiological measures that, in some contexts, mere exposure is the product of top-down interpretations of fluency.
Apathy and Reduced Speed of Processing Underlie Decline in Verbal Fluency following DBS
Directory of Open Access Journals (Sweden)
Jennifer A. Foley
2017-01-01
Full Text Available Objective. Reduced verbal fluency is a strikingly uniform finding following deep brain stimulation (DBS for Parkinson’s disease (PD. The precise cognitive mechanism underlying this reduction remains unclear, but theories have suggested reduced motivation, linguistic skill, and/or executive function. It is of note, however, that previous reports have failed to consider the potential role of any changes in speed of processing. Thus, the aim of this study was to examine verbal fluency changes with a particular focus on the role of cognitive speed. Method. In this study, 28 patients with PD completed measures of verbal fluency, motivation, language, executive functioning, and speed of processing, before and after DBS. Results. As expected, there was a marked decline in verbal fluency but also in a timed test of executive functions and two measures of speed of processing. Verbal fluency decline was associated with markers of linguistic and executive functioning, but not after speed of processing was statistically controlled for. In contrast, greater decline in verbal fluency was associated with higher levels of apathy at baseline, which was not associated with changes in cognitive speed. Discussion. Reduced generativity and processing speed may account for the marked reduction in verbal fluency commonly observed following DBS.
Apathy and Reduced Speed of Processing Underlie Decline in Verbal Fluency following DBS
Foltynie, Tom; Zrinzo, Ludvic; Hyam, Jonathan A.; Limousin, Patricia
2017-01-01
Objective. Reduced verbal fluency is a strikingly uniform finding following deep brain stimulation (DBS) for Parkinson's disease (PD). The precise cognitive mechanism underlying this reduction remains unclear, but theories have suggested reduced motivation, linguistic skill, and/or executive function. It is of note, however, that previous reports have failed to consider the potential role of any changes in speed of processing. Thus, the aim of this study was to examine verbal fluency changes with a particular focus on the role of cognitive speed. Method. In this study, 28 patients with PD completed measures of verbal fluency, motivation, language, executive functioning, and speed of processing, before and after DBS. Results. As expected, there was a marked decline in verbal fluency but also in a timed test of executive functions and two measures of speed of processing. Verbal fluency decline was associated with markers of linguistic and executive functioning, but not after speed of processing was statistically controlled for. In contrast, greater decline in verbal fluency was associated with higher levels of apathy at baseline, which was not associated with changes in cognitive speed. Discussion. Reduced generativity and processing speed may account for the marked reduction in verbal fluency commonly observed following DBS. PMID:28408788
Apathy and Reduced Speed of Processing Underlie Decline in Verbal Fluency following DBS.
Foley, Jennifer A; Foltynie, Tom; Zrinzo, Ludvic; Hyam, Jonathan A; Limousin, Patricia; Cipolotti, Lisa
2017-01-01
Objective . Reduced verbal fluency is a strikingly uniform finding following deep brain stimulation (DBS) for Parkinson's disease (PD). The precise cognitive mechanism underlying this reduction remains unclear, but theories have suggested reduced motivation, linguistic skill, and/or executive function. It is of note, however, that previous reports have failed to consider the potential role of any changes in speed of processing. Thus, the aim of this study was to examine verbal fluency changes with a particular focus on the role of cognitive speed. Method . In this study, 28 patients with PD completed measures of verbal fluency, motivation, language, executive functioning, and speed of processing, before and after DBS. Results . As expected, there was a marked decline in verbal fluency but also in a timed test of executive functions and two measures of speed of processing. Verbal fluency decline was associated with markers of linguistic and executive functioning, but not after speed of processing was statistically controlled for. In contrast, greater decline in verbal fluency was associated with higher levels of apathy at baseline, which was not associated with changes in cognitive speed. Discussion . Reduced generativity and processing speed may account for the marked reduction in verbal fluency commonly observed following DBS.
Smith-Spark, James H; Henry, Lucy A; Messer, David J; Zięcik, Adam P
2017-08-01
The executive function of fluency describes the ability to generate items according to specific rules. Production of words beginning with a certain letter (phonemic fluency) is impaired in dyslexia, while generation of words belonging to a certain semantic category (semantic fluency) is typically unimpaired. However, in dyslexia, verbal fluency has generally been studied only in terms of overall words produced. Furthermore, performance of adults with dyslexia on non-verbal design fluency tasks has not been explored but would indicate whether deficits could be explained by executive control, rather than phonological processing, difficulties. Phonemic, semantic and design fluency tasks were presented to adults with dyslexia and without dyslexia, using fine-grained performance measures and controlling for IQ. Hierarchical regressions indicated that dyslexia predicted lower phonemic fluency, but not semantic or design fluency. At the fine-grained level, dyslexia predicted a smaller number of switches between subcategories on phonemic fluency, while dyslexia did not predict the size of phonemically related clusters of items. Overall, the results suggested that phonological processing problems were at the root of dyslexia-related fluency deficits; however, executive control difficulties could not be completely ruled out as an alternative explanation. Developments in research methodology, equating executive demands across fluency tasks, may resolve this issue. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.
Working memory influences processing speed and reading fluency in ADHD.
Jacobson, Lisa A; Ryan, Matthew; Martin, Rebecca B; Ewen, Joshua; Mostofsky, Stewart H; Denckla, Martha B; Mahone, E Mark
2011-01-01
Processing-speed deficits affect reading efficiency, even among individuals who recognize and decode words accurately. Children with ADHD who decode words accurately can still have inefficient reading fluency, leading to a bottleneck in other cognitive processes. This "slowing" in ADHD is associated with deficits in fundamental components of executive function underlying processing speed, including response selection. The purpose of the present study was to deconstruct processing speed in order to determine which components of executive control best explain the "processing" speed deficits related to reading fluency in ADHD. Participants (41 ADHD, 21 controls), ages 9-14 years, screened for language disorders, word reading deficits, and psychiatric disorders, were administered measures of copying speed, processing speed, reading fluency, working memory, reaction time, inhibition, and auditory attention span. Compared to controls, children with ADHD showed reduced oral and silent reading fluency and reduced processing speed-driven primarily by deficits on WISC-IV Coding. In contrast, groups did not differ on copying speed. After controlling for copying speed, sex, severity of ADHD-related symptomatology, and GAI, slowed "processing" speed (i.e., Coding) was significantly associated with verbal span and measures of working memory but not with measures of response control/inhibition, lexical retrieval speed, reaction time, or intrasubject variability. Further, "processing" speed (i.e., Coding, residualized for copying speed) and working memory were significant predictors of oral reading fluency. Abnormalities in working memory and response selection (which are frontally mediated and enter into the output side of processing speed) may play an important role in deficits in reading fluency in ADHD, potentially more than posteriorally mediated problems with orienting of attention or perceiving the stimulus.
Jong, N. de; Perfetti, C.A.
2011-01-01
The present study investigates the role of speech repetition in oral fluency development. Twenty-four students enrolled in English-as-a-second-language classes performed three training sessions in which they recorded three speeches, of 4, 3, and 2 min, respectively. Some students spoke about the
A Strategic Necessity: Building Senior Leadership's Fluency in Digital Technology
Kolomitz, Kara; Cabellon, Edmund T.
2016-01-01
This chapter describes the opportunity for senior student affairs officers (SSAOs) to develop an increased digital fluency to meet the needs of various constituencies in the digital age. The authors explore what a digital fluency is, how it might impact SSAOs' leadership potential, and the benefits for their respective divisions.
What oral text reading fluency can reveal about reading comprehension
Veenendaal, N.J.; Groen, M.A.; Verhoeven, L.T.W.
2015-01-01
Text reading fluency – the ability to read quickly, accurately and with a natural intonation – has been proposed as a predictor of reading comprehension. In the current study, we examined the role of oral text reading fluency, defined as text reading rate and text reading prosody, as a contributor
Event-Related Potential (ERP) Evidence for Fluency-Based Recognition Memory
Leynes, P. Andrew; Zish, Kevin
2012-01-01
Two experiments investigated the influence of perceptual fluency on recognition memory. Words were studied using a shallow encoding task to decrease the contribution of recollection on recognition. Fluency was manipulated by blurring half of the test probes. Clarity varied randomly across trials in one experiment and was grouped into two blocks…
Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD
Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui
2017-11-01
TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.
Fluency: an aim in teaching and a criterion in assessment
Directory of Open Access Journals (Sweden)
Aud Marit Simensen
2010-05-01
Full Text Available This article investigates the concept ‘fluency’ from different perspectives. When fluency is an aim in teaching, a thorough comprehension of the concept among teachers is a prerequisite for appropriate planning of instruction, including the choice of appropriate classroom activities. When fluency is an assessment criterion, it is even more important that examiners have a shared perception of the concept. The present article starts by presenting common perceptions of the concept and goes on to explore some of the current research. Next, it provides a historical overview of the place of fluency in teaching theory and explains some of the preconditions for the inclusion of this concept among teaching objectives and assessment criteria. It will also, as an illustration, give an outline of the position of the concept over time in the Norwegian school system on the basis of an analysis of the relevant syllabuses. Finally, the article explicates the notion of language use as a complex cognitive skill and explores current method¬ological ideas about teaching towards fluency.
Emotion Decoding and Incidental Processing Fluency as Antecedents of Attitude Certainty.
Petrocelli, John V; Whitmire, Melanie B
2017-07-01
Previous research demonstrates that attitude certainty influences the degree to which an attitude changes in response to persuasive appeals. In the current research, decoding emotions from facial expressions and incidental processing fluency, during attitude formation, are examined as antecedents of both attitude certainty and attitude change. In Experiment 1, participants who decoded anger or happiness during attitude formation expressed their greater attitude certainty, and showed more resistance to persuasion than participants who decoded sadness. By manipulating the emotion decoded, the diagnosticity of processing fluency experienced during emotion decoding, and the gaze direction of the social targets, Experiment 2 suggests that the link between emotion decoding and attitude certainty results from incidental processing fluency. Experiment 3 demonstrated that fluency in processing irrelevant stimuli influences attitude certainty, which in turn influences resistance to persuasion. Implications for appraisal-based accounts of attitude formation and attitude change are discussed.
Shall we use non-verbal fluency in schizophrenia? A pilot study.
Rinaldi, Romina; Trappeniers, Julie; Lefebvre, Laurent
2014-05-30
Over the last few years, numerous studies have attempted to explain fluency impairments in people with schizophrenia, leading to heterogeneous results. This could notably be due to the fact that fluency is often used in its verbal form where semantic dimensions are implied. In order to gain an in-depth understanding of fluency deficits, a non-verbal fluency task - the Five-Point Test (5PT) - was proposed to 24 patients with schizophrenia and to 24 healthy subjects categorized in terms of age, gender and schooling. The 5PT involves producing as many abstract figures as possible within 1min by connecting points with straight lines. All subjects also completed the Frontal Assessment Battery (FAB) while those with schizophrenia were further assessed using the Positive and Negative Syndrome Scale (PANSS). Results show that the 5PT evaluation differentiates patients from healthy subjects with regard to the number of figures produced. Patients׳ results also suggest that the number of figures produced is linked to the "overall executive functioning" and to some inhibition components. Although this study is a first step in the non-verbal efficiency research field, we believe that experimental psychopathology could benefit from the investigations on non-verbal fluency. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
Berland, Matthew W.
As scientists use the tools of computational and complex systems theory to broaden science perspectives (e.g., Bar-Yam, 1997; Holland, 1995; Wolfram, 2002), so can middle-school students broaden their perspectives using appropriate tools. The goals of this dissertation project are to build, study, evaluate, and compare activities designed to foster both computational and complex systems fluencies through collaborative constructionist virtual and physical robotics. In these activities, each student builds an agent (e.g., a robot-bird) that must interact with fellow students' agents to generate a complex aggregate (e.g., a flock of robot-birds) in a participatory simulation environment (Wilensky & Stroup, 1999a). In a participatory simulation, students collaborate by acting in a common space, teaching each other, and discussing content with one another. As a result, the students improve both their computational fluency and their complex systems fluency, where fluency is defined as the ability to both consume and produce relevant content (DiSessa, 2000). To date, several systems have been designed to foster computational and complex systems fluencies through computer programming and collaborative play (e.g., Hancock, 2003; Wilensky & Stroup, 1999b); this study suggests that, by supporting the relevant fluencies through collaborative play, they become mutually reinforcing. In this work, I will present both the design of the VBOT virtual/physical constructionist robotics learning environment and a comparative study of student interaction with the virtual and physical environments across four middle-school classrooms, focusing on the contrast in systems perspectives differently afforded by the two environments. In particular, I found that while performance gains were similar overall, the physical environment supported agent perspectives on aggregate behavior, and the virtual environment supported aggregate perspectives on agent behavior. The primary research questions
Mirror Asymmetry of Category and Letter Fluency in Traumatic Brain Injury and Alzheimer's Patients
Capitani, Erminio; Rosci, Chiara; Saetti, Maria Cristina; Laiacona, Marcella
2009-01-01
In this study we contrasted the Category fluency and Letter fluency performance of 198 normal subjects, 57 Alzheimer's patients and 57 patients affected by traumatic brain injury (TBI). The aim was to check whether, besides the prevalence of Category fluency deficit often reported among Alzheimer's patients, the TBI group presented the opposite…
Besken, Miri; Mulligan, Neil W.
2014-01-01
Judgments of learning (JOLs) are sometimes influenced by factors that do not impact actual memory performance. One recent proposal is that perceptual fluency during encoding affects metamemory and is a basis of metacognitive illusions. In the present experiments, participants identified aurally presented words that contained inter-spliced silences…
Verbal fluency in bilingual Spanish/English Alzheimer's disease patients.
Salvatierra, Judy; Rosselli, Monica; Acevedo, Amarilis; Duara, Ranjan
2007-01-01
Studies have demonstrated that in verbal fluency tests, monolinguals with Alzheimer's disease (AD) show greater difficulties retrieving words based on semantic rather than phonemic rules. The present study aimed to determine whether this difficulty was reproduced in both languages of Spanish/English bilinguals with mild to moderate AD whose primary language was Spanish. Performance on semantic and phonemic verbal fluency of 11 bilingual AD patients was compared to the performance of 11 cognitively normal, elderly bilingual individuals matched for gender, age, level of education, and degree of bilingualism. Cognitively normal subjects retrieved significantly more items under the semantic condition compared to the phonemic, whereas the performance of AD patients was similar under both conditions, suggesting greater decline in semantic verbal fluency tests. This pattern was produced in both languages, implying a related semantic decline in both languages. Results from this study should be considered preliminary because of the small sample size.
Alternative Text Types to Improve Reading Fluency for Competent to Struggling Readers
Directory of Open Access Journals (Sweden)
Timothy V. Rasinski
2016-01-01
Full Text Available This article offers instructional suggestions and strategies based on research and theoretical literature for developing reading fluency through the use of rhyming poetry and other texts beyond the narrative and informational texts that have been traditionally used for reading instruction. Readers’ lack of fluency in reading can be a monumental impediment to proficiency in good comprehension and overall reading competency. For all readers it is well established that as they progress in reading competence their reading ability grows (Stanovich, 1993/1994. This continued reading success begets continued reading growth; however, many struggling readers have difficulty in moving to a level of automaticity and fluency in their reading that enables them to engage in a successful practice. Lack of practice inhibits their reading comprehension. Readers’ abilities to effectively comprehend texts are significantly affected by their proficiency in accurate and automatic word recognition and prosody (May, 1998; Stanovich, 1993/1994; LaBerge & Samuels, 1974; Schreiber, 1991. Repeated reading practice has been shown to be a powerful way to improve these important fluency competencies. Certain texts are particularly well suited for repeated reading that improves both aspects of fluency
So Long, Robot Reader! A Superhero Intervention Plan for Improving Fluency
Marcell, Barclay; Ferraro, Christine
2013-01-01
This article presents an engaging means for turning disfluent readers into prosody superstars. Each week students align with Poetry Power Man and his superhero friends to battle the evil Robot Reader and his sidekicks. The Fluency Foursome helps students adhere to the multidimensional aspects of fluency where expression and comprehension are…
Directory of Open Access Journals (Sweden)
André Luiz Moraes
2013-12-01
Full Text Available Verbal fluency tasks are widely used in (clinical neuropsychology to evaluate components of executive functioning and lexical-semantic processing (linguistic and semantic memory. Performance in those tasks may be affected by several variables, such as age, education and diseases. This study investigated whether aging, education, reading and writing frequency, performance in semantic judgment tasks and depression symptoms predict the performance in unconstrained, phonemic and semantic fluency tasks. This study sample comprised 260 healthy adults aged 19 to 75 years old. The Pearson correlation coefficient and multiple regression models were used for data analysis. The variables under analysis were associated in different ways and had different levels of contribution according to the type of verbal fluency task. Education had the greatest effect on verbal fluency tasks. There was a greater effect of age on semantic fluency than on phonemic tasks. The semantic judgment tasks predicted the verbal fluency performance alone or in combination with other variables. These findings corroborate the importance of education in cognition supporting the hypothesis of a cognitive reserve and confirming the contribution of lexical-semantic processing to verbal fluency.
The effect of topic selection on writing fluency among Japanese high school students
Directory of Open Access Journals (Sweden)
Sarah Lin Lubold
2016-01-01
Full Text Available Written fluency and fluency building activities have been shown to promote linguistic choice and student voice development, increased ability to express ideas using complex grammatical structures and greater intrinsic motivation in English language learners. Since the 1970’s, process-oriented writing has been emphasized, yielding an amplified focus on meaning of student content over linguistic form precision. Current research of writing fluency must delve deeper into questions of student ownership of topic and the outcomes for low-risk activities that support fluency practice and encourage confidence building in students. The purpose of this replication study is to further explore previous findings on the effects of topic selection on writing fluency for high school English as foreign language learners. Building off of the work of Bonzo (2008, this study focused on a timed, non-graded writing activity administered to groups of Japanese engineering students in three departments: mechanical, electrical, and global engineering. The six subsequent samples for each participating student were analyzed using online text-analysis for total and unique word counts, providing data used to perform a t-test. Responses to bi-lingual student questionnaires, with prompts on self-perceived written English ability, self-efficacy and strategies for success while writing, provided additional insight into the facets of fluency. The results of these writing sessions offer both confirmation of and contrast to Bonzo’s original work, demonstrate increased student meaning making, and support the use of free writing activities in English language classrooms as a means by which student written fluency may be improved.
Improving English Speaking Fluency: The Role of Six Factors
Directory of Open Access Journals (Sweden)
Gholamhossein Shahini
2017-12-01
Full Text Available This qualitative study, using an open interview, set out to investigate the roles six factors, including age, university education, teachers of English Language institutes, teaching English, dictionary, and note-taking, played in improving English speaking fluency of seventeen fluent Iranian EFL speakers. The participants were chosen purposefully based on the speaking scale of Common European Framework of Reference for Languages (CEFRL. The findings indicated that early age had a great impact on the participants’ speaking fluency. They mentioned that they could not pick up fluency if they had started learning English at older ages. Moreover, university education had no effect on enhancing their fluency. They stated that not having enough opportunities to speak English in classrooms, being exposed to wrong amounts of input from their classmates or even from some university instructors, having no access to English native speakers in English Language Departments, professors’ talking in native language out of classes, in their offices or even sometimes in classes all led to their losing motivation after entering the university. In contrast, teachers in English language institutes had a supportive role in increasing the participants’ English learning. Although two participants quit teaching English since it had a negative influence on their speaking, it had a positive impact on improving speaking ability of the rest. And finally, fruitful strategies were suggested on how to use dictionaries and note-takings.
Chesters, Jennifer; Möttönen, Riikka; Watkins, Kate E
2018-04-01
See Crinion (doi:10.1093/brain/awy075) for a scientific commentary on this article.Stuttering is a neurodevelopmental condition affecting 5% of children, and persisting in 1% of adults. Promoting lasting fluency improvement in adults who stutter is a particular challenge. Novel interventions to improve outcomes are of value, therefore. Previous work in patients with acquired motor and language disorders reported enhanced benefits of behavioural therapies when paired with transcranial direct current stimulation. Here, we report the results of the first trial investigating whether transcranial direct current stimulation can improve speech fluency in adults who stutter. We predicted that applying anodal stimulation to the left inferior frontal cortex during speech production with temporary fluency inducers would result in longer-lasting fluency improvements. Thirty male adults who stutter completed a randomized, double-blind, controlled trial of anodal transcranial direct current stimulation over left inferior frontal cortex. Fifteen participants received 20 min of 1-mA stimulation on five consecutive days while speech fluency was temporarily induced using choral and metronome-timed speech. The other 15 participants received the same speech fluency intervention with sham stimulation. Speech fluency during reading and conversation was assessed at baseline, before and after the stimulation on each day of the 5-day intervention, and at 1 and 6 weeks after the end of the intervention. Anodal stimulation combined with speech fluency training significantly reduced the percentage of disfluent speech measured 1 week after the intervention compared with fluency intervention alone. At 6 weeks after the intervention, this improvement was maintained during reading but not during conversation. Outcome scores at both post-intervention time points on a clinical assessment tool (the Stuttering Severity Instrument, version 4) also showed significant improvement in the group receiving
Visiting digital fluency for pre-service teachers in Turkey
Kadir Demir; Betül Aydın; Nazife Şen Ersoy; Aydın Kelek; İsmail Tatar; Abdullah Kuzu; Hatice Ferhan Odabaşı
2015-01-01
Digital literacy is to know how to use digital tools, however digital fluency is a new concept. Beyond the digital literacy, digital fluency requires skills to know when to use the technology and even why to use the technology. The technology advances rapidly; as a result, education and instruction are getting digitalized. So it could be estimated that; pre-service teachers who are future teachers, should have digital skills. This is the main point of this study which aims to visit pre-ser...
Impairments of speech fluency in Lewy body spectrum disorder.
Ash, Sharon; McMillan, Corey; Gross, Rachel G; Cook, Philip; Gunawardena, Delani; Morgan, Brianna; Boller, Ashley; Siderowf, Andrew; Grossman, Murray
2012-03-01
Few studies have examined connected speech in demented and non-demented patients with Parkinson's disease (PD). We assessed the speech production of 35 patients with Lewy body spectrum disorder (LBSD), including non-demented PD patients, patients with PD dementia (PDD), and patients with dementia with Lewy bodies (DLB), in a semi-structured narrative speech sample in order to characterize impairments of speech fluency and to determine the factors contributing to reduced speech fluency in these patients. Both demented and non-demented PD patients exhibited reduced speech fluency, characterized by reduced overall speech rate and long pauses between sentences. Reduced speech rate in LBSD correlated with measures of between-utterance pauses, executive functioning, and grammatical comprehension. Regression analyses related non-fluent speech, grammatical difficulty, and executive difficulty to atrophy in frontal brain regions. These findings indicate that multiple factors contribute to slowed speech in LBSD, and this is mediated in part by disease in frontal brain regions. Copyright © 2011 Elsevier Inc. All rights reserved.
Mellard, Daryl F.; Anthony, Jason L.; Woods, Kari L.
2012-01-01
This study extends the literature on the component skills involved in oral reading fluency. Dominance analysis was applied to assess the relative importance of seven reading-related component skills in the prediction of the oral reading fluency of 272 adult literacy learners. The best predictors of oral reading fluency when text difficulty was…
Johnston, Lauren E.; Mercer, Sterett H.; Geres-Smith, Rhonda
2018-01-01
The purpose of this preliminary study was to determine whether incorporating vocabulary instruction in individual reading fluency interventions for English Language Learners (ELLs) would improve reading comprehension. Two vocabulary instructional procedures were contrasted with a fluency-building only condition in an alternating-treatments design…
Episodic Memory, Semantic Memory, and Fluency.
Schaefer, Carl F.
1980-01-01
Suggests that creating a second-language semantic network can be conceived as developing a plan for retrieving second-language word forms. Characteristics of linguistic performance which will promote fluency are discussed in light of the distinction between episodic and semantic memory. (AMH)
Is semantic verbal fluency impairment explained by executive function deficits in schizophrenia?
Directory of Open Access Journals (Sweden)
Arthur A. Berberian
2016-01-01
Full Text Available Objective: To investigate if verbal fluency impairment in schizophrenia reflects executive function deficits or results from degraded semantic store or inefficient search and retrieval strategies. Method: Two groups were compared: 141 individuals with schizophrenia and 119 healthy age and education-matched controls. Both groups performed semantic and phonetic verbal fluency tasks. Performance was evaluated using three scores, based on 1 number of words generated; 2 number of clustered/related words; and 3 switching score. A fourth performance score based on the number of clusters was also measured. Results: SZ individuals produced fewer words than controls. After controlling for the total number of words produced, a difference was observed between the groups in the number of cluster-related words generated in the semantic task. In both groups, the number of words generated in the semantic task was higher than that generated in the phonemic task, although a significant group vs. fluency type interaction showed that subjects with schizophrenia had disproportionate semantic fluency impairment. Working memory was positively associated with increased production of words within clusters and inversely correlated with switching. Conclusion: Semantic fluency impairment may be attributed to an inability (resulting from reduced cognitive control to distinguish target signal from competing noise and to maintain cues for production of memory probes.
Casals-Coll, M; Sánchez-Benavides, G; Quintana, M; Manero, R M; Rognoni, T; Calvo, L; Palomo, R; Aranciva, F; Tamayo, F; Peña-Casanova, J
2013-01-01
Lexical fluency tests are frequently used in clinical practice to assess language and executive function. As part of the Spanish normative studies project in young adults (NEURONORMA young adults project), we provide age- and education-adjusted normative data for 3 semantic fluency tasks (animals, fruits and vegetables, and kitchen tools), three formal lexical fluency tasks (words beginning with P, M and R), three excluded-letter fluency tasks (words excluding A, E and S) and a verb fluency task. The sample consisted of 179 participants who are cognitively normal and range in age from 18 to 49 years. Tables are provided to convert raw scores to scaled scores. Age- and education-adjusted scores are provided by applying linear regression techniques. The results show that education impacted most of the verbal fluency test scores, with no effects related to age and only minimal effects related to sex. The norms obtained will be extremely useful in the clinical evaluation of young Spanish adults. Copyright © 2011 Sociedad Española de Neurología. Published by Elsevier Espana. All rights reserved.
Considering the Context and Texts for Fluency: Performance, Readers Theater, and Poetry
Young, Chase; Nageldinger, James
2014-01-01
This article describes the importance of teaching reading fluency and all of its components, including automaticity and prosody. The authors explain how teachers can create a context for reading fluency instruction by engaging students in reading performance activities. To support the instructional contexts, the authors suggest particular…
Linguistic and Cultural Factors Associated with Phonemic Fluency Performance in Bilingual Hispanics
Bennett, Jennifer
2012-01-01
Verbal fluency tasks are used extensively in clinical settings because of their sensitivity to a wide variety of disorders, including cognitive decline and dementia, and their usefulness in differential diagnoses. However, the effects of bilingualism on neuropsychological assessment, and verbal fluency in particular, are currently not completely…
Directory of Open Access Journals (Sweden)
Vuksanović Jasmina
2008-01-01
Full Text Available Fluency tests are frequently used in clinical practice to asses executive functions. The literature data are not unequivocal although in a great number of papers is pointed out the importance of the left hemisphere, specially of the left frontal lobes in the mediation of phonological fluency and the right hemisphere in the mediation of nonverbal fluency. This paper considers the suitability of fluency tests for the detection of left versus right seizure laterality. The sample consisted of thirty-two epilepsy patients divided into two groups: LHF-participants with the seizure focus in the left hemisphere (n=16, and DHF-participants with the seizure focus in the right hemisphere (n=16, and K-the control group of t age-matched healthy children (n=50 aged 7-11 years. The qualitative and quantitative comparison of the phonological and nonverbal fluency performance was carried out in consideration of the seizure laterality as well as compared to the healthy controls. The results of phonological fluency performance revealed that the performance of the LHF group was significantly reduced as compared to both DHF and K group. The analysis of nonverbal fluency performance revealed that the performance of the DHF group was significantly reduced as compared to both LHF and K group The qualitative analysis obtained valuable data, which could additionally contribute to the neuropsychological evaluation of the left versus right seizure laterality.
The Effectiveness of Cooperative Learning Activities in Enhancing EFL Learners' Fluency
Alrayah, Hassan
2018-01-01
This research-paper aims at examining the effectiveness of cooperative learning activities in enhancing EFL learners' fluency. The researcher has used the descriptive approach, recorded interviews for testing fluency as tools of data collection and the software program SPSS as a tool for the statistical treatment of data. Research sample consists…
Using an Intelligent Tutor and Math Fluency Training to Improve Math Performance
Arroyo, Ivon; Royer, James M.; Woolf, Beverly P.
2011-01-01
This article integrates research in intelligent tutors with psychology studies of memory and math fluency (the speed to retrieve or calculate answers to basic math operations). It describes the impact of computer software designed to improve either strategic behavior or math fluency. Both competencies are key to improved performance and both…
Emotional verbal fluency: a new task on emotion and executive function interaction.
Sass, Katharina; Fetz, Karolina; Oetken, Sarah; Habel, Ute; Heim, Stefan
2013-09-01
The present study introduces "Emotional Verbal Fluency" as a novel (partially computerized) task, which is aimed to investigate the interaction between emotionally loaded words and executive functions. Verbal fluency tasks are thought to measure executive functions but the interaction with emotional aspects is hardly investigated. In the current study, a group of healthy subjects (n = 21, mean age 25 years, 76% females) were asked to generate items that are either part of a semantic category (e.g., plants, toys, vehicles; standard semantic verbal fluency) or can trigger the emotions joy, anger, sadness, fear and disgust. The results of the task revealed no differences between performance on semantic and emotional categories, suggesting a comparable task difficulty for healthy subjects. Hence, these first results on the comparison between semantic and emotional verbal fluency seem to highlight that both might be suitable for examining executive functioning. However, an interaction was found between the category type and repetition (first vs. second sequence of the same category) with larger performance decrease for semantic in comparison to emotional categories. Best performance overall was found for the emotional category "joy" suggesting a positivity bias in healthy subjects. To conclude, emotional verbal fluency is a promising approach to investigate emotional components in an executive task, which may stimulate further research, especially in psychiatric patients who suffer from emotional as well as cognitive deficits.
