WorldWideScience

Sample records for superfund tri epcra

  1. CERCLA and EPCRA Continuous Release Reporting

    Science.gov (United States)

    Congress established reportable quantities for Superfund hazardous substances. A continuous release of a hazardous substance is defined as being without interruption or abatement and stable in quantity and rate.

  2. Superfund Query

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Superfund Query allows users to retrieve data from the Comprehensive Environmental Response, Compensation, and Liability Information System (CERCLIS) database.

  3. Reporting continuous releases of hazardous and extremely hazardous substances under CERCLA and EPCRA

    Energy Technology Data Exchange (ETDEWEB)

    1995-01-01

    This guidance is designed to provide basic instruction to US DOE and DOE operations contractor personnel on how to characterize CERCLA and EPCRA hazardous substance releases as continuous and how to prepare and deliver continuousreleasee reports to Federal, State, and local authorities. DOE staff should use this guidance as an overview of the continuous release requirements, a quick ready reference guide for specific topics concerning continuous releases and a step-by-step guide for the process of identifying and reporting continuous releases.

  4. A Field Program to Identify TRI Chemicals and Determine Emission Factors from DoD Munitions Activities

    Science.gov (United States)

    2006-01-01

    FINAL REPORT to STRATEGIC ENVIROMENTAL RESEARCH AND DEVELOPMENT PROGRAM (SERDP) on A FIELD PROGRAM TO IDENTIFY TRI CHEMICALS...adhere to EPCRA, including the toxic release inventory (TRI) requirements. A particularly difficult reporting issue for DoD concerns air emissions...primarily because of constraints imposed on the physical location of the lidar due to laser safety issues . The lack of flexibility in repositioning

  5. Superfund Site Information

    Data.gov (United States)

    U.S. Environmental Protection Agency — This asset includes a number of individual data sets related to site-specific information for Superfund, which is governed under the Comprehensive Environmental...

  6. Superfund Technical Assistance Grants

    Data.gov (United States)

    U.S. Environmental Protection Agency — This asset includes data related to the Superfund Technical Assistance Grant program, including grant number, award amounts, award dates, period of performance,...

  7. 77 FR 19716 - Notice of Filing of Consent Decree Pursuant to the Clean Air Act, CERCLA and EPCRA

    Science.gov (United States)

    2012-04-02

    ... New Source Performance Standards (NSPS), and Risk Management Plan regulations, and CERCLA and EPCRA... injunctive relief directed primarily at insuring future compliance with the Risk Management Program... be obtained by mail from the Consent Decree Library, P.O. Box 7611, U.S. Department of...

  8. CERCLA {section}103 and EPCRA {section}304 Release Notification Requirements update

    Energy Technology Data Exchange (ETDEWEB)

    1995-01-01

    This guidance document updates and clarifies information provided in an earlier guidance document published by the US Environmental Protection Agency (EPA) entitled Guidance for Federal Facilities on Release Notification Requirements under CERCLA and SARA Title III (EPA 9360.7-06; November 1990). Since publication of that earlier guidance document, several significant events have occurred that affect the reporting obligations of facilities owned or operated by the Department of Energy (DOE), including the publication of Executive Order 12856--Federal Compliance with Right-to-Know Laws and Pollution Prevention Requirements--and a rejection by the US Court of Appeals of EPA`s interpretation of the term release into the environment. In preparing this guidance document, the Office of Environmental Policy and Assistance, RCRA/CERCLA Division (EH-413), has documented responses to queries from DOE field elements on CERCLA and EPCRA release reporting requirements, as well as incorporating those Questions and Answers from the previous document that remain germane to DOE`s reporting obligations under CERCLA and EPCRA.

  9. Region 9 TRI Facilities 2012

    Data.gov (United States)

    U.S. Environmental Protection Agency — A federal law called the Emergency Planning and Community Right to Know Act (EPCRA) gives the public the right to know about toxic chemicals being released into the...

  10. Region 9 TRI Facilities 2010

    Data.gov (United States)

    U.S. Environmental Protection Agency — A federal law called the Emergency Planning and Community Right to Know Act (EPCRA) gives the public the right to know about toxic chemicals being released into the...

  11. SITE COMPREHENSIVE LISTING (CERCLIS) (Superfund)

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Comprehensive Environmental Response, Compensation and Liability Information System (CERCLIS) (Superfund) Public Access Database contains a selected set of...

  12. 75 FR 49414 - Cooperative Agreements and Superfund State Contracts for Superfund Response Actions

    Science.gov (United States)

    2010-08-13

    ... AGENCY 40 CFR Part 35 RIN 2050-AG58 Cooperative Agreements and Superfund State Contracts for Superfund... Superfund Cooperative Agreements and Superfund State Contracts. DATES: This rule is effective October 12... requirements shall apply to all new Cooperative Agreements and Superfund State Contracts, funded under...

  13. SUPERFUND CLEANUPS AND INFANT HEALTH

    Science.gov (United States)

    Currie, Janet; Greenstone, Michael; Moretti, Enrico

    2013-01-01

    We are the first to examine the effect of Superfund cleanups on infant health rather than focusing on proximity to a site. We study singleton births to mothers residing within 5km of a Superfund site between 1989–2003 in five large states. Our “difference in differences” approach compares birth outcomes before and after a site clean-up for mothers who live within 2,000 meters of the site and those who live between 2,000– 5,000 meters of a site. We find that proximity to a Superfund site before cleanup is associated with a 20 to 25% increase in the risk of congenital anomalies. PMID:25152535

  14. SITE COMPREHENSIVE LISTING (CERCLIS) (Superfund) - NPL Sites

    Data.gov (United States)

    U.S. Environmental Protection Agency — National Priorities List (NPL) Sites - The Comprehensive Environmental Response, Compensation and Liability Information System (CERCLIS) (Superfund) Public Access...

  15. Superfund Site Information - Site Sampling Data

    Data.gov (United States)

    U.S. Environmental Protection Agency — This asset includes Superfund site-specific sampling information including location of samples, types of samples, and analytical chemistry characteristics of...

  16. CERCLIS (Superfund) ASCII Text Format - CPAD Database

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Comprehensive Environmental Response, Compensation and Liability Information System (CERCLIS) (Superfund) Public Access Database (CPAD) contains a selected set...

  17. 76 FR 64296 - Oil Pollution Prevention; Spill Prevention, Control, and Countermeasure (SPCC) Rule-Compliance...

    Science.gov (United States)

    2011-10-18

    ... AGENCY 40 CFR Part 112 RIN 2050-AG59 Oil Pollution Prevention; Spill Prevention, Control, and... Federal Register. List of Subjects in 40 CFR Part 112 Oil pollution prevention, Farms, Compliance date... Superfund, TRI, EPCRA, RMP and Oil Information Center at (800) 424-9346 or TDD (800) 553-7672...

  18. Superfund and Toxic Release Inventory Sites - SUPERFUND_IDEM_IN: Superfund Program Facilities in Indiana (Indiana Department of Environmental Management, Point Shapefile)

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — SUPERFUND_IDEM_IN is a point shapefile that contains GPS-located Superfund Program facility locations in Indiana, provided by personnel of Indiana Department of...

  19. Superfund National Priority List (NPL) Site Boundaries

    Data.gov (United States)

    U.S. Environmental Protection Agency — A set of site boundaries for each site in EPA Region 1 (Connecticut, Maine, Massachusetts, New Hampshire, Rhode Island, and Vermont) on EPA's Superfund National...

  20. 2016 TRI Preliminary Dataset

    Science.gov (United States)

    The TRI preliminary dataset includes the most current TRI data available and reflects toxic chemical releases and pollution prevention activities that occurred at TRI facilities during the 2016 calendar year.

  1. TRI Fotonovela Slideshow - Spanish

    Science.gov (United States)

    Presentation designed to introduce the basic concepts of the Toxics Release Inventory, including why TRI is an important resource for commmunities and which tool provides the easiest access to basic TRI data.

  2. 2017 TRI University Challenge

    Science.gov (United States)

    Details about the 2017 TRI University Challenge, in which EPA is looking to academic institutions to help build a diverse portfolio of practical and replicable projects that benefit communities, the environment, academic institutions, and the TRI Program.

  3. SITE COMPREHENSIVE LISTING (CERCLIS) (Superfund) - Non-NPL Sites

    Data.gov (United States)

    U.S. Environmental Protection Agency — Non-NPL Sites - The Comprehensive Environmental Response, Compensation and Liability Information System (CERCLIS) (Superfund) Public Access Database contains a...

  4. SITE COMPREHENSIVE LISTING (CERCLIS) - Contaminants at CERCLIS (Superfund) Sites

    Data.gov (United States)

    U.S. Environmental Protection Agency — Contaminants at Comprehensive Environmental Response, Compensation and Liability Information System (CERCLIS) (Superfund) Sites - The CERCLIS Public Access Database...

  5. SITE COMPREHENSIVE LISTING (CERCLIS) (Superfund) - Responsible Parties at CERCLIS Sites

    Data.gov (United States)

    U.S. Environmental Protection Agency — Responsible Parties at CERCLIS Sites - The Comprehensive Environmental Response, Compensation and Liability Information System (CERCLIS) (Superfund) Public Access...

  6. Mining-related sediment and soil contamination in a large Superfund site: Characterization, habitat implications, and remediation

    Science.gov (United States)

    Juracek, Kyle E.; Drake, K. D.

    2016-01-01

    Historical mining activity (1850–1970) in the now inactive Tri-State Mining District provided an ongoing source of lead and zinc to the environment including the US Environmental Protection Agency Superfund site located in Cherokee County, southeast Kansas, USA. The resultant contamination adversely affected biota and caused human health problems and risks. Remediation in the Superfund site requires an understanding of the magnitude and extent of contamination. To provide some of the required information, a series of sediment and soil investigations were conducted in and near the Superfund site to characterize lead and zinc contamination in the aquatic and floodplain environments along the main-stem Spring River and its major tributaries. In the Superfund site, the most pronounced lead and zinc contamination, with concentrations that far exceed sediment quality guidelines associated with potential adverse biological effects, was measured for streambed sediments and floodplain soils located within or downstream from the most intensive mining-affected areas. Tributary streambeds and floodplains in affected areas are heavily contaminated with some sites having lead and zinc concentrations that are an order of magnitude (or more) greater than the sediment quality guidelines. For the main-stem Spring River, the streambed is contaminated but the floodplain is mostly uncontaminated. Measured lead and zinc concentrations in streambed sediments, lakebed sediments, and floodplain soils documented a persistence of the post-mining contamination on a decadal timescale. These results provide a basis for the prioritization, development, and implementation of plans to remediate contamination in the affected aquatic and floodplain environments within the Superfund site.

  7. Mining-Related Sediment and Soil Contamination in a Large Superfund Site: Characterization, Habitat Implications, and Remediation.

    Science.gov (United States)

    Juracek, K E; Drake, K D

    2016-10-01

    Historical mining activity (1850-1970) in the now inactive Tri-State Mining District provided an ongoing source of lead and zinc to the environment including the US Environmental Protection Agency Superfund site located in Cherokee County, southeast Kansas, USA. The resultant contamination adversely affected biota and caused human health problems and risks. Remediation in the Superfund site requires an understanding of the magnitude and extent of contamination. To provide some of the required information, a series of sediment and soil investigations were conducted in and near the Superfund site to characterize lead and zinc contamination in the aquatic and floodplain environments along the main-stem Spring River and its major tributaries. In the Superfund site, the most pronounced lead and zinc contamination, with concentrations that far exceed sediment quality guidelines associated with potential adverse biological effects, was measured for streambed sediments and floodplain soils located within or downstream from the most intensive mining-affected areas. Tributary streambeds and floodplains in affected areas are heavily contaminated with some sites having lead and zinc concentrations that are an order of magnitude (or more) greater than the sediment quality guidelines. For the main-stem Spring River, the streambed is contaminated but the floodplain is mostly uncontaminated. Measured lead and zinc concentrations in streambed sediments, lakebed sediments, and floodplain soils documented a persistence of the post-mining contamination on a decadal timescale. These results provide a basis for the prioritization, development, and implementation of plans to remediate contamination in the affected aquatic and floodplain environments within the Superfund site.

  8. Mining-Related Sediment and Soil Contamination in a Large Superfund Site: Characterization, Habitat Implications, and Remediation

    Science.gov (United States)

    Juracek, K. E.; Drake, K. D.

    2016-10-01

    Historical mining activity (1850-1970) in the now inactive Tri-State Mining District provided an ongoing source of lead and zinc to the environment including the US Environmental Protection Agency Superfund site located in Cherokee County, southeast Kansas, USA. The resultant contamination adversely affected biota and caused human health problems and risks. Remediation in the Superfund site requires an understanding of the magnitude and extent of contamination. To provide some of the required information, a series of sediment and soil investigations were conducted in and near the Superfund site to characterize lead and zinc contamination in the aquatic and floodplain environments along the main-stem Spring River and its major tributaries. In the Superfund site, the most pronounced lead and zinc contamination, with concentrations that far exceed sediment quality guidelines associated with potential adverse biological effects, was measured for streambed sediments and floodplain soils located within or downstream from the most intensive mining-affected areas. Tributary streambeds and floodplains in affected areas are heavily contaminated with some sites having lead and zinc concentrations that are an order of magnitude (or more) greater than the sediment quality guidelines. For the main-stem Spring River, the streambed is contaminated but the floodplain is mostly uncontaminated. Measured lead and zinc concentrations in streambed sediments, lakebed sediments, and floodplain soils documented a persistence of the post-mining contamination on a decadal timescale. These results provide a basis for the prioritization, development, and implementation of plans to remediate contamination in the affected aquatic and floodplain environments within the Superfund site.

  9. ADHD: Tips to Try

    Science.gov (United States)

    ... Loss Surgery? A Week of Healthy Breakfasts Shyness ADHD: Tips to Try KidsHealth > For Teens > ADHD: Tips to Try Print A A A en español TDAH: Consejos que puedes probar ADHD , or attention deficit hyperactivity disorder, is a medical ...

  10. Toxics Release Inventory (TRI)

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Toxics Release Inventory (TRI) is a dataset compiled by the U.S. Environmental Protection Agency (EPA). It contains information on the release and waste...

  11. TRI National Analysis

    Science.gov (United States)

    Interpretation of annual TRI data reported by industrial facilities. Interactive maps and other tools give a close look at how industries, parent companies, and individual facilities manage toxic chemical waste and how they prevent and reduce pollution.

  12. Feasibility study for the United Heckathorn Superfund Site, Richmond, California

    Energy Technology Data Exchange (ETDEWEB)

    Lincoff, A.H. [US Environmental Protection Agency, San Francisco, CA (United States). Region IX; Costan, G.P.; Montgomery, M.S.; White, P.J. [Pacific Northwest Lab., Richland, WA (United States)

    1994-07-01

    The United Heckathom Superfund Site in Richmond, California, was used to formulate pesticides from approximately 1947 to 1966. Soils at the site and sediments in the harbor were contaminated with various chlorinated pesticides, primarily DDT, as a result of these activities. The US Environmental Protection Agency listed the site on the Superfund National Priorities List in 1990. This document is part of the Remedial Investigation and Feasibility Study phase of the Superfund response, which will provide the basis for selection of a final remedy that will protect human health and the environment and achieve compliance with federal and state envirorunental laws.

  13. Report: Remedial Project Manager Turnover at Superfund Sites

    Science.gov (United States)

    Report #2001-M-000015, June 15, 2001. We determined that EPA Region III did not have formal procedures in place to mitigate continuity problems caused by turnover of EPA personnel in the Superfund program.

  14. 77 FR 13603 - Anniston PCB Superfund Site; Anniston, Calhoun County, AL; Correction

    Science.gov (United States)

    2012-03-07

    ... AGENCY Anniston PCB Superfund Site; Anniston, Calhoun County, AL; Correction AGENCY: Environmental... concerning the Anniston PCB Superfund Site located in Anniston. The settlement is not an amendment, but a new... name Anniston PCB by one of the following methods:...

  15. Cleanups In My Community (CIMC) - Superfund National Priority List (NPL) Sites, National Layer

    Data.gov (United States)

    U.S. Environmental Protection Agency — This data layer provides access to Superfund National Priority List Sites as part of the CIMC web service. Superfund is a program administered by the EPA to locate,...

  16. 78 FR 729 - Ellman Battery Superfund Site; Orlando, Orange County, FL; Notice of Settlement

    Science.gov (United States)

    2013-01-04

    ... From the Federal Register Online via the Government Publishing Office ENVIRONMENTAL PROTECTION AGENCY Ellman Battery Superfund Site; Orlando, Orange County, FL; Notice of Settlement AGENCY... concerning a previous Removal Action at the Ellman Battery Superfund Site located in Orlando, Orange...

  17. 78 FR 13056 - Proposed CERCLA Administrative Cost Recovery Settlement; in re: Factory H Superfund Site, Meriden...

    Science.gov (United States)

    2013-02-26

    ... AGENCY Proposed CERCLA Administrative Cost Recovery Settlement; in re: Factory H Superfund Site, Meriden...)(1) concerning the Factory H Superfund Site in Meriden, Connecticut (``Site'') with the following... refer to the Factory H Superfund Site, U.S. EPA Docket No. CERCLA-01-2012-0112. FOR FURTHER...

  18. 75 FR 53694 - Florida Petroleum Reprocessors Superfund Site; Davie, Broward County, FL; Notice of Settlement

    Science.gov (United States)

    2010-09-01

    ...] Florida Petroleum Reprocessors Superfund Site; Davie, Broward County, FL; Notice of Settlement AGENCY... Florida Petroleum Reprocessors Superfund Site located in Davie, Broward County, Florida for publication..., identified by Docket ID No. EPA-RO4- SFUND-2010-0729 or Site name Florida Petroleum Reprocessors Superfund...

  19. 77 FR 8255 - Constitution Road Drum Superfund Site, Atlanta, Dekalb County, GA; Notice of Settlement

    Science.gov (United States)

    2012-02-14

    ... AGENCY Constitution Road Drum Superfund Site, Atlanta, Dekalb County, GA; Notice of Settlement AGENCY... entered into a settlement for past response costs concerning the Constitution Road Drum Superfund Site... available from Ms. Paula V. Painter. Submit your comments by Site name Constitution Road Drum Superfund...

  20. Field analytical support during Superfund site remediation

    Energy Technology Data Exchange (ETDEWEB)

    Goldschmidt, W.L.; Catherman, D.R. [Environmental Resources Management, Inc., Exton, PA (United States)

    1995-12-31

    ERM-FAST{reg_sign} Services has provided cost-effective and critical field analytical support for a wide variety of investigatory and remedial projects over the past four years. Two recent projects involving soils remediation at Superfund sites exemplify the power of real time field analytical support in reducing time and expense during a project`s remedial phase. ERM-FAST on-site analytical facilities were able to meet, in a real time scenario, all data quality objectives (DQOs), all regulatory agency requirements, and satisfied the client`s needs. ERM-FAST made this possible through the development of unique analytical strategies, the proper selection of analytical technologies, and by streamlining the analytical methodologies. Both of these remedial efforts offer illustrations of the effectiveness of field analysis for vastly differing site contaminants. This case study focuses on the use of portable Gas Chromatography (GC) instrumentation as a tool for providing analytical support during a CERCLA site remediation program. The project discussed provides an example of how low cost portable analytical instrumentation can be utilized in a field setting to meet analytical DQOs consistent with CERCLA compliance and to meet the requirements for remedial activity cost control. Substantial savings were realized both by reducing total project analytical cost, and by efficient and effective process and schedule management.

  1. IS IT WORTH TRYING?

    Institute of Scientific and Technical Information of China (English)

    1994-01-01

    Introduction The traditional approach to English learning and teaching is increasingly being challenged by the communicative method. Not everyone accepts or agrees with this new trend, while others feel that it is not radical enough. ELT is a field full of controversy, and there is no universally accepted conventional wisdom. My personal experience of foreign language teaching has been with both junior and senior middle school students. In recent years I have been trying to implement the communicative method with the texts in the current senior books. In this paper I shall discuss the traditional approach, my own way of teaching and an experiment with both the traditional and communicative approach.

  2. SUPERFUND GROUND WATER ISSUE - ACCURACY OF DEPTH TO WATER MEASUREMENTS

    Science.gov (United States)

    Accuracy of depth to water measurements is an issue identified by the Forum as a concern of Superfund decision-makers as they attempt to determine directions of ground-water flow, areas of recharge of discharge, the hydraulic characteristics of aquifers, or the effects of manmade...

  3. 77 FR 11533 - Anniston PCB Superfund Site, Anniston, Calhoun County, Alabama; Notice of Amended Settlement

    Science.gov (United States)

    2012-02-27

    ... AGENCY Anniston PCB Superfund Site, Anniston, Calhoun County, Alabama; Notice of Amended Settlement... Agency has entered into a settlement for past response costs concerning the Anniston PCB Superfund Site... available from Ms. Paula V. Painter. Submit your comments by Site name Anniston PCB by one of the...

  4. 75 FR 81269 - Ward Transformer Superfund Site Raleigh, Wake County, NC; Notice of Settlements

    Science.gov (United States)

    2010-12-27

    ... AGENCY Ward Transformer Superfund Site Raleigh, Wake County, NC; Notice of Settlements AGENCY... Ward Transformer Superfund Site located in Raleigh, Wake County, North Carolina for publication. DATES... your comments, identified by Docket ID No. EPA-RO4- SFUND-2010-1053 or Site name Ward...

  5. 78 FR 14543 - Ward Transformer Superfund Site; Raleigh, Wake County, NC; Notice of Settlement

    Science.gov (United States)

    2013-03-06

    ... AGENCY Ward Transformer Superfund Site; Raleigh, Wake County, NC; Notice of Settlement AGENCY... Agency has entered into a settlement at the Ward Transformer Superfund Site located in Raleigh, Wake... EPA Region 4 contact Ms. Paula V. Painter. Submit your comments by Site name Ward...

  6. Remediation System Evaluation, McCormick and Baxter Superfund SiteRemediation System Evaluation, McCormick and Baxter Superfund Site

    Science.gov (United States)

    The McCormick and Baxter Creosoting Company, Portland Plant, Superfund Site is located adjacent tothe Willamette River in Portland, Oregon and addresses contamination of soil, groundwater, and riversediments stemming from creosoting operations...

  7. tri

    African Journals Online (AJOL)

    In our search for the active constituents of Anogeissus leocarpus, we hereby report the isolation ... and hydrogen bonded -OH, and -C=O stretching vibrations of an aryl lactone. .... Control plate was also included which contains no extract.

  8. General RMP Guidance - Appendix C: Technical Assistance

    Science.gov (United States)

    Contacts for resources available to facilities in complying with 40 CFR part 68 (risk management program) include Office of Emergency Prevention Preparedness and Response, EPCRA/Superfund/RCRA/CAA Call Center, and the Center for Chemical Process Safety.

  9. RMP Guidance for Chemical Distributors - Appendix C: Technical Assistance

    Science.gov (United States)

    Resources available to assist warehousing facilities include the Office of Emergency Management website, EPCRA/Superfund/RCRA/CAA hotline, OSHA website and documents and training program, and American Institute of Chemical Engineers publications.

  10. RMP Guidance for Warehouses - Appendix C: Technical Assistance

    Science.gov (United States)

    Resources to assist warehousing facilities in complying include the Chemical Emergency Preparedness and Prevention Office website, EPCRA/Superfund/RCRA/CAA hotline, OSHA publications and training program, and Institute of Chemical Engineers publications.

  11. Cleanups In My Community (CIMC) - Federal facilities that are also Superfund sites, National Layer

    Data.gov (United States)

    U.S. Environmental Protection Agency — Federal facilities are properties owned by the federal government. This data layer provides access to Federal facilities that are Superfund sites as part of the CIMC...

  12. Letter to Silverton and San Juan County Regarding Potential Superfund Listing

    Science.gov (United States)

    Feb. 12, 2016 Update: EPA added a letter to the Town of Silverton and San Juan County regarding the agency’s commitment to the Town and County’s involvement during a potential Superfund listing process.

  13. Grain Handling Facility at Freeman, Washington Proposed to Superfund Cleanup List

    Science.gov (United States)

    (March 24, 2015 - Seattle) The U.S. Environmental Protection Agency is proposing to add the Grain Handling Facility at Freeman, in Spokane County, Washington, to the Superfund National Priorities List. The proposed listing includes a 60-day public comment

  14. Preliminary estimate of natural resource damage : Rocky Mountain Arsenal Superfund Site

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This is a preliminary estimate of natural resource damages associated with uncontrolled release of hazardous materials at the Rocky Mountain Arsenal Superfund Site...

  15. Remediation System Evaluation, Streamlined Remediation System Evaluation (RSE-Lite), Circuitron Corporation Superfund Site

    Science.gov (United States)

    The Circuitron Corporation Superfund Site is located at 82 Milbar Boulevard, East Farmingdale, Suffolk County, New York. The site is situated on a 1-acre lot in an industrial/commercial area that is surrounded by similar small manufacturers...

  16. Cleanups In My Community (CIMC) - Base Realignment and Closure (BRAC) Superfund Sites, National Layer

    Data.gov (United States)

    U.S. Environmental Protection Agency — This data layer provides access to Base Realignment and Closure (BRAC) Superfund Sites as part of the CIMC web service. EPA works with DoD to facilitate the reuse...