Fluency profile: comparison between Brazilian and European Portuguese speakers.
Castro, Blenda Stephanie Alves e; Martins-Reis, Vanessa de Oliveira; Baptista, Ana Catarina; Celeste, Letícia Correa
2014-01-01
The purpose of the study was to compare the speech fluency of Brazilian Portuguese speakers with that of European Portuguese speakers. The study participants were 76 individuals of any ethnicity or skin color aged 18-29 years. Of the participants, 38 lived in Brazil and 38 in Portugal. Speech samples from all participants were obtained and analyzed according to the variables of typology and frequency of speech disruptions and speech rate. Descriptive and inferential statistical analyses were performed to assess the association between the fluency profile and linguistic variant variables. We found that the speech rate of European Portuguese speakers was higher than the speech rate of Brazilian Portuguese speakers in words per minute (p=0.004). The qualitative distribution of the typology of common dysfluencies (pPortuguese speakers is not available, speech therapists in Portugal can use the same speech fluency assessment as has been used in Brazil to establish a diagnosis of stuttering, especially in regard to typical and stuttering dysfluencies, with care taken when evaluating the speech rate.
Verbal fluency as a prefrontal activation probe: a validation study using 99mTc-ECD brain SPET
International Nuclear Information System (INIS)
Audenaert, K.; Brans, B.; Laere, K. van; Versijpt, J.; Dierckx, R.; Lahorte, P.; Heeringen, K. van
2000-01-01
This study aimed to investigate the feasibility of brain single-photon emission tomography (SPET) in the letter and category fluency paradigm of the Controlled Oral Word Association (COWA) test in healthy volunteers. Two groups each comprising ten right-handed healthy volunteers were injected twice with 370 MBq technetium-99m ethyl cysteinate dimer following a split-dose paradigm (resting and activation condition). Statistical parametric mapping (SPM96) was used to determine voxelwise significant changes. The letter fluency and the category fluency activation paradigm had a differential brain activation pattern. The posterior part of the left inferior prefrontal cortex (LIPC) was activated in both paradigms, with the category fluency task having an extra activation in the anterior LIPC. In the category fluency task, but not the letter fluency task, an activation in the right inferior prefrontal cortex was found. These findings confirm to a large extent the results of previous functional magnetic resonance imaging and positron emission tomography studies in semantic and phonological activation paradigms. The choice and validity of various methodological characteristics of the experimental design leading to these results are critically discussed. It is concluded that brain SPET activation with the letter fluency and category fluency paradigm under standard neuropsychological conditions in healthy volunteers is both technically and practically feasible. (orig.)
Effects of literacy on semantic verbal fluency in an immigrant population
DEFF Research Database (Denmark)
Nielsen, T. Rune; Waldemar, Gunhild
2016-01-01
OBJECTIVE: A significant impact of limited schooling and illiteracy has been found on numerous neuropsychological tests, which may partly be due to the ecological relevance of the tests in the context of illiteracy. The aims of this study were to compare the performance of illiterate and literate...... and acculturation score did not affect this interaction effect. CONCLUSIONS: Overall, our results are in line with previous studies comparing semantic fluency in illiterate and literate individuals. The results lend further support to the strong associations between literacy, semantic verbal fluency performance...... immigrants on two semantic criteria for the verbal fluency test, and examine the influence of acculturation on test performances. METHOD: Performances of 20 cognitively unimpaired illiterate and 21 literate Turkish immigrants aged ≥50 years were compared on an animal and supermarket criterion...
Text-fading based training leads to transfer effects on children’s sentence reading fluency
Directory of Open Access Journals (Sweden)
Telse eNagler
2015-02-01
Full Text Available Previous studies used a text-fading procedure as a training tool with the goal to increase silent reading fluency (i.e., proficient reading rate and comprehension. In recently published studies, this procedure resulted in lasting reading enhancements for adult and adolescent research samples. However, studies working with children reported mixed results. While reading rate improvements were observable for Dutch reading children in a text-fading training study, reading fluency improvements in standardized reading tests post-training attributable to the fading manipulation were not detectable. These results raise the question of whether text-fading training is not effective for children or whether research design issues have concealed possible transfer effects. Hence, the present study sought to investigate possible transfer effects resulting from a text-fading based reading training program, using a modified research design. Over a period of three weeks, two groups of German third-graders read sentences either with an adaptive text-fading procedure or at their self-paced reading rate. A standardized test measuring reading fluency at the word, sentence, and text level was conducted pre- and post-training. Text level reading fluency improved for both groups equally. Post-training gains at the word level were found for the text-fading group, however, no significant interaction between groups was revealed for word reading fluency. Sentence level reading fluency gains were found for the text-fading group, which significantly differed from the group of children reading at their self-paced reading routine. These findings provide evidence for the efficacy of text-fading as a training method for sentence reading fluency improvement also for children.
On the (elusive) role of oral motor-movements in fluency-based memory illusions.
Westerman, Deanne L; Klin, Celia M; Lanska, Meredith
2015-07-01
It is well established that the ease with which a stimulus is processed affects many different types of evaluative judgments. Recently, it has been proposed that for verbal stimuli the effect of fluency on such judgments is mediated by the muscles that are involved in speech (Topolinski & Strack, 2009, 2010). Evidence for this claim can be found in studies that have shown that fluency effects are eliminated if such judgments are made while these muscles are otherwise engaged (such as while chewing gum or eating). Additional research has found that oral-motor tasks block familiarity-based responding on recognition memory tasks (Topolinski, 2012). The current study investigated the effect of an oral-motor task on recognition memory. Of particular interest was whether the fluency-blocking effects of an oral-motor task would extend to fluency-based illusions of recognition memory. Although we found robust fluency-based illusions of familiarity, we did not find that the effects were modulated by the nature of the concurrent task (gum-chewing vs. a manual-motor task). Moreover, we found no evidence that oral-motor tasks affected recognition more generally, nor did we find that an oral-motor task modulated affective ratings to repeated stimuli. We were also unable to replicate the finding that an oral-motor task blocks the false fame effect (Topolinski & Strack, 2010). These results call into question the assertion that oral-motor movements mediate fluency effects in recognition memory and other evaluative judgments. (c) 2015 APA, all rights reserved.
Typography and color: effects of salience and fluency on conscious recollective experience.
Wehr, Thomas; Wippich, Werner
2004-12-01
Within one experiment the central assumptions of the distinctiveness/fluency account of recollective experience were tested and contrasted with predictions of processing theory. To manipulate perceptual salience, the typography of words was varied. Effects of conceptual salience were induced by a variation of word color. In the study phase participants generated different word or object images according to presented words. To manipulate perceptual and conceptual fluency one test group underwent a priming procedure in the test phase, consisting of a recognition test, whereby some primes were identical to the target words typographically or by color and others were not. Additionally, all participants were asked to make judgments of recollective experience (remember, know, guess) after the old/new decisions. The results of the data analyses confirm the distinctiveness/fluency account. Words written in an unusual typography or color were judged significantly more often as "remembered" than normal words. The priming procedure uncovered some effects of fluency on reaction times: old/new decisions took less time if prime and target words were perceptually or conceptually identical.
The limited use of the fluency heuristic: Converging evidence across different procedures.
Pohl, Rüdiger F; Erdfelder, Edgar; Michalkiewicz, Martha; Castela, Marta; Hilbig, Benjamin E
2016-10-01
In paired comparisons based on which of two objects has the larger criterion value, decision makers could use the subjectively experienced difference in retrieval fluency of the objects as a cue. According to the fluency heuristic (FH) theory, decision makers use fluency-as indexed by recognition speed-as the only cue for pairs of recognized objects, and infer that the object retrieved more speedily has the larger criterion value (ignoring all other cues and information). Model-based analyses, however, have previously revealed that only a small portion of such inferences are indeed based on fluency alone. In the majority of cases, other information enters the decision process. However, due to the specific experimental procedures, the estimates of FH use are potentially biased: Some procedures may have led to an overestimated and others to an underestimated, or even to actually reduced, FH use. In the present article, we discuss and test the impacts of such procedural variations by reanalyzing 21 data sets. The results show noteworthy consistency across the procedural variations revealing low FH use. We discuss potential explanations and implications of this finding.
Wójcik, Aleksandra; Merecz-Kot, Dorota; Andysz, Aleksandra
2015-01-01
Managers influence the way organization works as well as the functioning of subordinates - in the context of their work life but non-professional functioning as well e.g., attitude towards work-life balance or taking care of health. We focused on the superior-subordinate relation, referring to social power bases theory by Raven. We identified the reasons why subordinates decide to follow their superiors' orders and determined specific styles of compliance with superiors' will. Understanding why employees listen to their superiors may be valuable in the context of supporting healthy organizational climate and atmosphere of co-operation or communicating values - for example, as regards taking care of own health. We discussed the results referring to the issue of influencing employees in the context of their health behavior. The research involved 100 Polish employees, aged 28 years old on average, who filled in the Interpersonal Power Inventory by Raven et al. for subordinates in a Polish adaptation by Zaleski. The questionnaire includes 11 subscales referring to power bases. Based on the cluster analysis results, we recognized people who complied because of: all kinds of power bases (typical for 46% of the respondents); the respect for superiors' professionalism (34%); and formal/objective reasons (20%). Employees differ in terms of their styles of compliance. Their motives to comply with superiors' instructions constitute compilations of power bases. The superiors' awareness of the reasons why their employees decide to follow orders is necessary for successful management. It may motivate employees to work but also to take care of their own health. This work is available in Open Access model and licensed under a CC BY-NC 3.0 PL license.
Oral Reading Fluency with iPods
Arens, Karla; Gove, Mary K.; Abate, Ron
2018-01-01
Research suggests that oral reading fluency frees up working memory so readers can focus on the meaning of a text, but traditional instruction in oral reading can be problematic in classrooms with students at different reading levels. Differentiating instruction, providing motivation to practice, as well as timely corrective feedback are practical…
Linguistic Phenomena in Men and Women - TOT, FOK, Verbal Fluency
Ewa Szepietowska; Barbara Gawda; Agnieszka Gawda
2013-01-01
The aim of this study is to describe the differences between women and men in the phenomena of feeling of knowing/know (FOK), tip of the tongue (TOT), and verbal fluency. Two studies are presented. The first included a group of 60 participants and focused on the analysis of FOK and TOT in men and women. The second study described the performance of 302 participants in verbal fluency tasks. Both studies showed that sex is not a significant predictor of linguistic abilities. Rather, the main fa...
Phonemic verbal fluency and severity of anxiety disorders in young children
Directory of Open Access Journals (Sweden)
Rudineia Toazza
Full Text Available Abstract Introduction: Previous studies have implicated impaired verbal fluency as being associated with anxiety disorders in adolescents. Objectives: To replicate and extend previously reported evidence by investigating whether performance in phonemic verbal fluency tasks is related to severity of anxiety symptoms in young children with anxiety disorders. We also aim to investigate whether putative associations are independent from co-occurring attention deficit hyperactivity disorder (ADHD symptoms. Methods: Sixty children (6-12 years old with primary diagnoses of anxiety disorders participated in this study. Severity of symptoms was measured using clinician-based, parent-rated and self-rated validated scales. Verbal fluency was assessed using a simple task that measures the number of words evoked in 1-minute with the letter F, from which we quantified the number of isolated words, number of clusters (groups of similar words and number of switches (transitions between clusters and/or between isolated words. Results: There was a significant association between the number of clusters and anxiety scores. Further analysis revealed associations were independent from co-occurring ADHD symptoms. Conclusion: We replicate and extend previous findings showing that verbal fluency is consistently associated with severity in anxiety disorders in children. Further studies should explore the potential effect of cognitive training on symptoms of anxiety disorders.
Verbal fluency in idiopathic Parkinson's disease
International Nuclear Information System (INIS)
Thut, G.; Antonini, A.; Roelcke, U.; Missimer, J.; Maguire, R.P.; Leenders, K.L.; Regard, M.
1997-01-01
In the present study, the relationship between resting metabolism and verbal fluency, a correlate of frontal lobe cognition, was examined in 33 PD patients. We aimed to determine brain structures involved in frontal lobe cognitive impairment with special emphasis on differences between demented and non-demented PD patients. (author) 3 figs., 2 refs
SEMANTIC VERBAL FLUENCY OF THE BILINGUAL CHILDREN WITH MILD INTELLECTUAL DISABILITY
Directory of Open Access Journals (Sweden)
Nenad GLUMBIKJ
2005-06-01
Full Text Available Semantic verbal fluency test is reliable instrument for detection of various kinds of neuropsychological deficits. Participants’ attainments in this test are influenced by array of socio-cultural factors. The occurrence of “twofold semilingualism” belongs to these cultural factors.The objective of this research is to determine differences between monolingual and bilingual children with mild mental retardation in semantic verbal fluency test.The sample consisted of 90 participants with mild mental retardation, of both sexes, aged from 12 to 15. The whole sample was divided into three subsets: 30 monolingual children (M1, who speak only Serbian, 30 monolingual Roma children who do not speak Romany (M2 and 30 bilingual Roma children who speak both, Romany and Serbian language (B.It was found that both groups of monolingual children have better performances in semantic fluency tasks than bilingual children.
Reading fluency: implications for the assessment of children with reading disabilities.
Meisinger, Elizabeth B; Bloom, Juliana S; Hynd, George W
2010-06-01
The current investigation explored the diagnostic utility of reading fluency measures in the identification of children with reading disabilities. Participants were 50 children referred to a university-based clinic because of suspected reading problems and/or a prior diagnosis of dyslexia, where children completed a battery of standardized intellectual, reading achievement, and processing measures. Within this clinical sample, a group of children were identified that exhibited specific deficits in their reading fluency skills with concurrent deficits in rapid naming speed and reading comprehension. This group of children would not have been identified as having a reading disability according to assessment of single word reading skills alone, suggesting that it is essential to assess reading fluency in addition to word reading because failure to do so may result in the under-identification of children with reading disabilities.
Verbal fluency as a prefrontal activation probe: a validation study using {sup 99m}Tc-ECD brain SPET
Energy Technology Data Exchange (ETDEWEB)
Audenaert, K. [Department of Nuclear Medicine, Ghent University Hospital (Belgium); Department of Psychiatry and Medical Psychology, Ghent University Hospital and Ghent University (Belgium); Brans, B.; Laere, K. van; Versijpt, J.; Dierckx, R. [Department of Nuclear Medicine, Ghent University Hospital (Belgium); Lahorte, P. [Department of Nuclear Medicine, Ghent University Hospital (Belgium); Laboratory of Subatomic and Radiation Physics, Ghent University (Belgium); Heeringen, K. van [Department of Psychiatry and Medical Psychology, Ghent University Hospital and Ghent University (Belgium)
2000-12-01
This study aimed to investigate the feasibility of brain single-photon emission tomography (SPET) in the letter and category fluency paradigm of the Controlled Oral Word Association (COWA) test in healthy volunteers. Two groups each comprising ten right-handed healthy volunteers were injected twice with 370 MBq technetium-99m ethyl cysteinate dimer following a split-dose paradigm (resting and activation condition). Statistical parametric mapping (SPM96) was used to determine voxelwise significant changes. The letter fluency and the category fluency activation paradigm had a differential brain activation pattern. The posterior part of the left inferior prefrontal cortex (LIPC) was activated in both paradigms, with the category fluency task having an extra activation in the anterior LIPC. In the category fluency task, but not the letter fluency task, an activation in the right inferior prefrontal cortex was found. These findings confirm to a large extent the results of previous functional magnetic resonance imaging and positron emission tomography studies in semantic and phonological activation paradigms. The choice and validity of various methodological characteristics of the experimental design leading to these results are critically discussed. It is concluded that brain SPET activation with the letter fluency and category fluency paradigm under standard neuropsychological conditions in healthy volunteers is both technically and practically feasible. (orig.)
Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells
Das, Debajyoti; Kar, Debjit
2017-12-01
A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.
Jakesch, Martina; Leder, Helmut; Forster, Michael
2013-01-01
Ambiguity is often associated with negative affective responses, and enjoying ambiguity seems restricted to only a few situations, such as experiencing art. Nevertheless, theories of judgment formation, especially the “processing fluency account”, suggest that easy-to-process (non-ambiguous) stimuli are processed faster and are therefore preferred to (ambiguous) stimuli, which are hard to process. In a series of six experiments, we investigated these contrasting approaches by manipulating fluency (presentation duration: 10ms, 50ms, 100ms, 500ms, 1000ms) and testing effects of ambiguity (ambiguous versus non-ambiguous pictures of paintings) on classification performance (Part A; speed and accuracy) and aesthetic appreciation (Part B; liking and interest). As indicated by signal detection analyses, classification accuracy increased with presentation duration (Exp. 1a), but we found no effects of ambiguity on classification speed (Exp. 1b). Fifty percent of the participants were able to successfully classify ambiguous content at a presentation duration of 100 ms, and at 500ms even 75% performed above chance level. Ambiguous artworks were found more interesting (in conditions 50ms to 1000ms) and were preferred over non-ambiguous stimuli at 500ms and 1000ms (Exp. 2a - 2c, 3). Importantly, ambiguous images were nonetheless rated significantly harder to process as non-ambiguous images. These results suggest that ambiguity is an essential ingredient in art appreciation even though or maybe because it is harder to process. PMID:24040172
Miller, Jeremy K.; Lloyd, Marianne E.; Westerman, Deanne L.
2008-01-01
Previous research has shown that illusions of recognition memory based on enhanced perceptual fluency are sensitive to the perceptual match between the study and test phases of an experiment. The results of the current study strengthen that conclusion, as they show that participants will not interpret enhanced perceptual fluency as a sign of…
Non-leptonic kaon decays at large Nc
Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando
2018-03-01
We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.
Event-related potentials indicate that fluency can be interpreted as familiarity.
Bruett, Heather; Leynes, P Andrew
2015-11-01
Recent evidence suggests that fluency may be capable of supporting recognition independently of familiarity. This hypothesis was further tested in the present study. 29 participants encoded name-brand and off-brand products in an incidental task. Participants then judged whether the product was old or new during two tests with products from one category (i.e., only name-brand or only off-brand products) and a mixed test (where both name-brand and off-brand products were shown). The ERP data elicited by off-brand products varied as a function of test format. During the mixed test, off-brand products were correlated with a FN400 effect, whereas a fluency ERP (old ERPs were more negative than new at parietal electrodes 225-400ms) was observed during the other test. Importantly, no FN400 was detected during this test. The ERP results suggest that viewing the off-brand products during the mixed test produced a familiarity experience; however, fluency supported recognition when viewing off-brand products on the other test. The results are strong evidence that top-down processing of visual features during recognition interprets the information relative to the context. This process results in either fluency or, in other contexts, it is interpreted as familiarity as the Discrepancy-Attribution Hypothesis (Whittlesea and Williams, 2001a, 2001b) contends. Copyright © 2015 Elsevier Ltd. All rights reserved.
A normative study of lexical verbal fluency in an educationally-diverse elderly population.
Kim, Bong Jo; Lee, Cheol Soon; Oh, Byoung Hoon; Hong, Chang Hyung; Lee, Kang Soo; Son, Sang Joon; Han, Changsu; Park, Moon Ho; Jeong, Hyun-Ghang; Kim, Tae Hui; Park, Joon Hyuk; Kim, Ki Woong
2013-12-01
Lexical fluency tests are frequently used to assess language and executive function in clinical practice. We investigated the influences of age, gender, and education on lexical verbal fluency in an educationally-diverse, elderly Korean population and provided its' normative information. We administered the lexical verbal fluency test (LVFT) to 1676 community-dwelling, cognitively normal subjects aged 60 years or over. In a stepwise linear regression analysis, education (B=0.40, SE=0.02, standardized B=0.506) and age (B=-0.10, SE=0.01, standardized B=-0.15) had significant effects on LVFT scores (p0.05). Education explained 28.5% of the total variance in LVFT scores, which was much larger than the variance explained by age (5.42%). Accordingly, we presented normative data of the LVFT stratified by age (60-69, 70-74, 75-79, and ≥80 years) and education (0-3, 4-6, 7-9, 10-12, and ≥13 years). The LVFT norms should provide clinically useful data for evaluating elderly people and help improve the interpretation of verbal fluency tasks and allow for greater diagnostic accuracy.
Fine, Eric M; Delis, Dean C; Paul, Brianna M; Filoteo, J Vincent
2011-02-01
There has been an increasing interest within neuropsychology in comparing verbal fluency for different grammatical classes (e.g., verb generation vs. noun generation) in neurological populations, including Parkinson's disease (PD). However, to our knowledge, few studies have compared verbal fluency for common nouns and proper names in PD. Common nouns and proper names differ in terms of their semantic characteristics, as categories of common nouns are organized hierarchically based on semantics, while categories of proper nouns lack a well-defined semantic organization. In addition, there is accumulating evidence that the retrieval of these distinct grammatical classes are subserved by somewhat distinct neural systems. Given that verbal fluency deficits are among the first impairments to emerge in PD, and that such deficits are predictors of future cognitive decline, it is important to examine all aspects of verbal fluency in this population. For the current study, we compared the performance of a group of 32 nondemented PD patients with 32 healthy participants (HP) on verbal fluency tasks for common nouns (animals) and proper names (boys' first names). A significant interaction between verbal fluency task and diagnostic status emerged, as the PD group performed significantly worse on only the proper name fluency task. This finding may reflect the absence of well-defined semantic organization that structures the verbal search for first names, thus placing a greater onus on strategic or "executive" verbal retrieval processes.
Directory of Open Access Journals (Sweden)
Devin eDuke
2014-04-01
Full Text Available According to attribution models of familiarity assessment, people can use a heuristic in recognition-memory decisions, in which they attribute the subjective ease of processing of a memory probe to a prior encounter with the stimulus in question. Research in social cognition suggests that experienced positive affect may be the proximal cue that signals fluency in various experimental contexts. In the present study, we compared the effects of positive affect and fluency on recognition-memory judgments for faces with neutral emotional expression. We predicted that if positive affect is indeed the critical cue that signals processing fluency at retrieval, then its manipulation should produce effects that closely mirror those produced by manipulations of processing fluency. In two experiments, we employed a masked-priming procedure in combination with a Remember-Know paradigm that aimed to separate familiarity- from recollection-based memory decisions. In addition, participants performed a prime-discrimination task that allowed us to take inter-individual differences in prime awareness into account. We found highly similar effects of our priming manipulations of processing fluency and of positive affect. In both cases, the critical effect was specific to familiarity-based recognition responses. Moreover, in both experiments it was reflected in a shift towards a more liberal response bias, rather than in changed discrimination. Finally, in both experiments, the effect was found to be related to prime awareness; it was present only in participants who reported a lack of such awareness on the prime-discrimination task. These findings add to a growing body of evidence that points not only to a role of fluency, but also of positive affect in familiarity assessment. As such they are consistent with the idea that fluency itself may be hedonically marked.
Duke, Devin; Fiacconi, Chris M; Köhler, Stefan
2014-01-01
According to attribution models of familiarity assessment, people can use a heuristic in recognition-memory decisions, in which they attribute the subjective ease of processing of a memory probe to a prior encounter with the stimulus in question. Research in social cognition suggests that experienced positive affect may be the proximal cue that signals fluency in various experimental contexts. In the present study, we compared the effects of positive affect and fluency on recognition-memory judgments for faces with neutral emotional expression. We predicted that if positive affect is indeed the critical cue that signals processing fluency at retrieval, then its manipulation should produce effects that closely mirror those produced by manipulations of processing fluency. In two experiments, we employed a masked-priming procedure in combination with a Remember-Know (RK) paradigm that aimed to separate familiarity- from recollection-based memory decisions. In addition, participants performed a prime-discrimination task that allowed us to take inter-individual differences in prime awareness into account. We found highly similar effects of our priming manipulations of processing fluency and of positive affect. In both cases, the critical effect was specific to familiarity-based recognition responses. Moreover, in both experiments it was reflected in a shift toward a more liberal response bias, rather than in changed discrimination. Finally, in both experiments, the effect was found to be related to prime awareness; it was present only in participants who reported a lack of such awareness on the prime-discrimination task. These findings add to a growing body of evidence that points not only to a role of fluency, but also of positive affect in familiarity assessment. As such they are consistent with the idea that fluency itself may be hedonically marked.
Analysis of Speech Fluency in Williams Syndrome
Rossi, Natalia Freitas; Sampaio, Adriana; Goncalves, Oscar F.; Giacheti, Celia Maria
2011-01-01
Williams syndrome (WS) is a neurodevelopmental genetic disorder, often referred as being characterized by dissociation between verbal and non-verbal abilities, although the number of studies disputing this proposal is emerging. Indeed, although they have been traditionally reported as displaying increased speech fluency, this topic has not been…
Pastor-Fernández, Iván; Arranz-Solís, David; Regidor-Cerrillo, Javier; Álvarez-García, Gema; Hemphill, Andrew; García-Culebras, Alicia; Cuevas-Martín, Carmen; Ortega-Mora, Luis M
2015-01-30
Currently there are no effective vaccines for the control of bovine neosporosis. During the last years several subunit vaccines based on immunodominant antigens and other proteins involved in adhesion, invasion and intracellular proliferation of Neospora caninum have been evaluated as targets for vaccine development in experimental mouse infection models. Among them, the rhoptry antigen NcROP2 and the immunodominant NcGRA7 protein have been assessed with varying results. Recent studies have shown that another rhoptry component, NcROP40, and NcNTPase, a putative dense granule antigen, exhibit higher expression levels in tachyzoites of virulent N. caninum isolates, suggesting that these could be potential vaccine candidates to limit the effects of infection. In the present work, the safety and efficacy of these recombinant antigens formulated in Quil-A adjuvant as monovalent vaccines or pair-wise combinations (rNcROP40+rNcROP2 and rNcGRA7+rNcNTPase) were evaluated in a pregnant mouse model of neosporosis. All the vaccine formulations elicited a specific immune response against their respective native proteins after immunization. Mice vaccinated with rNcROP40 and rNcROP2 alone or in combination produced the highest levels of IFN-γ and exhibited low parasite burdens and low IgG antibody levels after the challenge. In addition, most of the vaccine formulations were able to increase the median survival time in the offspring. However, pup survival only ensued in the groups vaccinated with rNcROP40+rNcROP2 (16.2%) and rNcROP2 (6.3%). Interestingly, vertical transmission was not observed in those survivor pups immunized with rNcROP40+rNcROP2, as shown by PCR analyses. These results show a partial protection against N. caninum infection after vaccination with rNcROP40+rNcROP2, suggesting a synergistic effect of the two recombinant rhoptry antigens. Copyright © 2014 Elsevier B.V. All rights reserved.
Measuring autobiographical fluency in the self-memory system.
Rathbone, Clare J; Moulin, Chris J A
2014-01-01
Autobiographical memory is widely considered to be fundamentally related to concepts of self and identity. However, few studies have sought to test models of self and memory directly using experimental designs. Using a novel autobiographical fluency paradigm, the present study investigated memory accessibility for different levels of self-related knowledge. Forty participants generated 20 "I am" statements about themselves, from which the 1st, 5th, 10th, 15th, and 20th were used as cues in a two-minute autobiographical fluency task. The most salient aspects of the self, measured by both serial position and ratings of personal significance, were associated with more accessible sets of autobiographical memories. This finding supports theories that view the self as a powerful organizational structure in memory. Results are discussed with reference to models of self and memory.
Voice and Fluency Changes as a Function of Speech Task and Deep Brain Stimulation
Van Lancker Sidtis, Diana; Rogers, Tiffany; Godier, Violette; Tagliati, Michele; Sidtis, John J.
2010-01-01
Purpose: Speaking, which naturally occurs in different modes or "tasks" such as conversation and repetition, relies on intact basal ganglia nuclei. Recent studies suggest that voice and fluency parameters are differentially affected by speech task. In this study, the authors examine the effects of subcortical functionality on voice and fluency,…
A Cross-Sectional Study of Fluency and Reading Comprehension in Spanish Primary School Children
Calet, Nuria; Gutiérrez-Palma, Nicolás; Defior, Sylvia
2015-01-01
The importance of prosodic elements is recognised in most definitions of fluency. Although speed and accuracy have been typically considered the constituents of reading fluency, prosody is emerging as an additional component. The relevance of prosody in comprehension is increasingly recognised in the latest studies. The purpose of this research is…
Whitney, Todd; Hirn, Regina G.; Lingo, Amy S.
2016-01-01
In the present study, we examined the effects of a fluency-building mathematics program called Great Leaps Math on fluency of basic addition mathematics facts zero to nine and word problem solving using a multiple probe design across participants. Three elementary students with challenging behaviors and mathematics difficulty participated in the…
NC10 bacteria in marine oxygen minimum zones
DEFF Research Database (Denmark)
Padilla, Cory C; Bristow, Laura A; Sarode, Neha
2016-01-01
Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...
Virtual NC machine model with integrated knowledge data
International Nuclear Information System (INIS)
Sidorenko, Sofija; Dukovski, Vladimir
2002-01-01
The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)
Evaluation of fluency stent-grafts in transjugular intrahepatic portosystemic shunts
International Nuclear Information System (INIS)
Zhao Jianbo; Li Yanhao; Chen Yong; He Xiaofeng; Zeng Qingle; Mei Quelin; Lu Wei
2009-01-01
Objective: To evaluate the efficacy of Fluency stent-graft (Bard Corp) in transjugular intrahepatic portosystemic shunt (TIPS). Methods: The clinical data of 21 consecutive patients treated by TIPS using Fluency stent-grafts were retrospectively reviewed. All of them were recurrent variceal bleeding secondary to portal vein hypertension, 1 was bleeding secondary to primary hepatic carcinoma with port vein thrombus, and 1 was Budd-Chiari syndrome. They were followed-up after (10.1±4.6) months (2.0 to 24.0 months). Stent-grafts patancy, portal vein pressure and liver function were recorded and compared. Results: Twenty-five stent-grafts were successfully implanted in 21 patients, 23 stent grafts were 8 mm 2 were 10 mm in diameter. The covered length of the stents varied from 6 to 8 cm. The bleeding was stopped and the portal vein pressure decreased significantly from (25.4±3.5) mm Hg to (15.4±2.8) mm Hg (t= 12.495, P 0.05). Conclusion: The Fluency stent-grafts could increase the patency of the TIPS, but its efficacy on the long-term effect and hepatic encephalopathy need further investigation. (authors)
Brébion, Gildas; Stephan-Otto, Christian; Ochoa, Susana; Nieto, Lourdes; Contel, Montserrat; Usall, Judith
2018-01-01
Decreased processing speed in schizophrenia patients has been identified as a major impairment factor in various neuropsychological domains. Working memory span has been found to be involved in several deep or effortful cognitive processes. We investigated the impact that these 2 cognitive functions may have on phonological and semantic fluency in schizophrenia patients and healthy participants. Fifty-five patients with schizophrenia and 60 healthy participants were administered a neuropsychological battery including phonological and semantic fluency, working memory, and cognitive and motor speed. Regression analyses revealed that motor speed was related to phonological fluency in female patients, whereas cognitive speed was related to semantic fluency in male patients. In addition, working memory span was related to verbal fluency in women from both the patient and the healthy control groups. Decreased processing speed, but not decreased working memory span, accounted for the verbal fluency deficit in patients. Verbal fluency was inversely related to attention deficit in female patients and to negative symptoms in male patients. Decreased processing speed may be the main factor in verbal fluency impairment of patients. Further, the cognitive and clinical predictors of verbal fluency efficiency are different in men and women. (PsycINFO Database Record (c) 2018 APA, all rights reserved).
Development of Speech Fluency over a Short Period of Time: Effects of Pedagogic Intervention
Tavakoli, Parvaneh; Campbell, Colin; McCormack, Joan
2016-01-01
This study investigates the effects of a short-term pedagogic intervention on development of second language (L2) fluency among learners studying English for academic purposes at a UK university. It also examines the interaction between development of fluency and complexity and accuracy. Through a pretest and posttest design, data were collected…
Memory, verbal fluency, and response inhibition in normal aging
Directory of Open Access Journals (Sweden)
Gaurav Thapliyal
2016-01-01
Full Text Available Background: The concepts of aging-related cognitive changes have appeared to be a major challenge in the society. In this context, the present study was planned to find out the functioning of aging population on different neurocognitive measures. Aims: The aim of the study was to find out the neurocognitive functioning, namely memory, verbal fluency, and response inhibition of normal aging population. Materials and Methods: Following purposive sampling technique, a total of 50 healthy subjects (30 males and 20 females in the age range of 60-70 years were recruited from Jaipur city of Rajasthan. Mini-mental state Examination, PGI memory scale, animal names test, and Stroop test were administered. Results: The findings reveal dysfunction in almost all the domains of memory, namely mental balance, attention and concentration, delayed recall, verbal retention for dissimilar pairs, visual retention and recognition, immediate recall, verbal retention for similar pairs, and visual retention. In domain of verbal fluency, all subjects gave low responses on the animal names test. In domain of response inhibition, all the subjects took less time in color test as compared to color word test on the Stroop task. Conclusions: Findings suggest that there are dysfunction in the area of memory, verbal fluency, and response inhibition in persons aged 60-70 years. However, recent and remote memory were found to be intact.
Emotional Verbal Fluency: A New Task on Emotion and Executive Function Interaction
Directory of Open Access Journals (Sweden)
Sarah Oetken
2013-07-01
Full Text Available The present study introduces “Emotional Verbal Fluency” as a novel (partially computerized task, which is aimed to investigate the interaction between emotionally loaded words and executive functions. Verbal fluency tasks are thought to measure executive functions but the interaction with emotional aspects is hardly investigated. In the current study, a group of healthy subjects (n = 21, mean age 25 years, 76% females were asked to generate items that are either part of a semantic category (e.g., plants, toys, vehicles; standard semantic verbal fluency or can trigger the emotions joy, anger, sadness, fear and disgust. The results of the task revealed no differences between performance on semantic and emotional categories, suggesting a comparable task difficulty for healthy subjects. Hence, these first results on the comparison between semantic and emotional verbal fluency seem to highlight that both might be suitable for examining executive functioning. However, an interaction was found between the category type and repetition (first vs. second sequence of the same category with larger performance decrease for semantic in comparison to emotional categories. Best performance overall was found for the emotional category “joy” suggesting a positivity bias in healthy subjects. To conclude, emotional verbal fluency is a promising approach to investigate emotional components in an executive task, which may stimulate further research, especially in psychiatric patients who suffer from emotional as well as cognitive deficits.
Speech fluency profile on different tasks for individuals with Parkinson's disease.
Juste, Fabiola Staróbole; Andrade, Claudia Regina Furquim de
2017-07-20
To characterize the speech fluency profile of patients with Parkinson's disease. Study participants were 40 individuals of both genders aged 40 to 80 years divided into 2 groups: Research Group - RG (20 individuals with diagnosis of Parkinson's disease) and Control Group - CG (20 individuals with no communication or neurological disorders). For all of the participants, three speech samples involving different tasks were collected: monologue, individual reading, and automatic speech. The RG presented a significant larger number of speech disruptions, both stuttering-like and typical dysfluencies, and higher percentage of speech discontinuity in the monologue and individual reading tasks compared with the CG. Both groups presented reduced number of speech disruptions (stuttering-like and typical dysfluencies) in the automatic speech task; the groups presented similar performance in this task. Regarding speech rate, individuals in the RG presented lower number of words and syllables per minute compared with those in the CG in all speech tasks. Participants of the RG presented altered parameters of speech fluency compared with those of the CG; however, this change in fluency cannot be considered a stuttering disorder.
Implicit Recognition Based on Lateralized Perceptual Fluency
Directory of Open Access Journals (Sweden)
Iliana M. Vargas
2012-02-01
Full Text Available In some circumstances, accurate recognition of repeated images in an explicit memory test is driven by implicit memory. We propose that this “implicit recognition” results from perceptual fluency that influences responding without awareness of memory retrieval. Here we examined whether recognition would vary if images appeared in the same or different visual hemifield during learning and testing. Kaleidoscope images were briefly presented left or right of fixation during divided-attention encoding. Presentation in the same visual hemifield at test produced higher recognition accuracy than presentation in the opposite visual hemifield, but only for guess responses. These correct guesses likely reflect a contribution from implicit recognition, given that when the stimulated visual hemifield was the same at study and test, recognition accuracy was higher for guess responses than for responses with any level of confidence. The dramatic difference in guessing accuracy as a function of lateralized perceptual overlap between study and test suggests that implicit recognition arises from memory storage in visual cortical networks that mediate repetition-induced fluency increments.
Implicit recognition based on lateralized perceptual fluency.
Vargas, Iliana M; Voss, Joel L; Paller, Ken A
2012-02-06
In some circumstances, accurate recognition of repeated images in an explicit memory test is driven by implicit memory. We propose that this "implicit recognition" results from perceptual fluency that influences responding without awareness of memory retrieval. Here we examined whether recognition would vary if images appeared in the same or different visual hemifield during learning and testing. Kaleidoscope images were briefly presented left or right of fixation during divided-attention encoding. Presentation in the same visual hemifield at test produced higher recognition accuracy than presentation in the opposite visual hemifield, but only for guess responses. These correct guesses likely reflect a contribution from implicit recognition, given that when the stimulated visual hemifield was the same at study and test, recognition accuracy was higher for guess responses than for responses with any level of confidence. The dramatic difference in guessing accuracy as a function of lateralized perceptual overlap between study and test suggests that implicit recognition arises from memory storage in visual cortical networks that mediate repetition-induced fluency increments.
Ahmad, Fahad N; Hockley, William E
2017-09-01
We examined whether processing fluency contributes to associative recognition of unitized pre-experimental associations. In Experiments 1A and 1B, we minimized perceptual fluency by presenting each word of pairs on separate screens at both study and test, yet the compound word (CW) effect (i.e., hit and false-alarm rates greater for CW pairs with no difference in discrimination) did not reduce. In Experiments 2A and 2B, conceptual fluency was examined by comparing transparent (e.g., hand bag) and opaque (e.g., rag time) CW pairs in lexical decision and associative recognition tasks. Lexical decision was faster for transparent CWs (Experiment 2A) but in associative recognition, the CW effect did not differ by CW pair type (Experiment 2B). In Experiments 3A and 3B, we examined whether priming that increases processing fluency would influence the CW effect. In Experiment 3A, CW and non-compound word pairs were preceded with matched and mismatched primes at test in an associative recognition task. In Experiment 3B, only transparent and opaque CW pairs were presented. Results showed that presenting matched versus mismatched primes at test did not influence the CW effect. The CW effect in yes-no associative recognition is due to reliance on enhanced familiarity of unitized CW pairs.
Nie, Jia; Zhang, Wei; Liu, Ying
2017-01-01
The aims of this study were to explore depression, self-esteem and verbal fluency functions among normal internet users, mild internet addictions and severe internet addictions. The survey sample consisted of 316 college students, and their internet addiction symptoms, depression and self-esteem symptoms were assessed using the Revised Chen Internet Addiction Scale (CIAS-R), Zung Self-Rating Depression Scale (ZSDS), Rosenberg Self-Esteem Scale (RSES), respectively. From this sample, 16 students with non-addictions, 19 students with mild internet addiction (sub-MIA) and 15 students with severe internet addiction (sub-SIA) were recruited and subjected to the classical verbal fluency tests, including the semantic and phonemic fluency task. The results indicated that severe internet addiction in the survey sample showed the highest tendency towards depressive symptoms and lowest self-esteem scores, and sub-SIA showed poor performance on the semantic fluency task. In conclusion, severe internet addiction was significantly associated with depression, low self-esteem and semantic verbal fluency problems. Copyright © 2017 Elsevier Inc. All rights reserved.
THE CONTRIBUTION OF COMPLEXITY, ACCURACY AND FLUENCY TO LANGUAGE FOR SPECIFIC PURPOSES
Directory of Open Access Journals (Sweden)
Anthony Rausch
2016-03-01
Full Text Available This paper will outline an instructional approach that proposes a Complexity, Accuracy, Fluency (CAF paradigm as a means of providing learners with the CAF-based communication consciousness and CAF-oriented manipulative skills that are increasingly important in language use in Language for Specific Purposes. Given the complex combinations of communicative tasks, communicative formats and communicative circumstances that accompany the wide-ranging and various contexts of contemporary professional communication, communicative competence demands a combinative consciousness and informed application of Complexity, Accuracy and Fluency as a communication paradigm. Viewed as a combination of its three components, a CAF paradigm constitutes a fundamental ‘information, language and communication’ triad that can guide professional language use in any communicative circumstance. Viewed as a communicative skill set, the CAF triad implies the capability to adjust specific elements and aspects of information, language and communication as needed for a communicative task, whether in oral or print communication and regardless of task category. Adjusting complexity in this context refers to both content and language complexity. Adjusting accuracy refers to the conventions that dictate appropriate or acceptable language in a given context. Finally, adjusting fluency refers to a sense of communicative fluency, that which yields either smooth and persuasive language as in a native-speaker normative view or explicit and clearly explanatory language as necessary in some communicative encounters. The need to manipulate these three components depends on circumstance variables such as objective, available time, audience characteristics and the degree of detail desired. This paper will outline this combinative CAF notion as background to a materials development project being undertaken in a Japanese university, introducing the specifics of an Extended Reading Aloud
Besken, Miri
2016-01-01
The perceptual fluency hypothesis claims that items that are easy to perceive at encoding induce an illusion that they will be easier to remember, despite the finding that perception does not generally affect recall. The current set of studies tested the predictions of the perceptual fluency hypothesis with a picture generation manipulation.…
Panos, Joseph A; Hoffman, Joshua T; Wordeman, Samuel C; Hewett, Timothy E
2016-03-01
Correction of neuromuscular impairments after anterior cruciate ligament injury is vital to successful return to sport. Frontal plane knee control during landing is a common measure of lower-extremity neuromuscular control and asymmetries in neuromuscular control of the knee can predispose injured athletes to additional injury and associated morbidities. Therefore, this study investigated the effects of anterior cruciate ligament injury on knee biomechanics during landing. Two-dimensional frontal plane video of single leg drop, cross over drop, and drop vertical jump dynamic movement trials was analyzed for twenty injured and reconstructed athletes. The position of the knee joint center was tracked in ImageJ software for 500 milliseconds after landing to calculate medio-lateral knee motion velocities and determine normal fluency, the number of times per second knee velocity changed direction. The inverse of this calculation, analytical fluency, was used to associate larger numerical values with fluent movement. Analytical fluency was decreased in involved limbs for single leg drop trials (P=0.0018). Importantly, analytical fluency for single leg drop differed compared to cross over drop trials for involved (Pinjury. Copyright © 2016 Elsevier Ltd. All rights reserved.
Do language fluency and other socioeconomic factors influence the use of PubMed and MedlinePlus?
Sheets, L; Gavino, A; Callaghan, F; Fontelo, P
2013-01-01
Increased usage of MedlinePlus by Spanish-speakers was observed after introduction of MedlinePlus in Spanish. This probably reflects increased usage of MEDLINE and PubMed by those with greater fluency in the language in which it is presented; but this has never been demonstrated in English speakers. Evidence that lack of English fluency deters international healthcare personnel from using PubMed could support the use of multi-language search tools like Babel-MeSH. This study aims to measure the effects of language fluency and other socioeconomic factors on PubMed MEDLINE and MedlinePlus access by international users. We retrospectively reviewed server pageviews of PubMed and MedlinePlus from various periods of time, and analyzed them against country statistics on language fluency, GDP, literacy rate, Internet usage, medical schools, and physicians per capita, to determine whether they were associated. We found fluency in English to be positively associated with pageviews of PubMed and MedlinePlus in countries with high literacy rates. Spanish was generally found to be positively associated with pageviews of MedlinePlus en Español. The other parameters also showed varying degrees of association with pageviews. After adjusting for the other factors investigated in this study, language fluency was a consistently significant predictor of the use of PubMed, MedlinePlus English and MedlinePlus en Español. This study may support the need for multi-language search tools and may increase access of health information resources from non-English speaking countries.
Decker, Martha M; Buggey, Tom
2014-01-01
The authors compared the effects of video self-modeling and video peer modeling on oral reading fluency of elementary students with learning disabilities. A control group was also included to gauge general improvement due to reading instruction and familiarity with researchers. The results indicated that both interventions resulted in improved fluency. Students in both experimental groups improved their reading fluency. Two students in the self-modeling group made substantial and immediate gains beyond any of the other students. Discussion is included that focuses on the importance that positive imagery can have on student performance and the possible applications of both forms of video modeling with students who have had negative experiences in reading.
The Relationship between Reading Fluency and Lexile Measures
Purvis, Joshua Steve
2017-01-01
With increasing emphasis being placed on teachers to show an improvement in student achievement, schools are relying on indicators such as reading fluency and reading comprehension to gauge student progress throughout the year. Since the growth on these assessments are used in calculating teachers and administrators' yearly job evaluations, the…
Directory of Open Access Journals (Sweden)
Ayyoub Malek
2013-08-01
Full Text Available BACKGROUND: The present study aims to design and standardize the verbal fluency test (VFT among bilingual (Turkish-Persian adolescents in Tabriz, Iran. METHODS: In the designing stage, 190 adolescents who were already selected randomly from among the guidance and high school students in Tabriz were classified into three age groups (11-12, 13-15, 16-18. The screening test including 33 Persian letters and three ‘animal’, ‘fruit’, and ‘supermarket stuff’ categories, and SDQ was administered to them. The results were the three letters ‘M’, ‘D’, and ‘B’ for phonological fluency, and two ‘animal’ and ‘supermarket stuff’ categories for semantic fluency in the Persian language. In the standardization stage, the letters and categories specified in the designing stage were administered in the same order to 302 adolescents. Moreover, 28 adolescents diagnosed with ADHD were selected to estimate the discriminant validity of VFT. RESULTS: Pearson correlation coefficient between test-retest of the three letters ‘M’, ‘D’, and ‘B’ for phonological fluency were estimated at 0.67, 0.66, and 0.75, respectively. Furthermore, for the two categories of ‘animal’ and ‘supermarket stuff’ it was estimated to be 0.80 and 0.65, respectively. All these amounts were significant (P < 0.01. The discriminant validity, which was estimated through comparison between the scores of normal and ADHD adolescents, showed that the obtained t value for all indices except for the letter ‘B’ was meaningful. The results of MANOVA between two gender groups were significant at P < 0.05 for three ‘M’, ‘D’, and ‘B’ variables of verbal fluency and ‘animal’ semantic fluency. In both verbal and semantic fluency the mean of subjects’ performance scores showed that females outperformed males. CONCLUSIONS: The findings of the current study indicated that VFT is reliable in the studied sample group, and has a valid psychometric
Effect of low fluencies of near-ultraviolet radiation on Bacteroides fragilis survival
International Nuclear Information System (INIS)
Slade, H.J.K.; Jones, D.T.; Woods, D.R.
1982-01-01
Bacteroides fragilis is a convenient obligate anaerobe for an investigation on the effect of near-UV irradiation since the authors have shown that it can be maintained in aerobic solutions for at least 6 h without loss in viability. Furthermore, they recently demonstrated that B. fragilis differs from other bacteria in that it is more sensitive to far-UV (254 nm) radiation in the presence of oxygen. The role of oxygen on near-UV survival in B. fragilis, was investigated. The effect of chloramphenicol was also studied. Survival curves are presented. B. fragilis Bf-2 cells irradiated with increasing fluencies of near-UV light under anaerobic conditions showed no loss in viability. A 'V'-shaped survival curve was obtained when cells were irradiated aerobically. After the initial reduction in viability with fluencies up to 1.5 kJ/m 2 further irradiation resulted in the recovery of colony-forming ability which was maximal at 2.6 kJ/m 2 and remained at this level up to fluencies of 4 kJ/m 2 . (Auth.)
Messinis, L.; Kosmidis, M. H.; Vlahou, C.; Malegiannaki, A. C.; Gatzounis, G.; Dimisianos, N.; Karra, A.; Kiosseoglou, G.; Gourzis, P.; Papathanasopoulos, P.
2013-01-01
The strategies used to perform a verbal fluency task appear to be reflective of cognitive abilities necessary for successful daily functioning. In the present study, we explored potential differences in verbal fluency strategies (switching and clustering) used to maximize word production by patients with relapsing-remitting multiple sclerosis (RRMS) versus patients with secondary progressive multiple sclerosis (SPMS). We further assessed impairment rates and potential differences in the sensi...
Swanson, H Lee; O'Connor, Rollanda
2009-01-01
The authors investigated whether practice in reading fluency had a causal influence on the relationship between working memory (WM) and text comprehension for 155 students in Grades 2 and 4 who were poor or average readers. Dysfluent readers were randomly assigned to repeated reading or continuous reading practice conditions and compared with untreated dysfluent and fluent readers on posttest measures of fluency, word identification, vocabulary, and reading comprehension. Three main findings emerged: (a) The influence of WM on text comprehension was not related to fluency training, (b) dysfluent readers in the continuous-reading condition had higher posttest scores than dysfluent readers in the other conditions on measures of text comprehension but not on vocabulary, and (c) individual differences in WM better predicted posttest comprehension performance than word-attack skills. In general, the results suggested that although continuous reading increased comprehension, fluency practice did not compensate for WM demands. The results were interpreted within a model that viewed reading comprehension processes as competing for a limited supply of WM resources that operate independent of fluency.
Behavioral fluency: Evolution of a new paradigm
Binder, Carl
1996-01-01
Behavioral fluency is that combination of accuracy plus speed of responding that enables competent individuals to function efficiently and effectively in their natural environments. Evolving from the methodology of free-operant conditioning, the practice of precision teaching set the stage for discoveries about relations between behavior frequency and specific outcomes, notably retention and maintenance of performance, endurance or resistance to distraction, and application or transfer of tra...
ncRNA consensus secondary structure derivation using grammar strings.
Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh
2011-04-01
Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.
Inherent and antigen-induced airway hyperreactivity in NC mice
Directory of Open Access Journals (Sweden)
Tetsuto Kobayashi
1999-01-01
Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.
The Use of Profanity During Letter Fluency Tasks in Frontotemporal Dementia and Alzheimer's Disease
Ringman, John M.; Kwon, Eunice; Flores, Deborah L.; Rotko, Carol; Mendez, Mario F.; Lu, Po
2012-01-01
Objective To assess whether the production of profanity during letter fluency testing distinguishes frontotemporal dementia (FTD) and Alzheimer's disease (AD) patients. Background Alterations in language and social behavior typify FTD spectrum disorders. Nonetheless, in can be difficult to distinguish pathologically-defined frontotemporal lobar degeneration (FTLD) from AD clinically. Assessing verbal fluency by having patients generate as many words as they can beginning with specific letters in a given period of time can yield diverse information of diagnostic utility. Method Words produced during FAS letter fluency testing were reviewed and instances of the use of "f*ck", "*ss", and "sh*t" and other words felt to be inappropriate were sought. The frequency of these words was compared between clinically diagnosed FTD and AD patients using chi-square tests. Results We found that 6/32 (18.8%) patients with FTD generated the word "f*ck" during the "F" trial as opposed to none of 38 patients with AD (p = 0.007). Patients who said "f*ck" had diagnoses of either behavioral variant FTD (3/15), progressive non-fluent aphasia (2/8), or semantic dementia (1/3). Conclusions Though the specific neuropathology in these cases is uncertain, generation of "f*ck" during letter fluency testing appears to have utility in differentiating FTD from AD. PMID:20829665
Stocker, James D., Jr.; Kubina, Richard M., Jr.
2017-01-01
Fluency, a combination of response accuracy and speed, enables students to work efficiently through academic tasks. Students with disabilities and math deficits often struggle to learn math facts fluently. Although issues with fluency frequently coexist with a disability, problems gaining fluency also stem from a lack of practice and appropriate…
Stavroussi, Panayiota; Andreou, Georgia; Karagiannopoulou, Dimitra
2016-01-01
The purpose of this study was to examine verbal fluency and verbal short-term memory in 12 adults with Down syndrome (DS) and 12 adults with Intellectual Disability (ID) of unspecified origin, matched for receptive vocabulary and chronological age. Participants' performance was assessed on two conditions of a verbal fluency test, namely, semantic…
McGee, Daniel; Moore-Russo, Deborah
2015-01-01
A test project at the University of Puerto Rico in Mayagüez used GeoGebra applets to promote the concept of multirepresentational fluency among high school mathematics preservice teachers. For this study, this fluency was defined as simultaneous awareness of all representations associated with a mathematical concept, as measured by the ability to…
Improving Earth Science Metadata: Modernizing ncISO
O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.
2016-12-01
ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's data.noaa.gov CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.
Explorations of the extended ncKP hierarchy
International Nuclear Information System (INIS)
Dimakis, Aristophanes; Mueller-Hoissen, Folkert
2004-01-01
A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities
Remediation of fluency: Word specific or generalised training effects?
Berends, I.E.; Reitsma, P.
2006-01-01
The present study examines whether reading fluency benefits more from repeated reading of a limited set of words or from practicing reading with many different words. A group of 37 reading delayed Dutch children repeatedly read the same 20 words with limited exposure duration, whereas another group
Influences of early English language teaching on oral fluency
de Wolf, Stephana; Smit, Nienke; Lowie, Wander
2017-01-01
Elementary-level foreign language education is currently receiving a lot of attention in the literature on second language learning, and has emerged as an important educational policy issue. The present study aims to contribute to this discussion by focusing on the fluency benefits gained from early
Coping with stress in adults with speech fluency disorders
Directory of Open Access Journals (Sweden)
Magdalena Pietraszek
2016-12-01
Full Text Available Background Stuttering is a developmental speech disorder that affects the fluency of speech. Persons who stutter perceive speaking situations and social interactions as threatening. Participants and procedure Nineteen (47.50% adults with speech fluency disorders (SFD and 21 (52.50% without participated in the study. All participants completed the following measures individually: the State-Trait Anxiety Inventory, the Coping Inventory for Stressful Situations (CISS, and an informational survey. Results Our study confirmed that persons with SFD experience more stressful situations in life and feel greater anxiety, both as a trait and as a state, which influences their daily life. The negative affect experienced contributed to their preferred use of Emotion-Oriented Coping strategies, at the expense of more proactive Task-Oriented Coping. Experienced stress and anxiety influenced and consolidated their habitual stress coping styles, devoted mainly to dealing with negative emotions. Conclusions Stuttering affects daily activities, interpersonal relationships, and the quality of life. Therefore, professional support should include adaptive, task-oriented coping.
Piselli, Katherine D.
2017-01-01
Math fluency, which refers to the ability to solve single digit arithmetic problems quickly and accurately, is a foundational mathematical skill. Recent research has examined the role of phonological processing, executive control, and number sense in explaining differences in math fluency performance in school-aged children. Identifying the links…
Verbal fluency in children with intellectual disability: Influence of basic executive components
Directory of Open Access Journals (Sweden)
Gligorović Milica
2014-01-01
Full Text Available Phonemic and semantic fluency tasks are frequently used to differentiate executive control roles and the integrity of lexical-semantic representation. The main goal of this study is to determine the influence of basic executive components on phonemic and semantic productivity in children with mild intellectual disability. The sample consisted of 95 children with unspecified mild intellectual disability (MID, ages 10-13.11. Phonemic fluency was assessed by the Controlled Oral Word Association Test (COWAT, while semantic fluency was assessed by the Category Naming Test (CNT. Cognitive flexibility was assessed by Wisconsin Card Sorting Test (WCST and Trail Making Test (TMT. Number Manipulation Task (NMT was used for the verbal working memory assessment, while Day/Night Stroop Task was used for the assessment of inhibitory control. The results analysis showed that all of the assessed EF components significantly affect phonemic productivity. Semantic productivity significantly depends on WCST and TMT performance. Verbal working memory and inhibitory control do not significantly contribute to semantic productivity. The results of our study indicate that the discrepancy between phonemic and semantic productivity in children with MID could be directly associated with the basic executive functions components.
Connected text reading and differences in text reading fluency in adult readers.
Directory of Open Access Journals (Sweden)
Sebastian Wallot
Full Text Available The process of connected text reading has received very little attention in contemporary cognitive psychology. This lack of attention is in parts due to a research tradition that emphasizes the role of basic lexical constituents, which can be studied in isolated words or sentences. However, this lack of attention is in parts also due to the lack of statistical analysis techniques, which accommodate interdependent time series. In this study, we investigate text reading performance with traditional and nonlinear analysis techniques and show how outcomes from multiple analyses can used to create a more detailed picture of the process of text reading. Specifically, we investigate reading performance of groups of literate adult readers that differ in reading fluency during a self-paced text reading task. Our results indicate that classical metrics of reading (such as word frequency do not capture text reading very well, and that classical measures of reading fluency (such as average reading time distinguish relatively poorly between participant groups. Nonlinear analyses of distribution tails and reading time fluctuations provide more fine-grained information about the reading process and reading fluency.
ADHD and adolescent EFL learners’ speaking complexity, accuracy, and fluency in English
Directory of Open Access Journals (Sweden)
Hamid Marashi
2016-07-01
Full Text Available This study was an attempt to investigate the relationships among Attention-Deficit/ Hyperactivity Disorder (ADHD and speaking complexity, accuracy, and fluency (CAF among Iranian EFL learners. To fulfill the purpose of this study, the teachers and parents of 593 male students were given the Farsi version of the CSI-4 ADHD diagnostic questionnaire, out of which 61 students scored above the cut-off score of nine in both the teacher and parent questionnaires. These students then sat for a sample speaking section of the Key English Test (KET; the interviews were scored by two raters according to the measures of CAF. The data were thus analyzed and the results revealed a significant positive correlation between ADHD and speaking fluency; in contrast, a significant negative correlation was observed between ADHD and speaking complexity and ADHD and speaking accuracy. The regressions disclosed that ADHD is a significant predictor of complexity, accuracy, and fluency in speaking. The findings of this study have pedagogical implications for both parents and teachers in contact with students with ADHD with respect to the importance of identifying such students and thus planning and monitoring their progress.
Prosody as a Tool for Assessing Reading Fluency of Adult ESL Students
Directory of Open Access Journals (Sweden)
Seftirina Evina Sinambela
2017-12-01
Full Text Available The prosodic features in reading aloud assignment has been associated with the students’ decoding skill. The goal of the present study is to determine the reliability of prosody for assessing reading fluency of adult ESL students in Indonesia context. The participants were all Indonesian natives, undergraduate students, adult females and males who have learned English in school (at the very least twice a week for more than 12 years. Text reading prosody was assessed by reading aloud task and the students’ speaking manner was taped and measured by using the Multidimensional Fluency Scale, as for text comprehension was assessed with a standardized test. It was discovered by the current study that prosody is a reliable sign to determine reading fluency and also reading comprehension. The student who did not read the text prosodically (with appropriate expression actually showed that he/she failed to comprehend the text. This study also revealed that a struggling reader was also having low comprehension capacity in listening spoken texts. The ESL students’ common problems to acquire prosodic reading skill are low exposure to the target language and do not have a good model to imitate prosodic reading.