  17. EPA, 12 Private Entities Agree to Remove Contamination and Conduct Study at Metro Container Superfund Site

    Science.gov (United States)

    PHILADELPHIA (October 21, 2015) -- The U.S. Environmental Protection Agency and 12 private entities have agreed to settle on actions that will lead to increased environmental protection at the Metro Container Superfund Site in Trainer, Delaware Co.,

  18. Report: EPA’s Distribution of Superfund Human Resources Does Not Support Current Regional Workload

    Science.gov (United States)

    Report #17-P-0397, September 19, 2017. Due to insufficient human resources to cover all Superfund site work, some regions have had to slow down or discontinue their efforts to protect human health and the environment.

  19. Analysis of bubbles and crashes in the TRY/USD, TRY/EUR, TRY/JPY and TRY/CHF exchange rate within the scope of econophysics

    Science.gov (United States)

    Deviren, Bayram; Kocakaplan, Yusuf; Keskin, Mustafa; Balcılar, Mehmet; Özdemir, Zeynel Abidin; Ersoy, Ersan

    2014-09-01

    In this study, we analyze the Turkish Lira/US Dollar (TRY/USD), Turkish Lira/Euro (TRY/EUR), Turkish Lira/Japanese Yen (TRY/JPY) and Turkish Lira/Swiss Franc (TRY/CHF) exchange rates in the global financial crisis period to detect the bubbles and crashes in the TRY by using a mathematical methodology developed by Watanabe et al. (2007). The methodology defines the bubbles and crashes in financial market price fluctuations by considering an exponential fitting of the associated data. This methodology is applied to detect the bubbles and crashes in the TRY/USD, TRY/EUR, TRY/JPY and TRY/CHF exchange rates from January, 1, 2005 to December, 20, 2013. In this mathematical methodology, the whole period of bubbles and crashes can be determined purely from past data, and the start of bubbles and crashes can be identified even before its bursts. In this way, the periods of bubbles and crashes in the TRY/USD, TRY/EUR, TRY/JPY and TRY/CHF are determined, and the beginning and end points of these periods are detected. The results show that the crashes in the TRY/CHF exchange rate are commonly finished earlier than in the other exchange rates; hence it is probable that the crashes in the other exchange rates would be finished soon when the crashes in the TRY/CHF exchange rate ended. We also find that the periods of crashes in the TRY/EUR exchange rate take longer time than in the other exchange rates. This information can be used in risk management and/or speculative gain. The crashes' periods in the TRY/EUR and TRY/USD exchange rates are observed to be relatively longer than in the other exchange rates.

  20. Remediation of the Wells G & H Superfund Site, Woburn, Massachusetts.

    Science.gov (United States)

    Bair, E Scott; Metheny, Maura A

    2002-01-01

    Remediation of ground water and soil contamination at the Wells G & H Superfund Site, Woburn, Massachusetts, uses technologies that reflect differences in hydrogeologic settings, concentrations of volatile organic compounds (VOCs), and costs of treatment. The poorly permeable glacial materials that overlie fractured bedrock at the W.R. Grace property necessitate use of closely spaced recovery wells. Contaminated ground water is treated with hydrogen peroxide and ultraviolet (UV) oxidation. At UniFirst, a deep well completed in fractured bedrock removes contaminated ground water, which is treated by hydrogen peroxide, UV oxidation, and granular activated carbon (GAC). The remediation system at Wildwood integrates air sparging, soil-vapor extraction, and ground water pumping. Air stripping and GAC are used to treat contaminated water; GAC is used to treat contaminated air. New England Plastics (NEP) uses air sparging and soil-vapor extraction to remove VOCs from the unsaturated zone and shallow ground water. Contaminated air and water are treated using separate GAC systems. After nine years of operation at W.R. Grace and UniFirst, 30 and 786 kg, respectively, of VOCs have been removed. In three years of operation, 866 kg of VOCs have been removed at Wildwood. In 15 months of operation, 36 kg of VOCs were removed at NEP. Characterization work continues at the Olympia Nominee Trust, Whitney Barrel, Murphy Waste Oil, and Aberjona Auto Parts properties. Risk assessments are being finalized that address heavy metals in the floodplain sediments along the Aberjona River that are mobilized from the Industri-Plex Superfund Site located a few miles upstream.

  1. Spatial disparity in the distribution of superfund sites in South Carolina: an ecological study.

    Science.gov (United States)

    Burwell-Naney, Kristen; Zhang, Hongmei; Samantapudi, Ashok; Jiang, Chengsheng; Dalemarre, Laura; Rice, LaShanta; Williams, Edith; Wilson, Sacoby

    2013-11-06

    According to the US Environmental Protection Agency (EPA), Superfund is a federal government program implemented to clean up uncontrolled hazardous waste sites. Twenty-six sites in South Carolina (SC) have been included on the National Priorities List (NPL), which has serious human health and environmental implications. The purpose of this study was to assess spatial disparities in the distribution of Superfund sites in SC. The 2000 US census tract and block level data were used to generate population characteristics, which included race/ethnicity, socioeconomic status (SES), education, home ownership, and home built before 1950. Geographic Information Systems (GIS) were used to map Superfund facilities and develop choropleth maps based on the aforementioned sociodemographic variables. Spatial methods, including mean and median distance analysis, buffer analysis, and spatial approximation were employed to characterize burden disparities. Regression analysis was performed to assess the relationship between the number of Superfund facilities and population characteristics. Spatial coincidence results showed that of the 29.5% of Blacks living in SC, 55.9% live in Superfund host census tracts. Among all populations in SC living below poverty (14.2%), 57.2% were located in Superfund host census tracts. Buffer analyses results (0.5mi, 1.0mi, 5.0mi, 0.5km, 1.0km, and 5.0km) showed a higher percentage of Whites compared to Blacks hosting a Superfund facility. Conversely, a slightly higher percentage of Blacks hosted (30.2%) a Superfund facility than those not hosting (28.8%) while their White counterparts had more equivalent values (66.7% and 67.8%, respectively). Regression analyses in the reduced model (Adj. R2 = 0.038) only explained a small percentage of the variance. In addition, the mean distance for percent of Blacks in the 90th percentile for Superfund facilities was 0.48mi. Burden disparities exist in the distribution of Superfund facilities in SC at the block and

  2. Air-water exchange of PAHs and OPAHs at a superfund mega-site.

    Science.gov (United States)

    Tidwell, Lane G; Blair Paulik, L; Anderson, Kim A

    2017-12-15

    Chemical fate is a concern at environmentally contaminated sites, but characterizing that fate can be difficult. Identifying and quantifying the movement of chemicals at the air-water interface are important steps in characterizing chemical fate. Superfund sites are often suspected sources of air pollution due to legacy sediment and water contamination. A quantitative assessment of polycyclic aromatic hydrocarbons (PAHs) and oxygenated PAH (OPAHs) diffusive flux in a river system that contains a Superfund Mega-site, and passes through residential, urban and agricultural land, has not been reported before. Here, passive sampling devices (PSDs) were used to measure 60 polycyclic aromatic hydrocarbons (PAHs) and 22 oxygenated PAH (OPAHs) in air and water. From these concentrations the magnitude and direction of contaminant flux between these two compartments was calculated. The magnitude of PAH flux was greater at sites near or within the Superfund Mega-site than outside of the Superfund Mega-site. The largest net individual PAH deposition at a single site was naphthalene at a rate of -14,200 (±5780) (ng/m(2))/day. The estimated one-year total flux of phenanthrene was -7.9×10(5) (ng/m(2))/year. Human health risk associated with inhalation of vapor phase PAHs and dermal exposure to PAHs in water were assessed by calculating benzo[a]pyrene equivalent concentrations. Excess lifetime cancer risk estimates show potential increased risk associated with exposure to PAHs at sites within and in close proximity to the Superfund Mega-site. Specifically, estimated excess lifetime cancer risk associated with dermal exposure and inhalation of PAHs was above 1 in 1 million within the Superfund Mega-site. The predominant depositional flux profile observed in this study suggests that the river water in this Superfund site is largely a sink for airborne PAHs, rather than a source. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Tri-Sasakian consistent reduction

    CERN Document Server

    Cassani, Davide

    2011-01-01

    We establish a universal consistent Kaluza-Klein truncation of M-theory based on seven-dimensional tri-Sasakian structure. The four-dimensional truncated theory is an N=4 gauged supergravity with three vector multiplets and a non-abelian gauge group, containing the compact factor SO(3). Consistency follows from the fact that our truncation takes exactly the same form as a left-invariant reduction on a specific coset manifold, and we show that the same holds for the various universal consistent truncations recently put forward in the literature. We describe how the global symmetry group SL(2,R) x SO(6,3) is embedded in the symmetry group E7(7) of maximally supersymmetric reductions, and make the connection with the approach of Exceptional Generalized Geometry. Vacuum AdS4 solutions spontaneously break the amount of supersymmetry from N=4 to N=3,1 or 0, and the spectrum contains massive modes. We find a subtruncation to minimal N=3 gauged supergravity as well as an N=1 subtruncation to the SO(3)-invariant secto...

  4. 76 FR 24479 - In the Matter of the Taylor Lumber and Treating Superfund Site, Sheridan, Oregon, Amendment to...

    Science.gov (United States)

    2011-05-02

    ... AGENCY In the Matter of the Taylor Lumber and Treating Superfund Site, Sheridan, Oregon, Amendment to... with PWPO provided a covenant not to sue for response costs at the Taylor Lumber and Treating Site... should reference the Taylor Lumber and Treating Superfund Site in Sheridan, Oregon, EPA Docket No....

  5. 78 FR 47317 - Ore Knob Mine Superfund Site; Laurel Springs, Ashe County, North Carolina; Notice of Settlement

    Science.gov (United States)

    2013-08-05

    ... AGENCY Ore Knob Mine Superfund Site; Laurel Springs, Ashe County, North Carolina; Notice of Settlement... Protection Agency has entered into a settlement with Herbert N. Francis concerning the Ore Knob Mine... comments by site name ``Ore Knob Mine Superfund Site'' by one of the following methods:...

  6. SUPERFUND TREATABILITY CLEARINGHOUSE: BDAT INCINERATION OF CERCLA SARMS AT THE JOHN ZINK COMPANY TEST FACILITY (FINAL PROJECT REPORT)

    Science.gov (United States)

    This report presents the results of a treatability study of rotary kiln incineration of a synthetic "Superfund soil" bearing a wide range of chemical contaminants typically occurring at Superfund sites. This surrogate soil is referred to as a synthetic analytical reference ...

  7. Standard tri-point transition function

    Institute of Scientific and Technical Information of China (English)

    XIE Yuquan

    2005-01-01

    It is usually difficult to express a family of tri-point transition function (TTF)by a transition matrix as Markov processes with one parameter. In this paper, we define three kinds of connection matrixes on the states of standard tri-point transition function (STTF) and study their essential character, give a constructive method on the constantvalue standard tri-point transition function and a general expression of the state-symmetric standard tri-point transition function by a sequence of the transition matrixes of special and simple Markov processes with one parameter.

  8. EPA Proposes to Remove Most of Fulton, Oswego County, New York Site from Superfund List

    Science.gov (United States)

    (New York, N.Y) After cleaning up more than 10,000 cubic yards of contaminated soil and approximately 9 million gallons of contaminated groundwater, the U.S. Environmental Protection Agency is proposing to remove a portion of the Fulton Terminals Superfund

  9. Superfund record of decision (EPA Region 5): Ormet Corporation, Hannibal, OH, September 1994

    Energy Technology Data Exchange (ETDEWEB)

    1994-09-12

    The Record of Decision presents the selected remedy for the Ormet Corporation Superfund Site. The purpose of this remedy is to eliminate or reduce contamination in soils, sediments and ground water, and to reduce the risks associated with exposure to contaminated materials. This is the first and final remedy planned for the Site.

  10. Medical costs and lost productivity from health conditions at volatile organic compound-contaminated Superfund sites

    Energy Technology Data Exchange (ETDEWEB)

    Lybarger, J.A.; Spengler, R.F.; Brown, D.R. [Agency for Toxic Substances and Disease Registry, Atlanta, GA (United States). Div. of Health Studies; Lee, R.; Vogt, D.P. [Oak Ridge National Lab., TN (United States)]|[Joint Inst. for Energy and Environment, Oak Ridge, TN (United States); Perhac, R.M. Jr. [Univ. of Tennessee, Knoxville, TN (United States)]|[Joint Inst. for Energy and Environment, Oak Ridge, TN (United States)

    1998-10-01

    This paper estimates the health costs at Superfund sites for conditions associated with volatile organic compounds (VOCs) in drinking water. Health conditions were identified from published literature and registry information as occurring at excess rates in VOC-exposed populations. These health conditions were: (1) some categories of birth defects, (2) urinary tract disorders, (3) diabetes, (4) eczema and skin conditions, (5) anemia, (6) speech and hearing impairments in children under 10 years of age, and (7) stroke. Excess rates were used to estimate the excess number of cases occurring among the total population living within one-half mile of 258 Superfund sites. These sites had evidence of completed human exposure pathways for VOCs in drinking water. For each type of medical condition, an individual`s expected medical costs, long-term care costs, and lost work time due to illness or premature mortality were estimated. Costs were calculated to be approximately $330 million per year, in the absence of any remediation or public health intervention programs. The results indicate the general magnitude of the economic burden associated with a limited number of contaminants at a portion of all Superfund sites, thus suggesting that the burden would be greater than that estimated in this study if all contaminants at all Superfund sites could be taken into account.

  11. Superfund: Interagency Agreements and Improved Project Management Needed to Achieve Cleanup Progress at Key Defense Installations

    Science.gov (United States)

    2010-07-01

    Superfund completing the remedial investigation, which would include a human and ecological risk assessment , feasibility study, proposed plan...EPA said that a human and ecological risk assessment —which would estimate how threatening a hazardous waste site is to human health and the

  12. A General Chemistry Assignment Analyzing Environmental Contamination for the Depue, IL, National Superfund Site

    Science.gov (United States)

    Saslow Gomez, Sarah A.; Faurie-Wisniewski, Danielle; Parsa, Arlen; Spitz, Jeff; Spitz, Jennifer Amdur; Loeb, Nancy C.; Geiger, Franz M.

    2015-01-01

    The classroom exercise outlined here is a self-directed assignment that connects students to the environmental contamination problem surrounding the DePue Superfund site. By connecting chemistry knowledge gained in the classroom with a real-world problem, students are encouraged to personally connect with the problem while simultaneously…

  13. 75 FR 68788 - Ore Knob Mine Superfund Site; Jefferson, Ashe County, North Carolina; Notice of Settlement

    Science.gov (United States)

    2010-11-09

    ... Doc No: 2010-28260] ENVIRONMENTAL PROTECTION AGENCY [Docket EPA-RO4-SFUND-2010-0893, FRL-9223-8] Ore... Protection Agency has entered into a settlement for reimbursement of past response costs concerning the Ore..., identified by Docket ID No. EPA-RO4- SFUND-2010-0893 or Site name Ore Knob Mine Superfund Site by one of...

  14. 77 FR 16548 - Florida Petroleum Reprocessors Superfund Site; Davie, Broward County, FL; Notice of Settlements

    Science.gov (United States)

    2012-03-21

    ...] Florida Petroleum Reprocessors Superfund Site; Davie, Broward County, FL; Notice of Settlements AGENCY... entered into four (4) settlements for past response costs concerning the Florida Petroleum Reprocessors... settlement are available from Ms. Paula V. Painter. Submit your comments by Site name Florida Petroleum...

  15. SUPERFUND TREATABILITY CLEARINGHOUSE: CERCLA BDAT SARM PREPARATION AND RESULTS OF PHYSICAL SOILS WASHING EXPERIMENTS (FINAL REPORT)

    Science.gov (United States)

    This study reports on the results of work preparing 30,000 Ibs of SARM or synthetic analytical reference matrix, a surrogate Superfund soil containing a vide range of contaminants. It also reports the results ©f bench scale treatability experiments designed to simulate the EP...

  16. A General Chemistry Assignment Analyzing Environmental Contamination for the Depue, IL, National Superfund Site

    Science.gov (United States)

    Saslow Gomez, Sarah A.; Faurie-Wisniewski, Danielle; Parsa, Arlen; Spitz, Jeff; Spitz, Jennifer Amdur; Loeb, Nancy C.; Geiger, Franz M.

    2015-01-01

    The classroom exercise outlined here is a self-directed assignment that connects students to the environmental contamination problem surrounding the DePue Superfund site. By connecting chemistry knowledge gained in the classroom with a real-world problem, students are encouraged to personally connect with the problem while simultaneously…

  17. Grain Handling Facility at Freeman, Washington Added to Superfund Cleanup List

    Science.gov (United States)

    (September 28, 2015 - Seattle) The U.S. Environmental Protection Agency has added the Grain Handling Facility at Freeman, in Spokane County, Washington, to the Superfund National Priorities List. The site was added to the NPL after EPA considered input rec

  18. 77 FR 2981 - Constitution Road Drum Superfund Site; Atlanta, Dekalb County, GA; Notice of Settlement

    Science.gov (United States)

    2012-01-20

    ... AGENCY Constitution Road Drum Superfund Site; Atlanta, Dekalb County, GA; Notice of Settlement AGENCY... Protection Agency has entered into a settlement for past response costs concerning the Constitution Road Drum... settlement are available from Ms. Paula V. Painter. Submit your comments by Site name Constitution Road...

  19. Chuanshi Brand Tri-cone Roller Bit

    Institute of Scientific and Technical Information of China (English)

    Chen Xilong; Shen Zhenzhong; Yuan Xiaoyi

    1997-01-01

    @@ Compared with other types of bits, the tri-cone roller bit has the advantages of excellent comprehensive performance, low price, wide usage range. It is free of formation limits. The tri-cone roller bit accounts for 90% of the total bits in use. The Chengdu Mechanical Works, as a major manufacturer of petroleum mechanical products and one of the four major tri-cone roller bit factories in China,has produced 120 types of bits in seven series and 19 sizes since 1967. The bits manufactured by the factory are not only sold to the domestic oilfields, but also exported to Japan, Thailand, Indonesia, the Philippines and the Middle East.

  20. Can't sleep? Try these tips

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/patientinstructions/000853.htm Can't sleep? Try these tips To use the sharing ... with your daily activities. References Adams SK, Kisler TS. Sleep quality as a mediator between technology-related ...

  1. Report: Independent Ground Water Sampling Generally Confirms EPA’s Data at Wheeler Pit Superfund Site in Wisconsin

    Science.gov (United States)

    Report #10-P-0218, September 8, 2010. With minimal exceptions, our independent sampling results at the Wheeler Pit Superfund Site were consistent with the sampling results that EPA Region 5 has obtained historically.

  2. Issuance of Final Guidance: Ecological Risk Assessment and Risk Management Principles for Superfund Sites, October 7, 1999

    Science.gov (United States)

    This guidance is intended to help Superfund risk managers make ecological risk management decisions that are based on sound science, consistent across Regions, and present a characterization of site risks that is transparent to the public.

  3. EPA Contract Laboratory Program Statement of Work for Inorganic Superfund Methods Multi-Media, Multi-Concentration ISM02.2

    Science.gov (United States)

    This document contains analytical methods for the analysis of metals and cyanide in environmental samples. It also contains contractual requirements for laboratories participating in Superfund's Contract Laboratory Program.

  4. EPA Contract Laboratory Program Statement of Work for Inorganic Superfund Methods Multi-Media, Multi-Concentration ISM02.3

    Science.gov (United States)

    This document contains analytical methods for the analysis of metals and cyanide in environmental samples. It also contains contractual requirements for laboratories participating in Superfund's Contract Laboratory Program.

  5. Biomonitoring for metal contamination near two Superfund sites in Woburn, Massachusetts, using phytochelatins

    Energy Technology Data Exchange (ETDEWEB)

    Gawel, James E.; Hemond, Harold F

    2004-09-01

    Characterizing the spatial extent of groundwater metal contamination traditionally requires installing sampling wells, an expensive and time-consuming process in urban areas. Moreover, extrapolating biotic effects from metal concentrations alone is problematic, making ecological risk assessment difficult. Our study is the first to examine the use of phytochelatin measurements in tree leaves for delimiting biological metal stress in shallow, metal-contaminated groundwater systems. Three tree species (Rhamnus frangula, Acer platanoides, and Betula populifolia) growing above the shallow groundwater aquifer of the Aberjona River watershed in Woburn, Massachusetts, display a pattern of phytochelatin production consistent with known sources of metal contamination and groundwater flow direction near the Industri-Plex Superfund site. Results also suggest the existence of a second area of contaminated groundwater and elevated metal stress near the Wells G and H Superfund site downstream, in agreement with a recent EPA ecological risk assessment. Possible contamination pathways at this site are discussed.

  6. Electrochemical peroxidation of PCBs and VOCs in superfund site water and sediments

    Energy Technology Data Exchange (ETDEWEB)

    Scrudato, R.J.; Chiarenzelli, J.R. [SUNY, Oswego, NY (United States)

    1996-12-31

    An electrochemical peroxidation (ECP) process has been developed and used to degrade polychlorinated biphenyls (PCB) and volatile organic compounds (VOC)-contaminated water, sludge, and sediments at a New York State Federal and State Superfund Site. The process involves passing an oscillating low-amperage (<10 amps) current through steel electrodes immersed in an acidified water or sediment slurry into which hydrogen peroxide (<1,000 ppm) is added. The generated free radicals attack organic compounds, including organo-metallic complexes and refractory compounds including PCBs. PCB degradation ranged from about 30% to 80% in experiments involving Federal Superfund Site sediments; total PCBs were reduced by {approximately}97% to 68%, respectively, in water and slurry collected from a State Superfund subsurface storage tank. VOC bench-scale experiments involved chloroethane, 1,1-dichloroethane, dichloromethane, 1,1,1-trichloroethane, and acetone and after a 3-min ECP treatment, degradation ranged from >94% to about 99.9%. Results indicate the ECP is a viable process to degrade organic contaminants in water and sediment suspensions. Because the treated water suspensions are acidified, select trace metal sorbed to the particulates is solubilized and therefore can be segregated from the particulates, offering a process that simultaneously degrades organic contaminants and separates trace metals. 19 refs., 1 fig., 4 tabs.

  7. Timed intercourse for couples trying to conceive

    NARCIS (Netherlands)

    Manders, M.; McLindon, L.; Schulze, B.; Beckmann, M.M.; Kremer, J.A.M.; Farquhar, C.

    2015-01-01

    BACKGROUND: Fertility problems are very common, as subfertility affects about 10% to 15% of couples trying to conceive. There are many factors that may impact a couple's ability to conceive and one of these may be incorrect timing of intercourse. Conception is only possible from approximately five d

  8. Try This: Umbrella--Materials Testing

    Science.gov (United States)

    Preston, Christine

    2016-01-01

    This article is the second in "Teaching Science's" "Try This" series. These hands-on activities are designed especially for early childhood students to encourage their natural curiosity and promote development of scientific thinking. In this activity, the problem-based learning approach means that the children are engaged in a…

  9. An Optical Tri-valued Computing System

    Directory of Open Access Journals (Sweden)

    Junjie Peng

    2014-03-01

    Full Text Available A new optical computing experimental system is presented. Designed based on tri-valued logic, the system is built as a photoelectric hybrid computer system which is much advantageous over its electronic counterparts. Say, the tri-valued logic of the system guarantees that it is more powerful in information processing than that of systems with binary logic. And the optical characteristic of the system makes it be much capable in huge data processing than that of the electronic computers. The optical computing system includes two parts, electronic part and optical part. The electronic part consists of a PC and two embedded systems which are used for data input/output, monitor, synchronous control, user data combination and separation and so on. The optical part includes three components. They are optical encoder, logic calculator and decoder. It mainly answers for encoding the users' requests into tri-valued optical information, computing and processing the requests, decoding the tri-valued optical information to binary electronic information and so forth. Experiment results show that the system is quite right in optical information processing which demonstrates the feasibility and correctness of the optical computing system.

  10. Toxic Releases/IGD: EF_TRI

    Data.gov (United States)

    U.S. Environmental Protection Agency — EF_NPL is a subset of facilities from FRS_INTEREST and FRS_FACILITY_SITE which are updated on a monthly basis as part of the Locational Reference EF_TRI is a subset...

  11. Trying and the Arguments from Total Failure

    DEFF Research Database (Denmark)

    Grünbaum, Thor

    2008-01-01

    is be to build a case against the possibility of naked, independently existing tryings, by questioning how well we understand the scenarios invoked in their favour. Thus, rather than attempting to present a definitive metaphysical refutation of New Volitionalism, I attempt to diminish or demolish its underlying...

  12. Methane Tri-reforming over nickel catalysts

    OpenAIRE

    García Vargas, José Manuel

    2014-01-01

    The present work is part of a research program carried out in the Department of Chemical Engineering at the University of Castilla-La Mancha, focused in the preparation, characterization and evaluation of catalysts that can be applied in industrially relevant reactions. In this way, the PhD work reported here was aimed to study and improve nickel catalysts applied to the tri-reforming process, evaluating the role of support, precursor and promoter and optimizing the catalyst preparation. Furt...

  13. Giving Games the Old College Try

    Directory of Open Access Journals (Sweden)

    Amy R. Hofer

    2013-12-01

    Full Text Available In Brief: Based on evidence that games might help students get more engaged in my online class, I decided to overcome my skepticism and road-test two information literacy games. First I tried BiblioBouts, which uses the online citation management tool Zotero to integrate gaming into a research paper assignment that is already part of the course […

  14. A transgenic tri-modality reporter mouse.

    Directory of Open Access Journals (Sweden)

    Xinrui Yan

    Full Text Available Transgenic mouse with a stably integrated reporter gene(s can be a valuable resource for obtaining uniformly labeled stem cells, tissues, and organs for various applications. We have generated a transgenic mouse model that ubiquitously expresses a tri-fusion reporter gene (fluc2-tdTomato-ttk driven by a constitutive chicken β-actin promoter. This "Tri-Modality Reporter Mouse" system allows one to isolate most cells from this donor mouse and image them for bioluminescent (fluc2, fluorescent (tdTomato, and positron emission tomography (PET (ttk modalities. Transgenic colonies with different levels of tri-fusion reporter gene expression showed a linear correlation between all three-reporter proteins (R(2=0.89 for TdTomato vs Fluc, R(2=0.94 for Fluc vs TTK, R(2=0.89 for TdTomato vs TTK in vitro from tissue lysates and in vivo by optical and PET imaging. Mesenchymal stem cells (MSCs isolated from this transgenics showed high level of reporter gene expression, which linearly correlated with the cell numbers (R(2=0.99 for bioluminescence imaging (BLI. Both BLI (R(2=0.93 and micro-PET (R(2=0.94 imaging of the subcutaneous implants of Tri-Modality Reporter Mouse derived MSCs in nude mice showed linear correlation with the cell numbers and across different imaging modalities (R(2=0.97. Serial imaging of MSCs transplanted to mice with acute myocardial infarction (MI by intramyocardial injection exhibited significantly higher signals in MI heart at days 2, 3, 4, and 7 (p<0.01. MSCs transplanted to the ischemic hindlimb of nude mice showed significantly higher BLI and PET signals in the first 2 weeks that dropped by 4(th week due to poor cell survival. However, laser Doppler perfusion imaging revealed that blood circulation in the ischemic limb was significantly improved in the MSCs transplantation group compared with the control group. In summary, this mouse can be used as a source of donor cells and organs in various research areas such as stem cell

  15. A Transgenic Tri-Modality Reporter Mouse

    Science.gov (United States)

    Yan, Xinrui; Ray, Pritha; Paulmurugan, Ramasamy; Tong, Ricky; Gong, Yongquan; Sathirachinda, Ataya; Wu, Joseph C.; Gambhir, Sanjiv S.

    2013-01-01

    Transgenic mouse with a stably integrated reporter gene(s) can be a valuable resource for obtaining uniformly labeled stem cells, tissues, and organs for various applications. We have generated a transgenic mouse model that ubiquitously expresses a tri-fusion reporter gene (fluc2-tdTomato-ttk) driven by a constitutive chicken β-actin promoter. This “Tri-Modality Reporter Mouse” system allows one to isolate most cells from this donor mouse and image them for bioluminescent (fluc2), fluorescent (tdTomato), and positron emission tomography (PET) (ttk) modalities. Transgenic colonies with different levels of tri-fusion reporter gene expression showed a linear correlation between all three-reporter proteins (R2=0.89 for TdTomato vs Fluc, R2=0.94 for Fluc vs TTK, R2=0.89 for TdTomato vs TTK) in vitro from tissue lysates and in vivo by optical and PET imaging. Mesenchymal stem cells (MSCs) isolated from this transgenics showed high level of reporter gene expression, which linearly correlated with the cell numbers (R2=0.99 for bioluminescence imaging (BLI)). Both BLI (R2=0.93) and micro-PET (R2=0.94) imaging of the subcutaneous implants of Tri-Modality Reporter Mouse derived MSCs in nude mice showed linear correlation with the cell numbers and across different imaging modalities (R2=0.97). Serial imaging of MSCs transplanted to mice with acute myocardial infarction (MI) by intramyocardial injection exhibited significantly higher signals in MI heart at days 2, 3, 4, and 7 (p<0.01). MSCs transplanted to the ischemic hindlimb of nude mice showed significantly higher BLI and PET signals in the first 2 weeks that dropped by 4th week due to poor cell survival. However, laser Doppler perfusion imaging revealed that blood circulation in the ischemic limb was significantly improved in the MSCs transplantation group compared with the control group. In summary, this mouse can be used as a source of donor cells and organs in various research areas such as stem cell research

  16. Aquatic assessment of the Ely Copper Mine Superfund site, Vershire, Vermont

    Science.gov (United States)

    Seal, Robert R.; Kiah, Richard G.; Piatak, Nadine M.; Besser, John M.; Coles, James F.; Hammarstrom, Jane M.; Argue, Denise M.; Levitan, Denise M.; Deacon, Jeffrey R.; Ingersoll, Christopher G.

    2010-01-01

    The Ely Mine, which operated from 1821 to 1905, and its area of downstream impact constitute the Ely Copper Mine Superfund site. The site was placed on the National Priorities List in 2001. The mine comprises underground workings, foundations from historical structures, several waste-rock piles, roast beds associated with the smelting operation, and slag piles resulting from the smelting. The mine site is drained by Ely Brook, which includes several tributaries, one of which drains a series of six ponds. Ely Brook empties into Schoolhouse Brook, which flows 3.3 kilometers and joins the Ompompanoosuc River.

  17. Geophysical logging at the Cristex Drum National Priorities List Superfund Site near Oxford, North Carolina

    Science.gov (United States)

    Antolino, Dominick J.

    2017-01-01

    The collection of borehole geophysical logs data was conducted by the U.S. Geological Survey South Atlantic Water Science Center in the vicinity of the Cristex Drum National Priorities List Superfund Site near Oxford, North Carolina, during January through March 2016. In an effort to assist the U.S. Environmental Protection Agency in the development of a conceptual groundwater model for the assessment of current contaminant distribution and future migration of contaminants, borehole geophysical log and image data collection, which included the delineation of more than 150 subsurface features (primarily fracture orientations) in 3 open borehole wells.

  18. Synergistic Extraction of Lactic Acid with Tri-n-Octylamine and Try-n-Butylphosphate

    Energy Technology Data Exchange (ETDEWEB)

    Matsumoto, Michiaki.; Yuba, Seiji.; Kondo, Kazuo. [Doshisha University, Department of Chemical Engineering and Materials Science (Japan)

    1998-12-01

    Synergistic extraction system of lactic acid is examined to develop to in situ extractive fermentation process. The addition of try-n-butyl phosphate(TBP) to the extraction system of lactic acid(HA) with tri-n-actylamine(TOA) diluted by hexane causes a large synergism. Extraction reaction with the mixed extractant is interpreted quite well based on the formation of mixed complex, HA{center_dot}TOA{center_dot}2TBP. Though the addition of hexane solution containing TBP and TOA to the culture of Lactobacillus rhamnosus results in low lactate production, some lactate is produced. (author)

  19. Synergistic Extraction of Lactic Acid with Tri-n-Octylamine and Try-n-Butylphosphate

    Energy Technology Data Exchange (ETDEWEB)

    Matsumoto, Michiaki.; Yuba, Seiji.; Kondo, Kazuo. (Doshisha University, Department of Chemical Engineering and Materials Science (Japan))

    1998-12-01

    Synergistic extraction system of lactic acid is examined to develop to in situ extractive fermentation process. The addition of try-n-butyl phosphate(TBP) to the extraction system of lactic acid(HA) with tri-n-actylamine(TOA) diluted by hexane causes a large synergism. Extraction reaction with the mixed extractant is interpreted quite well based on the formation of mixed complex, HA[center dot]TOA[center dot]2TBP. Though the addition of hexane solution containing TBP and TOA to the culture of Lactobacillus rhamnosus results in low lactate production, some lactate is produced. (author)

  20. 75 FR 54297 - Tri-County Advisory Committee Meeting

    Science.gov (United States)

    2010-09-07

    ... Forest Service Tri-County Advisory Committee Meeting AGENCY: Forest Service, USDA. ACTION: Notice of... Beaverhead-Deerlodge National Forest's Tri-County Resource Advisory Committee will meet on Thursday September... INFORMATION CONTACT: Patty Bates, Tri County Resource Advisory Committee Coordinator, Beaverhead-Deerlodge...

  1. Environmental Asbestos Assessment Manual Superfund Method for the Determination of Asbestos in Ambient Air Part 2: Technical Background Document

    Science.gov (United States)

    A sampling and analysis method for the determination of asbestos in air is presented in Part 1 of this report, under separate cover. This method is designed specifically to provide results suitable for supporting risk assessments at Superfund sites, although it is applicable t...

  2. ASSESSMENT OF VAPOR INTRUSION IN HOMES NEAR THE RAYMARK SUPERFUND SITE USING BASEMENT AND SUB-SLAB AIR SAMPLES

    Science.gov (United States)

    This report describes the results of an investigation conducted to assist EPA’s New England Regional Office in evaluating vapor intrusion at 15 homes and one commercial building near the Raymark Superfund Site in Stratford, Connecticut. Methods were developed to sample sub-slab ...

  3. Characterization of Tri-lab Tantalum Plate.

    Energy Technology Data Exchange (ETDEWEB)

    Buchheit, Thomas E.; Cerreta, Ellen K.; Deibler, Lisa Anne; Chen, Shu-Rong; Michael, Joseph R.

    2014-09-01

    This report provides a detailed characterization Tri-lab Tantalum (Ta) plate jointly purchased from HCStark Inc. by Sandia, Los Alamos and Lawrence Livermore National Laboratories. Data in this report was compiled from series of material and properties characterization experiments carried out at Sandia (SNL) and Los Alamos (LANL) Laboratories through a leveraged effort funded by the C2 campaign. Results include microstructure characterization detailing the crystallographic texture of the material and an increase in grain size near the end of the rolled plate. Mechanical properties evaluations include, compression cylinder, sub-scale tension specimen, micohardness and instrumented indentation testing. The plate was found to have vastly superior uniformity when compare with previously characterized wrought Ta material. Small but measurable variations in microstructure and properties were noted at the end, and at the top and bottom edges of the plate.

  4. Tri-Center Analysis: Determining Measures of Trichotomous Central Tendency for the Parametric Analysis of Tri-Squared Test Results

    Science.gov (United States)

    Osler, James Edward

    2014-01-01

    This monograph provides an epistemological rational for the design of a novel post hoc statistical measure called "Tri-Center Analysis". This new statistic is designed to analyze the post hoc outcomes of the Tri-Squared Test. In Tri-Center Analysis trichotomous parametric inferential parametric statistical measures are calculated from…

  5. DMPD: RIG-I: tri-ing to discriminate between self and non-self RNA. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available 17307033 RIG-I: tri-ing to discriminate between self and non-self RNA. Bowie AG, Fi...-I: tri-ing to discriminate between self and non-self RNA. PubmedID 17307033 Title RIG-I: tri-ing to discriminate between self... and non-self RNA. Authors Bowie AG, Fitzgerald KA. Publication

  6. Hydrogeologic characterization and assessment of bioremediation of chlorinated benzenes and benzene in wetland areas, Standard Chlorine of Delaware, Inc. Superfund Site, New Castle County, Delaware, 2009-12

    Science.gov (United States)

    Lorah, Michelle M.; Walker, Charles W.; Baker, Anna C.; Teunis, Jessica A.; Majcher, Emily H.; Brayton, Michael J.; Raffensperger, Jeff P.; Cozzarelli, Isabelle M.

    2014-01-01

    Wetlands at the Standard Chlorine of Delaware, Inc. Superfund Site (SCD) in New Castle County, Delaware, are affected by contamination with chlorobenzenes and benzene from past waste storage and disposal, spills, leaks, and contaminated groundwater discharge. In cooperation with the U.S. Environmental Protection Agency, the U.S. Geological Survey began an investigation in June 2009 to characterize the hydrogeology and geochemistry in the wetlands and assess the feasibility of monitored natural attenuation and enhanced bioremediation as remedial strategies. Groundwater flow in the wetland study area is predominantly vertically upward in the wetland sediments and the underlying aquifer, and groundwater discharge accounts for a minimum of 47 percent of the total discharge for the subwatershed of tidal Red Lion Creek. Thus, groundwater transport of contaminants to surface water could be significant. The major contaminants detected in groundwater in the wetland study area included benzene, monochlorobenzene, and tri- and di-chlorobenzenes. Shallow wetland groundwater in the northwest part of the wetland study area was characterized by high concentrations of total chlorinated benzenes and benzene (maximum about 75,000 micrograms per liter [μg/L]), low pH, and high chloride. In the northeast part of the wetland study area, wetland groundwater had low to moderate concentrations of total chlorinated benzenes and benzene (generally not greater than 10,000 μg/L), moderate pH, and high sulfate concentrations. Concentrations in the groundwater in excess of 1 percent of the solubility of the individual chlorinated benzenes indicate that a contaminant source is present in the wetland sediments as dense nonaqueous phase liquids (DNAPLs). Consistently higher contaminant concentrations in the shallow wetland groundwater than deeper in the wetland sediments or the aquifer also indicate a continued source in the wetland sediments, which could include dissolution of DNAPLs and

  7. Congressional Testimony: Statement of Wade T. Najjum Before the Subcommittee on Superfund and Environmental Health Committee on Environment and Public Works United States Senate

    Science.gov (United States)

    Statement of Wade T. Najjum Assistant Inspector General for Program Evaluation U.S. EPA Office of Inspector General Before the Subcommittee on Superfund and Environmental Health Committee on Environment and Public Works United States Senate

  8. Environmental contaminants in fish and mussels from Meddybemps Lake, the Dennys River, and East Machias River - Eastern Surplus Superfund Site, Meddybemps, Maine

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — From 1946 to the early 1980s, the 3-acre Eastern Surplus Superfund Site in Meddybemps, Maine, was used for the disposal and storage of surplus military equipment and...

  9. Integrating Monitoring and Genetic Methods To Infer Historical Risks of PCBs and DDE to Common and Roseate Terns Nesting Near the New Bedford Harbor Superfund Site (Massachusetts, USA)

    Science.gov (United States)

    Common and roseate terns are migratory piscivorous seabirds with major breeding colonies within feeding range of thepolychlorinated biphenyl (PCB)-contaminated New Bedford Harbor (NBH, MA, USA) Superfund site. Our longitudinal study shows that before PCB discharges into NBH cease...

  10. Continued geophysical logging near the GMH Electronics National Priorities List Superfund site near Roxboro, North Carolina

    Science.gov (United States)

    Antolino, Dominick J.; Chapman, Melinda J.

    2017-01-06

    The U.S. Geological Survey South Atlantic Water Science Center collected borehole geophysical logs and images and continuous water-level data near the GMH Electronics National Priorities List Superfund site near Roxboro, North Carolina, during December 2012 through July 2015. Previous work by the U.S. Geological Survey South Atlantic Water Science Center at the site involved the collection of borehole geophysical log data in 15 wells, in addition to surface geologic mapping and passive diffusion bag sampling. In a continued effort to assist the U.S. Environmental Protection Agency in developing a conceptual groundwater model to assess current contaminant distribution and future migration of contaminants, more than 900 subsurface features (primarily fracture orientations) in 10 open borehole wells were delineated and continuous water-level data information from 14 monitoring wells within close proximity of the initially drilled boreholes was collected to observe any induced water-level fluctuations during drilling operations

  11. Raman spectroscopy of efflorescent sulfate salts from Iron Mountain Mine Superfund Site, California.

    Science.gov (United States)

    Sobron, Pablo; Alpers, Charles N

    2013-03-01

    The Iron Mountain Mine Superfund Site near Redding, California, is a massive sulfide ore deposit that was mined for iron, silver, gold, copper, zinc, and pyrite intermittently for nearly 100 years. As a result, both water and air reached the sulfide deposits deep within the mountain, producing acid mine drainage consisting of sulfuric acid and heavy metals from the ore. Particularly, the drainage water from the Richmond Mine at Iron Mountain is among the most acidic waters naturally found on Earth. The mineralogy at Iron Mountain can serve as a proxy for understanding sulfate formation on Mars. Selected sulfate efflorescent salts from Iron Mountain, formed from extremely acidic waters via drainage from sulfide mining, have been characterized by means of Raman spectroscopy. Gypsum, ferricopiapite, copiapite, melanterite, coquimbite, and voltaite are found within the samples. This work has implications for Mars mineralogical and geochemical investigations as well as for terrestrial environmental investigations related to acid mine drainage contamination.

  12. Raman spectroscopy of efflorescent sulfate salts from Iron Mountain Mine Superfund Site, California

    Science.gov (United States)

    Sobron, Pablo; Alpers, Charles N.

    2013-01-01

    The Iron Mountain Mine Superfund Site near Redding, California, is a massive sulfide ore deposit that was mined for iron, silver, gold, copper, zinc, and pyrite intermittently for nearly 100 years. As a result, both water and air reached the sulfide deposits deep within the mountain, producing acid mine drainage consisting of sulfuric acid and heavy metals from the ore. Particularly, the drainage water from the Richmond Mine at Iron Mountain is among the most acidic waters naturally found on Earth. The mineralogy at Iron Mountain can serve as a proxy for understanding sulfate formation on Mars. Selected sulfate efflorescent salts from Iron Mountain, formed from extremely acidic waters via drainage from sulfide mining, have been characterized by means of Raman spectroscopy. Gypsum, ferricopiapite, copiapite, melanterite, coquimbite, and voltaite are found within the samples. This work has implications for Mars mineralogical and geochemical investigations as well as for terrestrial environmental investigations related to acid mine drainage contamination.

  13. Surface geophysics and porewater evaluation at the Lower Darby Creek Area Superfund Site, Philadelphia, Pennsylvania, 2013

    Science.gov (United States)

    Walker, Charles W.; Degnan, James R.; Brayton, Michael J.; Cruz, Roberto M.; Lorah, Michelle M.

    2015-01-01

    In cooperation with the U.S. Environmental Protection Agency (EPA), Region 3, the U.S. Geological Survey (USGS) is participating in an ongoing study to aid in the identification of subsurface heterogeneities that may act as preferential pathways for contaminant transport in and around the Lower Darby Creek Area (LDCA) Superfund Site, Philadelphia Pa. Lower Darby Creek, which flows into the Delaware River, borders the western part of the former landfill site. In 2013, the USGS conducted surface geophysics measurements and stream porewater sampling to provide additional data for EPA’s site characterization. This report contains data collected from field measurements of direct current (DC) resistivity, frequency-domain electromagnetic (FDEM) surveys, and stream porewater specific conductance (SC).

  14. Symptoms in smokers trying to quit

    Directory of Open Access Journals (Sweden)

    Helgason Asgeir R

    2006-08-01

    Full Text Available Abstract Aims To describe the prevalence and intensity of different symptoms in relation to tobacco abstinence. To explore latent dimensions between symptoms in smokers trying to quit. Design A cross sectional study using a questionnaire to retrospectively assess symptoms over a period of 12 months. Setting Swedish telephone quitline, a nationwide free of charge service. Participants All 741 individuals who had called the quitline and signed up for smoking cessation treatment between February 2000 to November 2001 and reported to have been smoke free for at least 24 hours during the previous 12 month period from first contact. Measurements Assessments were made by self-report, and abstinence was defined as "not a single puff of smoke during the last week". A factor analysis approach where individual items aggregate into factors was used to explore the relationship between the different symptoms. Findings High intensity of symptoms related to unsuccessful quitting attempts and included craving, irritability, apprehension/anxiety, difficulties concentrating, restlessness, depression/depressed mood, and insomnia. The factor loadings of all 17 symptoms resulted in three factors with factor 1, psychological being the most important. High scores on this factor relates to unsuccessful quitting attempts. Using Nicotine Replacement Therapy (NRT for 5 weeks or longer, reduced symptoms included in factor 1. The other two factors were factor 2 physiological and factor 3 neurological. Conclusion Symptoms that are psychological and/or neurological in nature are interrelated and appear to be the most significant obstacles for successful quitting attempts in a population-based setting. These symptoms may be successfully treated with NRT.

  15. Symptoms in smokers trying to quit

    Directory of Open Access Journals (Sweden)

    Helgason Asgeir R

    2006-08-01

    Full Text Available Abstract Aims To describe the prevalence and intensity of different symptoms in relation to tobacco abstinence. To explore latent dimensions between symptoms in smokers trying to quit. Design A cross sectional study using a questionnaire to retrospectively assess symptoms over a period of 12 months. Setting Swedish telephone quitline, a nationwide free of charge service. Participants All 741 individuals who had called the quitline and signed up for smoking cessation treatment between February 2000 to November 2001 and reported to have been smoke free for at least 24 hours during the previous 12 month period from first contact. Measurements Assessments were made by self-report, and abstinence was defined as "not a single puff of smoke during the last week". A factor analysis approach where individual items aggregate into factors was used to explore the relationship between the different symptoms. Findings High intensity of symptoms related to unsuccessful quitting attempts and included craving, irritability, apprehension/anxiety, difficulties concentrating, restlessness, depression/depressed mood, and insomnia. The factor loadings of all 17 symptoms resulted in three factors with factor 1, psychological being the most important. High scores on this factor relates to unsuccessful quitting attempts. Using Nicotine Replacement Therapy (NRT for 5 weeks or longer, reduced symptoms included in factor 1. The other two factors were factor 2 physiological and factor 3 neurological. Conclusion Symptoms that are psychological and/or neurological in nature are interrelated and appear to be the most significant obstacles for successful quitting attempts in a population-based setting. These symptoms may be successfully treated with NRT.

  16. PyTRiP - a toolbox and GUI for the proton/ion therapy planning system TRiP

    Science.gov (United States)

    Toftegaard, J.; Petersen, J. B.; Bassler, N.

    2014-03-01

    Purpose: Only very few treatment planning systems (TPS) are capable of handling heavy ions. Commercial heavy ion TPS are costly and normally restrict the possibility to implement new functionalities. PyTRiP provides Python bindings and a platform-independent graphical user interface (GUI) for the heavy ion treatment program TRiP, and adds seamless support of DICOM files. We aim to provide a front-end for TRiP which does not require any special computer skills. Methods: PyTRiP is written in Python combined with C for fast computing. Routines for DICOM file import/export to TRiPs native file format are implemented. The GUI comes as an executable with all its dependencies including PyTRiP making it easy to install on Windows, Mac and Linux. Results: PyTRiP is a comprehensive toolbox for handling TRiP. Treatment plans are handled using an object oriented structure. Bindings to TRiP (which only runs on Linux, either locally or on a remote server) are performed through a single function call. GUI users can intuitively create treatment plans without much knowledge about the TRiP user interface. Advanced users still have full access to all TRiP functionality. The user interface comes with a comprehensive plotting tool, which can visualize 2D contours, volume histograms, as well as dose- and linear energy transfer (LET) distributions. Conclusion: We developed a powerful toolbox for ion therapy research using TRiP as backend. The corresponding GUI allows to easily and intuitively create, calculate and visualize treatment plans. TRiP is thereby more accessible and simpler to use.

  17. A novel SOFC tri-generation system for building applications

    OpenAIRE

    Elmer, Theo

    2015-01-01

    In response to the critical need to decarbonise the built environment, alternative methods for more effective energy utilisation need to be explored including tri-generation systems. Tri-generation is the simultaneous generation of electricity, heating and/or cooling from a single fuel source. Solid oxide fuel cell (SOFC) and liquid desiccant demonstrate many characteristics that make them an attractive option in the development of an efficient and effective tri-generation system. SOFCs h...

  18. MALAYSIAN WEATHER DATA (TRY) FOR ENERGY SIMULATIONS IN BUILDINGS

    DEFF Research Database (Denmark)

    Reimann, Gregers Peter

    2001-01-01

    Detailed energy simulations for buildings in Malaysia have become possible after the recent construction of a Malaysian TRY (Test Reference Year) based on 21 years of hourly weather data from Subang Meteorological Station. The climatic parameters contained in the TRY are dry bulb temperature, wet...... making TSBI3 a powerful tool for energy analysis and optimisation of buildings. Other applications of the TRY are manifold including energy studies for solar systems and photovoltaic architecture....

  19. Preparation of tri- and difluoromethylsilanes via an unusual magnesium metal-mediated reductive tri- and difluoromethylation of chlorosilanes using tri- and difluoromethyl sulfides, sulfoxides, and sulfones.

    Science.gov (United States)

    Prakash, G K Surya; Hu, Jinbo; Olah, George A

    2003-05-30

    A new and efficient method for the preparation of tri- and difluoromethylsilanes using magnesium metal-mediated reductive tri- and difluoromethylation of chlorosilanes is reported using tri- and difluoromethyl sulfides, sulfoxides, and sulfones. The byproduct of the process is diphenyl disulfide. Since phenyl trifluoromethyl sulfone, sulfoxide, and sulfide are readily prepared from trifluoromethane (CF(3)H) and diphenyl disulfide, the method can be considered to be catalytic in diphenyl disulfide for the preparation of (trifluoromethyl)trimethylsilane (TMS-CF(3)) from non-ozone-depleting trifluoromethane.

  20. Tri-Cities Index of Innovation and Technology

    Energy Technology Data Exchange (ETDEWEB)

    Fowler, Richard A.; Scott, Michael J.; Butner, Ryan S.

    2011-01-17

    In 2001 and 2004, the Economic Development Office of Pacific Northwest National Laboratory published companion reports to the Washington Technology Center Index studies that provided additional information on the Tri-Cities (Kennewick-Richland-Pasco) area of the state, its technology businesses, and important advantages that the Tri-Cities have as places to live and do business. These reports also compared the Tri-Cities area to other technology-based metropolitan areas in the Pacific Northwest and nation along critical dimensions known to be important to technology firms. This report updates the material in these earlier reports, and highlights a growing Tri-Cities metropolitan area.