How Reading Volume Affects both Reading Fluency and Reading Achievement
Directory of Open Access Journals (Sweden)
Richard L. ALLINGTON
2014-10-01
Full Text Available Long overlooked, reading volume is actually central to the development of reading proficiencies, especially in the development of fluent reading proficiency. Generally no one in schools monitors the actual volume of reading that children engage in. We know that the commonly used commercial core reading programs provide only material that requires about 15 minutes of reading activity daily. The remaining 75 minute of reading lessons is filled with many other activities such as completing workbook pages or responding to low-level literal questions about what has been read. Studies designed to enhance the volume of reading that children do during their reading lessons demonstrate one way to enhance reading development. Repeated readings have been widely used in fostering reading fluency but wide reading options seem to work faster and more broadly in developing reading proficiencies, including oral reading fluency.
Implicit Recognition Based on Lateralized Perceptual Fluency
Vargas, Iliana M.; Voss, Joel L.; Paller, Ken A.
2012-01-01
In some circumstances, accurate recognition of repeated images in an explicit memory test is driven by implicit memory. We propose that this “implicit recognition” results from perceptual fluency that influences responding without awareness of memory retrieval. Here we examined whether recognition would vary if images appeared in the same or different visual hemifield during learning and testing. Kaleidoscope images were briefly presented left or right of fixation during divided-attention enc...
The Role of Reading Fluency in Children's Text Comprehension.
Álvarez-Cañizo, Marta; Suárez-Coalla, Paz; Cuetos, Fernando
2015-01-01
Understanding a written text requires some higher cognitive abilities that not all children have. Some children have these abilities, since they understand oral texts; however, they have difficulties with written texts, probably due to problems in reading fluency. The aim of this study was to determine which aspects of reading fluency are related to reading comprehension. Four expositive texts, two written and two read by the evaluator, were presented to a sample of 103 primary school children (third and sixth grade). Each text was followed by four comprehension questions. From this sample we selected two groups of participants in each grade, 10 with good results in comprehension of oral and written texts, and 10 with good results in oral and poor in written comprehension. These 40 subjects were asked to read aloud a new text while they were recorded. Using Praat software some prosodic parameters were measured, such as pausing and reading rate (number and duration of the pauses and utterances), pitch and intensity changes and duration in declarative, exclamatory, and interrogative sentences and also errors and duration in words by frequency and stress. We compared the results of both groups with ANOVAs. The results showed that children with less reading comprehension made more inappropriate pauses and also intersentential pauses before comma than the other group and made more mistakes in content words; significant differences were also found in the final declination of pitch in declarative sentences and in the F0 range in interrogative ones. These results confirm that reading comprehension problems in children are related to a lack in the development of a good reading fluency.
Subjective memory complaints and their relation with verbal fluency in active older people.
Bernardes, Flavia Rodrigues; Machado, Camila Kretzer; Souza, Monique Coan; Machado, Marcos José; Belaunde, Aline Megumi Arakawa
2017-05-22
To verify subjective memory complaints and their relation to verbal fluency in older people participating in community groups. An epidemiological quantitative study performed in community groups for older people in Florianópolis, state of Santa Catarina, Brazil. Data were collected by structured interview using the Memory Complaint Questionnaire (MAC-Q) and the Verbal Fluency Test (VFT) by semantic categories "animals/minute". For an inferential descriptive analysis, data with p people in question and added to the questionnaire). We found no relation between subjective memory complaints and verbal fluency of active older people. Mnemonic complaints were correlated to the negative perception of memory and to the duration of the complaint. However, subjective memory complaints were an indicator for those individuals with negative perception of memory, being one aspect that must be considered in older people's speech when investigating a possible cognitive deterioration. Such data can assist in formulating public health care policies aimed at older people in the city, which emphasizes the importance of verifying subjective memory complaints in this population.
Hilbig, Benjamin E.; Erdfelder, Edgar; Pohl, Rudiger F.
2011-01-01
A new process model of the interplay between memory and judgment processes was recently suggested, assuming that retrieval fluency--that is, the speed with which objects are recognized--will determine inferences concerning such objects in a single-cue fashion. This aspect of the fluency heuristic, an extension of the recognition heuristic, has…
Behavioural and neural evidence for the impact of fluency context on conscious memory.
Gomes, Carlos Alexandre; Mecklinger, Axel; Zimmer, Hubert
2017-07-01
It has been recently suggested that fluency may impact recognition memory performance when the fluency context varies from trial-to-trial. Surprisingly, such an effect has proved difficult to detect in the masked priming paradigm, one of the most popular means to increase fluency-based memory judgements. We conducted a functional magnetic resonance imaging (fMRI) experiment in which participants encoded words at study and, at test, performed a recognition memory task within a masked priming procedure. In order to optimise the chances of finding priming effects on recognition memory performance, we used low-frequency words, which have been shown to increase hits relative to false alarms and enhance masked priming effects. Fluency context was manipulated by either mixing primed and unprimed trials [Random context (RC) experiment] or blocking primed and unprimed trials [Blocked context (BC) experiment]. Behaviourally, priming affected high-confidence memory performance only in the RC experiment. This behavioural effect correlated positively with neural priming in several recognition memory regions. Moreover, we observed a functional coupling between the left middle temporal gyrus and the left parietal and posterior cingulate cortices that was greater for primed relative to unprimed words. In contrast, in the BC experiment, despite similar activity in recognition-memory-related regions, we did not find any significant correlations between neural and behavioural priming. Finally, we observed striking differences in the neural correlates of masked priming between the RC and BC experiments not only in location but also in direction of the neural response. Possible implications of these findings are discussed. Copyright © 2017 Elsevier Ltd. All rights reserved.
Lexical Access in Persian Normal Speakers: Picture Naming, Verbal Fluency and Spontaneous Speech
Directory of Open Access Journals (Sweden)
Zahra Sadat Ghoreishi
2014-06-01
Full Text Available Objectives: Lexical access is the process by which the basic conceptual, syntactical and morpho-phonological information of words are activated. Most studies of lexical access have focused on picture naming. There is hardly any previous research on other parameters of lexical access such as verbal fluency and analysis of connected speech in Persian normal participants. This study investigates the lexical access performance in normal speakers in different issues such as age, sex and education. Methods: The performance of 120 adult Persian speakers in three tasks including picture naming, verbal fluency and connected speech, was examined using "Persian Lexical Access Assessment Package”. The performance of participants between two gender groups (male/female, three education groups (below 5 years, above 12 years, between 5 and 12 years and three age groups (18-35 years, 36-55 years, 56-75 years were compared. Results: According to findings, picture naming increased with increasing education and decreased with increasing age. The performance of participants in phonological and semantic verbal fluency showed improvement with age and education. No significant difference was seen between males and females in verbal fluency task. In the analysis of connected speech there were no significant differences between different age and education groups and just mean length of utterance in males was significantly higher than females. Discussion: The findings could be a primitive scale for comparison between normal subjects and patients in lexical access tasks, furthermore it could be a horizon for planning of treatment goals in patients with word finding problem according to age, gender and education.
Directory of Open Access Journals (Sweden)
Olivia Geisseler
2016-01-01
Full Text Available Cognitive impairment is as an important feature of Multiple Sclerosis (MS, and might be even more relevant to patients than mobility restrictions. Compared to the multitude of studies investigating memory deficits or basic cognitive slowing, executive dysfunction is a rarely studied cognitive domain in MS, and its neural correlates remain largely unexplored. Even rarer are topological studies on specific cognitive functions in MS. Here we used several structural MRI parameters – including cortical thinning and T2 lesion load – to investigate neural correlates of executive dysfunction, both on a global and a regional level by means of voxel- and vertex-wise analyses. Forty-eight patients with relapsing-remitting MS and 48 healthy controls participated in the study. Five executive functions were assessed, i.e. verbal and figural fluency, working memory, interference control and set shifting. Patients scored lower than controls in verbal and figural fluency only, and displayed widespread cortical thinning. On a global level, cortical thickness independently predicted verbal fluency performance, when controlling for lesion volume and central brain atrophy estimates. On a regional level, cortical thinning in the anterior cingulate region correlated with deficits in verbal and figural fluency and did so in a lateralised manner: Left-sided thinning was related to reduced verbal – but not figural – fluency, whereas the opposite pattern was observed for right-sided thinning. We conclude that executive dysfunction in MS patients can specifically affect verbal and figural fluency. The observed lateralised clinico-anatomical correlation has previously been described in brain-damaged patients with large focal lesions only, for example after stroke. Based on focal grey matter atrophy, we here show for the first time comparable lateralised findings in a white matter disease with widespread pathology.
Jacks, Adam; Haley, Katarina L.
2015-01-01
Purpose: To study the effects of masked auditory feedback (MAF) on speech fluency in adults with aphasia and/or apraxia of speech (APH/AOS). We hypothesized that adults with AOS would increase speech fluency when speaking with noise. Altered auditory feedback (AAF; i.e., delayed/frequency-shifted feedback) was included as a control condition not…
Li, Liping; Wu, Xinchun
2015-01-01
Purpose This study examined the contribution of metalinguistic awareness including morphological awareness, phonological awareness and orthographical awareness to reading comprehension, and the role of reading fluency as a mediator of the effects of metalinguistic awareness on reading comprehension from grades 2 to 4. Methods Four hundred and fifteen elementary students in China mainland were administered a test battery that included measures of morphological awareness, phonological awareness, orthographical awareness, reading fluency, reading comprehension and IQ. Hierarchical regression and structural equation models (SEM) were used to analyze the data. Results Morphological awareness uniquely explained 9%, 10% and 13% variance of reading comprehension respectively from grade 2 to grade 4, however, phonological awareness and orthographical awareness did not contribute to reading comprehension; Reading fluency partially mediated the effect of morphological awareness on reading comprehension in grades 2-4. Conclusions These findings indicated that reading fluency and morphological awareness should be facilitated in the Chinese instruction. Morphological awareness played an important role in Chinese reading and affected reading comprehension in grades 2 to 4; Reading fluency was a significant link between morphological awareness and reading comprehension in grades 2-4. PMID:25799530
Li, Bingbing; Taylor, Jason R; Wang, Wei; Gao, Chuanji; Guo, Chunyan
2017-08-01
Processing fluency appears to influence recognition memory judgements, and the manipulation of fluency, if misattributed to an effect of prior exposure, can result in illusory memory. Although it is well established that fluency induced by masked repetition priming leads to increased familiarity, manipulations of conceptual fluency have produced conflicting results, variously affecting familiarity or recollection. Some recent studies have found that masked conceptual priming increases correct recollection (Taylor & Henson, 2012), and the magnitude of this behavioural effect correlates with analogous fMRI BOLD priming effects in brain regions associated with recollection (Taylor, Buratto, & Henson, 2013). However, the neural correlates and time-courses of masked repetition and conceptual priming were not compared directly in previous studies. The present study used event-related potentials (ERPs) to identify and compare the electrophysiological correlates of masked repetition and conceptual priming and investigate how they contribute to recognition memory. Behavioural results were consistent with previous studies: Repetition primes increased familiarity, whereas conceptual primes increased correct recollection. Masked repetition and conceptual priming also decreased the latency of late parietal component (LPC). Masked repetition priming was associated with an early P200 effect and a later parietal maximum N400 effect, whereas masked conceptual priming was only associated with a central-parietal maximum N400 effect. In addition, the topographic distributions of the N400 repetition priming and conceptual priming effects were different. These results suggest that fluency at different levels of processing is associated with different ERP components, and contributes differentially to subjective recognition memory experiences. Copyright © 2017 Elsevier Inc. All rights reserved.
Influences of Early English Language Teaching on Oral Fluency
de Wolf, Stephana; Smit, Nienke; Lowie, Wander
2017-01-01
Elementary-level foreign language education is currently receiving a lot of attention in the literature on second language learning, and has emerged as an important educational policy issue. The present study aims to contribute to this discussion by focusing on the fluency benefits gained from early foreign language teaching. The participants were…
Using an iPad® App to Improve Sight Word Reading Fluency for At-Risk First Graders
Musti-Rao, Shobana; Lo, Ya-yu; Plati, Erin
2015-01-01
We used a multiple baseline across word lists design nested within a multiple baseline across participants design to examine the effects of instruction delivered using an iPad® app on sight word fluency and oral reading fluency of six first graders identified as at risk for reading failure. In Study 1, three students participated in…
Undorf, Monika; Zimdahl, Malte F
2018-04-26
Words printed in a larger 48-point font are judged to be more memorable than words printed in a smaller 18-point font, although font size does not affect actual memory. To clarify the basis of this font size effect on metamemory and memory, 4 experiments investigated how presenting words in 48 (Experiment 1) or 4 (Experiments 2 to 4) font sizes between 6 point and 500 point affected judgments of learning (JOLs) and recall performance. Response times in lexical decision tasks were used to measure perceptual fluency. In all experiments, perceptual fluency was lower for words presented in very small and very large font sizes than for words presented in intermediate font sizes. In contrast, JOLs increased monotonically with font size, even beyond the point where a large font impaired perceptual fluency. Assessments of people's metacognitive beliefs about font size revealed that the monotonic increase in JOLs was not due to beliefs masking perceptual fluency effects (Experiment 3). Also, JOLs still increased across the whole range of font sizes when perceptual fluency was made salient at study (Experiment 4). In all experiments but Experiment 4, recall performance increased with increasing font size, although to a lesser extent than JOLs. Overall, the current study supports the idea that metacognitive beliefs underlie font size effects in metamemory. As important, it reveals that people's font size beliefs have some accuracy. (PsycINFO Database Record (c) 2018 APA, all rights reserved).
An overview on STEP-NC compliant controller development
Othman, M. A.; Minhat, M.; Jamaludin, Z.
2017-10-01
The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.
78 FR 72009 - Establishment of Class E Airspace; Star, NC
2013-12-02
...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...
Two Mechanisms of Constructive Recollection: Perceptual Recombination and Conceptual Fluency
Doss, Manoj K.; Bluestone, Maximilian R.; Gallo, David A.
2016-01-01
Recollection is constructive and prone to distortion, but the mechanisms through which recollections can become embellished with rich yet illusory details are still debated. According to the conceptual fluency hypothesis, abstract semantic or conceptual activation increases the familiarity of a nonstudied event, causing one to falsely attribute…
Investigating Patterns of Errors for Specific Comprehension and Fluency Difficulties
Koriakin, Taylor A.; Kaufman, Alan S.
2017-01-01
Although word reading has traditionally been viewed as a foundational skill for development of reading fluency and comprehension, some children demonstrate "specific" reading comprehension problems, in the context of intact word reading. The purpose of this study was to identify specific patterns of errors associated with reading…
Maintaining students’ Speaking Fluency through Exhibition Examination in Sociolinguistic Studies
Directory of Open Access Journals (Sweden)
Khusnul Qhotimah Yuliatuty
2013-07-01
Full Text Available Using exhibition for the final project in Sociolinguistic study is really interesting for Universitas Siswa Bangsa Internasional students, especially for 2011 English Department students. Exhibition becomes interesting because this is the new thing to conduct the final project for English Department students’ cohort 2011 at Universitas Siswa Bangsa Internasional. The lecturer divides the students into pairs and each pairs should master one content or topic in Sociolinguistic study. The students will do the exhibition about the topic that they get in a pairs. The lecturer also gives the students rubric sheet to fill by the visitors. The exhibition will make the students prepare themselves well because they will face many questions about the content which will be delivered by them. Beside, this exhibition also maintains students’ fluency in speaking English because they will explain and answer the questions from visitors with English. This paper tries to focus on how exhibition examination can maintain students’ fluency in speaking English.
78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC
2013-04-24
... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...
Software module for geometric product modeling and NC tool path generation
International Nuclear Information System (INIS)
Sidorenko, Sofija; Dukovski, Vladimir
2003-01-01
The intelligent CAD/CAM system named VIRTUAL MANUFACTURE is created. It is consisted of four intelligent software modules: the module for virtual NC machine creation, the module for geometric product modeling and automatic NC path generation, the module for virtual NC machining and the module for virtual product evaluation. In this paper the second intelligent software module is presented. This module enables feature-based product modeling carried out via automatic saving of the designed product geometric features as knowledge data. The knowledge data are afterwards applied for automatic NC program generation for the designed product NC machining. (Author)
Teachers Engaging Parents as Tutors to Improve Oral Reading Fluency
Kupzyk, Sara S.
2012-01-01
This dissertation examined the application of evidence-based tutoring for oral reading fluency (ORF) to a natural setting, using teachers as parent trainers. Measures used to determine the impact of parent tutoring included treatment integrity, student reading outcomes, attitudes towards involvement and reading, and social validity. Six teachers…
Scrutinizing the Factors Affecting Fluency of English among Arab Learners
Al Ghazali, Fawzi
2017-01-01
This research study investigates the cognitive, psychological and personal factors affecting the accuracy and fluency of English language usage among Arab learners. Early research led by Chomsky (1965) and Krashen (1981) suggested that an individual's Language Acquisition Device once triggered at the appropriate time and supported with adequate…
Smirni, Daniela; Turriziani, Patrizia; Mangano, Giuseppa Renata; Bracco, Martina; Oliveri, Massimiliano; Cipolotti, Lisa
2017-07-28
A growing body of evidence have suggested that non-invasive brain stimulation techniques, such as transcranial magnetic stimulation (TMS) and transcranial direct current stimulation (tDCS), can improve the performance of aphasic patients in language tasks. For example, application of inhibitory rTMS or tDCs over the right frontal lobe of dysphasic patients resulted in improved naming abilities. Several studies have also reported that in healthy controls (HC) tDCS application over the left prefrontal cortex (PFC) improve performance in naming and semantic fluency tasks. The aim of this study was to investigate in HC, for the first time, the effects of inhibitory repetitive TMS (rTMS) over left and right lateral frontal cortex (BA 47) on two phonemic fluency tasks (FAS or FPL). 44 right-handed HCs were administered rTMS or sham over the left or right lateral frontal cortex in two separate testing sessions, with a 24h interval, followed by the two phonemic fluency tasks. To account for possible practice effects, an additional 22 HCs were tested on only the phonemic fluency task across two sessions with no stimulation. We found that rTMS-inhibition over the left lateral frontal cortex significantly worsened phonemic fluency performance when compared to sham. In contrast, rTMS-inhibition over the right lateral frontal cortex significantly improved phonemic fluency performance when compared to sham. These results were not accounted for practice effects. We speculated that rTMS over the right lateral frontal cortex may induce plastic neural changes to the left lateral frontal cortex by suppressing interhemispheric inhibitory interactions. This resulted in an increased excitability (disinhibition) of the contralateral unstimulated left lateral frontal cortex, consequently enhancing phonemic fluency performance. Conversely, application of rTMS over the left lateral frontal cortex may induce a temporary, virtual lesion, with effects similar to those reported in left frontal
The role of reading fluency in children’s text comprehension
Directory of Open Access Journals (Sweden)
Marta eÁlvarez-Cañizo
2015-11-01
Full Text Available Understanding a written text requires some higher cognitive abilities that not all children have. Some children have these abilities, since they understand oral texts; however they have difficulties with written texts, probably due to problems in reading fluency. The aim of this study was to determine which aspects of reading fluency are related to reading comprehension. Four expositive texts, two written and two read by the evaluator, were presented to a sample of 103 primary school children (third and sixth grade. Each text was followed by four comprehension questions. From this sample we selected two groups of participants in each grade, 10 with good results in comprehension of oral and written texts, and 10 with good results in oral and poor in written comprehension. These 40 subjects were asked to read aloud a new text while they were recorded. Using Praat software some prosodic parameters were measured, such as pausing and reading rate (number and duration of the pauses and utterances, pitch and intensity changes and duration in declarative, exclamatory and interrogative sentences and also errors and duration in words by frequency and stress. We compared the results of both groups with ANOVAs. The results showed that children with less reading comprehension made more inappropriate pauses and also intersentential pauses before comma than the other group and made more mistakes in content words; significant differences were also found in the final declination of pitch in declarative sentences and in the F0 range in interrogative ones. These results confirm that reading comprehension problems in children are related to a lack in the development of a good reading fluency.
The role of auditory temporal cues in the fluency of stuttering adults
Directory of Open Access Journals (Sweden)
Juliana Furini
Full Text Available ABSTRACT Purpose: to compare the frequency of disfluencies and speech rate in spontaneous speech and reading in adults with and without stuttering in non-altered and delayed auditory feedback (NAF, DAF. Methods: participants were 30 adults: 15 with Stuttering (Research Group - RG, and 15 without stuttering (Control Group - CG. The procedures were: audiological assessment and speech fluency evaluation in two listening conditions, normal and delayed auditory feedback (100 milliseconds delayed by Fono Tools software. Results: the DAF caused a significant improvement in the fluency of spontaneous speech in RG when compared to speech under NAF. The effect of DAF was different in CG, because it increased the common disfluencies and the total of disfluencies in spontaneous speech and reading, besides showing an increase in the frequency of stuttering-like disfluencies in reading. The intergroup analysis showed significant differences in the two speech tasks for the two listening conditions in the frequency of stuttering-like disfluencies and in the total of disfluencies, and in the flows of syllable and word-per-minute in the NAF. Conclusion: the results demonstrated that delayed auditory feedback promoted fluency in spontaneous speech of adults who stutter, without interfering in the speech rate. In non-stuttering adults an increase occurred in the number of common disfluencies and total of disfluencies as well as reduction of speech rate in spontaneous speech and reading.
Effect of Music-Integrated Instruction on First Graders' Reading Fluency
Bryant, Kerry G.
2012-01-01
The study examined music-integrated (MI) instruction, framed by automatic information processing theory and elements of prosody. A quasi-experimental, pre- and posttest design was utilized to ascertain the effect of MI instruction on reading fluency among first grade students. Subjects were students in two public elementary schools in Georgia. To…
Specificity and overlap in skills underpinning reading and arithmetical fluency
van Daal, V.; van der Leij, A.; Adèr, H.
2013-01-01
The aim of this study was to examine unique and common causes of problems in reading and arithmetic fluency. 13- to 14-year-old students were placed into one of five groups: reading disabled (RD, n = 16), arithmetic disabled (AD, n = 34), reading and arithmetic disabled (RAD, n = 17), reading,
Reading Fluency Instruction for Students at Risk for Reading Failure
Ring, Jeremiah J.; Barefoot, Lexie C.; Avrit, Karen J.; Brown, Sasha A.; Black, Jeffrey L.
2013-01-01
The important role of reading fluency in the comprehension and motivation of readers is well documented. Two reading rate intervention programs were compared in a cluster-randomized clinical trial of students who were considered at-risk for reading failure. One program focused instruction at the word level; the second program focused instruction…
Oral Reading Fluency Testing: Pitfalls for Children with Speech Disorders
Howland, Karole; Scaler Scott, Kathleen
2016-01-01
As school districts nationwide have moved toward data driven intervention, oral reading fluency measures have become a prevalent means to monitor progress by assessing the degree to which a child is becoming a fast (and therefore fluent) reader. This article reviews results of a survey of speech-language pathologists (SLPs) working with children…
Development of STEP-NC Adaptor for Advanced Web Manufacturing System
Ajay Konapala, Mr.; Koona, Ramji, Dr.
2017-08-01
Information systems play a key role in the modern era of Information Technology. Rapid developments in IT & global competition calls for many changes in basic CAD/CAM/CAPP/CNC manufacturing chain of operations. ‘STEP-NC’ an enhancement to STEP for operating CNC machines, creating new opportunities for collaborative, concurrent, adaptive works across the manufacturing chain of operations. Schemas and data models defined by ISO14649 in liaison with ISO10303 standards made STEP-NC file rich with feature based, rather than mere point to point information of G/M Code format. But one needs to have a suitable information system to understand and modify these files. Various STEP-NC information systems are reviewed to understand the suitability of STEP-NC for web manufacturing. Present work also deals with the development of an adaptor which imports STEP-NC file, organizes its information, allowing modifications to entity values and finally generates a new STEP-NC file to export. The system is designed and developed to work on web to avail additional benefits through the web and also to be part of a proposed ‘Web based STEP-NC manufacturing platform’ which is under development and explained as future scope.
The impact of pushed output on accuracy and fluency of Iranian EFL learners’ speaking
Directory of Open Access Journals (Sweden)
Aram Reza Sadeghi Beniss
2014-07-01
Full Text Available The current study attempted to establish baseline quantitative data on the impacts of pushed output on two components of speaking (i.e., accuracy and fluency. To achieve this purpose, 30 female EFL learners were selected from a whole population pool of 50 based on the standard test of IELTS interview and were randomly assigned into an experimental group and a control group. The participants in the experimental group received pushed output treatment while the students in the control group received non-pushed output instruction. The data were collected through IELTS interview and then the interview of each participant was separately tape-recorded and later transcribed and coded to measure accuracy and fluency. Then, the independent samples t-test was employed to analyze the collected data. The results revealed that the experimental group outperformed the control group in accuracy. In contrast, findings substantiated that pushed output had no impact on fluency. The positive impact of pushed output demonstrated in this study is consistent with the hypothesized function of Swain’s (1985 pushed output. The results can provide some useful insights into syllabus design and English language teaching.
Directory of Open Access Journals (Sweden)
Mara Breen
2016-07-01
Full Text Available Researchers have established a relationship between beginning readers’ silent comprehension ability and their prosodic fluency, such that readers who read aloud with appropriate prosody tend to have higher scores on silent reading comprehension assessments. The current study was designed to investigate this relationship in two groups of high school readers: Specifically Poor Comprehenders (SPCs, who have adequate word level and phonological skills but poor reading comprehension ability, and a group of age- and decoding skill-matched controls. We compared the prosodic fluency of the two groups by determining how effectively they produced prosodic cues to syntactic and semantic structure in imitations of a model speaker’s production of syntactically and semantically varied sentences. Analyses of pitch and duration patterns revealed that speakers in both groups produced the expected prosodic patterns; however, controls provided stronger durational cues to syntactic structure. These results demonstrate that the relationship between prosodic fluency and reading comprehension continues past the stage of early reading instruction. Moreover, they suggest that prosodically fluent speakers may also generate more fluent implicit prosodic representations during silent reading, leading to more effective comprehension.
Inherent and antigen-induced airway hyperreactivity in NC mice
Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa
1999-01-01
In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...
Graf, Laura K M; Landwehr, Jan R
2015-11-01
In this article, we develop an account of how aesthetic preferences can be formed as a result of two hierarchical, fluency-based processes. Our model suggests that processing performed immediately upon encountering an aesthetic object is stimulus driven, and aesthetic preferences that accrue from this processing reflect aesthetic evaluations of pleasure or displeasure. When sufficient processing motivation is provided by a perceiver's need for cognitive enrichment and/or the stimulus' processing affordance, elaborate perceiver-driven processing can emerge, which gives rise to fluency-based aesthetic evaluations of interest, boredom, or confusion. Because the positive outcomes in our model are pleasure and interest, we call it the Pleasure-Interest Model of Aesthetic Liking (PIA Model). Theoretically, this model integrates a dual-process perspective and ideas from lay epistemology into processing fluency theory, and it provides a parsimonious framework to embed and unite a wealth of aesthetic phenomena, including contradictory preference patterns for easy versus difficult-to-process aesthetic stimuli. © 2015 by the Society for Personality and Social Psychology, Inc.
Boosting Reading Fluency: An Intervention Case Study at Subword Level
Kairaluoma, Leila; Ahonen, Timo; Aro, Mikko; Holopainen, Leena
2007-01-01
This study is an intervention case study of fluency in Finnish-speaking children with dyslexia. Two 7-year-old children, a girl and a boy, were selected from the Jyvaskyla Longitudinal Study of Dyslexia. The intervention emphasised syllables as reading units, and proceeded from reading syllables to reading words and text. Letter knowledge, reading…
Specificity and Overlap in Skills Underpinning Reading and Arithmetical Fluency
van Daal, Victor; van der Leij, Aryan; Ader, Herman
2013-01-01
The aim of this study was to examine unique and common causes of problems in reading and arithmetic fluency. 13- to 14-year-old students were placed into one of five groups: reading disabled (RD, n = 16), arithmetic disabled (AD, n = 34), reading and arithmetic disabled (RAD, n = 17), reading, arithmetic, and listening comprehension disabled…
On pseudorandom generators in NC0
DEFF Research Database (Denmark)
Cryan, Mary; Miltersen, Peter Bro
2001-01-01
In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...
78 FR 54413 - Proposed Establishment of Class E Airspace; Star, NC
2013-09-04
...-0440; Airspace Docket No. 13-ASO-10] Proposed Establishment of Class E Airspace; Star, NC AGENCY... action proposes to establish Class E Airspace at Star, NC, to accommodate a new Area Navigation (RNAV... establish Class E airspace at Star, NC, providing the controlled airspace required to support the new RNAV...
Amunts, Katrin; Weiss, Peter H; Mohlberg, Hartmut; Pieperhoff, Peter; Eickhoff, Simon; Gurd, Jennifer M; Marshall, John C; Shah, Nadim J; Fink, Gereon R; Zilles, Karl
2004-05-01
We investigated neural activations underlying a verbal fluency task and cytoarchitectonic probabilistic maps of Broca's speech region (Brodmann's areas 44 and 45). To do so, we reanalyzed data from a previous functional magnetic resonance imaging (fMRI) [Brain 125 (2002) 1024] and from a cytoarchitectonic study [J. Comp. Neurol. 412 (1999) 319] and developed a method to combine both data sets. In the fMRI experiment, verbal fluency was investigated in 11 healthy volunteers, who covertly produced words from predefined categories. A factorial design was used with factors verbal class (semantic vs. overlearned fluency) and switching between categories (no vs. yes). fMRI data analysis employed SPM99 (Statistical Parametric Mapping). Cytoarchitectonic maps of areas 44 and 45 were derived from histologic sections of 10 postmortem brains. Both the in vivo fMRI and postmortem MR data were warped to a common reference brain using a new elastic warping tool. Cytoarchitectonic probability maps with stereotaxic information about intersubject variability were calculated for both areas and superimposed on the functional data, which showed the involvement of left hemisphere areas with verbal fluency relative to the baseline. Semantic relative to overlearned fluency showed greater involvement of left area 45 than of 44. Thus, although both areas participate in verbal fluency, they do so differentially. Left area 45 is more involved in semantic aspects of language processing, while area 44 is probably involved in high-level aspects of programming speech production per se. The combination of functional data analysis with a new elastic warping tool and cytoarchitectonic maps opens new perspectives for analyzing the cortical networks involved in language.
The visual attention span deficit in Chinese children with reading fluency difficulty.
Zhao, Jing; Liu, Menglian; Liu, Hanlong; Huang, Chen
2018-02-01
With reading development, some children fail to learn to read fluently. However, reading fluency difficulty (RFD) has not been fully investigated. The present study explored the underlying mechanism of RFD from the aspect of visual attention span. Fourteen Chinese children with RFD and fourteen age-matched normal readers participated. The visual 1-back task was adopted to examine visual attention span. Reaction time and accuracy were recorded, and relevant d-prime (d') scores were computed. Results showed that children with RFD exhibited lower accuracy and lower d' values than the controls did in the visual 1-back task, revealing a visual attention span deficit. Further analyses on d' values revealed that the attention distribution seemed to exhibit an inverted U-shaped pattern without lateralization for normal readers, but a W-shaped pattern with a rightward bias for children with RFD, which was discussed based on between-group variation in reading strategies. Results of the correlation analyses showed that visual attention span was associated with reading fluency at the sentence level for normal readers, but was related to reading fluency at the single-character level for children with RFD. The different patterns in correlations between groups revealed that visual attention span might be affected by the variation in reading strategies. The current findings extend previous data from alphabetic languages to Chinese, a logographic language with a particularly deep orthography, and have implications for reading-dysfluency remediation. Copyright © 2017 Elsevier Ltd. All rights reserved.
Is Earlier Better? Mastery of Reading Fluency in Early Schooling
Park, Yonghan; Chaparro, Erin A.; Preciado, Jorge; Cummings, Kelli D.
2015-01-01
Research Findings: The goal of the present study was to provide empirical evidence for the importance of mastering reading fluency in early schooling. Study participants were 1,322 students in 3rd grade in 42 schools in a northwestern state. These students were assessed using a battery of reading skill tests as well as comprehensive tests of more…
Characterizing ncRNAs in human pathogenic protists using high-throughput sequencing technology
Directory of Open Access Journals (Sweden)
Lesley Joan Collins
2011-12-01
Full Text Available ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, snoRNAs and long ncRNAs on a genomic scale making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases.
Characterizing ncRNAs in Human Pathogenic Protists Using High-Throughput Sequencing Technology
Collins, Lesley Joan
2011-01-01
ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses, and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, small nucleolar RNAs (snoRNAs), and long ncRNAs on a genomic scale, making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational, and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases. PMID:22303390
Gold, Carl A; Marchant, Natalie L; Koutstaal, Wilma; Schacter, Daniel L; Budson, Andrew E
2007-09-20
The presence or absence of conceptual information in pictorial stimuli may explain the mixed findings of previous studies of false recognition in patients with mild Alzheimer's disease (AD). To test this hypothesis, 48 patients with AD were compared to 48 healthy older adults on a recognition task first described by Koutstaal et al. [Koutstaal, W., Reddy, C., Jackson, E. M., Prince, S., Cendan, D. L., & Schacter D. L. (2003). False recognition of abstract versus common objects in older and younger adults: Testing the semantic categorization account. Journal of Experimental Psychology: Learning, Memory, and Cognition, 29, 499-510]. Participants studied and were tested on their memory for categorized ambiguous pictures of common objects. The presence of conceptual information at study and/or test was manipulated by providing or withholding disambiguating semantic labels. Analyses focused on testing two competing theories. The semantic encoding hypothesis, which posits that the inter-item perceptual details are not encoded by AD patients when conceptual information is present in the stimuli, was not supported by the findings. In contrast, the conceptual fluency hypothesis was supported. Enhanced conceptual fluency at test dramatically shifted AD patients to a more liberal response bias, raising their false recognition. These results suggest that patients with AD rely on the fluency of test items in making recognition memory decisions. We speculate that AD patients' over reliance upon fluency may be attributable to (1) dysfunction of the hippocampus, disrupting recollection, and/or (2) dysfunction of prefrontal cortex, disrupting post-retrieval processes.
Role of route previewing strategies on climbing fluency and exploratory movements
Seifert, Ludovic; Cordier, Romain; Orth, Dominic; Courtine, Yoan; Croft, James L.
2017-01-01
This study examined the role of route previewing strategies on climbing fluency and on exploratory movements of the limbs, in order to understand whether previewing helps people to perceive and to realize affordances. Eight inexperienced and ten experienced climbers previewed a 10 m high route of 5b
Rapid naming, phonological memory and reading fluency in Brazilian bilingual students.
Fleury, Fernanda Oppenheimer; Avila, Clara Regina Brandão de
2015-01-01
To characterize the performance of Brazilian students exposed to two languages in reading fluency, phonological memory, and rapid naming, according to grade level, and to investigate correlations between these variables. Sixty students took part in this study (50% female), enrolled in the third to the fifth grades of two elementary schools of the city of São Paulo. They constituted two groups - bilingual group: 30 Brazilian children whose mother tongue and language spoken at home was Brazilian Portuguese and who were daily exposed to English at school for a period not shorter than three years; monolingual group: 30 students, from a monolingual Brazilian elementary school, who were paired by gender, age, and grade level with the bilingual students. Foreign children, children with complaint or indication of speech and language disorder, or who had been retained were excluded. A rapid automatized naming, pseudoword repetition, and oral reading tests were administered. The bilingual children were assessed in both languages and their performances were compared among themselves and with the monolingual group, which was only assessed in Brazilian Portuguese. The bilingual group showed better performance in English, rapid naming, and pseudoword repetition tasks, whereas Brazilian Portuguese, in reading fluency. A higher number of correlations were found in Brazilian Portuguese. The results suggest that the acquisition of a second language may positively influence the abilities of rapid naming, reading rate, and accuracy. Brazilian bilingual students performed better in tasks of phonological memory in English and Brazilian Portuguese performed better in reading fluency. Different correlation patterns were found between the rapid naming, accuracy, and reading rate, in the bilingual group analysis, in both languages.
Corrective Feedback, Spoken Accuracy and Fluency, and the Trade-Off Hypothesis
Chehr Azad, Mohammad Hassan; Farrokhi, Farahman; Zohrabi, Mohammad
2018-01-01
The current study was an attempt to investigate the effects of different corrective feedback (CF) conditions on Iranian EFL learners' spoken accuracy and fluency (AF) and the trade-off between them. Consequently, four pre-intermediate intact classes were randomly selected as the control, delayed explicit metalinguistic CF, extensive recast, and…
Kent, Shawn; Wanzek, Jeanne; Petscher, Yaacov; Al Otaiba, Stephanie; Kim, Young-Suk
2013-01-01
In the present study, we examined the influence of kindergarten component skills on writing outcomes, both concurrently and longitudinally to first grade. Using data from 265 students, we investigated a model of writing development including attention regulation along with students’ reading, spelling, handwriting fluency, and oral language component skills. Results from structural equation modeling demonstrated that a model including attention was better fitting than a model with only language and literacy factors. Attention, a higher-order literacy factor related to reading and spelling proficiency, and automaticity in letter-writing were uniquely and positively related to compositional fluency in kindergarten. Attention and higher-order literacy factor were predictive of both composition quality and fluency in first grade, while oral language showed unique relations with first grade writing quality. Implications for writing development and instruction are discussed. PMID:25132722
Sidarus, Nura; Vuorre, Matti; Metcalfe, Janet; Haggard, Patrick
2017-01-01
How do we know how much control we have over our environment? The sense of agency refers to the feeling that we are in control of our actions, and that, through them, we can control our external environment. Thus, agency clearly involves matching intentions, actions, and outcomes. The present studies investigated the possibility that processes of action selection, i.e., choosing what action to make, contribute to the sense of agency. Since selection of action necessarily precedes execution of action, such effects must be prospective. In contrast, most literature on sense of agency has focussed on the retrospective computation whether an outcome fits the action performed or intended. This hypothesis was tested in an ecologically rich, dynamic task based on a computer game. Across three experiments, we manipulated three different aspects of action selection processing: visual processing fluency, categorization ambiguity, and response conflict. Additionally, we measured the relative contributions of prospective, action selection-based cues, and retrospective, outcome-based cues to the sense of agency. Manipulations of action selection were orthogonally combined with discrepancy of visual feedback of action. Fluency of action selection had a small but reliable effect on the sense of agency. Additionally, as expected, sense of agency was strongly reduced when visual feedback was discrepant with the action performed. The effects of discrepant feedback were larger than the effects of action selection fluency, and sometimes suppressed them. The sense of agency is highly sensitive to disruptions of action-outcome relations. However, when motor control is successful, and action-outcome relations are as predicted, fluency or dysfluency of action selection provides an important prospective cue to the sense of agency. PMID:28450839
[Profile, competencies and digital fluency of nurses in the Professional Improvement Program].
Tanabe, Lyvia Pini; Kobayashi, Rika Miyahara
2013-08-01
A descriptive exploratory study conducted in the city of São Paulo, which aimed to identify the profile, competencies and digital fluency of nurses in the Professional Improvement Program in handling technology at work. The population, composed by 60 nurses in the program, answered a questionnaire with data about profile, digital fluency and professional competencies. The participants were found to be: 95.0% female, 61.7% between 23 and 25 years old, 75.0% from public schools, 58.3% enrolled in cardiovascular nursing, 98.3% had contact with computing resources during graduation, 100.0% had a computer at home, 86.7% accessed the internet daily, 96.7% used Messenger and 58.3% had an intermediate level of knowledge and skill in computing. Professional competencies required for technology management referred to knowing how to be innovative, creative, and updated to identify and manage software and to use technological resources.
Directory of Open Access Journals (Sweden)
George Manolitsis
2017-10-01
Full Text Available The purpose of this longitudinal study was to examine the role of three morphological awareness (MA skills (inflection, derivation, and compounding in word reading fluency and reading comprehension in a relatively transparent orthography (Greek. Two hundred and fifteen (104 girls; Mage = 67.40 months, at kindergarten Greek children were followed from kindergarten (K to grade 2 (G2. In K and grade 1 (G1, they were tested on measures of MA (two inflectional, two derivational, and three compounding, letter knowledge, phonological awareness, rapid automatized naming (RAN, and general cognitive ability (vocabulary and non-verbal IQ. At the end of G1 and G2, they were also tested on word reading fluency and reading comprehension. The results of hierarchical regression analyses showed that the inflectional and derivational aspects of MA in K as well as all aspects of MA in G1 accounted for 2–5% of unique variance in reading comprehension. None of the MA skills predicted word reading fluency, after controlling for the effects of vocabulary and RAN. These findings suggest that the MA skills, even when assessed as early as in kindergarten, play a significant role in reading comprehension development.
The baryon vector current in the combined chiral and 1/Nc expansions
Energy Technology Data Exchange (ETDEWEB)
Flores-Mendieta, Ruben; Goity, Jose L [JLAB
2014-12-01
The baryon vector current is computed at one-loop order in large-Nc baryon chiral perturbation theory, where Nc is the number of colors. Loop graphs with octet and decuplet intermediate states are systematically incorporated into the analysis and the effects of the decuplet-octet mass difference and SU(3) flavor symmetry breaking are accounted for. There are large-Nc cancellations between different one-loop graphs as a consequence of the large-Nc spin-flavor symmetry of QCD baryons. The results are compared against the available experimental data through several fits in order to extract information about the unknown parameters. The large-Nc baryon chiral perturbation theory predictions are in very good agreement both with the expectations from the 1/Nc expansion and with the experimental data. The effect of SU(3) flavor symmetry breaking for the |Delta S|=1 vector current form factors f1(0) results in a reduction by a few percent with respect to the corresponding SU(3) symmetric values.
Predictors of Response to Intervention of Word Reading Fluency in Dutch
Scheltinga, Femke; van der Leij, Aryan; Struiksma, Chris
2010-01-01
The objective of this study was to investigate the contribution of rapid digit naming, phonological memory, letter sound naming, and orthographic knowledge to the prediction of responsiveness to a school-based, individual intervention of word reading fluency problems of 122 Dutch second and third graders whose reading scores were below the 10th…
Predictive Validity and Accuracy of Oral Reading Fluency for English Learners
Vanderwood, Michael L.; Tung, Catherine Y.; Checca, C. Jason
2014-01-01
The predictive validity and accuracy of an oral reading fluency (ORF) measure for a statewide assessment in English language arts was examined for second-grade native English speakers (NESs) and English learners (ELs) with varying levels of English proficiency. In addition to comparing ELs with native English speakers, the impact of English…
33 CFR 110.170 - Lockwoods Folly Inlet, N.C.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lockwoods Folly Inlet, N.C. 110.170 Section 110.170 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.170 Lockwoods Folly Inlet, N.C. (a) Explosives...
Birch, Susan A J; Brosseau-Liard, Patricia E; Haddock, Taeh; Ghrear, Siba E
2017-09-01
Knowledge can be a curse: Once we have acquired a particular item of knowledge it tends to bias, or contaminate, our ability to reason about a less informed perspective (referred to as the 'curse of knowledge' or 'hindsight bias'). The mechanisms underlying the curse of knowledge bias are a matter of great import and debate. We highlight two mechanisms that have been proposed to underlie this bias-inhibition and fluency misattribution. Explanations that involve inhibition argue that people have difficulty fully inhibiting or suppressing the content of their knowledge when trying to reason about a less informed perspective. Explanations that involve fluency misattribution focus on the feelings of fluency with which the information comes to mind and the tendency to misattribute the subjective feelings of fluency associated with familiar items to the objective ease or foreseeability of that information. Three experiments with a total of 359 undergraduate students provide the first evidence that fluency misattribution processes are sufficient to induce the curse of knowledge bias. These results add to the literature on the many manifestations of the curse of knowledge bias and the many types of source misattributions, by revealing their role in people's judgements of how common, or widespread, one's knowledge is. The implications of these results for cognitive science and social cognition are discussed. Copyright © 2017. Published by Elsevier B.V.
Koopmans, Martin P.; Schaeffer-Reiss, Christine; de Leeuw, Jan W.; Lewan, Michael D.; Maxwell, James R.; Schaeffer, Philippe; Sinninghe Damsté, Jaap S.
1997-06-01
Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature ( Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330°C for 72 h to study the diagenetic fate of n-C 37 and n-C 38 di- and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260°C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S- and O-bound n-C 37 and n-C 38 skeletons, saturated n-C 37 and n-C38 methyl, ethyl, and mid-chain ketones, C 37 and C 38 mid-chain 2,5-di- n-alkylthiophenes, C 37 and C 38 1,2-di- n-alkylbenzenes, and C 37 and C 38n-alkanes. With increasing thermal maturation, three forms of the n-C 37 and n-C 38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di- n-alkylbenzenes and saturated ketones), whereas the S- and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C 37 and n-C 38 skeleton can be expected as well as the corresponding hydrocarbons.
Koopmans, M.P.; Schaeffer-Reiss, C.; De Leeuw, J. W.; Lewan, M.D.; Maxwell, J.R.; Schaeffer, P.; Sinninghe, Damste J.S.
1997-01-01
Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature (Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330??C for 72 h to study the diagenetic fate of n-C37 and n-C38 di-and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260??C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S-and O-bound n-C37 and n-C38 skeletons, saturated n-C37 and n-C38 methyl, ethyl, and mid-chain ketones, C37 and C38 mid-chain 2,5-di-n-alkylthiophenes, C37 and C38 1,2-di-n-alkylbenzenes, and C37 and C38 n-alkanes. With increasing thermal maturation, three forms of the n-C37 and n-C38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di-n-alkylbenzenes and saturated ketones), whereas the S-and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C37 and n-C38 skeleton can be expected as well as the corresponding hydrocarbons. Copyright ?? 1997 Elsevier Science Ltd.
Fluency Effects on Brand Name Recognition and Preference
DEFF Research Database (Denmark)
Erz, Antonia; Christensen, Bo
2014-01-01
Existing research has not provided a clear understanding of processing fluency effects on memory. In a laboratory experiment with novel non-words, we found a recognition advantage of fluent non-words over moderately fluent and disfluent non-words. This advantage diminished when non-words were...... presented as novel brand names in different product contexts. We further tested a preference reversal in favor of disfluency and found that disfluent brand names (non-words) were equally disliked across different products contexts. A preference reversal could be observed when fluent names were preferred...
Effects of Listening While Reading (LWR on Swahili Reading Fluency and Comprehension
Directory of Open Access Journals (Sweden)
Filipo Lubua
2016-10-01
Full Text Available A number of studies have examined the contribution of technology in teaching such languages as English, French, and Spanish, among many others. Contrarily, most LCTL’s, have received very little attention. This study investigates if listening while reading (LWR may expedite Swahili reading fluency and comprehension. The study employed the iBook Author tool to create weekly mediated and interactive reading texts, with comprehension exercises, which were eventually used to collect descriptive and qualitative data from four Elementary Swahili students. Participants participated in a seven week reading program, which provided them with some kind of directed self-learning, and met with the instructor for at least 30 minutes every week for observation and more reading activities. The teacher recorded their reading scores, and a number of themes on how LWR influenced reading fluency and comprehension are discussed here. It shows that participants have a positive attitude towards LWR and they suggest it for all the reading classes.
Directory of Open Access Journals (Sweden)
Walshe Muriel
2011-01-01
Full Text Available Abstract Background Impairments in executive function and language processing are characteristic of both schizophrenia and bipolar disorder. Their functional neuroanatomy demonstrate features that are shared as well as specific to each disorder. Determining the distinct pattern of neural responses in schizophrenia and bipolar disorder may provide biomarkers for their diagnoses. Methods 104 participants underwent functional magnetic resonance imaging (fMRI scans while performing a phonological verbal fluency task. Subjects were 32 patients with schizophrenia in remission, 32 patients with bipolar disorder in an euthymic state, and 40 healthy volunteers. Neural responses to verbal fluency were examined in each group, and the diagnostic potential of the pattern of the neural responses was assessed with machine learning analysis. Results During the verbal fluency task, both patient groups showed increased activation in the anterior cingulate, left dorsolateral prefrontal cortex and right putamen as compared to healthy controls, as well as reduced deactivation of precuneus and posterior cingulate. The magnitude of activation was greatest in patients with schizophrenia, followed by patients with bipolar disorder and then healthy individuals. Additional recruitment in the right inferior frontal and right dorsolateral prefrontal cortices was observed in schizophrenia relative to both bipolar disorder and healthy subjects. The pattern of neural responses correctly identified individual patients with schizophrenia with an accuracy of 92%, and those with bipolar disorder with an accuracy of 79% in which mis-classification was typically of bipolar subjects as healthy controls. Conclusions In summary, both schizophrenia and bipolar disorder are associated with altered function in prefrontal, striatal and default mode networks, but the magnitude of this dysfunction is particularly marked in schizophrenia. The pattern of response to verbal fluency is highly
Smirnova, D; Walters, J; Fine, J; Muchnik-Rozanov, Y; Paz, M; Lerner, V; Belmaker, R H; Bersudsky, Y
2015-08-01
Due to the large migrations over the past three decades, large numbers of individuals with schizophrenia are learning a second language and being seen in clinics in that second language. We conducted within-subject comparisons to clarify the contribution of clinical, linguistic and bilingual features in the first and second languages of bilinguals with schizophrenia. Ten bilingual Russian(L1) and Hebrew(L2) proficient patients, who developed clinical schizophrenia after achieving proficiency in both languages, were selected from 60 candidates referred for the study; they were resident in Israel 7-32 years with 3-10 years from immigration to diagnosis. Clinical, linguistic and fluency markers were coded in transcripts of clinical interviews. There was a trend toward more verbal productivity in the first language (L1) than the second language (L2). Clinical speech markers associated with thought disorder and cognitive impairment (blocking and topic shift) were similar in both languages. Among linguistic markers of schizophrenia, Incomplete syntax and Speech role reference were significantly more frequent in L2 than L1; Lexical repetition and Unclear reference demonstrated a trend in the same direction. For fluency phenomena, Discourse markers were more prevalent in L1 than L2, and Codeswitching was similar across languages, showing that the patients were attuned to the socio-pragmatics of language use. More frequent linguistic markers of schizophrenia in L2 show more impairment in the syntactic/semantic components of language, reflecting greater thought and cognitive dysfunction. Patients are well able to acquire a second language. Nevertheless, schizophrenia finds expression in that language. Finally, more frequent fluency markers in L1 suggests motivation to maintain fluency, evidenced in particular by codeswitched L2 lexical items, a compensatory resource. Copyright © 2015 Elsevier Ltd. All rights reserved.
Direct and Indirect Effects of Print Exposure on Silent Reading Fluency
Mano, Quintino R.; Guerin, Julia M.
2018-01-01
Print exposure is an important causal factor in reading development. Little is known, however, of the mechanisms through which print exposure exerts an effect onto reading. To address this gap, we examined the direct and indirect effects of print exposure on silent reading fluency among college students (n = 52). More specifically, we focused on…
Krach, S. Kathleen; McCreery, Michael P.; Loe, Scott A.; Jones, W. Paul
2016-01-01
Previous research demonstrates specific relationships between personality traits and general academic performance. In addition, research studies have demonstrated relationships among personality and variables related to reading fluency (i.e. speed, accuracy, automaticity, and prosody). However, little investigation has examined specific links…
Directory of Open Access Journals (Sweden)
Sara Ramezani
2012-01-01
Full Text Available Objective: Stuttering is a fairly common speech disorder. However, the etiology is poorly understood and is likely to be heterogeneous. The aim of this research is to investigate phonological encoding complexity on speech fluency in 6-9 year old stuttering children in comparison with non-stutterers in Tehran. Materials & Methods: This cross-sectional, descriptive analytic research was done on 18 stuttering children with profound and severe level and 18 non-stuttering children. The stuttering subjects were selected by convenience and normal subjects were matched to stuttering subjects by gender, age and geographics. A non-word test comprising 87 non-words was used to investigate phonological encoding and phonological complexity effects on speech fluency. Stimuli were presented in random order with approximately 5 seconds between items, using a computer via external Toshiba SOMIC SM-818 headphone and requested subject was asked to repeat them. Results: The results indicated that speech fluency decreased significantly (P<0.05 by increasing phonological complexity comparing to controls. Conclusion: The findings of the present research seem to suggest that, stuttering children may have deficits in phonological encoding. The deficit has been increased with phonological encoding complexity. Based on covert repair hypothesis, phonological difficulty may cause covert self- repair and leads to different patterns of stuttering.
Noise in NC-AFM measurements with significant tip–sample interaction
Directory of Open Access Journals (Sweden)
Jannis Lübbe
2016-12-01
Full Text Available The frequency shift noise in non-contact atomic force microscopy (NC-AFM imaging and spectroscopy consists of thermal noise and detection system noise with an additional contribution from amplitude noise if there are significant tip–sample interactions. The total noise power spectral density DΔf(fm is, however, not just the sum of these noise contributions. Instead its magnitude and spectral characteristics are determined by the strongly non-linear tip–sample interaction, by the coupling between the amplitude and tip–sample distance control loops of the NC-AFM system as well as by the characteristics of the phase locked loop (PLL detector used for frequency demodulation. Here, we measure DΔf(fm for various NC-AFM parameter settings representing realistic measurement conditions and compare experimental data to simulations based on a model of the NC-AFM system that includes the tip–sample interaction. The good agreement between predicted and measured noise spectra confirms that the model covers the relevant noise contributions and interactions. Results yield a general understanding of noise generation and propagation in the NC-AFM and provide a quantitative prediction of noise for given experimental parameters. We derive strategies for noise-optimised imaging and spectroscopy and outline a full optimisation procedure for the instrumentation and control loops.
ORF Sequence: NC_002695 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002695 gi|15830145 >gi|15830145|ref|NP_308918.1| putative transmembrane subunit...IFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN
ORF Sequence: NC_004307 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004307 gi|23464690 >gi|23464690|ref|NP_695293.1| hypothetical transmembrane pro...LVQLCAMGFIIGYVIRSNNVWMVFSLMAVMLVAAVQIVMSRARGIPKGLAGPIFLSLVITMLLMLALVTELIVRPHPWYAPQLVVPLTGMLLGNTVSALAVGLSRFYESME
ORF Sequence: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005027 gi|32471017 >gi|32471017|ref|NP_864010.1| hypothetical protein-transmemb...HALISRLRIWGRETLTEMPSWLVSMVVHLTLLLVLALIGRSTSKVGQIELLFRQSSESSSMELAEFTIAAAAPLESFERSMEEERIATTQLVSIDVIDAEAEMFSLVP
ORF Sequence: NC_002942 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002942 gi|52840424 >gi|52840424|ref|YP_094223.1| probable transmembrane protein...EYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIGEVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVAEIELIKPTPAVKYKQTYYHSYPVFPTHNSAEKYTSME
ORF Sequence: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005027 gi|32476407 >gi|32476407|ref|NP_869401.1| hypothetical protein-transmemb...IYPDDRPGWIDQPIVNDGKDYSLVVTAGPSGSMEEADELIGVYARGAVQSYVDELVSEQEWATEPEMIPLDIDWIRDELVVRRYEGVVQVGDEQQFEKAILIRIEPEDKKVFETAIADMKLKERLAATGIVILGGFSLLVGGSIVLGGLASRQKQPTAAA
ORF Sequence: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39933242 >gi|39933242|ref|NP_945518.1| possible nicotinate-nucleotide adn...WWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTLRYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSFRALAAPAAQRLMRMRIPNNKAATLADREPPAWVYLTGLKSLVSSTALRNPDGSWKT
ORF Sequence: NC_002162 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002162 gi|13358092 >gi|13358092|ref|NP_078366.1| cytosine-specific methyltransferase [Ureap...RILFDLQKLNQLPQFLLLENVNNMLSKQHKLDYDMWTKSLKQLGYSTCTFQLNALDYGSAQRRKRVYAISILNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYK
Fluency or Accuracy - Two Different ‘Colours’ in Writing Assessment
Directory of Open Access Journals (Sweden)
Listyani Listyani
2017-01-01
Full Text Available Fluency and accuracy. These two things have victoriously won many teachers’ attention at tertiary level. In the case of writing, these two remain debatable, and have always attracted many people, both lecturers’ and students’ attention. These language production measures have distracted many lecturers’ concentration: should they be faithful to fluency of ideas, or grammatical and language accuracy in correcting students’ essays? This paper tries to present the classical yet never-ending dilemmatic conflicts within the area of writing assessment. This debate still remains interesting to follow. Data were gained from close observation on documents, that is, 21 students’ essays and interviews with 2 students of Academic Writing in Semester II, 2015-2016. Four writing lecturers were also interviewed for their intellectual and critical opinions on these dilemmatic problems in assessing writing. Discussion results of FGD (Forum Group Discussion involving all writing lecturers at the English Education Study Program at the Faculty of Language and Literature of Satya Wacana Christian University which were held in June, 2016, were also included as source of data. Hopefully, this paper gives a little more “colour” in the area of writing assessment, and gives a little enlightenment for other writing lecturers. DOI: https://doi.org/10.24071/llt.2016.190201
Directory of Open Access Journals (Sweden)
Yun-bo SHI
2015-07-01
Full Text Available Objective To identify the sensitivity and specificity of Animal-City Alternating Form Fluency Test (ACFT differentiating mild cognitive impairment (MCI and Alzheimer's disease (AD from normal controls. Methods A total of 121 MCI patients, 104 AD patients and 104 healthy controls, who were matched in sex, age and education level, were enrolled in this study. They performed Animal Category Verbal Fluency Test (AFT, City Category Verbal Fluency Test (CFT and ACFT. A series of standard neuropsychological tests were also administered to reflect episodic memory, verbal ability, working memory, executive function and processing speed. The validity and related influencing factors of ACFT was evaluated. Results Compared with control group, the ACFT correct number in MCI and AD groups reduced significantly (P = 0.000, 0.000. Receiver operating characteristic (ROC curve revealed the sensitivity and specificity of ACFT in discriminating MCI (P = 0.012, 0.030 and AD (P = 0.004, 0.003 from normal controls were higher than those of AFT and CFT. There was no correlation of correct number in ACFT with age and education (P > 0.05, for all. The correlations of ACFT with Stroop Color-Word Test (SCWT, Digital Symbol Substitution Test (DSST, Shape Trail Test (STT and Digit Span Test (DS, all of which reflected attention and executive function, were significantly closer than those of AFT and CFT (P < 0.05, for all. Conclusions ACFT is more efficient in early cognitive impairment identification than the other traditional category verbal fluency tests. It is a new variant form of category verbal fluency test that could assess cognitive function and could be broadly applied in clinical practice. DOI: 10.3969/j.issn.1672-6731.2015.07.010
Fluency aspects of oral narrative task in del22q11.2 syndrome.
Santos, Amanda Oliveira; Rossi, Natalia Freitas; Tandel, Maria da Conceição Faria Freitas; Richieri-Costa, Antonio; Giacheti, Célia Maria
2016-01-01
To investigate the fluency aspects of the oral narrative task in individuals with del22q11.2 syndrome and compare them with those of individuals with typical language development. Fifteen individuals diagnosed with del22q11.2 syndrome, both genders, aged 7-17 years participated in this study. They were compared with 15 individuals with typical language development, with similar gender and chronological age profiles. The oral narrative was elicited using the book "Frog, Where Are You?", and the fluency aspects were analyzed according to speech rate and type and frequency of disfluency (typical and stuttering). The number and duration of pauses were also investigated. The data were statistically analyzed. The group with del22q11.2 syndrome showed a higher average when compared with the group without the syndrome for the percentage of typical disfluencies, mainly hesitation and revision. The group presenting the syndrome also showed a higher average for stuttering disfluencies, with pause as the most frequent disfluency. With respect to speech rate, the group with the syndrome presented a lower average for the number of words and syllables per minute. Individuals with del22q11.2 syndrome showed greater difficulties of narration than their peers. The fluency aspects of the oral narrative task in subjects with del22q11.2 syndrome were similar to those of individuals with typical language development regarding the presence of hesitation, revision, and pause, but they were different with respect to frequency of disfluency, which was higher in individuals with the syndrome.