  1. Bismuth tri-iodide radiation detector development

    Science.gov (United States)

    Gokhale, Sasmit S.

    Bismuth tri-iodide is an attractive material for room temperature radiation detection. BiI3 demonstrates a number of properties that are apt for semiconductor radiation detection, especially gamma ray spectroscopy. The high atomic number (ZBi = 83 and ZI = 53) and the relatively high density (5.78 g/cm3) cause the material to have good photon stopping power, while the large band-gap (1.67 eV ) allows it to function as a room temperature radiation detector without any cooling mechanism. This work presents the fabrication and characterization of BiI3 radiation detectors. For the purpose of this research detectors were fabricated by cutting BiI3 crystal boules, followed by mechanical and chemical surface treatments. Detectors with various electrode geometries enabling single polarity charge sensing were fabricated. The electrical characteristics and the radiation response of the detectors were measured. The radiation response measurement was performed at room temperature using a 241Am alpha particle source and a 241Am sealed gamma-ray source. The spectral resolutions of the detectors varied from 2.09% - 6.1% for 59.5 keV gamma-rays and between 26% - 40% for 5.48 MeV alpha particles. Charge carrier properties such as the electron and hole mobility and lifetime were also estimated. The electron mobility for an ultrapure BiI 3 detector was estimated to be approximately 433 cm 2/Vs while that for antimony doped BiI3 was estimated to be around 956 cm2/Vs and the mobility-lifetime product for electrons was estimated to be around 5.44 x 10-4 cm 2/V. Detector simulation was performed using the Monte Carlo simulation code MCNP5. A Matlab script which incorporates charge carrier trapping and statistical variation was written to generate a gamma-ray spectrum from the simulated energy deposition spectra. Measured and simulated spectra were compared to extract the charge carrier mobility-lifetime products, which for electrons and holes were estimated to be 5 x 10-3 cm2/V and 1.3 x

  2. Financial Statement Audit Report of Tri-County Community College.

    Science.gov (United States)

    Campbell, Ralph

    This report presents the results of the Tri-County Community College financial statement audit for the fiscal year ending on June 30, 1998. Tri-County Community College is a component of the State of North Carolina, thus the authority to audit is granted by Article 5A of G.S. 147. The accounts and operations of the institution were subject to…

  3. 75 FR 3197 - Tri-County Advisory Committee Meeting

    Science.gov (United States)

    2010-01-20

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF AGRICULTURE Forest Service Tri-County Advisory Committee Meeting AGENCY: Forest Service, USDA. ACTION: Notice of... Beaverhead- Deerlodge National Forest's Tri-County Resource Advisory Committee will meet on Thursday February...

  4. 76 FR 13976 - Tri-County Advisory Committee Meeting

    Science.gov (United States)

    2011-03-15

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF AGRICULTURE Forest Service Tri-County Advisory Committee Meeting AGENCY: Forest Service, USDA. ACTION: Notice of... Beaverhead- Deerlodge National Forest's Tri-County Resource Advisory Committee will meet on Thursday April 7...

  5. 76 FR 29723 - Tri-County Advisory Committee Meeting

    Science.gov (United States)

    2011-05-23

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF AGRICULTURE Forest Service Tri-County Advisory Committee Meeting AGENCY: Forest Service, USDA. ACTION: Notice of... Beaverhead- Deerlodge National Forest's Tri-County Resource Advisory Committee will meet on Thursday June 16...

  6. Superfund reform: US Environmental Protection Agency`s 30-day study and its implication for the US Department of Energy

    Energy Technology Data Exchange (ETDEWEB)

    Siegel, M.R.; Friedman, J.R.; Neff, R.W.

    1993-03-01

    As part of an ongoing effort to reform and restructure the US Environmental Protection Agency`s (EPAS) Superfund program, the EPA Administrator on October 21, 1991, announced several key programmatic reforms. These reforms are a result of the Superfund 30-Day Task Force Report (30-Day Study, EPA 1991a), an effort carried out by EPAs office of Solid Waste and Emergency Response (OSWER). The EPA OSWER oversees environmental cleanup activities under a number of statutory authorities, including the Comprehensive Environmental response, Compensation, and Liability Act (CERCLA, also known as Superfund). CERCLA and its implementing regulation, the National Contingency Plan (NCP), establish a regulatory framework to govern the cleanup of existing, and often abandoned, hazardous waste sites. The purposes of this report are to (1) review the background and recommendations of EPNs 30-Day Study, (2) identify and discuss the initiatives from the 30-Day Study that may impact DOE`s environmental restoration mission, (3) report on EPAs progress in implementing the selected priority initiatives, and (4) describe potentially related DOE activities.

  7. Superfund and Toxic Release Inventory Sites, StateCERCLIS-This data set contains potential EPA Superfund sites. These locations represent sites, not contaminated areas., Published in 2008, 1:100000 (1in=8333ft) scale, State of Utah Automated Geographic Reference Center.

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — This Superfund and Toxic Release Inventory Sites dataset, published at 1:100000 (1in=8333ft) scale, was produced all or in part from Field Survey/GPS information as...

  8. Superfund and Toxic Release Inventory Sites, Point or polygon geo-location of federally designated superfund sites in Wisconsin. Usually geolocated via on screen digitizing against DOPs (could be geo-located via GPS). Source year of DOPs vary, Published in unknown, 1:4800 (1in=400ft) scale, Wisconsin DNR - Bureau of Remediation and Redevelopment.

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — This Superfund and Toxic Release Inventory Sites dataset, published at 1:4800 (1in=400ft) scale, was produced all or in part from Orthoimagery information as of...

  9. Design and Implementation of A PV Powered Tri-Cycle

    Directory of Open Access Journals (Sweden)

    Soumya Das

    2016-04-01

    Full Text Available Solar PV technology is one of the first among the various renewable energy technologies that have been adopted and accepted universally in order to meet the basic needs of generation of electricity. The objective of this paper is to propose a tri-cycle that utilises the application of stand-alone photovoltaic (PV system. A preliminary design and construction of a solar tri-cycle has been performed by evaluating and estimating the required panel size, battery capacity and motor power. Calculation in this paper exhibit that the solar power alone will be sufficient to operate a tri-cycle from one place to another.

  10. Studies on Effect of Tri(2-hydroxypropyl), Tri(2-hydroxybutyl) and Tri(hydroxythiodiethylene) Borates on Thermal and Heat Properties of Rigid Polyurethane-Polyisocyanurate Foams

    Institute of Scientific and Technical Information of China (English)

    CZUPRYNSKI, Boguslaw; PACIOREK-SADOWSKA, Joanna; LISZKOWSKA, Joanna

    2006-01-01

    Effect of tri(2-hydroxypropyl), tri(2-hydroxybutyl) and tri(hydroxythiodiethylene) borates (BT2HB, BT2HP and BTHET) on the thermal and heat properties of the rigid polyurethane-polyisocyanurate (PUR-PIR) foams was investigated. Increasing amounts of BT2HB and BT2HP in the foam composition, from 0.05 to 0.4 of chemical equivalent, caused increases in the softening point, the temperature of the first mass loss, the extrapolated temperature of the main mass loss foam and temperature of the highest rate of the mass loss. In the case when BTHTE was added to the foam compositions, the lower increase in the mentioned above characteristic temperatures was observed as compared to those of standard foam (without borate added).

  11. Phytoextraction of Pb and Cd from a superfund soil: effects of amendments and croppings.

    Science.gov (United States)

    Bricker, T J; Pichtel, J; Brown, H J; Simmons, M

    2001-01-01

    In a growth chamber, maize (Zea mays) and Indian mustard (Brassica juncea) were grown over two croppings in soil from a Superfund site (PbTotal = 65,200 mg/kg and CdTotal = 52mg/kg). Soil treatments consisted of ethylenediaminetetraacetic acid, sodium citrate and composted sewage sludge, each at two rates (EDTA .05%, EDTA .2%, citrate .05%, citrate .2%, CSS 5% and CSS 10%, respectively). In most cases, the EDTA and citrate treatments were superior in terms of solubilizing soil Pb for root uptake and translocation into above-ground biomass. In the first maize crop, the EDTA .2% treatment resulted in 2,435 and 9,389mg/kg Pb in shoot and root tissues, respectively. The CSS treatments typically resulted in lowest Pb and Cd removal efficiencies. Lead remaining in the soil after two croppings was mainly associated with the carbonate, organic, and residual fractions, which represent the less bioavailable forms. Soil Cd was generally more mobile for plant uptake than soil Pb. The EDTA .2% and citrate treatments were most successful in promoting Cd uptake by both maize and mustard. Although Pb concentrations (mg/kg tissue) were lower for maize than mustard, the former removed more total Pb (0.2 mg per pot, mean over all treatments), compared to mustard (0.03 mg), by virtue of its higher biomass production.

  12. Fishing a superfund site: Dissonance and risk perception of environmental hazards by fishermen in Puerto Rico

    Energy Technology Data Exchange (ETDEWEB)

    Burger, J.; Gochfeld, M. (Rutgers University, Piscataway, NJ (USA))

    1991-06-01

    Risk perception studies show that individuals tend to underestimate significant risks, overestimate negligible ones, and distrust authorities. They also rely on a variety of strategies or heuristics to reach decisions regarding their risk-taking behavior. The authors report on a survey of fishermen and crabbers engaged in recreational and substance fishing in a Puerto Rican estuary (near Humacao), which has been declared a Superfund site because of suspected contamination by mercury, and at ecologically similar control sites. Nearly everyone interviewed at the Humacao site was aware of the mercury contamination, but either denied its importance, believed the contamination was restricted to a distant part of the estuary, or assumed that the estuary would be closed by the authorities if the threat was real. All site-users consumed the fish and crabs they caught. At Humacao, the average catch was 7 fish per fishermen (mostly tilapia, Tilapia mossambica, and tarpon, Megalops atlantica) and 13 crabs per crabber (all blue crabs, Callinectes sapidus). On average, the site-users returned to the lagoons about 3-4 times per month. At control sites, fewer fish were eaten. The worst case consumption of tarpon, a species which concentrated mercury at Eastern Puerto Rico, provided an exposure exceeding the EPA reference dose, whereas consumption of one tarpon per week did not entail excess exposure. Fortunately, few individuals caught tarpon exclusively. Unlike counterparts in the northeastern United States, they trusted authorities and indicated that they would have heeded warnings of mercury contamination posted where they fished.

  13. Tri-Monthly Wildlife Information Reports, Multiple Species

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Tri-Monthly Wildlife Information Reports on multiple species of wildlife including reptiles, mammals, and avian species at Morgan Brake NWR.

  14. Does Legalizing Pot Spur Kids to Try It?

    Science.gov (United States)

    ... html Does Legalizing Pot Spur Kids to Try It? In 2 states studied, teens downplayed harms after ... stigmatized and adolescents were more likely to use it," said study author Magdalena Cerda. She is an ...

  15. Factors that contribute to the willingness to try "street hypnosis".

    Science.gov (United States)

    Davis, Orin C; Gao, Xuan

    2014-01-01

    This study takes a context-specific approach to examine people's willingness to try hypnosis under various conditions and the factors that contribute to their willingness. It examined 378 participants, who completed a web-based hypnosis survey. The results showed that people's willingness to try hypnosis varies by context. Specifically, people are more willing to try hypnosis when it is framed as "peak focus" rather than "hypnosis" and when they perceive the environment as being safer. Moreover, factors including participants' demographics, hypnotists' demographics (relative to the subjects'), participants' control bias, and knowledge of hypnosis affect people's degrees of willingness to try hypnosis, depending on the specific context. The results suggest further analysis of hypnosis occurring in public contexts and the effects it may have on attitudes and therapeutic outcomes.

  16. Tri-Service Center for Oral Health Studies (TSCOHS)

    Data.gov (United States)

    Federal Laboratory Consortium — The Tri-Service Center for Oral Health Studies (TSCOHS), a service of the Postgraduate Dental College, is chartered by the Department of Defense TRICARE Management...

  17. MALAYSIAN WEATHER DATA (TRY) FOR ENERGY SIMULATIONS IN BUILDINGS

    DEFF Research Database (Denmark)

    Reimann, Gregers Peter

    2001-01-01

    Detailed energy simulations for buildings in Malaysia have become possible after the recent construction of a Malaysian TRY (Test Reference Year) based on 21 years of hourly weather data from Subang Meteorological Station. The climatic parameters contained in the TRY are dry bulb temperature, wet...... bulb temperature, absolute humidity, relative humidity, cloud cover, wind speed, wind direction, sunshine hours, global, diffuse and beam solar radiation. The computer program TSBI3 uses the TRY to perform annual energy simulations for buildings hour by hour. The input and output are very detailed...... making TSBI3 a powerful tool for energy analysis and optimisation of buildings. Other applications of the TRY are manifold including energy studies for solar systems and photovoltaic architecture....

  18. TriG: Next Generation Scalable Spaceborne GNSS Receiver

    Science.gov (United States)

    Tien, Jeffrey Y.; Okihiro, Brian Bachman; Esterhuizen, Stephan X.; Franklin, Garth W.; Meehan, Thomas K.; Munson, Timothy N.; Robison, David E.; Turbiner, Dmitry; Young, Lawrence E.

    2012-01-01

    TriG is the next generation NASA scalable space GNSS Science Receiver. It will track all GNSS and additional signals (i.e. GPS, GLONASS, Galileo, Compass and Doris). Scalable 3U architecture and fully software and firmware recofigurable, enabling optimization to meet specific mission requirements. TriG GNSS EM is currently undergoing testing and is expected to complete full performance testing later this year.

  19. When trying to understand detracts from trying to behave: effects of perspective taking in intergroup interaction.

    Science.gov (United States)

    Vorauer, Jacquie D; Martens, Verena; Sasaki, Stacey J

    2009-04-01

    Four studies demonstrate that perspective taking can backfire in intergroup interaction, leading lower prejudice individuals to treat an outgroup member less positively than they do when they adopt alternative mind-sets; for higher prejudice individuals, perspective taking instead had a positive, albeit less consistent, effect on behavior. The net result was behavior disruption, whereby individuals' treatment of an outgroup member became incongruent with their inner attitudes. This disruption effect was evident for cognitive and affective forms of perspective taking, in ostensible and real face-to-face intergroup interactions, and for feelings of happiness experienced by individuals' interaction partner as well as outside observers' behavior assessments. Results further suggested that self-regulatory effort mediated the effect of perspective taking on intergroup interaction behavior, with the negative consequences of perspective taking for lower prejudice individuals' behavior appearing to stem from complacency rather than trying too hard. Overall, the findings reveal that perspective taking rather than self-focus accounts for the cognitive resource depletion and behavior disruption effects previously demonstrated to stem from evaluative concern in intergroup interaction and indicate that perspective taking may be more reliably helpful outside of intergroup interaction situations than within them.

  20. Geochemical Characteristics of TP3 Mine Wastes at the Elizabeth Copper Mine Superfund Site, Orange County, Vermont

    Science.gov (United States)

    Hammarstrom, Jane M.; Piatak, Nadine M.; Seal, Robert R., II; Briggs, Paul H.; Meier, Allen L.; Muzik, Timothy L.

    2003-01-01

    Remediation of the Elizabeth mine Superfund site in the Vermont copper belt poses challenges for balancing environmental restoration goals with issues of historic preservation while adopting cost-effective strategies for site cleanup and long-term maintenance. The waste-rock pile known as TP3, at the headwaters of Copperas Brook, is especially noteworthy in this regard because it is the worst source of surface- and ground-water contamination identified to date, while also being the area of greatest historical significance. The U.S. Geological Survey (USGS) conducted a study of the historic mine-waste piles known as TP3 at the Elizabeth mine Superfund site near South Strafford, Orange County, VT. TP3 is a 12.3-acre (49,780 m2) subarea of the Elizabeth mine site. It is a focus area for historic preservation because it encompasses an early 19th century copperas works as well as waste from late 19th- and 20th century copper mining (Kierstead, 2001). Surface runoff and seeps from TP3 form the headwaters of Copperas Brook. The stream flows down a valley onto flotation tailings from 20th century copper mining operations and enters the West Branch of the Ompompanoosuc River approximately 1 kilometer downstream from the mine site. Shallow drinking water wells down gradient from TP3 exceed drinking water standards for copper and cadmium (Hathaway and others, 2001). The Elizabeth mine was listed as a Superfund site in 2001, mainly because of impacts of acid-mine drainage on the Ompompanoosuc River.

  1. Superfund record of decision (EPA Region 4): Helena Chemical Company, (Tampa Plant), Hillsborough County, Tampa, FL, May 7, 1996

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-06-01

    The decision document (Record of Decision), presents the selected remedial action for the Helena Chemical Company Superfund Site, Tampa, Hillsborough County, Florida. This action addresses soil, sediment, and ground water contamination at the site and calls for the implementation of response measures which will protect human health and the environment. The selected remedy includes biological treatment (i.e., bioremediation) of pesticides and other site related contaminants located in surface soil sand sediments to levels appropriate for future industrial use of the Site. In addition, the selected remedy includes ground water recovery and treatment to remove pesticides and other site related contaminants.

  2. Characterization of ecological risks at the Milltown Reservoir-Clark Fork River Sediments Superfund Site, Montana

    Science.gov (United States)

    Pascoe, Gary A.; Blanchet, Richard J.; Linder, Greg L.; Palawski, Don; Brumbaugh, William G.; Canfield, Tim J.; Kemble, Nile E.; Ingersoll, Chris G.; Farag, Aïda M.; DalSoglio, Julie A.

    1994-01-01

    A comprehensive field and laboratory approach to the ecological risk assessment for the Milltown Reservoir-Clark Fork River Sediments Site, a Superfund site in the Rocky Mountains of Montana, has been described in the preceding reports of this series. The risk assessment addresses concerns over the ecological impacts of upstream releases of mining wastes to fisheries of the upper Clark Fork River (CFR) and the benthic and terrestrial habitats further downstream in Milltown Reservoir. The risk characterization component of the process integrated results from a triad of information sources: (a) chemistry studies of environmental media to identify and quantify exposures of terrestrial and aquatic organisms to site-related contaminants; (b) ecological or population studies of terrestrial vegetation, birds, benthic communities, and fish; and (c) in situ and laboratory toxicity studies with terrestrial and aquatic invertebrates and plants, small mammals, amphibians, and fish exposed to contaminated surface water, sediments, wetland soils, and food sources. Trophic transfer studies were performed on waterfowl, mammals, and predatory birds using field measurement data on metals concentrations in environmental media and lower trophic food sources. Studies with sediment exposures were incorporated into the Sediment Quality Triad approach to evaluate risks to benthic ecology. Overall results of the wetland and terrestrial studies suggested that acute adverse biological effects were largely absent from the wetland; however, adverse effects to reproductive, growth, and physiological end points of various terrestrial and aquatic species were related to metals exposures in more highly contaminated depositional areas. Feeding studies with contaminated diet collected from the upper CFR indicated that trout are at high risk from elevated metals concentrations in surface water, sediment, and aquatic invertebrates. Integration of chemical analyses with toxicological and ecological

  3. Evaluation of geophysical logs, phase I, for Crossley Farms Superfund Site, Berks County, Pennsylvania

    Science.gov (United States)

    Conger, Randall W.

    1998-01-01

    Twenty-one wells were drilled at Crossley Farms Superfund Site between December 15, 1987, and May 1, 1988, to define and monitor the horizontal and vertical distribution of ground-water contamination emanating from a suspected contaminant source area (Blackhead Hill). Eight well clusters were drilled on or near the Crossley Site and three well clusters were drilled at locations hydrologically down gradient from the site. Depths of wells range from 21 to 299 feet below land surface. These wells were installed in saprolite in shallow, intermediate, and deep water-producing zones of the fractured bedrock aquifer. Borehole-geophysical and video logging were conducted between April 24, 1997, and May 8, 1997, to determine the water-producing zones, water-receiving zones, zones of vertical flow, borehole depth, and casing integrity in each well. This data and interpretation will be used to determine the location of the well intake for the existing open-hole wells, which will be retrofitted to isolate and monitor water-producing zones and prevent further cross-contamination within each open borehole, and identify wells that may need rehabilitation or replacement. Caliper and video logs were used to locate fractures, inflections on fluid-temperature and fluidresistivity logs indicated possible fluid-bearing fractures, and flowmeter measurements verified these locations. Single-point-resistance and natural-gamma logs provided information on stratigraphy. After interpretation of geophysical logs, video logs, and driller?s notes, all wells will be constructed so that water-level fluctuations can be monitored and discrete water samples collected from shallow, intermediate, and deep water-bearing zones in each well. Geophysical logs were run on seven bedrock and two deep bedrock wells. Gamma logs were run on 10 bedrock wells. Twenty-two wells were inspected visually with the borehole video camera for casing integrity.

  4. Sustainable exposure prevention through innovative detection and remediation technologies from the NIEHS Superfund Research Program.

    Science.gov (United States)

    Henry, Heather F; Suk, William A

    2017-03-01

    Innovative devices and tools for exposure assessment and remediation play an integral role in preventing exposure to hazardous substances. New solutions for detecting and remediating organic, inorganic, and mixtures of contaminants can improve public health as a means of primary prevention. Using a public health prevention model, detection and remediation technologies contribute to primary prevention as tools to identify areas of high risk (e.g. contamination hotspots), to recognize hazards (bioassay tests), and to prevent exposure through contaminant cleanups. Primary prevention success is ultimately governed by the widespread acceptance of the prevention tool. And, in like fashion, detection and remediation technologies must convey technical and sustainability advantages to be adopted for use. Hence, sustainability - economic, environmental, and societal - drives innovation in detection and remediation technology. The National Institute of Health (NIH) National Institute of Environmental Health Sciences (NIEHS) Superfund Research Program (SRP) is mandated to advance innovative detection, remediation, and toxicity screening technology development through grants to universities and small businesses. SRP recognizes the importance of fast, accurate, robust, and advanced detection technologies that allow for portable real-time, on-site characterization, monitoring, and assessment of contaminant concentration and/or toxicity. Advances in non-targeted screening, biological-based assays, passive sampling devices (PSDs), sophisticated modeling approaches, and precision-based analytical tools are making it easier to quickly identify hazardous "hotspots" and, therefore, prevent exposures. Innovation in sustainable remediation uses a variety of approaches: in situ remediation; harnessing the natural catalytic properties of biological processes (such as bioremediation and phytotechnologies); and application of novel materials science (such as nanotechnology, advanced

  5. Evaluation of Exposure to Radon Levels in Relation to Climatic Conditions at a Superfund Site.

    Science.gov (United States)

    Merrill, Elaine Alice

    1995-11-01

    Workers at a Superfund site have expressed concern that they may be exposed to elevated levels of radon gas, especially when meteorology is suitable. The site, formally a uranium processing site, stores the world's largest quantity of Ra-226 in two concrete silos. A layer of bentonite foam was placed over the contents of the silos in 1991 as a means to reduce the amount of radon emissions. Hourly real-time outdoor and indoor site radon data covering an entire year was statistically evaluated in relation to meteorological data covering the same time period. The hourly data was found to be lognormally distributed. Radon levels were highest during the early morning hours and during the summer months. Both outdoor and indoor concentrations were found to significantly vary with temporal and climatic factors, namely wind direction and relative humidity. Radon levels in the work areas were not found to be statistically different from off-site levels. Only radon levels in the vicinity of the storage silos, which is an exclusion zone, were significantly higher than levels off-site. Hence, the protective bentonite covering seems to be effective in reducing radon emissions. Two methods were used to calculate a hypothetical dose, based upon the annual average concentrations of radon in the work areas onsite, the BEIR IV method and the NCRP method, respectively. The BEIR IV method, which accounts for the activity ratio of radon and its daughter products, resulted in a slightly higher dose than the NCRP method. As expected, based on the mean concentrations, the hypothetical annual exposures from radon in the work areas of the site were below recommended exposure limits.

  6. Detection of environmentally persistent free radicals at a superfund wood treating site.

    Science.gov (United States)

    dela Cruz, Albert Leo N; Gehling, William; Lomnicki, Slawomir; Cook, Robert; Dellinger, Barry

    2011-08-01

    Environmentally persistent free radicals (EPFRs) have previously been observed in association with combustion-generated particles and airborne PM(2.5) (particulate matter, d 2.5um). The purpose of this study was to determine if similar radicals were present in soils and sediments at Superfund sites. The site was a former wood treating facility containing pentachlorophenol (PCP) as a major contaminant. Both contaminated and noncontaminated (just outside the contaminated area) soil samples were collected. The samples were subjected to the conventional humic substances (HS) extraction procedure. Electron paramagnetic resonance (EPR) spectroscopy was used to measure the EPFR concentrations and determine their structure for each sample fraction. Analyses revealed a ∼30× higher EPFR concentration in the PCP contaminated soils (20.2 × 10(17) spins/g) than in the noncontaminated soil (0.7 × 10(17) spins/g). Almost 90% of the EPFR signal originated from the minerals/clays/humins fraction. GC-MS analyses revealed ∼6500 ppm of PCP in the contaminated soil samples and none detected in the background samples. Inductively coupled plasma-atomic emission spectrophotometry (ICP-AES) analyses revealed ∼7× higher concentrations of redox-active transition metals, in the contaminated soils than the noncontaminated soil. Vapor phase and liquid phase dosing of the clays/minerals/humins fraction of the soil with PCP resulted in an EPR signal identical to that observed in the contaminated soil, strongly suggesting the observed EPFR is pentachlorophenoxyl radical. Chemisorption and electron transfer from PCP to transition metals and other electron sinks in the soil are proposed to be responsible for EPFR formation.