Marbach, Joshua
2017-01-01
The Mathematics Fluency and Calculation Tests (MFaCTs) are a series of measures designed to assess for arithmetic calculation skills and calculation fluency in children ages 6 through 18. There are five main purposes of the MFaCTs: (1) identifying students who are behind in basic math fact automaticity; (2) evaluating possible delays in arithmetic…
ADHD and Adolescent EFL Learners' Speaking Complexity, Accuracy, and Fluency in English
Marashi, Hamid; Dolatdoost, Mohammad
2016-01-01
This study was an attempt to investigate the relationships among Attention-Deficit/Hyperactivity Disorder (ADHD) and speaking complexity, accuracy, and fluency (CAF) among Iranian EFL learners. To fulfill the purpose of this study, the teachers and parents of 593 male students were given the Farsi version of the CSI-4 ADHD diagnostic…
ORF Sequence: NC_002162 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002162 gi|13358063 >gi|13358063|ref|NP_078337.1| hypothetical protein UU500 [Ureap...MGNHTWDHPDIFEILTTKTNIIRPYNIINTHQYHLVGSGSRVFYCNKKMIRVTNLLGNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKL
Directory of Open Access Journals (Sweden)
Esther Gómez Zapata
2011-08-01
Full Text Available This article describes the process of planning an intervention program aimed at improving reading fluency in children with developmental dyslexia. Reading fluency is considered a crucial component in achieving literacy, especially regarding its role in facilitating reading comprehension. Improving reading fluency is particularly important for children with developmental dyslexia as they have difficulties automatizing word recognition. These difficulties lead to suboptimal reading skills that ultimately affect reading comprehension. This study shows the steps involved in planning an intervention program that combines accelerated and repeated reading, two methodologies commonly used to improve fluency. This is a structured and sequential training programme which includes syllable, word and text reading. The aim is to automatize the reading of sublexical units-which are easily recognizable in Spanish-to facilitate faster and more efficient word recognition. This will improve fluency when reading full texts. The program also includes metaphonological ability training.
ORF Sequence: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005027 gi|32475512 >gi|32475512|ref|NP_868506.1| hypothetical protein-signal peptide and transme...VLVGLLLPAVQAAREAARRMSCSNNIAQLTLATHNYEFSMEHLPPGTTNPTGPIVNTPNGEHISFLVRLLPYIEQQGTADDFDLTASVYAPANAKVRAYQISAFLCPS
ORF Sequence: NC_003280 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003280 gi|17533935 >gi|17533935|ref|NP_496777.1| ZYXin (zyx-1) [Caenorhabditis elegans] MNQIFHVDC...FAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTCNGNRLRVVSST
A Novel Type of Non-coding RNA, nc886, Implicated in Tumor Sensing and Suppression
Directory of Open Access Journals (Sweden)
Yong Sun Lee
2015-06-01
Full Text Available nc886 (=vtRNA2-1, pre-miR-886, or CBL3 is a newly identified non-coding RNA (ncRNA that represses the activity of protein kinase R (PKR. nc886 is transcribed by RNA polymerase III (Pol III and is intriguingly the first case of a Pol III gene whose expression is silenced by CpG DNA hypermethylation in several types of cancer. PKR is a sensor protein that recognizes evading viruses and induces apoptosis to eliminate infected cells. Like viral infection, nc886 silencing activates PKR and induces apoptosis. Thus, the significance of the nc886:PKR pathway in cancer is to sense and eliminate pre-malignant cells, which is analogous to PKR's role in cellular innate immunity. Beyond this tumor sensing role, nc886 plays a putative tumor suppressor role as supported by experimental evidence. Collectively, nc886 provides a novel example how epigenetic silencing of a ncRNA contributes to tumorigenesis by controlling the activity of its protein ligand.
76 FR 29645 - Safety Zone, Newport River; Morehead City, NC
2011-05-23
...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC. This safety... Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We received no...
76 FR 18669 - Safety Zone, Newport River; Morehead City, NC
2011-04-05
...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...
76 FR 38018 - Safety Zone, Newport River; Morehead City, NC
2011-06-29
...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City-Newport River high rise bridge in Carteret County, NC. This safety...) entitled Safety Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We...
76 FR 23227 - Safety Zone, Newport River; Morehead City, NC
2011-04-26
...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...
The impact of language co-activation on L1 and L2 speech fluency.
Bergmann, Christopher; Sprenger, Simone A; Schmid, Monika S
2015-10-01
Fluent speech depends on the availability of well-established linguistic knowledge and routines for speech planning and articulation. A lack of speech fluency in late second-language (L2) learners may point to a deficiency of these representations, due to incomplete acquisition. Experiments on bilingual language processing have shown, however, that there are strong reasons to believe that multilingual speakers experience co-activation of the languages they speak. We have studied to what degree language co-activation affects fluency in the speech of bilinguals, comparing a monolingual German control group with two bilingual groups: 1) first-language (L1) attriters, who have fully acquired German before emigrating to an L2 English environment, and 2) immersed L2 learners of German (L1: English). We have analysed the temporal fluency and the incidence of disfluency markers (pauses, repetitions and self-corrections) in spontaneous film retellings. Our findings show that learners to speak more slowly than controls and attriters. Also, on each count, the speech of at least one of the bilingual groups contains more disfluency markers than the retellings of the control group. Generally speaking, both bilingual groups-learners and attriters-are equally (dis)fluent and significantly more disfluent than the monolingual speakers. Given that the L1 attriters are unaffected by incomplete acquisition, we interpret these findings as evidence for language competition during speech production. Copyright © 2015. Published by Elsevier B.V.
Biological Dialogues: How to Teach Your Students to Learn Fluency in Biology
May, S. Randolph; Cook, David L.; May, Marilyn K.
2013-01-01
Biology courses have thousands of words to learn in order to intelligently discuss the subject and take tests over the material. Biological fluency is an important goal for students, and practical methods based on constructivist pedagogies can be employed to promote it. We present a method in which pairs of students write dialogues from…
ORF Sequence: NC_003279 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003279 gi|17507795 >gi|17507795|ref|NP_493043.1| putative protein, with at least 2 transme...YLNIQIADETTDLPVSIDRANVDMRIYRAFEMSMEKDIISLSTSNTSHAEISTPKSRKKKSRKLGLKNLEEVINSKYNSCQKQDNSMSIQ
Characteristics of Fluency and Speech in Two Families with High Incidences of Stuttering
Stager, Sheila V.; Freeman, Frances J.; Braun, Allen
2015-01-01
Purpose: This study presents data from 2 families with high incidence of stuttering, comparing methods of phenotype assignment and exploring the presence of other fluency disorders and corresponding speech characteristics. Method: Three methods for assigning phenotype of stuttering were used: self-identification, family identification, and expert…
Sex differences and autism: brain function during verbal fluency and mental rotation.
Directory of Open Access Journals (Sweden)
Felix D C C Beacher
Full Text Available Autism spectrum conditions (ASC affect more males than females. This suggests that the neurobiology of autism: 1 may overlap with mechanisms underlying typical sex-differentiation or 2 alternately reflect sex-specificity in how autism is expressed in males and females. Here we used functional magnetic resonance imaging (fMRI to test these alternate hypotheses. Fifteen men and fourteen women with Asperger syndrome (AS, and sixteen typically developing men and sixteen typically developing women underwent fMRI during performance of mental rotation and verbal fluency tasks. All groups performed the tasks equally well. On the verbal fluency task, despite equivalent task-performance, both males and females with AS showed enhanced activation of left occipitoparietal and inferior prefrontal activity compared to controls. During mental rotation, there was a significant diagnosis-by-sex interaction across occipital, temporal, parietal, middle frontal regions, with greater activation in AS males and typical females compared to AS females and typical males. These findings suggest a complex relationship between autism and sex that is differentially expressed in verbal and visuospatial domains.
Sex differences and autism: brain function during verbal fluency and mental rotation.
Beacher, Felix D C C; Radulescu, Eugenia; Minati, Ludovico; Baron-Cohen, Simon; Lombardo, Michael V; Lai, Meng-Chuan; Walker, Anne; Howard, Dawn; Gray, Marcus A; Harrison, Neil A; Critchley, Hugo D
2012-01-01
Autism spectrum conditions (ASC) affect more males than females. This suggests that the neurobiology of autism: 1) may overlap with mechanisms underlying typical sex-differentiation or 2) alternately reflect sex-specificity in how autism is expressed in males and females. Here we used functional magnetic resonance imaging (fMRI) to test these alternate hypotheses. Fifteen men and fourteen women with Asperger syndrome (AS), and sixteen typically developing men and sixteen typically developing women underwent fMRI during performance of mental rotation and verbal fluency tasks. All groups performed the tasks equally well. On the verbal fluency task, despite equivalent task-performance, both males and females with AS showed enhanced activation of left occipitoparietal and inferior prefrontal activity compared to controls. During mental rotation, there was a significant diagnosis-by-sex interaction across occipital, temporal, parietal, middle frontal regions, with greater activation in AS males and typical females compared to AS females and typical males. These findings suggest a complex relationship between autism and sex that is differentially expressed in verbal and visuospatial domains.
Kim, Young-Suk Grace; Wagner, Richard K.
2015-01-01
In the present study we investigated a developmentally changing role of text reading fluency in mediating the relations of word reading fluency and listening comprehension to reading comprehension. We addressed this question by using longitudinal data from Grades 1 to 4 and employing structural equation models. Results showed that the role of text…
Gehring, Kathleen M; Eastman, Deborah A
2008-01-01
Many initiatives for the improvement of undergraduate science education call for inquiry-based learning that emphasizes investigative projects and reading of the primary literature. These approaches give students an understanding of science as a process and help them integrate content presented in courses. At the same time, general initiatives to promote information fluency are being promoted on many college and university campuses. Information fluency refers to discipline-specific processing of information, and it involves integration of gathered information with specific ideas to form logical conclusions. We have implemented the use of inquiry-based learning to enhance and study discipline-specific information fluency skills in an upper-level undergraduate Developmental Biology course. In this study, an information literacy tutorial and a set of linked assignments using primary literature analysis were integrated with two inquiry-based laboratory research projects. Quantitative analysis of student responses suggests that the abilities of students to identify and apply valid sources of information were enhanced. Qualitative assessment revealed a set of patterns by which students gather and apply information. Self-assessment responses indicated that students recognized the impact of the assignments on their abilities to gather and apply information and that they were more confident about these abilities for future biology courses and beyond.
From fluency to comprehension powerful instruction through authentic reading
Rasinski, Timothy
2013-01-01
Helping teachers move beyond fluency as measured by speed alone, this book focuses on building the skills that students need to read accurately, meaningfully, and expressively--the essential components of reading comprehension. Each concise chapter presents a tried-and-true instructional or assessment strategy and shows how K-12 teachers can apply it in their own classrooms, using a wide variety of engaging texts. Special features include classroom examples, ""Your Turn"" activities, and 24 reproducible forms, in a large-size format for easy photocopying. Purchasers also get access to a
Motor skills and verbal fluency in HIV positive older adults in Rural ...
African Journals Online (AJOL)
The Finger Tapping Test of the Developmental Neuropsychological Test Battery was also used. Results: Tests of motor skill were less sensitive to HIV infection (F (1, 48) = 1.134, p= .292) than verbal fluency tests-Hopkins Verbal Learning (F (1, 48) = 42.994, p=.000, Hopkins Verbal Learning Test- delay (F (1, 48) = 45.886, ...
The Word Writing CAFE: Assessing Student Writing for Complexity, Accuracy, and Fluency
Leal, Dorothy J.
2005-01-01
The Word Writing CAFE is a new assessment tool designed for teachers to evaluate objectively students' word-writing ability for fluency, accuracy, and complexity. It is designed to be given to the whole class at one time. This article describes the development of the CAFE and provides directions for administering and scoring it. The author also…
Effects of carboxylic acids on nC60 aggregate formation
International Nuclear Information System (INIS)
Chang Xiaojun; Vikesland, Peter J.
2009-01-01
The discovery that negatively charged aggregates of C 60 fullerene (nC 60 ) are stable in water has raised concerns regarding the potential environmental and health effects of these aggregates. In this work, we show that nC 60 aggregates produced by extended mixing in the presence of environmentally relevant carboxylic acids (acetic acid, tartaric acid, citric acid) have surface charge and morphologic properties that differ from those produced by extended mixing in water alone. In general, aggregates formed in the presence of these acids have a more negative surface charge and are more homogeneous than those produced in water alone. Carboxylic acid identity, solution pH, and sodium ion concentration, which are all intricately coupled, play an important role in setting the measured surface charge. Comparisons between particle sizes determined by analysis of TEM images and those obtained by dynamic light scattering (DLS) indicate that DLS results require careful evaluation when used to describe nC 60 aggregates. - The effects of carboxylic acids on the formation of nC 60 aggregates are discussed
ORF Sequence: NC_003909 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003909 gi|42782207 >gi|42782207|ref|NP_979454.1| BclA protein [Bacillus cereus ATCC 10987] MANRLNFTGP...LGCCGISGKTGPTGPTGPTGVTGSTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGP...TGATGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGSTGP
ORF Sequence: NC_003070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN
Berg, Derek H.; Hutchinson, Nancy L.
2010-01-01
This study investigated whether processing speed, short-term memory, and working memory accounted for the differential mental addition fluency between children typically achieving in arithmetic (TA) and children at-risk for failure in arithmetic (AR). Further, we drew attention to fluency differences in simple (e.g., 5 + 3) and complex (e.g., 16 +…
Kasa, Siti Norbaya; Omar, Mohd Firdaus; Ismail, Ismarul Nizam
2017-12-01
Nanocrystalline cellulose (NCC) was synthesized from banana stem through strong acid hydrolysis with measured length of approximately 287.0 ± 56.4 nm and diameter of 26.6 ± 4.8 nm. Modification of NCC was carried by acetylation reaction in order to increase the compatibility during reinforcement with polylactic acid (PLA) polymer. The reinforcing effect towards morphology, crystallinity, mechanical and thermal properties of bio-nanocomposites was investigated. Scanning Electron Microscope (SEM) micrograph reveals the uniform dispersion achieved at 1 %, 3 % and 5% aNC loading while agglomeration was found at 7 % aNC loading. Disappearance of crystallinity peak at 2θ = 22.7⁰ for low aNC loading during elemental analysis using X-Ray Diffraction (XRD) indicates the proper dispersion of aNC in PLA polymer. From the tensile test, 1 % aNC loading gives the highest mechanical properties of bio-nanocomposite film with 82.71 %, 118.7 % and 24.18 % increment in tensile strength, tensile modulus and elongation at break. However, 7 % aNC loading gives the highest increment in TGA of aNC-PLA nanocomposites which is from 310 °C to 320 °C.
Khan, Arif O
2012-06-01
In unilateral congenital superior oblique palsy, a large hypertropia is sometimes associated with ipsilateral contracture of the superior rectus muscle and apparent overaction of the contralateral superior oblique. Ipsilateral double elevator weakening is one surgical approach; however, this procedure could compromise supraduction. We report a series of three consecutive patients who underwent ipsilateral superior rectus and inferior oblique recessions for unilateral superior oblique palsy. Intraoperatively, all three patients were found to have a lax ipsilateral superior oblique tendon. Postoperatively, all three patients had satisfactory correction of the hypertropia and abnormal head position with minimal supraduction defect. This procedure seems to be an acceptable initial surgical option for treating congenital superior oblique muscle palsy with ipsilateral contracture of the superior rectus muscle, even when the ipsilateral superior oblique tendon is lax. Copyright © 2012 American Association for Pediatric Ophthalmology and Strabismus. Published by Mosby, Inc. All rights reserved.
Halai, Ajay D; Woollams, Anna M; Lambon Ralph, Matthew A
2017-01-01
Individual differences in the performance profiles of neuropsychologically-impaired patients are pervasive yet there is still no resolution on the best way to model and account for the variation in their behavioural impairments and the associated neural correlates. To date, researchers have generally taken one of three different approaches: a single-case study methodology in which each case is considered separately; a case-series design in which all individual patients from a small coherent group are examined and directly compared; or, group studies, in which a sample of cases are investigated as one group with the assumption that they are drawn from a homogenous category and that performance differences are of no interest. In recent research, we have developed a complementary alternative through the use of principal component analysis (PCA) of individual data from large patient cohorts. This data-driven approach not only generates a single unified model for the group as a whole (expressed in terms of the emergent principal components) but is also able to capture the individual differences between patients (in terms of their relative positions along the principal behavioural axes). We demonstrate the use of this approach by considering speech fluency, phonology and semantics in aphasia diagnosis and classification, as well as their unique neural correlates. PCA of the behavioural data from 31 patients with chronic post-stroke aphasia resulted in four statistically-independent behavioural components reflecting phonological, semantic, executive-cognitive and fluency abilities. Even after accounting for lesion volume, entering the four behavioural components simultaneously into a voxel-based correlational methodology (VBCM) analysis revealed that speech fluency (speech quanta) was uniquely correlated with left motor cortex and underlying white matter (including the anterior section of the arcuate fasciculus and the frontal aslant tract), phonological skills with
Bringing the frame into focus: the influence of regulatory fit on processing fluency and persuasion.
Lee, Angela Y; Aaker, Jennifer L
2004-02-01
This research demonstrates that people's goals associated with regulatory focus moderate the effect of message framing on persuasion. The results of 6 experiments show that appeals presented in gain frames are more persuasive when the message is promotion focused, whereas loss-framed appeals are more persuasive when the message is prevention focused. These regulatory focus effects suggesting heightened vigilance against negative outcomes and heightened eagerness toward positive outcomes are replicated when perceived risk is manipulated. Enhanced processing fluency leading to more favorable evaluations in conditions of compatibility appears to underlie these effects. The findings underscore the regulatory fit principle that accounts for the persuasiveness of message framing effects and highlight how processing fluency may contribute to the "feeling right" experience when the strategy of goal pursuit matches one's goal.
Directory of Open Access Journals (Sweden)
Camille Duque
2018-05-01
Full Text Available Our purpose is to illuminate compliances with, and resistances to, what we are calling "compulsory fluency" which we define as conventions for what constitutes competent speech. We achieve our purpose through a study of day-to-day communication between a woman with less conventional speech and her support providing family members and friends. Drawing from McRuer's (2006 compulsory ablebodiedness and Kafer's (2013 compulsory able-mindedness, we use "compulsory fluency" to refer to a form of articulation that is standardized and idealized and imposed on all speakers including those whose speech is less conventional. We see compulsory fluency as central to North American conceptions of personhood which are tied to individual ability to speak for one's self (Brueggemann, 2005. In this paper, we trace some North American principles for linguistic competence to outline widely held ideals of receptive and expressive language use, namely, conventions for how language should be understood and expressed. Using Critical Disability Studies (Goodley, 2013; McRuer, 2006 together with a feminist framework of relational autonomy (Nedelsky, 1989, our goal is to focus on experiences of people with less conventional speech and draw attention to power in communication as it flows in idiosyncratic and intersubjective fashion (Mackenzie & Stoljar, 2000; Westlund, 2009. In other words, we use a critical disability and feminist framing to call attention to less conventional forms of communication competence and, in this process, we challenge assumptions about what constitutes competent speech. As part of a larger qualitative study, we conduct a conversation analysis informed by Rapley and Antaki (1996 to examine day-to-day verbal, vocal and non-verbal communications of a young woman who self identifies as "having autism" - pseudonym Addison - in interaction with her support-providing family members and friends. We illustrate a multitude of Addison's compliances with
Design and Investigation of SST/nc-Si:H/M (M = Ag, Au, Ni and M/nc-Si:H/M Multifunctional Devices
Directory of Open Access Journals (Sweden)
A. F. Qasrawi
2013-01-01
Full Text Available Hydrogenated nanocrystalline Silicon thin films prepared by the very high frequency chemical vapor deposition technique (VHF-CVD on stainless steel (SST substrates are used to design Schottky point contact barriers for the purpose of solar energy conversion and passive electronic component applications. In this process, the contact performance between SST and M (M = Ag, Au, and Ni and between Ag, Au, and Ni electrodes was characterized by means of current-voltage, capacitance-voltage, and light intensity dependence of short circuit ( current and open circuit voltage ( of the contacts. Particularly, the devices ideality factors, barrier heights were evaluated by the Schottky method and compared to the Cheung's. Best Schottky device performance with lowest ideality factor suitable for electronic applications was observed in the SST/nc-Si:H/Ag structure. This device reflects a of 229 mV with an of 1.6 mA/cm2 under an illumination intensity of ~40 klux. On the other hand, the highest being 9.0 mA/cm2 and the of 53.1 mV were observed for Ni/nc-Si:H/Au structure. As these voltages represent the maximum biasing voltage for some of the designed devices, the SST/nc-Si:H/M and M/nc-Si:H/M can be regarded as multifunctional self-energy that provided electronic devices suitable for active or passive applications.
The impact of language co-activation on L1 and L2 speech fluency
Bergmann, Christopher; Sprenger, Simone A.; Schmid, Monika S.
2015-01-01
Fluent speech depends on the availability of well-established linguistic knowledge and routines for speech planning and articulation. A lack of speech fluency in late second-language (12) learners may point to a deficiency of these representations, due to incomplete acquisition. Experiments on
Denton, Carolyn A.; Barth, Amy E.; Fletcher, Jack M.; Wexler, Jade; Vaughn, Sharon; Cirino, Paul T.; Romain, Melissa; Francis, David J.
2011-01-01
The purpose of this study was to investigate the relations among oral and silent reading fluency and reading comprehension for students in Grades 6 to 8 (n = 1,421) and the use of fluency scores to identify middle school students who are at risk for failure on a high-stakes reading test. Results indicated moderate positive relations between…
EnviroAtlas - Durham, NC - Demo (Parent)
U.S. Environmental Protection Agency — This EnviroAtlas dataset is the base layer for the Durham, NC EnviroAtlas Area. The block groups are from the US Census Bureau and are included/excluded based on...
Directory of Open Access Journals (Sweden)
Baptiste eFAUVEL
2014-10-01
Full Text Available Because of permanent use-dependent cerebral plasticity, all lifelong individuals’ experiences are believed to influence the cognitive aging quality. In old individuals, both former and current musical practices have been associated with better verbal skills, visual memory, processing speed, and planning function. This work sought for an interaction between musical practice and cognitive aging by comparing musician and nonmusician individuals for two periods of life (late adulthood and old age. Long-term memory, auditory verbal short-term memory, processing speed, nonverbal reasoning, and verbal fluencies were assessed. In study 1, measures of processing speed and auditory verbal short-term memory showed significant better performances for musicians compared with controls, but both groups displayed the same age-related difference. For verbal fluencies, musician individuals scored higher and displayed different age effects compared with controls. In study 2, we revealed that the life period at training onset (childhood versus adulthood was associated with phonemic, but not semantic fluency performances (musicians who had started practice in adulthood did not perform better on phonemic fluency compared with nonmusicians. For these two measures, current frequency of training did not account for musicians’ scores. These patterns of results are discussed by confronting the hypothesis of a transformative effect of musical practice with non-causal explanation.
ORF Sequence: NC_004307 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra
ORF Sequence: NC_005363 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/competitivene...ss [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR
ORF Sequence: NC_003078 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp
ORF Sequence: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV
ORF Sequence: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL
ORF Sequence: NC_002162 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002162 gi|13358146 >gi|13358146|ref|NP_078420.1| transcription antitermination factor [Ureap...lasma parvum serovar 3 str. ATCC 700970] MAYKIKDLDSKLLSDLKIDFNHRHQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLKIIKEKIKEVKIYEPSEAP
Delice, Ali; Kertil, Mahmut
2015-01-01
This article reports the results of a study that investigated pre-service mathematics teachers' modelling processes in terms of representational fluency in a modelling activity related to a cassette player. A qualitative approach was used in the data collection process. Students' individual and group written responses to the mathematical modelling…
Zhou, Xinlin; Wei, Wei; Zhang, Yiyun; Cui, Jiaxin; Chen, Chuansheng
2015-01-01
Studies have shown that numerosity processing (e.g., comparison of numbers of dots in two dot arrays) is significantly correlated with arithmetic performance. Researchers have attributed this association to the fact that both tasks share magnitude processing. The current investigation tested an alternative hypothesis, which states that visual perceptual ability (as measured by a figure-matching task) can account for the close relation between numerosity processing and arithmetic performance (computational fluency). Four hundred and twenty four third- to fifth-grade children (220 boys and 204 girls, 8.0-11.0 years old; 120 third graders, 146 fourth graders, and 158 fifth graders) were recruited from two schools (one urban and one suburban) in Beijing, China. Six classes were randomly selected from each school, and all students in each selected class participated in the study. All children were given a series of cognitive and mathematical tests, including numerosity comparison, figure matching, forward verbal working memory, visual tracing, non-verbal matrices reasoning, mental rotation, choice reaction time, arithmetic tests and curriculum-based mathematical achievement test. Results showed that figure-matching ability had higher correlations with numerosity processing and computational fluency than did other cognitive factors (e.g., forward verbal working memory, visual tracing, non-verbal matrix reasoning, mental rotation, and choice reaction time). More important, hierarchical multiple regression showed that figure matching ability accounted for the well-established association between numerosity processing and computational fluency. In support of the visual perception hypothesis, the results suggest that visual perceptual ability, rather than magnitude processing, may be the shared component of numerosity processing and arithmetic performance.
77 FR 57063 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC
2012-09-17
... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...
77 FR 64906 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC
2012-10-24
... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...
ORF Sequence: NC_006155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin
ORF Sequence: NC_002162 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002162 gi|13357802 >gi|13357802|ref|NP_078076.1| ribosomal protein L24 [Ureapla...sma parvum serovar 3 str. ATCC 700970] MNRIKKGDTVVVISGKNKNKSGVVIQVNPKEQTALVEGVNKIKRHQKKDQTHEQSGIIEKEAPIRLCKLALVDPKGKDKGKATKVKYLLKDNKKVRVARKSGSELDVNKK
CAI System with Multi-Media Text Through Web Browser for NC Lathe Programming
Mizugaki, Yoshio; Kikkawa, Koichi; Mizui, Masahiko; Kamijo, Keisuke
A new Computer Aided Instruction (CAI) system for NC lathe programming has been developed with use of multi-media texts including movies, animations, pictures, sound and texts through Web browser. Although many CAI systems developed previously for NC programming consist of text-based instructions, it is difficult for beginners to learn NC programming with use of them. In the developed CAI system, multi-media texts are adopted for the help of users' understanding, and it is available through Web browser anytime and anywhere. Also the error log is automatically recorded for the future references. According to the NC programming coded by a user, the movement of the NC lathe is animated and shown in the monitor screen in front of the user. If its movement causes the collision between a cutting tool and the lathe, some sound and the caution remark are generated. If the user makes mistakes some times at a certain stage in learning NC, the corresponding suggestion is shown in the form of movies, animations, and so forth. By using the multimedia texts, users' attention is kept concentrated during a training course. In this paper, the configuration of the CAI system is explained and the actual procedures for users to learn the NC programming are also explained too. Some beginners tested this CAI system and their results are illustrated and discussed from the viewpoint of the efficiency and usefulness of this CAI system. A brief conclusion is also mentioned.
Wang, Jianjian; Cao, Yuze; Zhang, Huixue; Wang, Tianfeng; Tian, Qinghua; Lu, Xiaoyu; Lu, Xiaoyan; Kong, Xiaotong; Liu, Zhaojun; Wang, Ning; Zhang, Shuai; Ma, Heping; Ning, Shangwei; Wang, Lihua
2017-01-04
The Nervous System Disease NcRNAome Atlas (NSDNA) (http://www.bio-bigdata.net/nsdna/) is a manually curated database that provides comprehensive experimentally supported associations about nervous system diseases (NSDs) and noncoding RNAs (ncRNAs). NSDs represent a common group of disorders, some of which are characterized by high morbidity and disabilities. The pathogenesis of NSDs at the molecular level remains poorly understood. ncRNAs are a large family of functionally important RNA molecules. Increasing evidence shows that diverse ncRNAs play a critical role in various NSDs. Mining and summarizing NSD-ncRNA association data can help researchers discover useful information. Hence, we developed an NSDNA database that documents 24 713 associations between 142 NSDs and 8593 ncRNAs in 11 species, curated from more than 1300 articles. This database provides a user-friendly interface for browsing and searching and allows for data downloading flexibility. In addition, NSDNA offers a submission page for researchers to submit novel NSD-ncRNA associations. It represents an extremely useful and valuable resource for researchers who seek to understand the functions and molecular mechanisms of ncRNA involved in NSDs. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.
Cadime, Irene; Rodrigues, Bruna; Santos, Sandra; Viana, Fernanda Leopoldina; Chaves-Sousa, Séli; do Céu Cosme, Maria; Ribeiro, Iolanda
2017-01-01
Empirical research has provided evidence for the simple view of reading across a variety of orthographies, but the role of oral reading fluency in the model is unclear. Moreover, the relative weight of listening comprehension, oral reading fluency and word recognition in reading comprehension seems to vary across orthographies and schooling years.…
precision deburring using NC and robot equipment. Final report
Energy Technology Data Exchange (ETDEWEB)
Gillespie, L.K.
1980-05-01
Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as 76.2-..mu..m maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.