  7. Short lived radioactive isotopes at TRI{mu}P facility

    Energy Technology Data Exchange (ETDEWEB)

    Shidling, P.D.; Giri, G.S.; Jungmann, K.; Kruithof, W.L.; Sohani, M.; Hoek, D.J. van der; Versolato, O.O.; Willmann, L.; Wilschut, H.W. [KVI, University of Groningen (Netherlands)

    2009-07-01

    At TRI{mu}P facility radioactive ion beam are produced and trapped for the study of fundamental symmetries and interaction in physics. The TRI{mu}P magnetic separator is used for in-flight production and separation of different radioactive isotopes. Different radioactive ion beam have been produced, via charge exchange, stripping, projectile fragmentation and fusion evaporation reactions in inverse kinematics. The radioactive beam can be used directly or can be converted to a low energy beam using a thermal ionizer. In this talk we focus on {sup 21}Na, {sup 213}Ra which are trapped as atoms or ions. With the trapping of {sup 21}Na we have completed the TRI{mu}P facility. Details on some selected aspect are discussed.

  8. Complete Tri-Axis Magnetometer Calibration with a Gyro Auxiliary.

    Science.gov (United States)

    Yang, Deng; You, Zheng; Li, Bin; Duan, Wenrui; Yuan, Binwen

    2017-05-26

    Magnetometers combined with inertial sensors are widely used for orientation estimation, and calibrations are necessary to achieve high accuracy. This paper presents a complete tri-axis magnetometer calibration algorithm with a gyro auxiliary. The magnetic distortions and sensor errors, including the misalignment error between the magnetometer and assembled platform, are compensated after calibration. With the gyro auxiliary, the magnetometer linear interpolation outputs are calculated, and the error parameters are evaluated under linear operations of magnetometer interpolation outputs. The simulation and experiment are performed to illustrate the efficiency of the algorithm. After calibration, the heading errors calculated by magnetometers are reduced to 0.5° (1σ). This calibration algorithm can also be applied to tri-axis accelerometers whose error model is similar to tri-axis magnetometers.

  9. Algunas cuestiones y problemas sobre triángulos

    OpenAIRE

    Romero, Juan-Bosco; López, Maria; Moreno, Sanchez

    1997-01-01

    En esta corta nota de carácter elemental presentar la relación que existe entre las mediatrices de un triángulo y las medias armónica y geométrica, así como la media geométrica ponderada de los números reales positivos, lo que es lo mismo de las longitudes de los segmentos geométricos asociados. Así mismo la construcción geométrica de todas las leyes anteriores a través del triángulo y sus mediatrices. También se presentan este artículo de nueva caracterización de los triángulos rectángulos...

  10. Toxics Release Inventory Chemical Hazard Information Profiles (TRI-CHIP) Dataset

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Toxics Release Inventory (TRI) Chemical Hazard Information Profiles (TRI-CHIP) dataset contains hazard information about the chemicals reported in TRI. Users can...

  11. Different acceptance functions for Multiple Try Metropolis schemes

    CERN Document Server

    Martino, Luca

    2012-01-01

    The Multiple Try Metropolis method is an extension of the classical Metropolis algorithm in which the next state of the chain is chosen among a set of samples, according to normalized weights. In literature, a generalization of this technique has been proposed in Pandolfi et al. (2010) where the weight functions are not analytically specified. In this work, we propose different Multiple Try Metropolis schemes where the analytic form of weight functions can be chosen arbitrarily. The resulting algorithms fulfill the detailed balance condition.

  12. Tri-generation in urban networks; Trigeneration en reseau urbain

    Energy Technology Data Exchange (ETDEWEB)

    Malahieude, J.M. [Trigen Energy Corp., New-York (United States)

    1996-12-31

    The concepts of tri-generation (simultaneous production of heat, electric power and refrigerating energy) and thermal energy distribution networks, are presented. The different components of the tri-generation system from Trigen Energy Corp. are ammonia as a refrigerant for the production of cooled water, screw compressors, gas turbines and an induction motor-generator in order to optimize the combined gas turbine and compressor utilization. The energy efficiency and pollution reduction of the system are evaluated; the system has been enhanced through re-powering and post combustion

  13. Calculating the Diffusive Flux of Persistent Organic Pollutants between Sediments and the Water Column on the Palos Verdes Shelf Superfund Site using Polymeric Passive Samplers

    Science.gov (United States)

    Passive samplers were used to determine water concentrations of persistent organic pollutants (POPs) in the surface sediments and near-bottom water of a marine Superfund site on the Palos Verdes Shelf, California, USA. Measured concentrations in the porewater and water column at...

  14. Passive Sampling to Measure Baseline Dissolved Persistent Organic Pollutant Concentrations in the Water Column of the Palos Verdes Shelf Superfund Site

    Science.gov (United States)

    Passive sampling was used to deduce water concentrations of persistent organic pollutants (POPs) in the vicinity of a marine Superfund site on the Palos Verdes Shelf, California, USA. Pre-calibrated solid phase microextraction (SPME) fibers and polyethylene (PE) strips that were...

  15. DOJ News Release: New York Man Ordered to Pay Over $400,000 in Restitution and Fines for Role in Kickback Scheme at New Jersey Superfund Sites

    Science.gov (United States)

    WASHINGTON, D.C. – An Amherst, New York, man was ordered to pay over $400,000 in restitution and fines and placed on five years’ probation for his role in a kickback scheme at the Federal Creosote and Diamond Alkali Superfund sites in New Jersey.

  16. Occurences and Fate of DDT Principal Isomers/Metabolites, DDA, and o,p'-DDD Enantiomers in Fish, Sediment and Water at a DDT-Impacted Superfund Site

    Science.gov (United States)

    In the 1950s and 60s, discharges from a DDT manufacturing plant contaminated a tributary system of the Tennessee River near Huntsville, Alabama, USA. Regulatory action resulted in declaring the area a Superfund site which required remediation and extensive monitoring. Monitoring ...

  17. Ethanol-Fed Or Solid-Phase Organic Sulfate Reducing Bioreactors For The National Tunnel Drainage, Clear Creek/Central City Superfund Site (Presentation)

    Science.gov (United States)

    The U.S. Environmental Protection Agency (EPA) is planning to treat mining influenced water (MIW) from the National Tunnel Adit that discharges to North Clear Creek near the City of Blackhawk, Colorado. North Clear Creek is part of the Clear Creek/Central City Superfund Site, an...

  18. Ethanol-Fed Or Solid-Phase Organic Sulfate Reducing Bioreactors For The National Tunnel Drainage, Clear Creek/Central City Superfund Site

    Science.gov (United States)

    The U.S. Environmental Protection Agency (EPA) is planning to treat mining influenced water (MIW) from the National Tunnel Adit that discharges to North Clear Creek near the City of Blackhawk, Colorado. North Clear Creek is part of the Clear Creek/Central City Superfund Site, an...

  19. COMPARISON OF GEOPROBE PRT AND AMS GVP SOIL-GAS SAMPLING SYSTEMS WITH DEDICATED VAPOR PROBES IN SANDY SOILS AT THE RAYMARK SUPERFUND SITE

    Science.gov (United States)

    A study was conducted near the Raymark Superfund Site in Stratford, Connecticut to compare results of soil-gas sampling using dedicated vapor probes, a truck-mounted direct-push technique - the Geoprobe Post-Run-Tubing (PRT) system, and a hand-held rotary hammer technique - the A...

  20. EPA Proposes to Add Dutchess County Creek, N.Y. to the Federal Superfund List, Sediment Contaminated with Mercury, Polycyclic Aromatic Hydrocarbons

    Science.gov (United States)

    (New York, N.Y.) The U.S. Environmental Protection Agency today proposed adding the Wappinger Creek in Dutchess County, N.Y. to its Superfund National Priorities List of the country's most hazardous waste sites. Sediment within the two mile long tidal port

  1. EPA Finalizes Plan to Address Contaminated Groundwater at Curtis Specialty Papers Superfund Site in Milford Borough and Alexandria Township, N.J.

    Science.gov (United States)

    (New York, N.Y.) The U.S. Environmental Protection Agency has finalized a plan to clean up contaminated groundwater at the Curtis Specialty Papers Superfund site in Milford Borough and Alexandria Township, New Jersey. The site includes the former Milford P

  2. ACE: accurate correction of errors using K-mer tries

    NARCIS (Netherlands)

    Sheikhizadeh Anari, S.; Ridder, de D.

    2015-01-01

    The quality of high-throughput next-generation sequencing data significantly influences the performance and memory consumption of assembly and mapping algorithms. The most ubiquitous platform, Illumina, mainly suffers from substitution errors. We have developed a tool, ACE, based on K-mer tries to c

  3. Chinese Tri-Network Convergence: Characteristics and Challenges

    Institute of Scientific and Technical Information of China (English)

    Hequan Wu

    2011-01-01

    @@ In the 2010 Report on the Work of the Government, delivered by Wen Jiabao, tri-network convergence is interpreted as "the integration oftelecommunications networks, cable television networks, and the Internet" [1].Enabling these three networks to interconnect with each other and share resources will provide users with diverse voice, data, radio,and TV services.

  4. Structuring edible oil with lecithin and sorbitan tri-stearate

    NARCIS (Netherlands)

    Pernetti, M.; Malssen, van K.; Kalnin, D.J.E.; Flöter, E.

    2007-01-01

    The gelation of edible oil by a mixture of lecithin and sorbitan tri-stearate (STS) was studied. The two components individually in oil do not give structure at concentrations between 6% and 20% w/w: viscous, pourable solutions are obtained. A synergetic effect is observed with their mixture, at

  5. Environmental Effects on the Polypyrrole Tri-layer Actuator

    Directory of Open Access Journals (Sweden)

    Nirul Masurkar

    2017-04-01

    Full Text Available Electroactive polymer actuators such as polypyrrole (PPy are exciting candidates to drive autonomous devices that require low weight and low power. A simple PPy tri-layer bending type cantilever which operates in the air has been demonstrated previously, but the environmental effect on this actuator is still unknown. The major obstacle in the development of the PPy tri-layer actuator is to create proper packaging that reduces oxidation of the electrolyte and maintains constant displacement. Here, we report the variation in the displacement as well as the charge transfer at the different environmental condition. PPy trilayer actuators were fabricated by depositing polypyrrole on gold-coated porous poly(vinylidene fluoride (PVDF using the electro-synthesis method. It has been demonstrated that the charge transfer of tri-layer actuators is more in an inert environment than in open air. In addition, tri-layer actuators show constant deflection and enhancement of life due to the negligible oxidation rate of the electrolyte in an inert environment.

  6. Di/tri-peptide transporters as drug delivery targets

    DEFF Research Database (Denmark)

    Nielsen, C U; Brodin, Birger

    2003-01-01

    . PepT1-mediated transport is up-regulated by short-term exposure to receptor agonists such as EGF, insulin, leptin, and clonidine, and down-regulated by VIP. Overall, the regulation of di/tri-peptide transport may be contributed to 1) changes in apical proton-motive force 2) recruitment of di...

  7. Composite germanium monochromators - results for the TriCS

    Energy Technology Data Exchange (ETDEWEB)

    Schefer, J.; Fischer, S.; Boehm, M.; Keller, L.; Horisberger, M.; Medarde, M.; Fischer, P. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1997-09-01

    Composite germanium monochromators are in the beginning of their application in neutron diffraction. We show here the importance of the permanent quality control with neutrons on the example of the 311 wafers which will be used on the single crystal diffractometer TriCS at SINQ. (author) 2 figs., 3 refs.

  8. Queens Tri-School Confederation, 1991-92 Evaluation Report.

    Science.gov (United States)

    Hannah, Susan; Dworkowitz, Barbara

    An evaluation was done of the Queens Tri-School Confederation, three high schools in the New York City Public Schools funded by a federal grant from the Magnet Schools Assistance Program. The grant provided Hillcrest, Jamaica, and Thomas A. Edison High Schools with funds to develop or expand emergency technician programs at Hillcrest; a law…

  9. Structuring edible oil with lecithin and sorbitan tri-stearate

    NARCIS (Netherlands)

    Pernetti, M.; Malssen, van K.; Kalnin, D.J.E.; Flöter, E.

    2007-01-01

    The gelation of edible oil by a mixture of lecithin and sorbitan tri-stearate (STS) was studied. The two components individually in oil do not give structure at concentrations between 6% and 20% w/w: viscous, pourable solutions are obtained. A synergetic effect is observed with their mixture, at spe

  10. DECS tries out instructional materials on AIDS prevention education.

    Science.gov (United States)

    1994-01-01

    A national try-out of the newly developed print and non-print instructional materials on AIDS Education is being conducted by the Department of Education, Culture and Sports (DECS) this school year 1993-to 1994. To determine the effectiveness of these materials, various public and private schools in Region IV (Southern Tagalog), VII (Central Visayas) XI (Southern Mindanao) and National Capital Region (Metro, Manila) were chosen as try-out institutions. The AIDS education materials will be tried out in different subjects in some grade and year levels such as civics and culture (grade one); science and health (grades three and six); home economics and livelihood education (grade five); physical education, health and music (second year) and Pilipino Language (third year). The materials for the elementary level consist of posters, cut-out pictures, voice tapes, jingles, talking books and slides, while the secondary school level utilizes modules. For the tertiary level, a Resource Book on AIDS Prevention Education is used by the Teacher Training Institutions and the Non-Formal Education employs the Facilitator's Guide for Levels I-III. These materials will be tried out in both urban and rural schools, with control school and experimental school at each level.

  11. Tri-bimaximal and bimaximal neutrino mixing from discrete symmetries

    CERN Document Server

    Merlo, Luca

    2009-01-01

    The neutrino oscillation data are well explained by the tri-bimaximal pattern. Recently it has been shown that also the bimaximal pattern could be a very good starting point in order to describe the lepton mixing. In this paper I review both the flavour structures and then I present an explicit example.

  12. New developments in TRI mu P and RIASH at KVI

    NARCIS (Netherlands)

    Dendooven, P.; Harissopulos, S; Demetriou, P; Julin, R

    2006-01-01

    The status of the TRI mu P facility at KVI is reviewed. Recent results on ion catcher devices are described. A thermo-ionizer for use with alkali and earth-alkali elements is close to completion. Concerning the use of superfluid helium as stopping medium, evidence that second sound pulses can be use

  13. Low Back Pain? Relax, Breathe and Try Yoga

    Science.gov (United States)

    ... Videos & Tools Español You Are Here: Home → Latest Health News → Article URL of this page: https://medlineplus.gov/news/fullstory_163537.html Low Back Pain? Relax, Breathe and Try Yoga Review of 12 studies found small improvements in ...

  14. TRiC’s tricks inhibit huntingtin aggregation

    Science.gov (United States)

    Shahmoradian, Sarah H; Galaz-Montoya, Jesus G; Schmid, Michael F; Cong, Yao; Ma, Boxue; Spiess, Christoph; Frydman, Judith; Ludtke, Steven J; Chiu, Wah

    2013-01-01

    In Huntington’s disease, a mutated version of the huntingtin protein leads to cell death. Mutant huntingtin is known to aggregate, a process that can be inhibited by the eukaryotic chaperonin TRiC (TCP1-ring complex) in vitro and in vivo. A structural understanding of the genesis of aggregates and their modulation by cellular chaperones could facilitate the development of therapies but has been hindered by the heterogeneity of amyloid aggregates. Using cryo-electron microscopy (cryoEM) and single particle cryo-electron tomography (SPT) we characterize the growth of fibrillar aggregates of mutant huntingtin exon 1 containing an expanded polyglutamine tract with 51 residues (mhttQ51), and resolve 3-D structures of the chaperonin TRiC interacting with mhttQ51. We find that TRiC caps mhttQ51 fibril tips via the apical domains of its subunits, and also encapsulates smaller mhtt oligomers within its chamber. These two complementary mechanisms provide a structural description for TRiC’s inhibition of mhttQ51 aggregation in vitro. DOI: http://dx.doi.org/10.7554/eLife.00710.001 PMID:23853712

  15. Intratubular disinfection with tri-antibiotic and calcium hydroxide pastes.

    Science.gov (United States)

    Pereira, Thais Cristina; Vasconcelos, Layla Reginna Silva Munhoz De; Graeff, Marcia Sirlene Zardin; Duarte, Marco Antonio Hungaro; Bramante, Clóvis Monteiro; Andrade, Flaviana Bombarda De

    2017-03-01

    The aim of this study was to compare the in vitro intradentinal antimicrobial ability of the calcium hydroxide and tri-antibiotic pastes. Standard bovine dentin tubes were sterilized and then infected with Enterococcus faecalis by a new contamination protocol of great depths of dentin. The specimens were filled with the medications, divided into two test-groups: calcium hydroxide (Group 1) and tri-antibiotic (Group 2) pastes. After 15 days, the teeth were evaluated by microbiological culture and confocal laser scanning microscopy (CLSM) with viability dye assay LIVE/DEAD inside dentinal tubules. In experiment of culture, the bacterial collection of the dentin fragments was done for counting the colony-forming units. The tri-antibiotic paste had a slightly greater antimicrobial effect; however, there was no statistical difference between the groups. It was concluded that the tri-antibiotic paste and the calcium hydroxide paste exercise the same effect on intra-tubular decontamination against E. faecalis. So, due the multiples advantages, the calcium hydroxide paste can be the choice for dentinal decontamination in regenerative procedures.

  16. Development and characterization of solid solution tri-carbides

    Science.gov (United States)

    Knight, Travis; Anghaie, Samim

    2001-02-01

    Solid-solution, binary uranium/refractory metal carbide fuels have been shown to be capable of performing at high temperatures for nuclear thermal propulsion applications. More recently, tri-carbide fuels such as (U, Zr, Nb)C1+x with less than 10% metal mole fraction uranium have been studied for their application in ultra-high temperature, high performance space nuclear power systems. These tri-carbide fuels require high processing temperatures greater than 2600 K owing to their high melting points in excess of 3600 K. This paper presents the results of recent studies involving hypostoichiometric, single-phase tri-carbide fuels. Processing techniques of cold uniaxial pressing and sintering were investigated to optimize the processing parameters necessary to produce high density (low porosity), single phase, solid solution mixed carbide nuclear fuels for testing. Scanning electron microscopy and xray diffraction were used to analyze samples. Liquid phase sintering with UC1+x at temperatures near 2700 K was shown to be instrumental in achieving good densification in hyper- and near-stoichiometric mixed carbides. Hypostoichiometric carbides require even higher processing temperatures greater than 2800 K in order to achieve liquid phase sintering with a UC liquid phase and good densification of the final solid solution, tri-carbide fuel. .

  17. Study on Extraction Performance of Tri-iso-amyl Phosphate

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    The distribution performance of HNO3, Pu(Ⅲ ), Pu(Ⅳ) and Np(Ⅳ) in the two phase system of Tri-iso-Amyl Phosphate(TiAP) and aqueous, the influence of the concentration of extractant, nitric acid and Al(NO3)3 on the distribution ratio of Pu(Ⅲ ),

  18. Trying to resolve the two-envelope problem

    NARCIS (Netherlands)

    Albers, CJ; Kooi, BP; Schaafsma, W

    After explaining the well-known two-envelope 'paradox' by indicating the fallacy involved, we consider the two-envelope 'problem' of evaluating the 'factual' information provided to us in the form of the value contained by the envelope chosen first. We try to provide a synthesis of contributions

  19. Doctors Try Brain-Training to Curb 'Phantom Limb Pain'

    Science.gov (United States)

    ... with the study. "The problem with having a prosthetic limb is that when you try to control that hand, it does not translate. You use other parts ... needed for a patient to move their "phantom" hand, and linked those signals to a robot prosthetic limb. Patients experienced an increase in phantom pain ...

  20. Analysis of geophysical logs, at North Penn Area 6 Superfund Site, Lansdale, Montgomery County, Pennsylvania

    Science.gov (United States)

    Conger, Randall W.

    1999-01-01

    The U.S. Geological Survey (USGS), as part of technical assistance to the U.S. Environmental Protection Agency (USEPA), collected borehole geophysical log data in 34 industrial, commercial, and public supply wells and 28 monitor wells at the North Penn Area 6 Superfund Site, in Lansdale, Pa., from August 22, 1995, through August 29, 1997. The wells range in depth from 50 to 1,027 feet below land surface and are drilled in Triassic-age shales and siltstones of the Brunswick Group and Lockatong Formation. The geophysical log data were collected to help describe the hydrogeologic framework in the area and to provide guidance in the reconstruction of the 28 monitor wells drilled during summer 1997. At the time of logging, all wells had open-hole construction. The geophysical logs, caliper, fluid-resistivity, and fluid-temperature, and borehole video logs were used to determine the vertical distribution of water-bearing fractures. Heatpulse-flowmeter measurements were used to determine vertical borehole flow under pumping and nonpumping conditions. The most productive fractures generally could be determined from heatpulse-flowmeter measurements under pumping conditions. Vertical borehole flow was measured under nonpumping conditions in most wells that had more than one water-bearing fracture. Upward flow was measured in 35 wells and probably is a result of natural head differences between fractures in the local ground-water-flow system. Downward flow was measured in 11 wells and commonly indicated differences in hydraulic heads of the fractures caused by nearby pumping. Both upward and downward flow was measured in three wells. No flow was detected in eight wells. Natural-gamma-ray logs were used to estimate the attitude of bedding. Thin shale marker beds, shown as spikes of elevated radioactivity in the natural-gamma logs of some wells throughout the area, enable the determination of bedding-plane orientation from three-point correlations. Generally, the marker beds in

  1. Identification of New Genes Positively Regulated by Tri10 and a Regulatory Network for Trichothecene Mycotoxin Production

    OpenAIRE

    Peplow, Andrew W.; Tag, Andrew G.; Garifullina, Gulnara F.; Beremand, Marian N.

    2003-01-01

    Tri10, a regulatory gene in trichothecene mycotoxin-producing Fusarium species, is required for trichothecene biosynthesis and the coordinated expression of four trichothecene pathway-specific genes (Tri4, Tri5, Tri6, and Tri101) and the isoprenoid biosynthetic gene for farnesyl pyrophosphate synthetase (FPPS). We showed that six more trichothecene genes (Tri3, Tri7, Tri8, Tri9, Tri11, and Tri12) are regulated by Tri10. We also constructed a cDNA library from a strain of Fusarium sporotrichio...

  2. Cholesterol complexes with tri-n-butylphosphate, tri-n-octylamine and cyclohexanone in chlorinated hydrocarbon solvents.

    Science.gov (United States)

    Senegacnik, Marjan; Klofutar, Cveto

    2007-04-01

    The hydrogen bonding interactions of moderately associated cholesterol with tri-n-butylphosphate, tri-n-octylamine and cyclohexanone in dilute solutions of tetrachloromethane, 1,2-dichloroethane and trichloromethane were studied by conventional IR spectroscopy. Information on the stoichiometry of the complexes formed was derived from least squares plots of the linearized expressions of Bjerrum's degree of system formation. The formation constants of the complexes were also determined in this way. The spectra recorded in the OH region from 3100 to 3700 cm-1 were resolved in to the bands of the cholesterol species and the complexes formed. The complexes responsible for the observed bands were recognized from the dependence of their intensity on cholesterol monomer and free base concentration and from their frequency locations. The presence of the complexes B...HO(R) and B...HO(R)...HO(R) with tri-n-butylphosphate and tri-n-octylamine was established in all of the solutions and also for the system cholesterol+cyclohexanone in 1,2-dichloroethane. On the other hand, for cholesterol bonding to cyclohexanone in tetrachloromethane, the model considering complexes with 3:1 and 1:1 stoichiometry seemed the most appropriate.

  3. Identification of animal movement patterns using tri-axial magnetometry.

    Science.gov (United States)

    Williams, Hannah J; Holton, Mark D; Shepard, Emily L C; Largey, Nicola; Norman, Brad; Ryan, Peter G; Duriez, Olivier; Scantlebury, Michael; Quintana, Flavio; Magowan, Elizabeth A; Marks, Nikki J; Alagaili, Abdulaziz N; Bennett, Nigel C; Wilson, Rory P

    2017-01-01

    Accelerometers are powerful sensors in many bio-logging devices, and are increasingly allowing researchers to investigate the performance, behaviour, energy expenditure and even state, of free-living animals. Another sensor commonly used in animal-attached loggers is the magnetometer, which has been primarily used in dead-reckoning or inertial measurement tags, but little outside that. We examine the potential of magnetometers for helping elucidate the behaviour of animals in a manner analogous to, but very different from, accelerometers. The particular responses of magnetometers to movement means that there are instances when they can resolve behaviours that are not easily perceived using accelerometers. We calibrated the tri-axial magnetometer to rotations in each axis of movement and constructed 3-dimensional plots to inspect these stylised movements. Using the tri-axial data of Daily Diary tags, attached to individuals of number of animal species as they perform different behaviours, we used these 3-d plots to develop a framework with which tri-axial magnetometry data can be examined and introduce metrics that should help quantify movement and behaviour.. Tri-axial magnetometry data reveal patterns in movement at various scales of rotation that are not always evident in acceleration data. Some of these patterns may be obscure until visualised in 3D space as tri-axial spherical plots (m-spheres). A tag-fitted animal that rotates in heading while adopting a constant body attitude produces a ring of data around the pole of the m-sphere that we define as its Normal Operational Plane (NOP). Data that do not lie on this ring are created by postural rotations of the animal as it pitches and/or rolls. Consequently, stereotyped behaviours appear as specific trajectories on the sphere (m-prints), reflecting conserved sequences of postural changes (and/or angular velocities), which result from the precise relationship between body attitude and heading. This novel

  4. 78 FR 43971 - Amendment of Class E Airspace; Tri-Cities, TN

    Science.gov (United States)

    2013-07-23

    ... Federal Aviation Administration 14 CFR Part 71 Amendment of Class E Airspace; Tri-Cities, TN AGENCY... airspace for the Tri-Cities, TN area, by correcting the regulatory text of the Class E surface airspace at Tri-Cities Regional Airport, Tri-Cities, TN. Exclusionary language was omitted in the final rule...

  5. 78 FR 7993 - Amendment of Class D and E Airspace; Tri-Cities, TN; Revocation of Class E Airspace; Tri-City, TN

    Science.gov (United States)

    2013-02-05

    ... Administration 14 CFR Part 71 Amendment of Class D and E Airspace; Tri-Cities, TN; Revocation of Class E Airspace; Tri-City, TN AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule. SUMMARY: This action amends Class D and Class E airspace and removes Class E airspace in the Tri-Cities, TN, area, to...

  6. 77 FR 59573 - Proposed Amendment of Class D and E Airspace; Tri-Cities, TN; Revocation of Class E Airspace; Tri...

    Science.gov (United States)

    2012-09-28

    ... Federal Aviation Administration 14 CFR Part 71 Proposed Amendment of Class D and E Airspace; Tri-Cities, TN; Revocation of Class E Airspace; Tri-City, TN AGENCY: Federal Aviation Administration (FAA), DOT... Tri-Cities Regional Airport, and establish Class E airspace extending upward from 700 feet above the...

  7. Finite Time Analysis of a Tri-Generation Cycle

    Directory of Open Access Journals (Sweden)

    Brian Agnew

    2015-06-01

    Full Text Available A review of the literature indicates that current tri-generation cycles show low thermal performance, even when optimised for maximum useful output. This paper presents a Finite Time analysis of a tri-generation cycle that is based upon coupled power and refrigeration Carnot cycles. The analysis applies equally well to Stirling cycles or any cycle that exhibits isothermal heat transfer with the environment and is internally reversible. It is shown that it is possible to obtain a significantly higher energy utilisation factor with this type of cycle by considering the energy transferred during the isothermal compression and expansion processes as useful products thus making the energy utilisation larger than the enthalpy drop of the working fluid of the power cycle. The cycle is shown to have the highest energy utilisation factor when energy is supplied from a low temperature heat source and in this case the output is biased towards heating and cooling.

  8. Tri-band microstrip antenna design for wireless communication applications

    Science.gov (United States)

    Sami, Gehan; Mohanna, Mahmoud; Rabeh, Mohamed L.

    2013-06-01

    This paper introduces a novel rectangular tri-band patch antenna that is fabricated and measured for wireless communication systems. The introduced antenna is designed for WLAN and WiMAX applications. The desired tri-band operation was obtained by proper loading for a rectangular patch antenna using slots and shorting pins. The optimal location and dimension for the loaded elements were obtained with the aid of interfacing a Genetic Algorithm (GA) model with an Ansoft High Frequency Structural Simulator (HFSS). The results obtained from our simulated antenna show 5.8% impedance matching band width at 2.4 GHz, 3.7% at 3.5 GHz and 1.57% at 5.7 GHz. In addition, an equivalent circuit of the proposed antenna is introduced using the least square curve fitting optimization technique.

  9. Virtual try-on through image-based rendering.

    Science.gov (United States)

    Hauswiesner, Stefan; Straka, Matthias; Reitmayr, Gerhard

    2013-09-01

    Virtual try-on applications have become popular because they allow users to watch themselves wearing different clothes without the effort of changing them physically. This helps users to make quick buying decisions and, thus, improves the sales efficiency of retailers. Previous solutions usually involve motion capture, 3D reconstruction or modeling, which are time consuming and not robust for all body poses. Our method avoids these steps by combining image-based renderings of the user and previously recorded garments. It transfers the appearance of a garment recorded from one user to another by matching input and recorded frames, image-based visual hull rendering, and online registration methods. Using images of real garments allows for a realistic rendering quality with high performance. It is suitable for a wide range of clothes and complex appearances, allows arbitrary viewing angles, and requires only little manual input. Our system is particularly useful for virtual try-on applications as well as interactive games.

  10. Crystal structures of fac-tri-chlorido-tris-(tri-methyl-phosphane-κP)rhodium(III) monohydrate and fac-tri-chlorido-tris-(tri-methyl-phosphane-κP)rhodium(III) methanol hemisolvate: rhodium structures that are isotypic with their iridium analogs.

    Science.gov (United States)

    Merola, Joseph S; Franks, Marion A

    2015-02-01

    The crystal structures of two solvates of fac-tri-chlorido-tris-(tri-methyl-phosphane-κP)rhodium(III) are reported, i.e. one with water in the crystal lattice, fac-[RhCl3(Me3P)3]·H2O, and one with methanol in the crystal lattice, fac-[RhCl3(Me3P)3]·0.5CH3OH. These rhodium compounds exhibit distorted octahedral coordination spheres at the metal and are isotypic with the analogous iridium compounds previously reported by us [Merola et al. (2013 ▶). Polyhedron, 54, 67-73]. Comparison is made between the rhodium and iridium compounds, highlighting their isostructural relationships.

  11. Tri-prong scheme for regularized long wave equation

    Directory of Open Access Journals (Sweden)

    M.M. Hosseini

    2016-06-01

    Full Text Available This paper witnesses the application of a tri-prong scheme comprising the well-known Variational Iteration (VIM, Adomian’s polynomials and an auxiliary parameter to obtain solutions of regularized long wave (RLW equation in large domain. Computational work elucidates the solution procedure appropriately and comparison with results by the standard variational iteration method shows that the auxiliary parameter proves very effective to control the convergence region of approximate solutions.

  12. Pembangunan Berkelanjutan Berdasarkan Konsep Tri Hita Karana untuk Kegiatan Ekowisata

    Directory of Open Access Journals (Sweden)

    I Wayan Runa

    2012-05-01

    Full Text Available Abstract Balinese society has from a long time ago managedand developed their land based on environmentallyfriendly principles. These principles have been inspired byimplementations of the Balinese Tri Hita Karana conception. Thisarticle attempts to explain various spatial developments relatingto ecotourism activities that are founded by Tri Hita Karanavalues and practices. It constructs its arguments by conductingan intensive literature study to review relevant hypotheses andconcepts proposed by scholars in the field. The article concludesthat ecotourism is a form of environmentally friendly touristdevelopments and is seen to be the most sustainable modelfor future’s tourism. The article completes its conclusion byunderlining that for its success, ecotourism related developmentpractices should be first understood. It then should come witha certain framework and standard for its implementations. Bestpractices pertaining to the ecotourism development should becertified and accessible by public and others parties involved. Inaddition to these remarks, the article conclusively proposes TriHita Kharana conception as a framework that offers guidancefor sustainably developed ecotourism. This local concept alsoprovides direction as to how its development and its impact onspatial development can be approached and managed, especiallyto the case of Bali.

  13. Tri-Bimaximal Mixing from Twisted Friedberg-Lee Symmetry

    CERN Document Server

    Araki, Takeshi

    2008-01-01

    We consider the tri-bimaximal generation mixing in terms of the Friedberg-Lee (FL) symmetry. The symmetry is a kind of translational one for the fermion field operators. The symmetry with uniform translation for each generation of neutrinos can partially realize the desired form of the neutrino mass matrix for the tri-bimaximal mixing but should be improved to obtain the experimentally favored neutrino mass spectrum. It is firstly pointed out that patterns of the uniformity breaking are important for resulting form of the neutrino mass matrix. Then we propose a promotion of the FL symmetry to have the $\\mu - \\tau$ one, and call that the twisted FL symmetry. Based on the twisted FL symmetry, two possible schemes are also presented toward the realistic neutrino mass spectrum and the tri-bimaximal mixing. The first possible scheme is that the uniformity of the FL symmetry is broken by terms preserving the twisted FL one. The second one is based on the $S_3$ permutation family symmetry. The breaking terms, which ...

  14. Bayer bilateral denoising on TriMedia3270

    Science.gov (United States)

    Phelippeau, H.; Akil, M.; Dias Rodrigues, B.; Talbot, H.; Bara, S.

    2009-02-01

    Digital cameras are now commonly included in several digital devices such as mobile phones. They are present everywhere and have become the principal image capturing tool. Inherent to light and semiconductors properties, sensor noise [10] continues to be an important factor of image quality [12], especially in low light conditions. Removing the noise with mathematical solutions appears thus unavoidable to obtain an acceptable image quality. However, embedded devices are limited by processing capabilities and power consumption and thus cannot make use of the full range of complex mathematical noise removing solutions. The bilateral filter [6] appears to be an interesting compromise between implementation complexity and noise removing performances. Especially, the Bayer [5] bilateral filter proposed in [11] is well adapted for single sensor devices. In this paper, we simulate and optimize the Bayer bilateral filter execution on a common media-processor: the TM3270 [4] from the NXP Semiconductors TriMedia family. To do so we use the TriMedia Compilation System (TCS). We applied common optimization techniques (such as LUT, loop unrolling, convenient data type representation) as well as custom TriMedia operations. We finally propose a new Bayer bilateral filter formulation dedicated to the TM3270 architecture that yields an execution improvement of 99.6% compared to the naÃve version. This improvement results in real-time video processing at VGA resolution at the 350MHz clock rate.

  15. Decontamination of tried-in orthodontic molar bands.

    Science.gov (United States)

    Fulford, M R; Ireland, A J; Main, B G

    2003-12-01

    Molar bands are commonly used to retain orthodontic attachments on posterior teeth and due to the variation in the size of such teeth, it is usually necessary to 'try in' several bands before the correct one is selected. A possible concern with re-using such bands is the lack of cross-infection control, even following autoclaving, due to the presence of one or more small bore lumen (the archwire and headgear tubes). The aim of this experiment was, therefore, to determine whether such bands could be successfully decontaminated so that they could be re-used without a cross-infection risk. Two hundred orthodontic molar bands that had previously been tried in patients' mouths, but not cemented into place, were tested. Each band was decontaminated using an enzymatic cleaner/disinfectant and then sterilized using either a downward displacement (n = 100) or a vacuum cycle autoclave (n = 100). Following autoclaving each band was inoculated into brain heart infusion culture broth and incubated at 37 degrees C for 5 days. None of the decontaminated bands exhibited growth after 5 days. It would appear that, using this methodology, there is little risk of a cross-infection hazard occurring with the re-use of previously tried-in and decontaminated molar bands.

  16. Cellular interactions regulate stem cell differentiation in tri-culture.

    Science.gov (United States)

    Wang, I-Ning E; Bogdanowicz, Danielle R; Mitroo, Siddarth; Shan, Jing; Kala, Sonam; Lu, Helen H

    2016-11-01

    Currently, the mechanism governing the regeneration of the soft tissue-to-bone interface, such as the transition between the anterior cruciate ligament (ACL) and bone, is not known. Focusing on the ACL-to-bone insertion, this study tests the novel hypothesis that interactions between cells from the ligament (fibroblasts) and bone (osteoblasts) initiate interface regeneration. Specifically, these heterotypic cell interactions direct the fibrochondrogenic differentiation of interface-relevant cell populations, defined here as ligament fibroblasts and bone marrow stromal cells (BMSC). The objective of this study is to examine the effects of heterotypic cellular interactions on BMSC or fibroblast growth and biosynthesis, as well as expression of fibrocartilage-relevant markers in tri-culture. The effects of cell-cell physical contact and paracrine interactions between fibroblasts and osteoblasts were also determined. It was found that, in tri-culture with fibroblasts and osteoblasts, BMSC exhibited greater fibrochondrogenic potential than ligament fibroblasts. The growth of BMSC decreased while proteoglycan production and TGF-β3 expression increased. Moreover, tri-culture regulated BMSC response via paracrine factors, and interestingly, fibroblast-osteoblast contact further promoted proteoglycan and TGF-β1 synthesis as well as induced SOX9 expression in BMSC. Collectively, the findings of this study suggest that fibroblast-osteoblast interactions play an important role in regulating the stem cell niche for fibrocartilage regeneration, and the mechanisms of these interactions are directed by paracrine factors and augmented with direct cell-cell contact.

  17. Breaking Tri-Bimaximal Mixing and Large θ13

    Science.gov (United States)

    Shimizu, Y.; Tanimoto, M.; Watanabe, A.

    2011-07-01

    The long baseline neutrino experiment, T2K, and the reactor experiment, Double Chooz will soon present new data. If we expect sinθ_{13} to be 0.1 - 0.2, which is close to the present experimental upper bound, we should not persist in the paradigm of the tri-bimaximal mixing. We discuss breaking the tri-bimaximal mixing by adding a simple mass matrix, which could be derived from some non-Abelian discrete symmetries. It is found that sinθ_{13} = 0.1 - 0.2 is expected in our model independent analysis of the generalized mass matrix for the normal or inverted hierarchical neutrino mass spectrum. On the other hand, sin^2θ_{23} and sin^2θ_{12} are expected to be not far from 1/2 and 1/3, respectively. As a typical example, we also discuss the A_4 flavor model with the 1 and 1' flavons, which break the tri-bimaximal mixing considerably. In this modified version of the Altarelli and Feruglio model, sinθ_{13} is predicted to be around 0.15 in the case of the normal hierarchical neutrino masses m_3 ≫ m_2, m_1, and 0.2 in the case of the inverted hierarchy m_3 ≪ m_2, m_1. The form of the neutrino mass matrix looks rather interesting -- it is suggestive of other discrete symmetries as well.

  18. Breaking Tri-bimaximal Mixing and Large $\\theta_{13}$

    CERN Document Server

    Shimizu, Yusuke; Watanabe, Atsushi

    2011-01-01

    The long baseline neutrino experiment, T2K, and the reactor experiment, Double Chooz will soon present new data. If we expect $\\sin\\theta_{13}$ to be 0.1-0.2, which is close to the present experimental upper bound, we should not persist in the paradigm of the tri-bimaximal mixing. We discuss the breaking the tri-bimaximal mixing by adding a simple mass matrix, which could be derived from some non-Abelian discrete symmetries. It is found that $\\sin\\theta_{13}=0.1-0.2$ is expected in our model independent analysis of the generalized mass matrix. On the other hand, $\\sin^2\\theta_{23}$ and $\\sin^2\\theta_{12}$ are expected to be not far from 1/2 and 1/3, respectively. As a typical example, we also discuss the $A_4$ flavor model with the 1 and 1' flavons, which break the tri-bimaximal mixing considerably. In this modified version of the Altarelli and Feruglio model, $\\sin\\theta_{13}$ is predicted to be around 0.15 in the case of the normal hierarchical neutrino masses $m_3\\gg m_2, m_1$, and 0.2 in the case of the i...

  19. Apolar Distal Pocket Mutants of Yeast Cytochrome c Peroxidase: Hydrogen Peroxide Reactivity and Cyanide Binding of the TriAla, TriVal, and TriLeu Variants

    Science.gov (United States)

    Bidwai, Anil K.; Meyen, Cassandra; Kilheeney, Heather; Wroblewski, Damian; Vitello, Lidia B.; Erman, James E.

    2012-01-01

    Three yeast cytochrome c peroxidase (CcP) variants with apolar distal heme pockets have been constructed. The CcP variants have Arg48, Trp51, and His52 mutated to either all alanines, CcP(triAla), all valines, CcP(triVal), or all leucines, CcP(triLeu). The triple mutants have detectable enzymatic activity at pH 6 but the activity is less than 0.02% that of wild-type CcP. The activity loss is primarily due to the decreased rate of reaction between the triple mutants and H2O2 compared to wild-type CcP. Spectroscopic properties and cyanide binding characteristics of the triple mutants have been investigated over the pH stability region of CcP, pH 4 to 8. The absorption spectra indicate that the CcP triple mutants have hemes that are predominantly five-coordinate, high-spin at pH 5 and six-coordinate, low-spin at pH 8. Cyanide binding to the triple mutants is biphasic indicating that the triple mutants have two slowly-exchanging conformational states with different cyanide affinities. The binding affinity for cyanide is reduced at least two orders of magnitude in the triple mutants compared to wild-type CcP and the rate of cyanide binding is reduced by four to five orders of magnitude. Correlation of the reaction rates of CcP and 12 distal pocket mutants with H2O2 and HCN suggests that both reactions require ionization of the reactants within the distal heme pocket allowing the anion to bind the heme iron. Distal pocket features that promote substrate ionization (basic residues involved in base-catalyzed substrate ionization or polar residues that can stabilize substrate anions) increase the overall rate of reaction with H2O2 and HCN while features that inhibit substrate ionization slow the reactions. PMID:23022490

  20. Geophysical logging and geologic mapping data in the vicinity of the GMH Electronics Superfund site near Roxboro, North Carolina

    Science.gov (United States)

    Chapman, Melinda J.; Clark, Timothy W.; Williams, John H.

    2013-01-01

    Geologic mapping, the collection of borehole geophysical logs and images, and passive diffusion bag sampling were conducted by the U.S. Geological Survey North Carolina Water Science Center in the vicinity of the GMH Electronics Superfund site near Roxboro, North Carolina, during March through October 2011. The study purpose was to assist the U.S. Environmental Protection Agency in the development of a conceptual groundwater model for the assessment of current contaminant distribution and future migration of contaminants. Data compilation efforts included geologic mapping of more than 250 features, including rock type and secondary joints, delineation of more than 1,300 subsurface features (primarily fracture orientations) in 15 open borehole wells, and the collection of passive diffusion-bag samples from 42 fracture zones at various depths in the 15 wells.

  1. Feasibility Study of Economics and Performance of Solar Photovoltaics at the Stringfellow Superfund Site in Riverside, California

    Energy Technology Data Exchange (ETDEWEB)

    Mosey, G.; Van Geet, O.

    2010-12-01

    This report presents the results of an assessment of the technical and economic feasibility of deploying a photovoltaics (PV) system on the Stringfellow Superfund Site in Riverside, California. The site was assessed for possible PV installations. The cost, performance, and site impacts of different PV options were estimated. The economics of the potential systems were analyzed using an electric rate of $0.13/kWh and incentives offered by Southern California Edison under the California Solar Initiative. According to the assessment, a government-owned, ground-mounted PV system represents a technically and economically feasible option. The report recommends financing options that could assist in the implementation of such a system.

  2. In situ field screening for polynuclear aromatic hydrocarbons with a portable spectrofluorometer at a Superfund site near Jackson, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    Amick, E.N.; Pollard, J.E. [Lockheed Environmental Systems and Technologies Co., Las Vegas, NV (United States); Engelmann, W.H. [Environmental Protection Agency, Las Vegas, NV (United States). Environmental Monitoring Systems Lab.; Vo-Dinh, T. [Oak Ridge National Lab., TN (United States). Advanced Monitoring Development Group

    1994-12-31

    The US Environmental Protection Agency`s (EPA) Environmental Monitoring Systems Laboratory in Las Vegas, Nevada (EMSL-LV) is currently evaluating the use of scanning ultraviolet-visible (UV-vis) fluorescence as a field screening technology. A prototype field-portable spectrofluorometer capable of excitation, emission, and synchronous scans has been developed and was field tested at the American Creosote Works Superfund site. The UV-vis fluorescence spectra of various polynuclear aromatic hydrocarbons (PAHs) were clearly seen in the synchronous spectra of soil samples extracted on site. Split soil samples were analyzed by gas chromatography/mass spectroscopy and by immunoassay methods. Although a comparison of results with these other methods has not been completed, the synchronous fluorescence method shows promise in that analytical results have the potential to provide compound- or class-selective results and can be immediately available on-site at a reasonable cost.

  3. Geophysical logging and thermal imaging at the Hemphill Road TCE NPL Superfund site near Gastonia, North Carolina

    Science.gov (United States)

    Antolino, Dominick J.; Chapman, Melinda J.

    2017-01-01

    The collection of borehole geophysical logs and thermal imaging data was conducted by the U.S. Geological Survey South Atlantic Water Science Center in the vicinity of the Hemphill Road TCE National Priorities List Superfund site near Gastonia, North Carolina, during August 2014 through February 2015. In an effort to assist the U.S. Environmental Protection Agency in the development of a conceptual groundwater model for the assessment of current contaminant distribution and future migration of contaminants, surface geological mapping and borehole geophysical log and image data collection, which included the delineation of more than 600 subsurface features (primarily fracture orientations) was conducted in 5 open borehole wells and 2 private supply bedrock wells. In addition, areas of potential groundwater discharge within a down-gradient, nearby creek were determined using thermal imagery to calculate temperature differences between the stream and bank seepage.

  4. Geophysical logging and thermal imaging near the Hemphill Road TCE National Priorities List Superfund site near Gastonia, North Carolina

    Science.gov (United States)

    Antolino, Dominick J.; Chapman, Melinda J.

    2017-03-27

    Borehole geophysical logs and thermal imaging data were collected by the U.S. Geological Survey near the Hemphill Road TCE (trichloroethylene) National Priorities List Superfund site near Gastonia, North Carolina, during August 2014 through February 2015. In an effort to assist the U.S. Environmental Protection Agency in the development of a conceptual groundwater model for the assessment of current contaminant distribution and future migration of contaminants, surface geological mapping and borehole geophysical log and thermal imaging data collection, which included the delineation of more than 600 subsurface features (primarily fracture orientations), was completed in five open borehole wells and two private supply bedrock wells. In addition, areas of possible groundwater discharge within a nearby creek downgradient of the study site were determined based on temperature differences between the stream and bank seepage using thermal imagery.

  5. Investigation of total and hexavalent chromium in filtered and unfiltered groundwater samples at the Tucson International Airport Superfund Site

    Science.gov (United States)

    Tillman, Fred; McCleskey, R. Blaine; Hermosillo, Edyth

    2016-01-01

    Potential health effects from hexavalent chromium in groundwater have recently become a concern to regulators at the Tucson International Airport Area Superfund site. In 2016, the U.S. Geological Survey sampled 46 wells in the area to characterize the nature and extent of chromium in groundwater, to understand what proportion of total chromium is in the hexavalent state, and to determine if substantial differences are present between filtered and unfiltered chromium concentrations. Results indicate detectable chromium concentrations in all wells, over 75 % of total chromium is in the hexavalent state in a majority of wells, and filtered and unfiltered results differ substantially in only a few high-turbidity total chromium samples.

  6. Post-Remediation Biomonitoring of Pesticides in Marine Waters Near the United Heckathorn Superfund Site, Richmond, California

    Energy Technology Data Exchange (ETDEWEB)

    LD Antrim; NP Kohn

    2000-09-05

    This report, PNNL-11911 Rev. 1, was published in July 2000 and replaces PNNL-11911, which was published in September 1998. The revision corrects tissue concentration units that were reported as dry weight but were actually wet weight, and updates conclusions based on the correct reporting units. Marine sediment remediation at the United Heckathorn Superfund Site was completed in April 1997. Water and mussel tissues were sampled in January 1998 from four stations near Lauritzen Canal in Richmond, California, for the first post-remediation monitoring of marine areas near the United Heckathorn Site. Dieldrin and DDT were analyzed in water samples, tissue samples from resident mussels, and tissue samples from transplanted mussels deployed for 4 months. Concentrations of dieldrin and total DDT in water and total DDT in tissue were compared to pre-remediation data available from the California State Mussel Watch program (tissues) and the Ecological Risk Assessment for the United Heckathorn Superfund Site (tissues and water). Chlorinated pesticide concentrations in water samples were similar to pre-remediation levels and did not meet remediation goals. Mean dieldrin concentrations in water ranged from 0.65 ng/L to 18.1 ng/L and were higher than the remediation goal (0.14 ng/L) at all stations. Mean total DDT concentrations in water ranged from 0.65 ng/L to 103 ng/L and exceeded the remediation goal of 0.59 ng/L. The highest concentrations of both pesticides were found in Lauritzen Canal, and the lowest levels were from the Richmond Inner Harbor Channel water. Unusual amounts of detritus in the water column at the time of sampling, particularly in Lauritzen Canal, could have contributed to the elevated pesticide concentrations and poor analytical precision.

  7. Tri-Permuting Mixing Matrix and predictions for theta_13

    CERN Document Server

    Bazzocchi, F

    2011-01-01

    We introduce a new texture for neutrino mixing named Tri-Permuting (TP) mixing matrix. This pattern is characterized by maximal solar and atmospheric angles and by a large reactor angle satisfying sin(theta_13)=1/3. The correct lepton mixing matrix is obtained when combining the charged lepton mixing matrix with the neutrino one. In this way we get new predictions for theta_13 with respect to those obtained by the well studied TBM or BM mixing patterns. We present a specific model that gives rise to TP mixing in the neutrino sector as well as the required corrections from the charged lepton one.

  8. Jaspers' try of the rehabilitation of the idea of university

    Directory of Open Access Journals (Sweden)

    Lolić Marinko

    2009-01-01

    Full Text Available Author is into discussion of Jaspers' perception of the crisis idea of university and his try to mane a rehabilitation of his idea in his texts from 1923 and 1945. Author shows that Jaspers in his discussing idea of university count on while derive from implicit sociology German idealism. For Jaspers the institutions are forms of objective spirit which can function only in live form of the achievement of idea which is interesting. As soon as spirit disappear, institution starts to fossilize in something which is soul, which decay in dead substance.