Using a Multimedia-Based Program for Developing Student Teachers' EFL Speaking Fluency Skills
Diyyab, Eman Aly; Abdel-Haq, Eman Muhamad; Aly, Mahsoub Abdel-Sadeq
2013-01-01
The objective of the present study was to investigate the effectiveness of using a multimedia-based program for developing EFL speaking fluency skills among second year, English section student teachers. The sample of the present study consisted of thirty students at Sadat Faculty of Education, Minufiya University, Egypt. The study sample was…
The Development of L2 Fluency during Study Abroad: A Cross-Language Study
Di Silvio, Francesca; Diao, Wenhao; Donovan, Anne
2016-01-01
Examining speech samples from 75 American university students learning 1 of 3 languages (Mandarin, Russian, and Spanish), this article reports on a study of second language (L2) learners' oral fluency development and its relationship with their gains in holistic proficiency ratings during a semester abroad. In study abroad research, there is a…
Budde, Kristin S; Barron, Daniel S; Fox, Peter T
2014-12-01
Developmental stuttering is a speech disorder most likely due to a heritable form of developmental dysmyelination impairing the function of the speech-motor system. Speech-induced brain-activation patterns in persons who stutter (PWS) are anomalous in various ways; the consistency of these aberrant patterns is a matter of ongoing debate. Here, we present a hierarchical series of coordinate-based meta-analyses addressing this issue. Two tiers of meta-analyses were performed on a 17-paper dataset (202 PWS; 167 fluent controls). Four large-scale (top-tier) meta-analyses were performed, two for each subject group (PWS and controls). These analyses robustly confirmed the regional effects previously postulated as "neural signatures of stuttering" (Brown, Ingham, Ingham, Laird, & Fox, 2005) and extended this designation to additional regions. Two smaller-scale (lower-tier) meta-analyses refined the interpretation of the large-scale analyses: (1) a between-group contrast targeting differences between PWS and controls (stuttering trait); and (2) a within-group contrast (PWS only) of stuttering with induced fluency (stuttering state). Copyright © 2014 Elsevier Inc. All rights reserved.
ORF Sequence: NC_003283 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003283 gi|17563066 >gi|17563066|ref|NP_506462.1| putative protein family member, with a transme...mbrane domain (5O433) [Caenorhabditis elegans] MWNLVSPIHISSKFSMEMAEVNVVAVPEENRQTYLETDNDRLVMAIIWLIMPPMAVFFKCRGCTKHVFINFLLYLLLVLPAYKHATWFCFVKGREFEAEDGFVRAR
ORF Sequence: NC_003280 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003280 gi|17535455 >gi|17535455|ref|NP_495314.1| putative endoplasmic reticulum protein, with a transme...mbrane domain (2G788) [Caenorhabditis elegans] MTDVRFIIWNCIALLVALMMALTSIIILSDAPHNSME
The Relationship of Error Rate and Comprehension in Second and Third Grade Oral Reading Fluency.
Abbott, Mary; Wills, Howard; Miller, Angela; Kaufman, Journ
2012-01-01
This study explored the relationships of oral reading speed and error rate on comprehension with second and third grade students with identified reading risk. The study included 920 2nd graders and 974 3rd graders. Participants were assessed using Dynamic Indicators of Basic Early Literacy Skills (DIBELS) and the Woodcock Reading Mastery Test (WRMT) Passage Comprehension subtest. Results from this study further illuminate the significant relationships between error rate, oral reading fluency, and reading comprehension performance, and grade-specific guidelines for appropriate error rate levels. Low oral reading fluency and high error rates predict the level of passage comprehension performance. For second grade students below benchmark, a fall assessment error rate of 28% predicts that student comprehension performance will be below average. For third grade students below benchmark, the fall assessment cut point is 14%. Instructional implications of the findings are discussed.
Padeliadu, Susana; Antoniou, Faye
2014-01-01
Experts widely consider decoding and fluency as the basis of reading comprehension, while at the same time consistently documenting problems in these areas as major characteristics of students with learning disabilities. However, scholars have developed most of the relevant research within phonologically deep languages, wherein decoding problems…
Directory of Open Access Journals (Sweden)
Oshin eVartanian
2014-04-01
Full Text Available The dorsal and ventral aspects of the prefrontal cortex (PFC are the two regions most consistently recruited in divergent thinking tasks. Given that frontal tasks have been shown to be vulnerable to sleep loss, we explored the impact of a single night of sleep deprivation on fluency (i.e., number of generated responses and PFC function during divergent thinking. Participants underwent functional magnetic resonance imaging (fMRI scanning twice while engaged in the Alternate Uses Task (AUT—once following a single night of sleep deprivation and once following a night of normal sleep. They also wore wrist activity monitors, which enabled us to quantify daily sleep and model cognitive effectiveness. The intervention was effective, producing greater levels of fatigue and sleepiness. Modelled cognitive effectiveness and fluency were impaired following sleep deprivation, and sleep deprivation was associated with greater activation in the left inferior frontal gyrus during AUT. The results suggest that an intervention known to temporarily compromise frontal function can impair fluency, and that this effect is instantiated in the form of an increased haemodynamic response in the left inferior frontal gyrus.
ORF Sequence: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI
Fauvel, Baptiste; Groussard, Mathilde; Mutlu, Justine; Arenaza-Urquijo, Eider M; Eustache, Francis; Desgranges, Béatrice; Platel, Hervé
2014-01-01
Because of permanent use-dependent brain plasticity, all lifelong individuals' experiences are believed to influence the cognitive aging quality. In older individuals, both former and current musical practices have been associated with better verbal skills, visual memory, processing speed, and planning function. This work sought for an interaction between musical practice and cognitive aging by comparing musician and non-musician individuals for two lifetime periods (middle and late adulthood). Long-term memory, auditory-verbal short-term memory, processing speed, non-verbal reasoning, and verbal fluencies were assessed. In Study 1, measures of processing speed and auditory-verbal short-term memory were significantly better performed by musicians compared with controls, but both groups displayed the same age-related differences. For verbal fluencies, musicians scored higher than controls and displayed different age effects. In Study 2, we found that lifetime period at training onset (childhood vs. adulthood) was associated with phonemic, but not semantic, fluency performances (musicians who had started to practice in adulthood did not perform better on phonemic fluency than non-musicians). Current frequency of training did not account for musicians' scores on either of these two measures. These patterns of results are discussed by setting the hypothesis of a transformative effect of musical practice against a non-causal explanation.
ORF Sequence: NC_004605 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV... NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family
ORF Sequence: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin
De Novo Discovery of Structured ncRNA Motifs in Genomic Sequences
DEFF Research Database (Denmark)
Ruzzo, Walter L; Gorodkin, Jan
2014-01-01
De novo discovery of "motifs" capturing the commonalities among related noncoding ncRNA structured RNAs is among the most difficult problems in computational biology. This chapter outlines the challenges presented by this problem, together with some approaches towards solving them, with an emphas...... on an approach based on the CMfinder CMfinder program as a case study. Applications to genomic screens for novel de novo structured ncRNA ncRNA s, including structured RNA elements in untranslated portions of protein-coding genes, are presented.......De novo discovery of "motifs" capturing the commonalities among related noncoding ncRNA structured RNAs is among the most difficult problems in computational biology. This chapter outlines the challenges presented by this problem, together with some approaches towards solving them, with an emphasis...
Nyachwaya, James M.
2016-01-01
The objective of this study was to examine college general chemistry students' conceptual understanding and language fluency in the context of the topic of acids and bases. 115 students worked in groups of 2-4 to complete an activity on conductometry, where they were given a scenario in which a titration of sodium hydroxide solution and dilute…
ORF Sequence: NC_000913 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available erobacterial common antigen (ECA) [Escherichia coli K12] MKVLTVFGTRPEAIKMAPLVHALAKD... NC_000913 gi|49176409 >gi|49176409|ref|YP_026253.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent
ORF Sequence: NC_003282 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003282 gi|17540144 >gi|17540144|ref|NP_500824.1| feminization 1 homolog a, FEMinization of XX and XO ani...mals FEM-1 (fem-1) [Caenorhabditis elegans] MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWII
ORF Sequence: NC_000913 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL
ORF Sequence: NC_001137 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ull mutation has global effects on transcription; Yer064cp [Saccharomyces cerevisiae] MIDDTENSKIHLEGSHKTGKYT... NC_001137 gi|6320907 >gi|6320907|ref|NP_010986.1| Non-essential nuclear protein; n
ORF Sequence: NC_000913 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000913 gi|16128858 >gi|16128858|ref|NP_415411.1| periplasmic chaperone effects translocation of lipoprot...eins from inner membrane to outer membrane [Escherichia coli K12] MMKKIAITCALLSSLVA
ORF Sequence: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006905 gi|62179485 >gi|62179485|ref|YP_215902.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer membrane [Salmonella enterica subsp. enterica serov
Explicit flow equations and recursion operator of the ncKP hierarchy
International Nuclear Information System (INIS)
He, Jingsong; Wang, Lihong; Tu, Junyi; Li, Xiaodong
2011-01-01
The explicit expression of the flow equations of the noncommutative Kadomtsev–Petviashvili (ncKP) hierarchy is derived. Compared with the flow equations of the KP hierarchy, our result shows that the additional terms in the flow equations of the ncKP hierarchy indeed consist of commutators of dynamical coordinates {u i }. The recursion operator for the flow equations under n-reduction is presented. Further, under 2-reduction, we calculate a nonlocal recursion operator Φ(2) of the noncommutative Korteweg–de Vries(ncKdV) hierarchy, which generates a hierarchy of local, higher-order flows. Thus we solve the open problem proposed by Olver and Sokolov (1998 Commun. Math. Phys. 193 245–68)
Testing the QCD string at large Nc from the thermodynamics of the hadronic phase
Cohen, Thomas D.
2007-02-01
It is generally believed that in the limit of a large number of colors (Nc) the description of confinement via flux tubes becomes valid and QCD can be modeled accurately via a hadronic string theory—at least for highly excited states. QCD at large Nc also has a well-defined deconfinement transition at a temperature Tc. In this talk it is shown how the thermodyanmics of the metastable hadronic phase of QCD (above Tc) at large NC can be related directly to properties of the effective QCD string. The key points in the derivation is the weakly interacting nature of hadrons at large Nc and the existence of a Hagedorn temperature TH for the effective string theory. From this it can be seen at large Nc and near TH, the energy density and pressure of the hadronic phase scale as E ˜ (TH - T)-(D⊥-6)/2 (for D⊥ TH - T)-(D⊥-4)/2 (for D⊥ TH > Tc this behavior is of relevance only to the metastable phase. The prospect of using this result to extract D⊥ via lattice simulations of the metastable hadronic phase at moderately large Nc is discussed.
ORF Sequence: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter
ORF Sequence: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter
ORF Sequence: NC_000913 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000913 gi|16131649 >gi|16131649|ref|NP_418241.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli K12] MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVR
ORF Sequence: NC_001147 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_001147 gi|6324442 >gi|6324442|ref|NP_014511.1| Plasma membrane Mg(2+) transporter, expression and turnov...er are regulated by Mg(2+) concentration; overexpression confers increased toleranc
ORF Sequence: NC_001134 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ivery of heterogeneous nuclear ribonucleoproteins to the nucleoplasm, binds rg-nucl... NC_001134 gi|6319491 >gi|6319491|ref|NP_009573.1| Transportin, cytosolic karyopherin beta 2 involved in del
Directory of Open Access Journals (Sweden)
Hirosawa R
2013-07-01
Full Text Available Rikuei Hirosawa,1 Jin Narumoto,1 Yuki Sakai,1 Seiji Nishida,2 Takuya Ishida,1 Takashi Nakamae,1 Yuichi Takei,3 Kenji Fukui1 1Department of Psychiatry, Graduate School of Medicine, Kyoto Prefectural University of Medicine, Kyoto, 2Maizuru Medical Center, Kyoto, 3Department of Psychiatry and Neuroscience, Gunma University Graduate School of Medicine, Gunma, Japan Background: Near-infrared spectroscopy has helped our understanding of the neurobiological mechanisms of psychiatric disorders and has advantages including noninvasiveness, lower cost, and ease of use compared with other imaging techniques, like functional magnetic resonance imaging. The verbal fluency task is the most common and well established task used to assess cognitive activation during near-infrared spectroscopy. Recent functional neuroimaging studies have shown that the orbitofrontal cortex and other brain regions, including the dorsolateral prefrontal cortex, may play important roles in the pathophysiology of obsessive-compulsive disorder (OCD. This study aimed to evaluate hemodynamic responses in the dorsolateral prefrontal cortex in patients with OCD using near-infrared spectroscopy during the verbal fluency task and to compare these with dorsolateral prefrontal cortex responses in healthy controls. Methods: Twenty patients with OCD and 20 controls matched for age, gender, handedness, and estimated intelligence quotient participated in this study. The verbal fluency task was used to elicit near-infrared spectroscopic activation and consisted of a 30-second pre-task, followed by three repetitions of a 20-second verbal fluency task (total 60 seconds, followed by a 70-second post-task period. The near-infrared spectroscopy experiment was conducted on the same day as surveys of obsessive-compulsive symptoms, depression, and anxiety. Z-scores for changes in the concentration of oxygenated hemoglobin were compared between the OCD patients and controls in 14 channels set over the
Can a "Shouting" Digital Game Help Learners Develop Oral Fluency in a Second Language?
Grimshaw, Jennica; Cardoso, Walcir; Waddington, David
2016-01-01
This study examines the development of oral fluency in a Computer-Mediated Communication (CMC) environment that uses a "shouting" digital game as a pedagogical tool: Spaceteam ESL4. Spaceteam ESL is a game for mobile devices that involves time-sensitive aural exchanges among players (English learners), with great potential to promote…
ORF Alignment: NC_002977 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002977 gi|53804693 >1fgjA 20 492 48 517 e-179 ... gb|AAU92745.1| hydroxylamine oxy...doreductase [Methylococcus capsulatus str. Bath] ... ref|YP_113436.1| hydroxylamine oxydoreductase ...
ORF Alignment: NC_006569 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006569 gi|56708985 >1fgjA 5 498 32 521 0.0 ... ref|YP_165030.1| hydroxylamine oxid...oreductase [Silicibacter pomeroyi DSS-3] ... gb|AAV97335.1| hydroxylamine oxidoreductase ... [
ORF Alignment: NC_004307 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK
ORF Sequence: NC_002945 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002945 gi|31792282 >gi|31792282|ref|NP_854775.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium bovis AF2122/97] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY
ORF Sequence: NC_000962 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000962 gi|57116825 >gi|57116825|ref|YP_177638.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium tuberculosis H37Rv] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY
ORF Sequence: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006905 gi|62181272 >gi|62181272|ref|YP_217689.1| H inversion: regulation of fla...gellar gene expression by site-specific inversion of DNA [Salmonella enterica subsp. enterica serovar Choler
The role of auditory temporal cues in the fluency of stuttering adults
Furini, Juliana; Picoloto, Luana Altran; Marconato, Eduarda; Bohnen, Anelise Junqueira; Cardoso, Ana Claudia Vieira; Oliveira, Cristiane Moço Canhetti de
2017-01-01
ABSTRACT Purpose: to compare the frequency of disfluencies and speech rate in spontaneous speech and reading in adults with and without stuttering in non-altered and delayed auditory feedback (NAF, DAF). Methods: participants were 30 adults: 15 with Stuttering (Research Group - RG), and 15 without stuttering (Control Group - CG). The procedures were: audiological assessment and speech fluency evaluation in two listening conditions, normal and delayed auditory feedback (100 milliseconds dela...
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17546028 >1fjgR 2 71 22 91 5e-16 ... emb|CAD15011.1| PROBABLE PRIMOSOMAL REPLICATION... PROTEIN [Ralstonia solanacearum] ... ref|NP_519430.1| PROBABLE PRIMOSOMAL REPLICATION ...
ORF Alignment: NC_003228 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003228 gi|60681683 >1gntA 1 551 3 543 0.0 ... emb|CAH07898.1| hydroxylamine reduct...ase [Bacteroides fragilis NCTC 9343] ... ref|YP_211827.1| hydroxylamine reductase [Bacteroides ...
ORF Sequence: NC_003281 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003281 gi|25151987 >gi|25151987|ref|NP_499440.2| TRAnsformer : XX animals trans...formed into males TRA-1, HERmaphrodization of XO animals HER-2, sex determination zinc-finger protein, alter
ORF Sequence: NC_003282 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available inization of XX and XO animals FEM-3 (46.2 kD) (fem-3) [Caenorhabditis elegans] MEVDPGSDDVEADRETRAQKLKLKRNVK... NC_003282 gi|17540880 >gi|17540880|ref|NP_501587.1| sex determination protein, FEM
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...
ORF Alignment: NC_006155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006155 gi|51597538 >1kmoA 5 661 59 714 9e-71 ... ref|YP_071729.1| putative hydroxamate-type ferris...ive ... hydroxamate-type ferrisiderophore receptor. [Yersinia ... pseudotuberculosis IP 32953
ORF Alignment: NC_006274 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006274 gi|52142162 >1gpuA 4 663 4 663 0.0 ... ref|YP_084669.1| transketolase (glycoal...dehyde transferase) [Bacillus cereus ZK] ... gb|AAU17181.1| transketolase (glycoaldehyde transfera
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003888 gi|21219041 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce
ORF Alignment: NC_003306 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003306 gi|17938860 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce
ORF Alignment: NC_003064 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003064 gi|16119505 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce
ORF Sequence: NC_001145 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_001145 gi|6323710 >gi|6323710|ref|NP_013781.1| Protein required for nuclear mem...brane fusion during karyogamy, localizes to the membrane with a soluble portion in the endoplasmic reticulum
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003919 gi|21242752 >1iwlA 2 180 23 207 3e-47 ... gb|AAM36870.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas axonopodis pv. citr
ORF Alignment: NC_006370 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006370 gi|54308356 >1iwlA 4 181 22 199 2e-52 ... ref|YP_129376.1| hypothetical outer membrane lipoproteins... ... hypothetical outer membrane lipoproteins carrier protein ... [Photobacterium profundum] ... L
ORF Sequence: NC_002655 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002655 gi|15800754 >gi|15800754|ref|NP_286768.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer [Escherichia coli O157:H7 EDL933] MMKKIAITCALLSSLVA
Predicting short-term stock fluctuations by using processing fluency
Alter, Adam L.; Oppenheimer, Daniel M.
2006-01-01
Three studies investigated the impact of the psychological principle of fluency (that people tend to prefer easily processed information) on short-term share price movements. In both a laboratory study and two analyses of naturalistic real-world stock market data, fluently named stocks robustly outperformed stocks with disfluent names in the short term. For example, in one study, an initial investment of $1,000 yielded a profit of $112 more after 1 day of trading for a basket of fluently named shares than for a basket of disfluently named shares. These results imply that simple, cognitive approaches to modeling human behavior sometimes outperform more typical, complex alternatives. PMID:16754871
Potter, Kevin W; Donkin, Chris; Huber, David E
2018-03-01
With immediate repetition priming of forced choice perceptual identification, short prime durations produce positive priming (i.e., priming the target leads to higher accuracy, while priming the foil leads to lower accuracy). Many theories explain positive priming following short duration primes as reflecting increased perceptual fluency for the primed target (i.e., decreased identification latency). However, most studies only examine either accuracy or response times, rather than considering the joint constraints of response times and accuracy to properly address the role of decision biases and response caution. This is a critical oversight because several theories propose that the transition to negative priming following a long duration prime reflects a decision strategy to compensate for the effect of increased perceptual fluency. In contrast, the nROUSE model of Huber and O'Reilly (2003) explains this transition as reflecting perceptual habituation, and thus a change to perceptual disfluency. We confirmed this prediction by applying a sequential sampling model (the diffusion race model) to accuracy and response time distributions from a new single item same-different version of the priming task. In this way, we measured strategic biases and perceptual fluency in each condition for each subject. The nROUSE model was only applied to accuracy from the original forced-choice version of the priming task. This application of nROUSE produced separate predictions for each subject regarding the degree of fluency and disfluency in each condition, and these predictions were confirmed by the drift rate parameters (i.e., fluency) from the response time model in contrast to the threshold parameters (i.e., bias). Copyright © 2017 Elsevier Inc. All rights reserved.
46 CFR 7.55 - Cape Henry, VA to Cape Fear, NC.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Cape Henry, VA to Cape Fear, NC. 7.55 Section 7.55 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES Atlantic Coast § 7.55 Cape Henry, VA to Cape Fear, NC. (a) A line drawn from Rudee Inlet Jetty Light “2” to...
Hearing "Quack" and Remembering a Duck: Evidence for Fluency Attribution in Young Children
Geurten, Marie; Lloyd, Marianne; Willems, Sylvie
2017-01-01
Previous research has suggested that fluency does not influence memory decisions until ages 7-8. In two experiments (n = 96 and n = 64, respectively), children, aged 4, 6, and 8 years (Experiments 1 and 2), and adults (Experiment 2) studied a list of pictures. Participants completed a recognition test during which each study item was preceded by a…
ORF Alignment: NC_006371 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006371 gi|54302237 >1r690 2 63 15 79 7e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...
ORF Alignment: NC_002947 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...
ORF Sequence: NC_001139 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_001139 gi|6321518 >gi|6321518|ref|NP_011595.1| Protein of unknown function; deletion... mutant has synthetic fitness defect with an sgs1 deletion mutant; Slx9p [Saccharomyces cerevisiae] MVA
ORF Alignment: NC_004461 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004461 gi|27467238 >1kolA 35 391 30 342 2e-04 ... ref|NP_763875.1| xylitol dehydro...genase [Staphylococcus epidermidis ATCC 12228] ... gb|AAO03917.1| xylitol dehydrogenase [Staphylococc
ORF Sequence: NC_002655 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available erobacterial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSAKALAAYSKRIDV... NC_002655 gi|15804377 >gi|15804377|ref|NP_290417.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent
ORF Alignment: NC_003075 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003075 gi|42566272 >1ogqA 3 270 31 261 6e-05 ... ref|NP_192248.2| leucine-rich repeat transme...ery: 151 XXXXXXXGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 210 ... GELPDVFQNLVGLINLDISSNNISGTLPPSME...NLLTLTTLRVQNNQLSGTLDV Sbjct: 121 LNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 180 ...
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17546366 >1bxdA 1 144 297 447 7e-18 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...PROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17546366 >1joyA 1 67 230 295 9e-16 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...ROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE
ORF Alignment: NC_002928 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002928 gi|33596933 >1kmoA 7 661 65 702 8e-60 ... ref|NP_884576.1| putative ferrisi...derophore receptor [Bordetella parapertussis 12822] ... emb|CAE37631.1| putative ferrisiderophore rec
ORF Alignment: NC_003155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003155 gi|29832733 >1chkA 1 236 48 283 9e-87 ... dbj|BAC73902.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_827367.1| putative chitosanase [Streptomyces ...
ORF Alignment: NC_003155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003155 gi|29828557 >1chkA 1 236 35 270 4e-95 ... dbj|BAC69726.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_823191.1| putative chitosanase [Streptomyces ...
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tide synthetase [Actinoplanes teichomyceticus] ... Length = 427 ... Query: 12 ... LSPLQEGMLFHNLFDEEELDAYNVQ... NC_003888 gi|32141196 >1l5aA 1 423 12 438 2e-57 ... emb|CAE53352.1| non-ribosomal pep
ORF Alignment: NC_005363 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005363 gi|42523916 >1a12A 35 375 64 376 3e-39 ... emb|CAE53335.1| putative RCC1 repeats protein [Actinoplan...es teichomyceticus] ... Length = 313 ... Query: 425 GVGFACALYDNNDLKCFGANDYGQLGD
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34557077 >1vdkA 1 459 5 463 e-135 ... ref|NP_906892.1| ASPARTATE AMMONIA...-LYASE [Wolinella succinogenes DSM 1740] ... emb|CAE09792.1| ASPARTATE AMMONIA-LYASE [Wolinella ...
ORF Alignment: NC_003450 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003450 gi|19553429 >1v4aA 22 435 620 1034 4e-69 ... ref|YP_226470.1| GLUTAMATE-AMMONIA...mb|CAF20569.1| ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERASE ... [Corynebacterium glutami
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17547365 >1gkmA 3 497 10 504 e-143 ... emb|CAD16353.1| PROBABLE HISTIDINE AMMONIA...-LYASE (HISTIDASE) PROTEIN [Ralstonia ... solanacearum] ref|NP_520767.1| PROBABLE HISTIDINE ... AMMONIA
ORF Alignment: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003047 gi|15966456 >1gkmA 2 501 3 499 e-107 ... emb|CAC47282.1| PUTATIVE HISTIDINE AMMONIA...-LYASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_386809.1| PUTATIVE HISTIDINE AMMONIA-LYASE
ORF Alignment: NC_003450 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003450 gi|19552717 >1vdkA 1 459 57 516 e-127 ... ref|YP_225787.1| ASPARTATE AMMONIA...ynebacterium glutamicum ATCC 13032] emb|CAF21511.1| ... ASPARTATE AMMONIA-LYASE (ASPARTASE) [Coryneba
The Effects of Divided Attention on Speech Motor, Verbal Fluency, and Manual Task Performance
Dromey, Christopher; Shim, Erin
2008-01-01
Purpose: The goal of this study was to evaluate aspects of the "functional distance hypothesis," which predicts that tasks regulated by brain networks in closer anatomic proximity will interfere more with each other than tasks controlled by spatially distant regions. Speech, verbal fluency, and manual motor tasks were examined to ascertain whether…
ORF Alignment: NC_005085 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005085 gi|34497787 >1f39A 3 98 107 198 1e-23 ... gb|AAQ60004.1| SOS mutagenesis [C...hromobacterium violaceum ATCC 12472] ... ref|NP_902002.1| SOS mutagenesis [Chromobacterium ...
ORF Alignment: NC_006840 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006840 gi|59712585 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization
ORF Alignment: NC_004605 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004605 gi|28900550 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization
ORF Alignment: NC_006085 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006085 gi|50842772 >1qr0A 1 205 2 202 3e-27 ... ref|YP_055999.1| biosurfactants pr...oduction protein [Propionibacterium acnes ... KPA171202] gb|AAT83041.1| biosurfactants production ...
ORF Sequence: NC_002655 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002655 gi|15804385 >gi|15804385|ref|NP_290425.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSLLQFSGLFVVWLLCTLFIA
ORF Alignment: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002678 gi|13474471 >1gkpA 2 454 5 422 3e-10 ... ref|NP_106039.1| creatinine deamin...ase [Mesorhizobium loti MAFF303099] ... dbj|BAB51825.1| creatinine deaminase [Mesorhizobium loti ...
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004463 gi|27381528 >1uzbA 40 515 6 475 3e-74 ... ref|NP_773057.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC51682.1| vanillin: NAD oxidoreductase ...
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004463 gi|27377799 >1uzbA 40 515 5 474 3e-69 ... ref|NP_769328.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC47953.1| vanillin: NAD oxidoreductase ...
ORF Alignment: NC_006361 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006361 gi|54024866 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut
ORF Alignment: NC_003450 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003450 gi|19554128 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17546367 >1kgsA 3 221 7 234 1e-40 ... emb|CAD15350.1| PROBABLE OXIDATIVE STRESS... ... solanacearum] ref|NP_519769.1| PROBABLE OXIDATIVE STRESS ... RESISTANCE TWO-COMPONENT RESPON
ORF Alignment: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005027 gi|32475765 >1zrn0 11 219 5 254 2e-04 ... ref|NP_868759.1| N-acetylglucosamine-6-phosha... ... N-acetylglucosamine-6-phoshatase or p-nitrophenyl ... phosphatase [Pirellula sp.] ... Len
ORF Alignment: NC_002939 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002939 gi|39996821 >1v7zA 3 252 1 232 3e-42 ... ref|NP_952772.1| creatinine amidoh...ydrolase [Geobacter sulfurreducens PCA] ... gb|AAR35099.1| creatinine amidohydrolase [Geobacter ...
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003888 gi|21225320 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003888 gi|21225300 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces
ORF Alignment: NC_002929 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002929 gi|33592999 >1kmoA 7 661 65 702 1e-60 ... ref|NP_880643.1| putative ferrisi...derophore receptor [Bordetella pertussis Tohama I] ... emb|CAE42244.1| putative ferrisiderophore rece
ORF Alignment: NC_002927 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002927 gi|33600770 >1kmoA 7 661 65 702 2e-60 ... ref|NP_888330.1| putative ferrisi...derophore receptor [Bordetella bronchiseptica RB50] ... emb|CAE32282.1| putative ferrisiderophore rec
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003888 gi|21219207 >1chkA 2 236 45 279 3e-87 ... ref|NP_624986.1| secreted chitosan...ase [Streptomyces coelicolor A3(2)] ... emb|CAB61194.1| secreted chitosanase [Streptomyces ...
ORF Alignment: NC_003911 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003911 gi|56696447 >1dlwA 19 115 21 125 4e-12 ... gb|AAV94850.1| protozoan/cyanoba...cterial globin family protein [Silicibacter ... pomeroyi DSS-3] ref|YP_166804.1| ... protozoan
ORF Alignment: NC_002977 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002977 gi|53804116 >1dlwA 19 113 26 120 5e-13 ... gb|AAU92168.1| protozoan/cyanoba...cterial globin family protein [Methylococcus ... capsulatus str. Bath] ref|YP_114018.1| ... protozoa
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39933534 >1rkd0 3 296 29 346 6e-36 ... emb|CAE25901.1| possible cabohydr...ate kinases [Rhodopseudomonas palustris CGA009] ... ref|NP_945810.1| possible cabohydrate kinases ...