  9. Implementasi Corporate Social Responsibility Berlandaskan Budaya Tri Hita Karana

    Directory of Open Access Journals (Sweden)

    I Dewa Ayu Eka Pertiwi

    2013-12-01

    Full Text Available This study aims to identify and to understand the implementation of CSR based on Tri Hita Karana at the Discovery Kartika Plaza Hotel. The ethnographic methods were used to obtain deeper and complete information. The research results found Integrated of CSR. It has a sense that the company as a business group in carrying out its activities always has a harmonious relationship with community, nature, and God. It produces four forms of implementation which are synergic and related to each other, namely of the implementation in the corporate, in the community, in the environment, and the matters relating to God.

  10. Tri-Light CTS膜版曝光系统

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Tri-Light CTS是一种NuArc两用型普通三光ST曝光系统,对于传统网版同样产生不寻常的效果,但也适合计算机制作网印版系统CTS的网版曝光,因此,它是这两种网版的用户以及计划将来使用传统网版的用户的选择。

  11. Tri-bimaximal mixing from twisted Friedberg-Lee symmetry

    Energy Technology Data Exchange (ETDEWEB)

    Araki, Takeshi [National Tsing Hua University, Department of Physics, Hsinchu (China); Takahashi, Ryo [Osaka University, Department of Physics, Graduate School of Science, Osaka (Japan)

    2009-10-15

    We investigate the Friedberg-Lee (FL) symmetry and its promotion to include the {mu}-{tau} symmetry, and call this the twisted FL symmetry. Based on the twisted FL symmetry, two possible schemes are presented toward the realistic neutrino mass spectrum and the tri-bimaximal mixing. In the first scheme, we suggest the semi-uniform translation of the FL symmetry. The second one is based on the S{sub 3} permutation family symmetry. The breaking terms, which are twisted FL symmetric, are introduced. Some viable models in each scheme are also presented. (orig.)

  12. Tri-bimaximal mixing from twisted Friedberg-Lee symmetry

    Science.gov (United States)

    Araki, Takeshi; Takahashi, Ryo

    2009-10-01

    We investigate the Friedberg-Lee (FL) symmetry and its promotion to include the μ- τ symmetry, and call this the twisted FL symmetry. Based on the twisted FL symmetry, two possible schemes are presented toward the realistic neutrino mass spectrum and the tri-bimaximal mixing. In the first scheme, we suggest the semi-uniform translation of the FL symmetry. The second one is based on the S 3 permutation family symmetry. The breaking terms, which are twisted FL symmetric, are introduced. Some viable models in each scheme are also presented.

  13. A Perturbed Tri-Polytropic Model of the Sun

    CERN Document Server

    Pinzon, G A

    2001-01-01

    Based on the Solar Standard Model SSM of Bahcall and Pinsonneault (SSM-BP2000) we developed a solar model in hydrostatic equilibrium using three polytropes, each one associated to the nuclear, the radiative and the convective regions of the solar interior. Then, we apply small periodic and adiabatic perturbations on this tri-polytropic model in order to obtain proper frequencies and proper functions which are in the p-modes range of low order 0

  14. Parametric design of tri-axial nested Helmholtz coils.

    Science.gov (United States)

    Abbott, Jake J

    2015-05-01

    This paper provides an optimal parametric design for tri-axial nested Helmholtz coils, which are used to generate a uniform magnetic field with controllable magnitude and direction. Circular and square coils, both with square cross section, are considered. Practical considerations such as wire selection, wire-wrapping efficiency, wire bending radius, choice of power supply, and inductance and time response are included. Using the equations provided, a designer can quickly create an optimal set of custom coils to generate a specified field magnitude in the uniform-field region while maintaining specified accessibility to the central workspace. An example case study is included.

  15. Tri-functional cannula for retinal endovascular surgery

    Science.gov (United States)

    Weiss, Jonathan D.

    2010-07-27

    A tri-functional cannula combines the functions of tissue Plasminogen Activator (tPA) solution delivery, illumination and venous pressure measurement. The cannula utilizes a tapered hollow-core optical fiber having an inlet for tPA solution, an attached fiber optic splitter configured to receive illumination light from an optical source such and a LED. A window in the cannula transmits the light to and from a central retinal vein. The return light is coupled to an optical detector to measure the pressure within the vein and determine whether an occlusion has been removed.

  16. An innovative tri-directional broadband piezoelectric energy harvester

    Energy Technology Data Exchange (ETDEWEB)

    Su, Wei-Jiun, E-mail: weijiun@mie.utoronto.ca; Zu, Jean [Department of Mechanical and Industrial Engineering, University of Toronto, Toronto, Ontario M5S 3G8 (Canada)

    2013-11-11

    This paper presents a tri-directional piezoelectric energy harvester that is able to harvest vibration energy over a wide bandwidth from three orthogonal directions. The harvester consists of a main beam, an auxiliary beam, and a spring-mass system, with magnets integrated to introduce nonlinear force and couple the three sub-systems. Theoretical analysis and experiments were performed at constant acceleration under frequency sweeps to acquire frequency responses. The experimental results show that the voltage can achieve more than 2 V over more than 5 Hz of bandwidth with 1 MΩ load in the three orthogonal directions.

  17. Estabilidad del color del Agregado Trióxido Mineral

    OpenAIRE

    Vallés Rodríguez, Marta

    2014-01-01

    El agregado trióxido mineral (MTA) es un material restaurador utilizado en endodoncia. Según su lugar de colocación, su color será importante en el resultado estético final del diente restaurado. El MTA está comercializado en color blanco para estas indicaciones estéticas, sin embargo se ha observado que a veces cambia de color. En este estudio hemos observado que el MTA blanco se oscurece cuando simultáneamente está en un ambiente sin oxígeno y recibe una fuente de luz. Llegamos a la hipó...

  18. Tri-functional cannula for retinal endovascular surgery

    Energy Technology Data Exchange (ETDEWEB)

    Weiss, Jonathan D [Albuquerque, NM

    2010-07-27

    A tri-functional cannula combines the functions of tissue Plasminogen Activator (tPA) solution delivery, illumination and venous pressure measurement. The cannula utilizes a tapered hollow-core optical fiber having an inlet for tPA solution, an attached fiber optic splitter configured to receive illumination light from an optical source such and a LED. A window in the cannula transmits the light to and from a central retinal vein. The return light is coupled to an optical detector to measure the pressure within the vein and determine whether an occlusion has been removed.

  19. The StreamCat Dataset: Accumulated Attributes for NHDPlusV2 Catchments (Version 2.1) for the Conterminous United States: Facility Registry Services (FRS) : Toxic Release Inventory (TRI) , National Pollutant Discharge Elimination System (NPDES) , and Superfund Sites

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset represents the estimated density of georeferenced sites within individual, local NHDPlusV2 catchments and upstream, contributing watersheds based on the...

  20. Research on Design of Tri-color Shift Device

    Science.gov (United States)

    Xu, Ping; Yuan, Xia; Huang, Haixuan; Yang, Tuo; Huang, Yanyan; Zhu, Tengfei; Tang, Shaotuo; Peng, Wenda

    2016-11-01

    An azimuth-tuned tri-color shift device based on an embedded subwavelength one-dimensional rectangular structure with single period is proposed. High reflection efficiencies for both TE and TM polarizations can be achieved simultaneously. Under an oblique incidence of 60°, the reflection efficiencies can reach up to 85, 86, and 100 % in blue (azimuth of 24°), green (azimuth of 63°), and red (azimuth of 90°) waveband, respectively. Furthermore, the laws of influence of device period, groove depth, coating thickness, and incident angle on reflection characteristics are investigated and exposed, and feasibility of the device is demonstrated. The proposed device realizes tri-color shift for natural light using a simple structure. It exhibits high efficiency as well as good security. Such a device can be fabricated by the existing embossing and coating technique. All these break through the limit of bi-color shift anti-counterfeiting technology and have great applications in the field of optically variable image security.

  1. Try Everything——一切皆有可能

    Institute of Scientific and Technical Information of China (English)

    李茁; 淡淡花事

    2016-01-01

    "Try Everything"是迪士尼3D动画片《疯狂动物城》(Zootopia)的主题曲,节奏感强,歌词更是十分励志。这首歌由拉丁女歌手Shakira演唱,她出生于哥伦比亚,早期以演唱西班牙语歌为主,后为与英语乐坛接轨开始演唱英语歌曲。Shakira最脍炙人口的歌曲要属她为2010年南非世界杯演唱的官方主题曲《非洲时刻》(Waka Waka)。这首"Try Everything"延续了她一贯的拉丁曲风节奏欢快又带有一些异域风情。片中的动物城是一个现代化的动物大都市,在这里,各种动物都生活在一

  2. Hanford and the Tri-Cities economy 1997

    Energy Technology Data Exchange (ETDEWEB)

    Scott, M.J.

    1998-04-09

    The missions of the US Department of Energy`s Richland Operations Office (DOE/RL) are to safely manage the Hanford Site, to manage and clean up its legacy wastes, and to develop and deploy new science and technology in the environmental and energy fields. Collectively, DOE/RL and its contractors are the most important single entity in the Tri-Cities local economy (Pasco, Kennewick, and Richland, Washington, and the surrounding area). While the relevant economic region affected by DOE/RL and its contractors actually embraces a geographic area reaching from Yakima in the west to Walla Walla in the east and from Moses Lake in the north to Pendleton, Oregon, in the south, over 90% of economic impacts likely occur in Benton and Franklin Counties. These two counties are defined as the local Tri-Cities economy for purposes of this study. In the Federal fiscal year (FY) 1997 (October 1, 1996 through September 30, 1997), the total impact of DOE`s local $1.7 billion budget was felt through payrolls and local purchases of goods and services that totaled about $774 million. Directly or indirectly, the DOE/RL budget sustained an estimated 36% of all local employment (30,300 out of 84,800 jobs) and up to 67% of local wage income.

  3. A magnetic tri-enzyme nanobiocatalyst for fruit juice clarification.

    Science.gov (United States)

    Sojitra, Uttam V; Nadar, Shamraja S; Rathod, Virendra K

    2016-12-15

    The major complications in fruit juice quality improvement are the presence of polysaccharides components in the form of disrupted fruit cell wall and cell materials. Hence, breakdown of cellulose along with pectin and starch is important for the juice processing. In this context, magnetic tri-enzyme nanobiocatalyst was prepared by simultaneously co-immobilizing three enzymes; α-amylase, pectinase and cellulase onto amino-functionalized magnetic nanoparticle by 60mM glutaraldehyde concentration with 10h cross-linking time for one pot juice clarification. The prepared nanobiocatalyst was characterized by FT-IR, SEM and XRD. The thermal (50-70°C) and pH (3-6) stability studies indicated more than two folds increment in half-life and enhanced tolerance to lower pH. The immobilized enzymes retained up to 75% of residual activity even after eight consecutive cycles of reuse. Finally, the clarification of apple, grapes and pineapple juices using magnetic tri-enzyme showed 41%, 46% and 53% respective reduction in turbidity till 150min treatment.

  4. Les particules et leurs symétries

    CERN Document Server

    Chanfray, Guy

    1997-01-01

    Les particules élémentaires, initialement au nombre de trois (proton, neutron, électron) se sont rapidement révélées plus nombreuses, notamment grâce aux expériences menées dans des accélérateurs de plus en plus puissants. L'interprétation théorique des données a permis de fonder une classification qui permet aujourd'hui de parler des " vrais " constituants fondamentaux : les quards et les leptons. Ce livre expose la manière dont les lois de symétrie, externes et internes, déterminent les propriétés des particules élémentaires. Il montre comment ces symétries mènent aux lois de conservation, comment le formalisme canonique de la théorie des champs permet de retrouver les diagrammes de Feynman et comment la compréhension des symétries SU(2) et SU (3)F détermine la classification des hadrons en multiples. La deuxième partie de l'ouvrage est consacrée aux grandes théories de jauge, la chromodynamique quantique et la théorie électrofaible. La QCD permet aujourd'hui de comprendre la...

  5. Design and analysis of miniature tri-axial fluxgate magnetometer

    Science.gov (United States)

    Zhi, Menghui; Tang, Liang; Qiao, Donghai

    2017-02-01

    The detection technology of weak magnetic field is widely used in Earth resource survey and geomagnetic navigation. Useful magnetic field information can be obtained by processing and analyzing the measurement data from magnetic sensors. A miniature tri-axial fluxgate magnetometer is proposed in this paper. This miniature tri-axial fluxgate magnetometer with ring-core structure has a dynamic range of the Earth’s field ±65,000 nT, resolution of several nT. It has three independent parts placed in three perpendicular planes for measuring three orthogonal magnetic field components, respectively. A field-programmable gate array (FPGA) is used to generate stimulation signal, analog-to-digital (A/D) convertor control signal, and feedback digital-to-analog (D/A) control signal. Design and analysis details are given to improve the dynamic range, sensitivity, resolution, and linearity. Our prototype was measured and compared with a commercial standard Magson fluxgate magnetometer as a reference. The results show that our miniature fluxgate magnetometer can follow the Magson’s change trend well. When used as a magnetic compass, our prototype only has ± 0.3∘ deviation compared with standard magnetic compass.

  6. Experimental Investigation and Modeling of Integrated Tri-generation Systems

    Science.gov (United States)

    Cetinkaya, Eda

    Energy demand in the world is increasing with population growth and higher living standards. Today, the need for energy requires a focus on renewable sources without abandoning fossil fuels. Efficient use of energy is one of the most important tasks in modern energy systems to achieve. In addition to the energy need, growing environmental concerns are linked with energy is emerged. Multi-purpose energy generation allows a higher efficiency by generating more outputs with the same input in the same system. Tri-generation systems are expected to provide at least three commodities, such as heating, cooling, desalination, storable fuel production and some other useful outputs, in addition to power generation. In this study, an experimental investigation of gasification is presented and two integrated tri-generation systems are proposed. The first integrated tri-generation system (System 1) utilizes solar energy as input and the outputs are power, fresh water and hot water. It consists of four sub-systems, namely solar power tower system, desalination system, Rankine cycle and organic Rankine cycle (ORC). The second integrated tri-generation system (System 2) utilizes coal and biomass as input and the outputs are power, fuel and hot water. It consists of five sub-systems: gasification plant, Brayton cycle, Rankine cycle, Fischer-Tropsch synthesis plant and an organic Rankine cycle (ORC). Experimental investigation includes coal and biomass gasification, where the experimental results of synthesis gas compositions are utilized in the analysis of the second systems. To maximize efficiency, heat losses from the system should be minimized through a recovery system to make the heat a useful commodity for other systems, such as ORCs which can utilize the low-grade heat. In this respect, ORCs are first analyzed for three different configurations in terms of energy and exergy efficiencies altering working fluids to increase the power output. Among two types of coal and one type

  7. Mercosur-Tlcan-UE: triángulo atlántico o triángulo de las bermudas

    Directory of Open Access Journals (Sweden)

    Grandi, Jorge

    2001-01-01

    Full Text Available O artigo aborda as relações externas do Mercosul, no âmbito do que o autor chama de novo triângulo, envolvendo o Tlcan ou Nafta, a União Européia e o Mercosul. O autor recupera os antecedentes históricos da constituição atual dos blocos na América, bem como de suas mútuas relações e tece considerações sobre os possíveis desdobramentos das mesmas

  8. Mercosur-Tlcan-UE: triángulo atlántico o triángulo de las Bermudas

    OpenAIRE

    Grandi, Jorge

    2007-01-01

    The article addresses Mercosur’s foreign affairs on the perspective of what the author calls new triangle, involving Nafta, European Union and Mercosur. The author traces back the historical background of the current constitution of countries’ integration zones in America, as well as their mutual relations, and makes considerations on possible developments in these relations. O artigo aborda as relaçoes externas do Mercosul, no âmbito do que o autor chama de novo triângulo, envolvendo o Tl...

  9. Aquatic assessment of the Pike Hill Copper Mine Superfund site, Corinth, Vermont

    Science.gov (United States)

    Piatak, Nadine M.; Argue, Denise M.; Seal, Robert R.; Kiah, Richard G.; Besser, John M.; Coles, James F.; Hammarstrom, Jane M.; Levitan, Denise M.; Deacon, Jeffrey R.; Ingersoll, Christopher G.

    2013-01-01

    The Pike Hill Copper Mine Superfund site in Corinth, Orange County, Vermont, includes the Eureka, Union, and Smith mines along with areas of downstream aquatic ecosystem impairment. The site was placed on the U.S. Environmental Protection Agency (USEPA) National Priorities List in 2004. The mines, which operated from about 1847 to 1919, contain underground workings, foundations from historical structures, several waste-rock piles, and some flotation tailings. The mine site is drained to the northeast by Pike Hill Brook, which includes several wetland areas, and to the southeast by an unnamed tributary that flows to the south and enters Cookville Brook. Both brooks eventually drain into the Waits River, which flows into the Connecticut River. The aquatic ecosystem at the site was assessed using a variety of approaches that investigated surface-water quality, sediment quality, and various ecological indicators of stream-ecosystem health. The degradation of surface-water quality is caused by elevated concentrations of copper, and to a lesser extent cadmium, with localized effects caused by aluminum, iron, and zinc. Copper concentrations in surface waters reached or exceeded the USEPA national recommended chronic water-quality criteria for the protection of aquatic life in all of the Pike Hill Brook sampling locations except for the location farthest downstream, in half of the locations sampled in the tributary to Cookville Brook, and in about half of the locations in one wetland area located in Pike Hill Brook. Most of these same locations also contained concentrations of cadmium that exceeded the chronic water-quality criteria. In contrast, surface waters at background sampling locations were below these criteria for copper and cadmium. Comparison of hardness-based and Biotic Ligand Model (BLM)-based criteria for copper yields similar results with respect to the extent or number of stations impaired for surface waters in the affected area. However, the BLM

  10. Experimental Validation of the Piezoelectric Triple Hybrid Actuation System (TriHYBAS)

    Science.gov (United States)

    Xu, Tian-Bing; Jiang, Xiaoning; Su, Ji

    2008-01-01

    A piezoelectric triple hybrid actuation system (TriHYBAS) has been developed. In this brief presentation of the validation process the displacement profile of TriHYBAS and findings regarding displacement versus applied voltage are highlighted.

  11. 2014 TRI National Analysis: Toxic Release Inventory Releases at Various Summary Levels

    Data.gov (United States)

    U.S. Environmental Protection Agency — The TRI National Analysis is EPA's annual interpretation of TRI data at various summary levels. It highlights how toxic chemical wastes were managed, where toxic...

  12. 2015 TRI National Analysis: Toxics Release Inventory Releases at Various Summary Levels

    Data.gov (United States)

    U.S. Environmental Protection Agency — The TRI National Analysis is EPA's annual interpretation of TRI data at various summary levels. It highlights how toxic chemical wastes were managed, where toxic...

  13. 75 FR 56603 - Tri-Continental Corporation, et al.; Notice of Application

    Science.gov (United States)

    2010-09-16

    ... COMMISSION Tri-Continental Corporation, et al.; Notice of Application September 10, 2010. AGENCY: Securities... specified by or in accordance with the terms of any preferred shares. Applicants: Tri-Continental Corporation (``Tri-Continental''), RiverSource LaSalle International Real Estate Fund, Inc. (``RLIREF...

  14. 76 FR 55796 - Safety Zone; TriRock Triathlon, San Diego Bay, San Diego, CA

    Science.gov (United States)

    2011-09-09

    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriRock Triathlon, San Diego Bay, San Diego.... Basis and Purpose Competitor Group is sponsoring the TriRock Triathlon, consisting of 2000 swimmers....T11-431 Safety Zone; TriRock Triathlon, San Diego Bay, San Diego, CA. (a) Location. The limits of...

  15. Influence of a chlor-alkali superfund site on mercury bioaccumulation in periphyton and low-trophic level fauna

    Science.gov (United States)

    Buckman, Kate L.; Marvin-DiPasquale, Mark C.; Taylor, Vivien F.; Chalmers, Ann T.; Broadley, Hannah J.; Agee, Jennifer L.; Jackson, Brian P.; Chen, Celia Y.

    2015-01-01

    In Berlin, New Hampshire, USA, the Androscoggin River flows adjacent to a former chlor-alkali facility that is a US Environmental Protection Agency Superfund site and source of mercury (Hg) to the river. The present study was conducted to determine the fate and bioaccumulation of methylmercury (MeHg) to lower trophic-level taxa in the river. Surface sediment directly adjacent to the source showed significantly elevated MeHg (10–40× increase, mean ± standard deviation [SD]: 20.1 ± 24.8 ng g–1 dry wt) and total mercury (THg; 10–30× increase, mean ± SD: 2045 ± 2669 ng g–1 dry wt) compared with all other reaches, with sediment THg and MeHg from downstream reaches elevated (3–7× on average) relative to the reference (THg mean ± SD: 33.5 ± 9.33 ng g–1 dry wt; MeHg mean ± SD: 0.52 ± 0.21 ng g–1 dry wt). Water column THg concentrations adjacent to the point source for both particulate (0.23 ng L–1) and dissolved (0.76 ng L–1) fractions were 5-fold higher than at the reference sites, and 2-fold to 5-fold higher than downstream. Methylmercury production potential of periphyton material was highest (2–9 ng g–1 d–1 dry wt) adjacent to the Superfund site; other reaches were close to or below reporting limits (0. 1 ng g–1 d–1 dry wt). Total Hg and MeHg bioaccumulation in fauna was variable across sites and taxa, with no clear spatial patterns downstream of the contamination source. Crayfish, mayflies, and shiners showed a weak positive relationship with porewater MeHg concentration.

  16. TRY – a global database of plant traits

    DEFF Research Database (Denmark)

    Kattge, J.; Diaz, S.; Lavorel, S.

    2011-01-01

    species richness to ecosystem functional diversity. Trait data thus represent the raw material for a wide range of research from evolutionary biology, community and functional ecology to biogeography. Here we present the global database initiative named TRY, which has united a wide range of the plant...... trait research community worldwide and gained an unprecedented buy‐in of trait data: so far 93 trait databases have been contributed. The data repository currently contains almost three million trait entries for 69 000 out of the world's 300 000 plant species, with a focus on 52 groups of traits...... within PFTs, up to 75% of the overall variation. In the context of vegetation models these traits would better be represented by state variables rather than fixed parameter values. The improved availability of plant trait data in the unified global database is expected to support a paradigm shift from...

  17. Ultrafast Optical Response from a Novel Tri-Branched Copolymer

    Institute of Scientific and Technical Information of China (English)

    李波; 米君; 孟凡顺; 田禾; 钱士雄

    2004-01-01

    A novel tri-branched copolymer is synthesized to show strong two-photon absorption and intense two-photon absorption induced fluorescence emission under the excitation of the femtosecond laser pulses at wavelength of 800 nm. The dynamics of the excited state was measured by the pump-probe technique. In a one-colour pump-probe experiment at 800 nm, there was an ultrafast transient absorption, followed by other two relaxation processes. The two-photon absorption process could be one origin for this ultrafast photoabsorption signal, which was further proven by two-colour pump-probe experiments. The other two decaying processes in the transient absorption dynamics have lifetime of about 15 ps and 129ps, which reflect the intraband vibrational relaxation and the decay of two-photon excited state, respectively.

  18. Dual Magnetic Separator for TRI$\\mu$P

    CERN Document Server

    Berg, G P A; Dammalapati, U; Harakeh, M N; Jungmann, Klaus; Onderwater, Gerco; Rogachevskiy, A; Sohani, M; Traykov, E; Willmann, L; Wilschut, H W

    2006-01-01

    The TRI$\\mu$P facility, under construction at KVI, requires the production and separation of short-lived and rare isotopes. Direct reactions, fragmentation and fusion-evaporation reactions in normal and inverse kinematics are foreseen to produce nuclides of interest with a variety of heavy-ion beams from the superconducting cyclotron AGOR. For this purpose, we have designed, constructed and commissioned a versatile magnetic separator that allows efficient injection into an ion catcher, i.e., gas-filled stopper/cooler or thermal ionizer, from which a low energy radioactive beam will be extracted. The separator performance was tested with the production and clean separation of $^{21}$Na isotopes, where a beam purity of 99.5% could be achieved. For fusion-evaporation products, some of the features of its operation as a gas-filled recoil separator were tested.