ORF Alignment: NC_003296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003296 gi|17548586 >1gkmA 10 504 26 526 e-118 ... ref|NP_521926.1| PROBABLE HISTIDINE AMMONIA...-LYASE PROTEIN [Ralstonia solanacearum ... GMI1000] emb|CAD17516.1| PROBABLE HISTIDINE ... AMMONIA
ORF Alignment: NC_003902 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003902 gi|21231422 >1iwlA 2 180 23 207 3e-47 ... ref|NP_637339.1| outer-membrane lipoproteins... ... gb|AAM41263.1| outer-membrane lipoproteins carrier ... protein precursor [Xanthomonas campest
Untimed Design Fluency in Aging and Alzheimer's Disease: Psychometrics and Normative Data.
Sunderaraman, Preeti; Sokolov, Elisaveta; Cines, Sarah; Sullo, Elizabeth; Orly, Aidan; Lerer, Bianca; Karlawish, Jason; Huey, Edward; Cosentino, Stephanie
2015-01-01
Design fluency tests, commonly used in both clinical and research contexts to evaluate nonverbal concept generation, have the potential to offer useful information in the differentiation of healthy versus pathological aging. Although normative data for older adults (OAs) are available for multiple timed versions of this test, similar data have been unavailable for a previously published untimed test, the Graphic Pattern Generation Test (GPG). Time constraints common to almost all of the available design fluency tests may cloud interpretation of higher-level executive abilities-for example, in individuals with slow processing speed. The current study examined the psychometric properties of the GPG and presents normative data in a sample of 167 healthy OAs and 110 individuals diagnosed with Alzheimer's disease (AD). Results suggest that a brief version of the GPG can be administered reliably and that this short form has high test-retest and interrater reliability. Number of perseverations was higher in individuals with AD as compared with OAs. A cutoff score of 4 or more perseverations showed a moderate degree of sensitivity (76%) and specificity (37%) in distinguishing individuals with AD and OAs. Finally, perseverations were associated with nonmemory indexes, thereby underscoring the nonverbal nature of this error in OAs and individuals with AD.
Video self-modeling as a post-treatment fluency recovery strategy for adults.
Harasym, Jessica; Langevin, Marilyn; Kully, Deborah
2015-06-01
This multiple-baseline across subjects study investigated the effectiveness of video self-modeling (VSM) in reducing stuttering and bringing about improvements in associated self-report measures. Participants' viewing practices and perceptions of the utility of VSM also were explored. Three adult males who had previously completed speech restructuring treatment viewed VSM recordings twice per week for 6 weeks. Weekly speech data, treatment viewing logs, and pre- and post-treatment self-report measures were obtained. An exit interview also was conducted. Two participants showed a decreasing trend in stuttering frequency. All participants appeared to engage in fewer avoidance behaviors and had less expectations to stutter. All participants perceived that, in different ways, the VSM treatment had benefited them and all participants had unique viewing practices. Given the increasing availability and ease in using portable audio-visual technology, VSM appears to offer an economical and clinically useful tool for clients who are motivated to use the technology to recover fluency. Readers will be able to describe: (a) the tenets of video-self modeling; (b) the main components of video-self modeling as a fluency recovery treatment as used in this study; and (c) speech and self-report outcomes. Copyright © 2015 Elsevier Inc. All rights reserved.
Van Wig, Ann
2016-01-01
The purpose of this quantitative, quasi-experimental study was to investigate the impact of a repeated reading fluency intervention focused on prosody, counterbalanced with an intervention focused on reading strategies. Both of these interventions were designed to promote feelings of achievement through participation in activities intended to…
Cho, Eunsoo; Capin, Philip; Roberts, Greg; Vaughn, Sharon
2017-07-01
Within multitiered instructional delivery models, progress monitoring is a key mechanism for determining whether a child demonstrates an adequate response to instruction. One measure commonly used to monitor the reading progress of students is oral reading fluency (ORF). This study examined the extent to which ORF slope predicts reading comprehension outcomes for fifth-grade struggling readers ( n = 102) participating in an intensive reading intervention. Quantile regression models showed that ORF slope significantly predicted performance on a sentence-level fluency and comprehension assessment, regardless of the students' reading skills, controlling for initial ORF performance. However, ORF slope was differentially predictive of a passage-level comprehension assessment based on students' reading skills when controlling for initial ORF status. Results showed that ORF explained unique variance for struggling readers whose posttest performance was at the upper quantiles at the end of the reading intervention, but slope was not a significant predictor of passage-level comprehension for students whose reading problems were the most difficult to remediate.
ORF Alignment: NC_003902 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003902 gi|21232942 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21242877 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_004663 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004663 gi|29348666 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_004578 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004578 gi|28867366 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_005139 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_005139 gi|37678876 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21241391 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_006177 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006177 gi|51892124 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_006349 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006349 gi|53716793 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_006840 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006840 gi|59711756 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_006370 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006370 gi|54310137 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21243399 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_003869 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003869 gi|20807352 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_006351 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006351 gi|53722013 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_004459 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004459 gi|27363966 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Alignment: NC_004461 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004461 gi|27467672 >1pwgA 4 344 72 389 1e-36 ... ref|NP_764309.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... epidermidis ATCC 12228] gb|AAO04351.1| autolysis
ORF Alignment: NC_006834 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006834 gi|58583632 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put
ORF Sequence: NC_001136 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_001136 gi|6320573 >gi|6320573|ref|NP_010653.1| Nucleolar protein involved in pre-rRNA processing; deplet...ion causes severely decreased 18S rRNA levels; Esf1p [Saccharomyces cerevisiae] MAG
ORF Alignment: NC_000964 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000964 gi|16078891 >1jmkC 6 230 1056 1270 2e-59 ... ref|NP_389712.1| plipastatin s...ynthetase [Bacillus subtilis subsp. subtilis str. 168] ... emb|CAB13713.1| plipastatin synthetase [B
ORF Alignment: NC_006841 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006841 gi|59714046 >1gntA 1 552 1 553 0.0 ... ref|YP_206821.1| hydroxylamine reduc...tase [Vibrio fischeri ES114] gb|AAW87933.1| ... hydroxylamine reductase [Vibrio fischeri ES114] ...
ORF Alignment: NC_006677 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006677 gi|58039331 >1hxhA 1 247 2 262 8e-39 ... pir||JC7939 xylitol dehydrogenase ...(EC 1.1.1.-) - Gluconobacter oxydans (Strain ... ATCC621) dbj|BAC16227.1| xylitol dehydrogenase ...
ORF Alignment: NC_002570 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002570 gi|15612789 >1v7zA 3 254 1 238 1e-53 ... dbj|BAB03945.1| creatinine amidohy...drolase [Bacillus halodurans C-125] ... ref|NP_241092.1| creatinine amidohydrolase [Bacillus ...
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004463 gi|27377041 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta
ORF Alignment: NC_000909 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000909 gi|15669839 >1gxlA 2 204 475 685 1e-34 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta
ORF Alignment: NC_003237 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003237 gi|19075000 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta
ORF Alignment: NC_000909 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000909 gi|15669839 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus jannaschii ... DSM 2661] gb|AAB99663.1| chromosome segreta
ORF Alignment: NC_003485 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003485 gi|19746967 >1g5aA 98 625 11 538 6e-94 ... gb|AAL98602.1| putative dextran ...glucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608103.1| putative dextran glucosidase ...
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34556965 >1mzbA 1 134 1 130 7e-21 ... ref|NP_906780.1| PEROXIDE STRESS R...EGULATOR [Wolinella succinogenes DSM 1740] ... emb|CAE09680.1| PEROXIDE STRESS REGULATOR [Wolinella ...
ORF Alignment: NC_006395 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006395 gi|55376664 >1v7zA 1 249 5 243 8e-44 ... ref|YP_134515.1| creatinine amidoh...ydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV44809.1| creatinine amidohydrolase [Haloarcula
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39933548 >1v7zA 10 254 14 256 2e-44 ... emb|CAE25915.1| putative creatin...e amidohydrolase [Rhodopseudomonas palustris ... CGA009] ref|NP_945824.1| putative creatine ...
ORF Alignment: NC_002928 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002928 gi|33596750 >1v7zA 3 253 1 251 8e-40 ... ref|NP_884393.1| putative creatini...ne amidohydrolase [Bordetella parapertussis 12822] ... emb|CAE37436.1| putative creatinine amidohydro
ORF Alignment: NC_006576 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006576 gi|56750058 >1v7zA 4 251 11 256 7e-49 ... ref|YP_170759.1| creatinine amido...hydrolase [Synechococcus elongatus PCC 6301] ... dbj|BAD78239.1| creatinine amidohydrolase [Synechoco
ORF Alignment: NC_006395 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006395 gi|55376890 >1v7zA 5 250 13 257 5e-37 ... ref|YP_134741.1| creatinine amido...hydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV45035.1| creatinine amidohydrolase [Haloarcul
ORF Alignment: NC_004311 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004311 gi|23500710 >1v7zA 10 254 1 242 2e-43 ... gb|AAN34155.1| creatinine amidohy...drolase, putative [Brucella suis 1330] ... ref|NP_700150.1| creatinine amidohydrolase, putative ...
ORF Alignment: NC_002771 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002771 gi|15829246 >1nm8A 15 579 43 592 3e-82 ... ref|NP_326606.1| CARNITINE O-ACE...TYLTRANSFERASE [Mycoplasma pulmonis UAB CTIP] ... emb|CAC13948.1| CARNITINE O-ACETYLTRANSFERASE ...
ORF Alignment: NC_006677 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006677 gi|58039110 >1kmoA 11 661 79 730 2e-52 ... ref|YP_191074.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60418.1| Hydroxamate-type ferrisid
ORF Alignment: NC_006677 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006677 gi|58039006 >1kmoA 12 661 92 773 1e-43 ... ref|YP_190970.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60314.1| Hydroxamate-type ferrisid
ORF Alignment: NC_006370 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006370 gi|54310050 >1r0wC 43 281 30 288 6e-50 ... ref|YP_131070.1| putative ABC-type oligopeptide transport...putative ... ABC-type oligopeptide transportsystem, ATPase component ... [Photobacterium profu
ORF Alignment: NC_006361 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006361 gi|54022220 >1y7yA 7 68 12 73 3e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...
ORF Sequence: NC_001141 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_001141 gi|6322114 >gi|6322114|ref|NP_012189.1| Part of a heptameric protein complex that regulates retro...grade Golgi-to-ER protein traffic in eukaryotic cells; coatomer forms the COP I ves
ORF Alignment: NC_005085 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005085 gi|34499386 >1qgiA 1 259 102 360 4e-95 ... gb|AAQ61593.1| probable chitosan...ase A [Chromobacterium violaceum ATCC 12472] ... ref|NP_903601.1| probable chitosanase A [Chromobacte
ORF Alignment: NC_006274 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006274 gi|52142820 >1kwfA 3 362 53 435 5e-85 ... ref|YP_084010.1| chitosanase; gly...cosyl hydrolases family 8; endoglucanase [Bacillus ... cereus ZK] gb|AAU17839.1| chitosanase; glycosy
ORF Alignment: NC_006348 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006348 gi|53725407 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac
ORF Alignment: NC_002976 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002976 gi|57866545 >1dlwA 19 115 47 146 6e-19 ... ref|YP_188173.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... epidermidis RP62A] gb|AAW53991.1| ... protozoa
ORF Alignment: NC_002951 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002951 gi|57650195 >1dlwA 19 115 21 120 3e-19 ... ref|YP_185875.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus COL] gb|AAW36475.1| ... protozoa
ORF Alignment: NC_006350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006350 gi|53718816 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac
ORF Alignment: NC_006087 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006087 gi|50955733 >1exqA 11 145 176 318 6e-09 ... ref|YP_063021.1| transposase, undefined... [Leifsonia xyli subsp. xyli str. CTCB07] ... gb|AAT89916.1| transposase, undefined [Leifsoni
ORF Alignment: NC_004668 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004668 gi|29376585 >1pq4B 1 288 29 305 1e-52 ... ref|NP_815739.1| endocarditis spe...cific antigen [Enterococcus faecalis V583] ... gb|AAO81809.1| endocarditis specific antigen ...
ORF Alignment: NC_000921 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000921 gi|15612352 >1mwmA 3 314 14 329 4e-45 ... ref|NP_224005.1| ROD SHAPE-DETERMINING... PROTEIN [Helicobacter pylori J99] ... gb|AAD06861.1| ROD SHAPE-DETERMINING PROTEIN ... [
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17544778 >1mwmA 4 314 14 329 3e-49 ... emb|CAD13587.1| PROBABLE ROD SHAPE-DETERMINING... PROTEIN [Ralstonia solanacearum] ... ref|NP_518180.1| PROBABLE ROD SHAPE-DETERMINING PR
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17548082 >1wcv1 2 241 2 249 7e-27 ... emb|CAD16862.1| PROBABLE SEPTUM SITE-DETERMINING... PROTEIN MIND [Ralstonia ... solanacearum] ref|NP_521484.1| PROBABLE SEPTUM ... SITE-DETERMINING
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17547375 >1v4aA 29 433 25 452 2e-95 ... emb|CAD16363.1| PROBABLE GLUTAMATE-AMMONIA... ... [Ralstonia solanacearum] ref|NP_520777.1| PROBABLE ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERAS
ORF Alignment: NC_003317 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003317 gi|17987610 >1v4aA 20 435 2 420 e-106 ... gb|AAL52508.1| GLUTAMATE-AMMONIA-...LIGASE ADENYLYLTRANSFERASE [Brucella melitensis ... 16M] ref|NP_540244.1| GLUTAMATE-AMMONIA-LIGASE ...
ORF Alignment: NC_005126 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005126 gi|37525549 >1iwlA 1 182 22 203 4e-57 ... ref|NP_928893.1| outer-membrane lipoproteins... ... emb|CAE13895.1| outer-membrane lipoproteins carrier ... protein precursor (P20) [Photorhabdus
ORF Alignment: NC_004603 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004603 gi|28897880 >1iwlA 4 181 30 207 4e-54 ... ref|NP_797485.1| outer membrane lipoproteins... carrier protein [Vibrio ... parahaemolyticus RIMD 2210633] dbj|BAC59369.1| outer ... membrane lipoproteins
ORF Alignment: NC_005966 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005966 gi|50085964 >1iwlA 2 180 37 230 6e-44 ... ref|YP_047474.1| outer-membrane lipoproteins... carrier protein [Acinetobacter sp. ... ADP1] emb|CAG69652.1| outer-membrane lipoproteins
ORF Alignment: NC_005139 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005139 gi|37679507 >1iwlA 4 181 20 197 6e-54 ... ref|NP_934116.1| outer membrane lipoproteins...tein ... carrier protein precursor dbj|BAC94087.1| outer membrane ... lipoproteins carrier pro
ORF Alignment: NC_005085 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005085 gi|34497069 >1iwlA 2 178 25 203 1e-46 ... gb|AAQ59290.1| outer membrane lipoproteins... carrier protein [Chromobacterium ... violaceum ATCC 12472] ref|NP_901284.1| outer membrane ... lipoproteins
Processing the Order of Symbolic Numbers: A Reliable and Unique Predictor of Arithmetic Fluency
Directory of Open Access Journals (Sweden)
Stephan E. Vogel
2017-12-01
Full Text Available A small but growing body of evidence suggests a link between individual differences in processing the order of numerical symbols (e.g., deciding whether a set of digits is arranged in ascending/descending order or not and arithmetic achievement. However, the reliability of behavioral correlates measuring symbolic and non-symbolic numerical order processing and their relationship to arithmetic abilities remain poorly understood. The present study aims to fill this knowledge gap by examining the behavioral correlates of numerical and non-numerical order processing and their unique associations with arithmetic fluency at two different time points within the same sample of individuals. Thirty-two right-handed adults performed three order judgment tasks consisting of symbolic numbers (i.e., digits, non-symbolic numbers (i.e., dots, and letters of the alphabet. Specifically, participants had to judge as accurately and as quickly as possible whether stimuli were ordered correctly (in ascending/descending order, e.g., 2-3-4; ●●●●-●●●-●●; B-C-D or not (e.g., 4-5-3; ●●●●-●●●●●-●●●; D-E-C. Results of this study demonstrate that numerical order judgments are reliable measurements (i.e., high test-retest reliability, and that the observed relationship between symbolic number processing and arithmetic fluency accounts for a unique and reliable portion of variance over and above the non-symbolic number and the letter conditions. The differential association of symbolic and non-symbolic numbers with arithmetic support the view that processing the order of symbolic and non-symbolic numbers engages different cognitive mechanisms, and that the ability to process ordinal relationships of symbolic numbers is a reliable and unique predictor of arithmetic fluency.
Reading Fluency as a Predictor of Reading Proficiency in Low-Performing, High-Poverty Schools
Baker, Scott K.; Smolkowski, Keith; Katz, Rachell; Fien, Hank; Seeley, John R.; Kame'enui, Edward J.; Beck, Carrie Thomas
2008-01-01
The purpose of this study was to examine oral reading fluency (ORF) in the context of a large-scale federal reading initiative conducted in low performing, high poverty schools. The objectives were to (a) investigate the relation between ORF and comprehensive reading tests, (b) examine whether slope of performance over time on ORF predicted…
Measurement Properties of DIBELS Oral Reading Fluency in Grade 2: Implications for Equating Studies
Stoolmiller, Michael; Biancarosa, Gina; Fien, Hank
2013-01-01
Lack of psychometric equivalence of oral reading fluency (ORF) passages used within a grade for screening and progress monitoring has recently become an issue with calls for the use of equating methods to ensure equivalence. To investigate the nature of the nonequivalence and to guide the choice of equating method to correct for nonequivalence,…
Jiang, Xiangying; Sawaki, Yasuyo; Sabatini, John
2012-01-01
This study examined the relationship among word reading efficiency, text reading fluency, and reading comprehension for adult English as a Foreign Language (EFL) learners. Data from 185 adult Chinese EFL learners preparing to take the Test-of-English-as-a-Foreign-Language[TM] (TOEFL[R]) were analyzed in this study. The participants completed a…
THE DEVELOPMENT OF A TRANSACTIONAL ANALYSIS PSYCHOMETRIC TOOL FOR ENHANCING FUNCTIONAL FLUENCY
TEMPLE, SUSANNAH FLEUR
2002-01-01
Functional Fluency denotes efficacy of interpersonal functioning in terms of flexibility and balance of the behavioural modes a person uses. The aim of this project is to design and create a psychometric tool for mapping the patterns of such functioning. The intention is that feedback on the test results will stimulate the insights and understanding to support and encourage positive behavioural change. This process, involving the development of self-awareness, which is a key as...
ORF Alignment: NC_004331 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004331 gi|23619306 >1wfiA 3 125 209 328 1e-34 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putativ
ORF Alignment: NC_003911 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003911 gi|56698151 >1wy2A 3 347 27 396 7e-44 ... gb|AAV96554.1| creatinase [Silici...bacter pomeroyi DSS-3] ref|YP_168523.1| ... creatinase [Silicibacter pomeroyi DSS-3] ... Length
ORF Alignment: NC_003366 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003366 gi|18309739 >1v7zA 1 255 3 250 3e-61 ... dbj|BAB80463.1| creatinase [Clostr...idium perfringens str. 13] ref|NP_561673.1| ... creatinase [Clostridium perfringens str. 13] ...
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34557929 >1kmoA 12 661 39 664 3e-52 ... ref|NP_907744.1| RECEPTOR PRECURSOR-Most...ly Fe transport [Wolinella succinogenes DSM ... 1740] emb|CAE10644.1| RECEPTOR PRECURSOR-Most
ORF Alignment: NC_003155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003155 gi|29828632 >1w1oA 22 489 11 408 6e-19 ... dbj|BAC69801.1| putative xylitol... oxidase [Streptomyces avermitilis MA-4680] ... ref|NP_823266.1| putative xylitol oxidase [Streptomyc
ORF Alignment: NC_004605 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004605 gi|28900808 >1l3wA 6 536 1265 1798 3e-11 ... ref|NP_800463.1| putative biofilm...-associated surface protein [Vibrio parahaemolyticus ... RIMD 2210633] dbj|BAC62296.1| putative biofilm
ORF Alignment: NC_003070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003070 gi|15221381 >1bq00 2 77 15 90 4e-20 ... ref|NP_177004.1| gravity-responsive... protein / altered response to gravity protein ... (ARG1) [Arabidopsis thaliana] gb|AAD13758.1| Altere
ORF Alignment: NC_000909 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000909 gi|15669839 >1ii8A 3 194 4 202 2e-10 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta
ORF Alignment: NC_002947 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002947 gi|26990072 >1uzbA 37 513 3 472 6e-68 ... ref|NP_745497.1| vanillin dehydro...genase [Pseudomonas putida KT2440] gb|AAN68961.1| ... vanillin dehydrogenase [Pseudomonas putida KT24
ORF Alignment: NC_002737 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002737 gi|15675767 >1g5aA 89 627 2 535 3e-86 ... gb|AAK34662.1| dextran glucosidas...e [Streptococcus pyogenes M1 GAS] ... ref|NP_269941.1| dextran glucosidase [Streptococcus ...
ORF Alignment: NC_003485 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003485 gi|19746879 >1g5aA 89 627 2 535 1e-86 ... gb|AAL98514.1| putative dextran g...lucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608015.1| putative dextran glucosidase ...
ORF Alignment: NC_002737 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002737 gi|15675852 >1g5aA 98 625 11 538 9e-95 ... gb|AAK34747.1| putative dextran ...glucosidase [Streptococcus pyogenes M1 GAS] ... ref|NP_270026.1| putative dextran glucosidase ...
ORF Alignment: NC_002927 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002927 gi|33600518 >1v7zA 3 253 1 251 1e-39 ... ref|NP_888078.1| putative creatini...ne amidohydrolase [Bordetella bronchiseptica RB50] ... emb|CAE32030.1| putative creatinine amidohydro
ORF Alignment: NC_000853 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000853 gi|15643179 >1v7zA 3 256 7 270 9e-43 ... ref|NP_228223.1| creatinine amidoh...ydrolase, putative [Thermotoga maritima MSB8] ... gb|AAD35498.1| creatinine amidohydrolase, putative
ORF Alignment: NC_004307 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004307 gi|23464642 >1v7zA 5 255 7 250 1e-55 ... ref|NP_695245.1| creatinine amidohydrolase; creatin...inase [Bifidobacterium longum ... NCC2705] gb|AAN23881.1| creatinine amidohydrolase; ... creatin
ORF Alignment: NC_002944 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002944 gi|41407994 >4uagA 7 413 12 470 1e-38 ... ref|NP_960830.1| MurC [Mycobacter... ... ligase (UDP-N-acetylmuramoyl-L-alanine synthetase) ... gb|AAS04213.1| MurC [Mycobacterium
ORF Alignment: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...
ORF Alignment: NC_000117 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000117 gi|15605507 >2bjiA 3 266 5 313 9e-29 ... ref|NP_220293.1| Sulfite Synthesis.../biphosphate phosphatase [Chlamydia trachomatis ... D/UW-3/CX] gb|AAC68369.1| Sulfite Synthesis/bipho
ORF Alignment: NC_003280 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003280 gi|25149956 >1qauA 5 99 56 151 2e-04 ... gb|AAN38752.1| axon identity speci...rm b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity
ORF Alignment: NC_004722 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004722 gi|30021592 >1vkpA 12 368 2 333 2e-83 ... ref|NP_833223.1| Agmatine deimina...se [Bacillus cereus ATCC 14579] gb|AAP10424.1| ... Agmatine deiminase [Bacillus cereus ATCC 14579] ...
ORF Alignment: NC_002952 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002952 gi|49483165 >1dlwA 19 115 21 120 3e-19 ... ref|YP_040389.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG39975.1| ... protozoa
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34556511 >1mwmA 3 314 14 327 1e-46 ... ref|NP_906326.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN [Wolinella succinogenes DSM ... 1740] emb|CAE09226.1| PUTATIVE ROD SHAPE-DETERMINING
ORF Alignment: NC_000921 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000921 gi|15611661 >1vdkA 1 460 2 461 e-141 ... ref|NP_223312.1| ASPARTATE AMMONIA...-LYASE [Helicobacter pylori J99] gb|AAD06167.1| ... ASPARTATE AMMONIA-LYASE [Helicobacter pylori J99
ORF Alignment: NC_003317 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003317 gi|17986393 >1vdkA 1 459 12 469 e-123 ... gb|AAL51291.1| ASPARTATE AMMONIA-...LYASE [Brucella melitensis 16M] ref|NP_539027.1| ... ASPARTATE AMMONIA-LYASE [Brucella melitensis 16M
ORF Alignment: NC_006348 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006348 gi|53726032 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur
ORF Alignment: NC_006840 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006840 gi|59711513 >1iwlA 4 181 21 198 9e-49 ... ref|YP_204289.1| outer-membrane lipoproteins... carrier protein [Vibrio fischeri ES114] ... gb|AAW85401.1| outer-membrane lipoproteins ca
ORF Alignment: NC_006350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006350 gi|53720213 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur
ORF Alignment: NC_005085 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005085 gi|34495619 >1t06A 1 193 1 205 2e-24 ... gb|AAQ57843.1| DNA alkylation repa...ir enzyme [Chromobacterium violaceum ATCC 12472] ... ref|NP_899834.1| DNA alkylation repair enzyme ...
ORF Alignment: NC_004307 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004307 gi|23466169 >1u94A 19 326 67 387 5e-28 ... ref|NP_696772.1| alkylation dama...ge repair protein [Bifidobacterium longum NCC2705] ... gb|AAN25408.1| alkylation damage repair protei
ORF Alignment: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005027 gi|32477023 >1t06A 1 191 9 220 1e-24 ... ref|NP_870017.1| probable DNA alkylation... repair enzyme [Rhodopirellula baltica SH 1] ... emb|CAD79170.1| probable DNA alkylation repair
ORF Alignment: NC_004350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004350 gi|24378587 >1t06A 1 191 11 210 3e-32 ... gb|AAN57848.1| DNA alkylation rep...air enzyme [Streptococcus mutans UA159] ... ref|NP_720542.1| DNA alkylation repair enzyme ...
ORF Alignment: NC_002945 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002945 gi|31791180 >1ii8A 1 187 1 168 2e-14 ... ref|NP_853673.1| DNA REPLICATION A...D92865.1| ... DNA REPLICATION AND REPAIR PROTEIN RECF (SINGLE-STRAND ... DNA BINDING PROTEIN)
ORF Alignment: NC_003317 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003317 gi|17987645 >1j1vA 4 94 20 109 8e-10 ... gb|AAL52543.1| CHROMOSOMAL REPLICATION... INITIATOR PROTEIN DNAA [Brucella melitensis ... 16M] ref|NP_540279.1| CHROMOSOMAL REPLICATION IN
ORF Alignment: NC_003232 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003232 gi|19173617 >1ltlE 7 224 22 242 3e-38 ... ref|NP_597420.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY (MCM6) ... [Encephalitozoon cuniculi] emb|CAD26597.1| DNA ... REPLICATION
ORF Alignment: NC_003071 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003071 gi|18403860 >1rl1A 4 90 215 300 7e-09 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putative
ORF Alignment: NC_003902 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003902 gi|21229523 >1p6rA 5 81 4 80 4e-10 ... ref|NP_635440.1| methicillin resista...nce protein [Xanthomonas campestris pv. ... campestris str. ATCC 33913] gb|AAM39364.1| methicillin ...
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003919 gi|21240843 >1p6rA 5 81 4 80 8e-10 ... gb|AAM34961.1| methicillin resistanc...e protein [Xanthomonas axonopodis pv. citri ... str. 306] ref|NP_640425.1| methicillin resistance ...
ORF Alignment: NC_002952 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002952 gi|49483221 >1pwgA 4 329 74 373 1e-38 ... ref|YP_040445.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG40034.1| autolysis
ORF Alignment: NC_002947 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002947 gi|26990378 >1wy2A 3 347 23 393 2e-45 ... ref|NP_745803.1| creatinase [Pseu...domonas putida KT2440] gb|AAN69267.1| creatinase ... [Pseudomonas putida KT2440] ... Length = 3
ORF Alignment: NC_002946 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002946 gi|59800954 >1ub4B 4 109 2 113 3e-22 ... ref|YP_207666.1| putative plasmid stable inheritance... ... gb|AAW89254.1| putative plasmid stable inheritance ... protein putative phage associated prote
ORF Alignment: NC_002745 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002745 gi|15925959 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol
ORF Alignment: NC_002758 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002758 gi|15923246 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T
ORF Alignment: NC_003075 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003075 gi|30692533 >3ullA 5 115 1 104 8e-18 ... ref|YP_063478.1| ssb1 [Campylobact...er jejuni] gb|AAR29567.1| ssb1 [Campylobacter ... jejuni] ... Length = 104 ... Query: 31 ... GQDSDVS
ORF Alignment: NC_003070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003070 gi|42572131 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin
ORF Alignment: NC_003070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003070 gi|42563264 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin
ORF Alignment: NC_003106 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003106 gi|15922820 >1n62B 24 793 4 684 e-115 ... ref|NP_378489.1| hypothetical nicotine... dehydrogenase subunit C [Sulfolobus tokodaii ... str. 7] dbj|BAB67598.1| 685aa long hypothetical nicotine
ORF Alignment: NC_006509 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006509 gi|56410456 >1n62C 1 286 1 287 4e-70 ... ref|YP_145830.1| nicotine dehydrog...enase chain A [Geobacillus kaustophilus HTA426] ... dbj|BAD74262.1| nicotine dehydrogenase chain A ...
ORF Alignment: NC_004310 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004310 gi|23502014 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON
ORF Alignment: NC_003317 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003317 gi|17987131 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON
ORF Alignment: NC_006370 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006370 gi|54310056 >1r0wC 45 273 39 283 1e-54 ... ref|YP_131076.1| putative ABC-type metal ion transports...ative ... ABC-type metal ion transportsystem, ATPase component ... [Photobacterium profundum