  19. Dual magnetic separator for TRI{mu}P

    Energy Technology Data Exchange (ETDEWEB)

    Berg, G.P.A. [Kernfysisch Versneller Instituut, Zernikelaan 25, 9747 AA Groningen (Netherlands)]. E-mail: gpberg@bergs.com; Dermois, O.C. [Kernfysisch Versneller Instituut, Zernikelaan 25, 9747 AA Groningen (Netherlands); Dammalapati, U. [Kernfysisch Versneller Instituut, Zernikelaan 25, 9747 AA Groningen (Netherlands); Dendooven, P. [Kernfysisch Versneller Instituut, Zernikelaan 25, 9747 AA Groningen (Netherlands); Harakeh, M.N. [Kernfysisch Versneller Instituut, Zernikelaan 25, 9747 AA Groningen (Netherlands); Jungmann, K. [Kernfysisch Versneller Instituut, Zernikelaan 25, 9747 AA Groningen (Netherlands); Onderwater, C.J.G. [Kernfysisch Versneller Instituut, Zernikelaan 25, 9747 AA Groningen (Netherlands); Rogachevskiy, A. [Kernfysisch Versneller Instituut, Zernikelaan 25, 9747 AA Groningen (Netherlands); Sohani, M. [Kernfysisch Versneller Instituut, Zernikelaan 25, 9747 AA Groningen (Netherlands); Traykov, E. [Kernfysisch Versneller Instituut, Zernikelaan 25, 9747 AA Groningen (Netherlands); Willmann, L. [Kernfysisch Versneller Instituut, Zernikelaan 25, 9747 AA Groningen (Netherlands); Wilschut, H.W. [Kernfysisch Versneller Instituut, Zernikelaan 25, 9747 AA Groningen (Netherlands)

    2006-05-10

    The TRI{mu}P facility, under construction at KVI, requires the production and separation of short-lived and rare isotopes. Direct reactions, fragmentation and fusion-evaporation reactions in normal and inverse kinematics are foreseen to produce nuclides of interest with a variety of heavy-ion beams from the superconducting cyclotron AGOR. For this purpose, we have designed, constructed and commissioned a versatile magnetic separator that allows efficient injection into an ion catcher, i.e., gas-filled stopper/cooler or thermal ionizer, from which a low energy radioactive beam will be extracted. The separator performance was tested with the production and clean separation of {sup 21}Na ions, where a beam purity of 99.5% could be achieved. For fusion-evaporation products, some of the features of its operation as a gas-filled recoil separator were tested.

  20. Aspects of Cooling at the TRI$\\mu$P Facility

    CERN Document Server

    Willmann, L; Dammalapati, U; De, S; Dendooven, P; Dermois, O; Jungmann, Klaus; Mol, A; Onderwater, Gerco; Rogachevskiy, A; Sohani, M; Traykov, E; Wilschut, H W

    2006-01-01

    The Tri$\\mu$P facility at KVI is dedicated to provide short lived radioactive isotopes at low kinetic energies to users. It comprised different cooling schemes for a variety of energy ranges, from GeV down to the neV scale. The isotopes are produced using beam of the AGOR cyclotron at KVI. They are separated from the primary beam by a magnetic separator. A crucial part of such a facility is the ability to stop and extract isotopes into a low energy beamline which guides them to the experiment. In particular we are investigating stopping in matter and buffer gases. After the extraction the isotopes can be stored in neutral atoms or ion traps for experiments. Our research includes precision studies of nuclear $\\beta$-decay through $\\beta$-$\

  1. Small type accelerator. Try for accelerator driven system

    CERN Document Server

    Mori, Y

    2003-01-01

    FFAG (Fixed-field alternating gradient) accelerator for accelerator driven subcritical reactor, which aims to change from long-lived radioactive waste to short-lived radioactivity, is introduced. It is ring accelerator. The performance needed is proton as accelerator particle, 10MW (total) beam power, about 1GeV beam energy, >30% power efficiency and continuous beam. The feature of FFAG accelerator is constant magnetic field. PoP (Proof-of-principle)-FFAG accelerator, radial type, was run at first in Japan in 2000. The excursion is about some ten cm. In principle, beam can be injected and extracted at any place of ring. The 'multi-fish' acceleration can accelerate beams to 100% duty by repeating acceleration. 150MeV-FFAG accelerator has been started since 2001. It tried to practical use, for example, treatment of cancer. (S.Y.)

  2. Kinetics of radiolytic decomposition of tri-n-butylphosphate

    Energy Technology Data Exchange (ETDEWEB)

    Vladimirova, M.V.; Kulikov, I.A.

    1986-09-01

    This paper studies the kinetics of the formation of the products of radiolysis of tri-n-butylphosphate (TBP). From a comparison of the calculations presented and experimental data previously obtained it follows that the accepted mechanisms of radiolysis of TBP and the kinetic scheme are satisfactorily described by the experimental data on the variation of TBP and DBPA with D = 10/sup 3/-10/sup 6/ Gy, but they do not satisfactorily described the data on the variation of MBPA and H/sub 3/PO/sub 4/. For D = 10/sup 3/-10/sup 6/ Gy, the instantaneous values of TBP and DBPA for fixed absorbed dose, irradiation dose rate, and time can be calculated using the formulas presented in this work.

  3. Inositol tri-phosphate inhuman and ascidian spermatozoa.

    Science.gov (United States)

    Tosti, E; Palumbo, A; Dale, B

    1993-05-01

    Using a specific protein binding assay we have shown that a spermatozoon of the ascidian Ciona intestinalis contains 1.58 +/- 0.74 x 10(-19) moles of inositol 1,4,5-tri-phosphate (InsP3), while a human spermatozoon contains 6.4 +/- 0.14 x 10(-19) moles. Induction of the acrosome reaction (AR) in both species, by exposure to the calcium ionophore A23187, does not significantly alter levels of InsP3, suggesting that phosphatidylinositol (PI) turnover is not necessary for the calcium ionophore induced AR. Furthermore, PI turnover in ascidian spermatozoa appears to be insensitive to lithium and phorbol ester. The high intracellular concentration of InsP3 in spermatozoa, corresponding to 50-200 microM, suggests it may play a role in egg activation.

  4. Tri-band small monopole antenna based on SRR units

    Directory of Open Access Journals (Sweden)

    Gehan Shehata

    2015-12-01

    Full Text Available In this paper a novel design for a tri-band monopole antenna coupled with metamaterial units is introduced. The proposed antenna was designed to cover WiMAX (2.5, 3.5 and WLAN (5.2 bands. In our proposal, a coplanar waveguide (CPW fed circular-disk monopole antenna is coupled with three split ring resonator (SRR units which exist on its back side. In our design a monopole antenna and SRR units are designed first to resonate at 5.2 GHz and 2.5 GHz respectively. In addition, antenna is loaded with post to force resonance at 3.5 GHz. SRR units are used for 2.5 GHz resonance to miniaturize antenna size, and our proposed antenna considered an electrically small antenna (ESA at its first resonance frequency. Simulated and measured results exhibit a good agreement that validate our design.

  5. Electre tri method used to storage location assignment into categories

    Directory of Open Access Journals (Sweden)

    Marcele Elisa Fontana

    2013-08-01

    Full Text Available Day after day, the importance of a company having an efficient storage location assignment system increases. Moreover, since products have different warehouse costs and customers' requirements are also different, it is important to sort products in order to adopt strategies for inventory management that are appropriate for each product. However, adopting a policy for each product is not applicable in the real world. Therefore, companies usually categorize products into classes and thereafter adopt specific inventory management policies. Given this situation, this paper puts forward the arguments for adopting a multi-criteria method, Electre TRI, to sort products that both considers criteria relating to the characteristics of a product as to its physical location in the warehouse and the criteria that are important for inventory strategies, such as, for example, the profitability of each unit held in storage.

  6. A tri-block copolymer templated synthesis of gold nanostructures.

    Science.gov (United States)

    Falletta, Ester; Ridi, Francesca; Fratini, Emiliano; Vannucci, Chiara; Canton, Patrizia; Bianchi, Sabrina; Castelvetro, Valter; Baglioni, Piero

    2011-05-01

    Stable ultra-small gold nanoparticles have been synthesized in aqueous phase by using a tri-block copolymer (BMB) as a templating agent consisting of two PEG-methylacrylate chains (B blocks) anchored to a poly(methacrylic) moiety containing a trithiocarbonate unit (M block). The effect of the BMB/Au molar ratios on the final particle size, shape and monodispersity has been investigated. The synthesized nanosols have been characterized by means of Visible Absorption, Small Angle X-ray Scattering (SAXS), and Transmission Electron Microscopy (TEM). Results clearly indicate that the polymer plays a key role in determining the size and shape of gold particles, from fractal-like structures to monodisperse spherical particles with a mean diameter of about 3 nm. The aggregation behavior of these nanostructures has been characterized both in solution (SAXS) as well as on mica substrate (AFM) and has been proven to be driven by the polymer to gold concentration ratio.

  7. PLA branching with anhydrides and tri-functional aziridine

    Science.gov (United States)

    Gu, Liangliang; Xu, Yuewen; Naredla, Rajasekhar; Hoye, Thomas; Macosko, Christopher

    Branched PLA was prepared by melt blending with tri-functional aziridine (T-Az) and pyromellitic dianhydride (PMDA). 1HNMR, gel permeation chromatography (GPC) and rheology were used to characterize the topological structures of branched PLA. Fast reaction between PLA carboxyl end group and T-Az resulted in 3-arm stars and increased the molecular weight. However, the 3-arm stars did not show strain hardening behavior under extensional flow. After modifying PLA hydroxyl end group with PMDA, PLA can react with T-Az on both chain ends and form long chain branched structure, which showed strain hardening in extension. It was found that that only 10% of the PLA hydroxyl end groups reacted with PMDA. This work is supported by Center for Sustainable Polymers.

  8. Tri-band small monopole antenna based on SRR units

    Science.gov (United States)

    Shehata, Gehan; Mohanna, Mahmoud; Rabeh, Mohammed Lotfy

    2015-12-01

    In this paper a novel design for a tri-band monopole antenna coupled with metamaterial units is introduced. The proposed antenna was designed to cover WiMAX (2.5, 3.5) and WLAN (5.2) bands. In our proposal, a coplanar waveguide (CPW) fed circular-disk monopole antenna is coupled with three split ring resonator (SRR) units which exist on its back side. In our design a monopole antenna and SRR units are designed first to resonate at 5.2 GHz and 2.5 GHz respectively. In addition, antenna is loaded with post to force resonance at 3.5 GHz. SRR units are used for 2.5 GHz resonance to miniaturize antenna size, and our proposed antenna considered an electrically small antenna (ESA) at its first resonance frequency. Simulated and measured results exhibit a good agreement that validate our design.

  9. Tri-Bimaximal Neutrino Mixing and Discrete Flavour Symmetries

    CERN Document Server

    Altarelli, Guido; Merlo, Luca

    2013-01-01

    We review the application of non-Abelian discrete groups to Tri-Bimaximal (TB) neutrino mixing, which is supported by experiment as a possible good first approximation to the data. After summarizing the motivation and the formalism, we discuss specific models, mainly those based on A4 but also on other finite groups, and their phenomenological implications, including the extension to quarks. The recent measurements of \\theta_13 favour versions of these models where a suitable mechanism leads to corrections to \\theta_13 that can naturally be larger than those to \\theta_12 and \\theta_23. The virtues and the problems of TB mixing models are discussed, also in connection with lepton flavour violating processes, and the different approaches are compared.

  10. Juveniles tried as adults: the age of the juvenile matters.

    Science.gov (United States)

    Semple, Jaclyn K; Woody, William Douglas

    2011-08-01

    Serious juvenile crimes require evaluation of a child as a criminal defendant in adult court. In such cases, it is crucial to understand jurors' attitudes, biases, and ability to follow legal instructions and maintain fairness. 308 undergraduate psychology students served as mock jurors, were randomly separated into four groups, and each group read the same realistic summary of a trial with the defendant's age presented as 13, 15, 17, or 21 years. Participants were asked to render guilty or not guilty verdicts and, if guilty, to suggest sentences. Chi-squared analysis indicated 13- and 15-year-old defendants were convicted less often than 17- and 21-year-old defendants, showing that jurors distinguished between juvenile defendants of different ages, but not minors and adults as defined by law. Additional analysis showed that age did not affect sentencing recommendations. Decision processes jurors use for juveniles tried as adults are discussed.

  11. Tri6 is a global transcription regulator in the phytopathogen Fusarium graminearum.

    Directory of Open Access Journals (Sweden)

    Charles G Nasmith

    2011-09-01

    Full Text Available In F. graminearum, the transcriptional regulator Tri6 is encoded within the trichothecene gene cluster and regulates genes involved in the biosynthesis of the secondary metabolite deoxynivalenol (DON. The Tri6 protein with its Cys₂His₂ zinc-finger may also conform to the class of global transcription regulators. This class of global transcriptional regulators mediate various environmental cues and generally responds to the demands of cellular metabolism. To address this issue directly, we sought to find gene targets of Tri6 in F. graminearum grown in optimal nutrient conditions. Chromatin immunoprecipitation followed by Illumina sequencing (ChIP-Seq revealed that in addition to identifying six genes within the trichothecene gene cluster, Tri1, Tri3, Tri6, Tri7, Tri12 and Tri14, the ChIP-Seq also identified 192 additional targets potentially regulated by Tri6. Functional classification revealed that, among the annotated genes, ∼40% are associated with cellular metabolism and transport and the rest of the target genes fall into the category of signal transduction and gene expression regulation. ChIP-Seq data also revealed Tri6 has the highest affinity toward its own promoter, suggesting that this gene could be subject to self-regulation. Electro mobility shift assays (EMSA performed on the promoter of Tri6 with purified Tri6 protein identified a minimum binding motif of GTGA repeats as a consensus sequence. Finally, expression profiling of F. graminearum grown under nitrogen-limiting conditions revealed that 49 out of 198 target genes are differentially regulated by Tri6. The identification of potential new targets together with deciphering novel binding sites for Tri6, casts new light into the role of this transcriptional regulator in the overall growth and development of F. graminearum.

  12. Human but not murine toll-like receptor 2 discriminates between tri-palmitoylated and tri-lauroylated peptides.

    Science.gov (United States)

    Grabiec, Alina; Meng, Guangxun; Fichte, Sylvia; Bessler, Wolfgang; Wagner, Hermann; Kirschning, Carsten J

    2004-11-12

    Toll-like receptors (TLRs) mediate activation of the immune system upon challenge with microbial agonists, components of disintegrating cells of the body, or metabolic intermediates of lipidic nature. Comparison of murine (m) and human (h) TLR2 primary sequences revealed 65% of identical residues within the extracellular domains in contrast to 84% in the intracellular domains. Comparative analysis of TLR2-driven cell activation by various TLR2 agonists showed that the tri-lauroylated lipopeptide analog (Lau(3)CSK(4)) is recognized efficiently through mTLR2 but not hTLR2. Genetically complemented human embryonic kidney 293 cells and murine TLR2(-/-) embryonic fibroblasts, as well as human and murine macrophage cells, were used for this analysis. In contrast to cellular activation, which depended on blockable access of the TLR2-ligand to TLR2, cellular uptake of Lau(3)CSK(4) and tri-palmitoylated peptide (P(3)CSK(4)) was independent of TLR2. A low-conserved region spanning from leucine-rich repeat (LRR) motif 7 to 10 was found to control TLR2 species-specific cell activation. Exchange of mLRR8 for hLRR8 in mTLR2 abrogated mTLR2-typical cell activation upon cellular challenge with Lau(3)CSK(4) but not P(3)CSK(4), implicating mLRR8 as a central element of Lau(3)CSK(4) recognition. The point mutation L112P within LRR3 abrogated hTLR2-dependent recognition of lipopeptides but merely attenuated mTLR2 function, whereas deletion of the N-terminal third of each LRR-rich domain (LRRs 1 to 7) had the opposite effect on P(3)CSK(4) recognition. Despite similar domain structure of both TLR2 molecules, species-specific properties thus exist. Our results imply distinct susceptibilities of humans and mice to challenge with specific TLR2 ligands.

  13. Pregnancy intentions among women who do not try: focusing on women who are okay either way.

    Science.gov (United States)

    McQuillan, Julia; Greil, Arthur L; Shreffler, Karina M

    2011-02-01

    Are women who are intentional about pregnancy (trying to or trying not to get pregnant) systematically different from women who are "okay either way" about getting pregnant? We use a currently sexually active subsample (n = 3,771) of the National Survey of Fertility Barriers, a random digit dialing telephone survey of reproductive-aged women (ages 25-45) in the United States. We compare women who are trying to, trying not to, or okay either way about getting pregnant on attitudes, social pressures, life course and status characteristics using bivariate analyses (chi-square tests for categorical and ANOVA tests for continuous variables). Multivariate multinomial logistic regression provides adjusted associations. Most women say that they are trying not to get pregnant (71%) or are okay either way (23%); few are trying to get pregnant. Among women with no prior pregnancies (n = 831), more say that they are trying to get pregnant (14%) but a similar percentage are okay either way (26%). Several characteristics distinguish those trying to from those okay: fertility intentions, importance of motherhood, age, parity, race/ethnicity and self identifying a fertility problem. Additional characteristics are associated with trying not to get pregnant compared to being okay: ideal number of children, wanting a baby, trusting conception, relationship satisfaction, race ethnicity, economic hardship, and attitudes about career success. Women who are "okay either way" about pregnancy should be assessed separately from women who are intentional (trying to, trying not to) about pregnancy.

  14. Evaluation of borehole geophysical and video logs, at Butz Landfill Superfund Site, Jackson Township, Monroe County, Pennsylvania

    Science.gov (United States)

    Low, D.J.; Conger, R.W.

    2001-01-01

    Between February 1996 and November 2000, geophysical logging was conducted in 27 open borehole wells in and adjacent to the Butz Landfill Superfund Site, Jackson Township, Monroe County, Pa., to determine casing depth and depths of water-producing zones, water-receiving zones, and zones of vertical borehole flow. The wells range in depth from 57 to 319 feet below land surface. The geophysical logging determined the placement of well screens and packers, which allow monitoring and sampling of water-bearing zones in the fractured bedrock so that the horizontal and vertical distribution of contaminated ground water migrating from known sources could be determined. Geophysical logging included collection of caliper, natural-gamma, single-point-resistance, fluid-resistivity, fluid-temperature, and video logs. Caliper and video logs were used to locate fractures, joints, and weathered zones. Inflections on single-point-resistance, fluid-temperature, and fluid-resistivity logs indicated possible water-bearing fractures, and heatpulse-flowmeter measurements verified these locations. Natural-gamma logs provided information on stratigraphy.

  15. The electro-thermal dynamic stripping process for the remediation of a creosote-contaminated superfund site

    Energy Technology Data Exchange (ETDEWEB)

    Northington, C.D. [WRS Infrastructure and Environment, Tampa, FL (United States); McGee, B.C.W. [McMillan-McGee Corp., Calgary, AB (Canada)

    2005-07-01

    Pump-and-treat is a conventional soil and groundwater contaminant removal method that depends on factors such as the chemical nature of the contaminant, subsurface heterogeneity, sorption of contaminants to subsurface materials, difficulties in characterizing the subsurface, and system design. The cleanup of dense non-aqueous phase liquids (DNAPLs) is further complicated by the uncertain contaminant fate due to the tendency of DNAPLs to migrate downward, where they become difficult to locate and where they become immobile residual globules and a long-term source of ground water contamination. This paper presents the results of a pilot scale study in which an in-situ thermal decontamination technology was tested. The technology known as the Electro-Thermal Dynamic Stripping Process{sup TM} (ET-DS), was developed for a creosote-contaminated Superfund site to show the effectiveness of full-scale implementation of this method over the currently used pump-and- treat system to address contamination in the source zone. The pilot study follows similar methods used by reservoir engineers in the evaluation of thermal recovery methods for the recovery of bitumen and heavy oil. ET-DS was field test in the oil sands in order to use some operating data from the pilot to design oil sand specific ET-DS.

  16. Using a triad approach in the assessment of hazardous waste site leaching from a Superfund site to an adjacent stream

    Energy Technology Data Exchange (ETDEWEB)

    Leppanen, C.J. [Univ. of Maine, Orono, ME (United States). Dept. of Biochemistry, Microbiology, and Molecular Biology; Blanner, P.M.; Allan, R.S.; Maier, K.J. [Univ. of Memphis, TN (United States); Benson, W.H. [Univ. of Mississippi, University, MS (United States)

    1998-10-01

    A triad approach was used in the evaluation of sediment in the Wolf River adjacent to the North Hollywood Dump, a federally listed Superfund site. Chemical analyses were done for 18 organochlorine pesticides, 21 polychlorinated biphenyl (PCB) congeners, and 10 metals. Sediment toxicity was evaluated with freshwater invertebrates. Chironomus tentans and Hyalella azteca. Benthic macroinvertebrate diversity and abundance were assessed with a family-level biotic index. Mean Al, Ba, Cd, Cu, Fe, Ni, Pb, and Zn concentrations were significantly higher in sediments collected in the spring. Both spring and fall sediments exhibited toxicity downstream from, adjacent to, and upstream from the dump, with toxicity significantly higher in fall sediments; however, a consistent trend was not observed. Toxicity was typically greater in the fall, and metal concentrations were typically higher in spring sediments, suggesting that metals were not responsible for the toxicity. Sediment-associated organochlorine pesticide and PCB congener concentrations were all below detectable limits, suggesting that these potential contaminants are not contributing to the observed toxicity. No differences were found in benthic macroinvertebrate community structure, which was composed of predominantly pollution-tolerant families, among seasons or river reaches, which appear to be limited by the physical characteristics of the river. Sediments in urban reaches of the Wolf River appear to be degraded; the North Hollywood Dump cannot be isolated as a source of toxicity in this study. In situ testing, sediment toxicity identification and evaluation testing, acid-volatile sulfide analyses, or artificial substrate work would be appropriate to follow.

  17. Anatomical Directional Dissimilarities in Tri-axial Swallowing Accelerometry Signals.

    Science.gov (United States)

    Movahedi, Faezeh; Kurosu, Atsuko; Coyle, James L; Perera, Subashan; Sejdic, Ervin

    2017-05-01

    Swallowing accelerometry is a noninvasive approach currently under consideration as an instrumental screening test for swallowing difficulties, with most current studies focusing on the swallowing vibrations in the anterior-posterior (A-P) and superior-inferior (S-I) directions. However, the displacement of the hyolaryngeal structure during the act of swallowing in patients with dysphagia involves declination of the medial-lateral (M-L), which suggests that the swallowing vibrations in the M-L direction have the ability to reveal additional details about the swallowing function. With this motivation, we performed a broad comparison of the swallowing vibrations in all three anatomical directions. Tri-axial swallowing accelerometry signals were concurrently collected from 72 dysphagic patients undergoing videofluoroscopic evaluation of swallowing (mean age: 63.94 ± 12.58 years period). Participants swallowed one or more thickened liquids with different consistencies including thin-thick liquids, nectar-thick liquids, and pudding-thick liquids with either a comfortable self-selected volume from a cup or a controlled volume by the examiner from a 5-ml spoon. Swallows were grouped based on the viscosity of swallows and the participant's stroke history. Then, a comprehensive set of features was extracted in multiple signal domains from 881 swallows. The results highlighted inter-axis dissimilarities among tri-axial swallowing vibrations including the extent of variability in the amplitude of signals, the degree of predictability of signals, and the extent of disordered behavior of signals in time-frequency domain. First, the upward movement of the hyolaryngeal structure, representing the S-I signals, were actually more variable in amplitude and showed less predictable behavior than the sideways and forward movements, representing the A-P and M-L signals, during swallowing. Second, the S-I signals, which represent the upward movement of the hyolaryngeal structure

  18. Hanford Diversification and the Tri-Cities Economy FY 1999

    Energy Technology Data Exchange (ETDEWEB)

    SCOTT, M.J.

    2000-06-05

    The missions of the U.S. Department of Energy's Richland Operations Office (DOE/RL) are to safely manage the Hanford Site, to manage and clean up its legacy wastes, and to develop and deploy new science and technology in the environmental and energy fields. Collectively, DOE/RL and its contractors are the most important single entity in the Tri-Cities local economy (Pasco, Kennewick, and Richland, Washington, and the surrounding area). Although the relevant economic region affected by DOE/RL and its contractors actually embraces a geographic area reaching from Yakima in the west to Walla Walla in the east and from Moses Lake in the north to Pendleton, Oregon, in the south, over 90% of economic impacts likely occur in Benton and Franklin Counties. These two counties are defined as the ''local'' Tri-Cities economy for purposes of this study. In the federal fiscal year (FY) 1999 (October 1, 1998 through September 30, 1999), the total impact of DOE'S local $1.59 billion budget was felt through payrolls of $542 million and local purchases of goods and services of $226 million. The total local spending of $768 million was up slightly from the FY 1998 total of $765 million. Taking into account the multiplier effects of this spending, the DOE/RL budget sustained an estimated 32% of all local employment (28,250 out of 88,100 jobs) and about 35% of local earned income (almost $1.08 billion out of $3.08 billion). The decrease in these percentages from last year's report reflects an update of the model's economic structure based on the 1997 economic census year, a correction of a programming error in the model found during the update, and a broader definition of earnings that includes proprietor income, not just wages (see the Appendix for revisions to the previous forecasts). DOE budget increases in FY 2000 are expected to result in no change to the number of local DOE contractor jobs and about a $29 million increase in direct local

  19. Hanford, diversification, and the Tri-Cities Economy FY 1998

    Energy Technology Data Exchange (ETDEWEB)

    SCOTT, M.J.

    1999-04-14

    The missions of the U.S. Department of Energy's Richland Operations Office (DOE/RL) are to safely manage the Hanford Site, to manage and clean up its legacy wastes, and to develop and deploy new science and technology in the environmental and energy fields. Collectively, DOE/RL and its contractors are the most important single entity in the Tri-Cities local economy (Pasco, Kennewick, and Richland, Washington, and the surrounding area). Although the relevant economic region affected by DOE/RL and its contractors actually embraces a geographic area reaching from Yakima in the west to Walla Walla in the east and from Moses Lake in the north to Pendleton, Oregon, in the south, over 90% of economic impacts likely occur in Benton and Franklin Counties. These two counties are defined as the ''local'' Tri-Cities economy for purposes of this study (see Figure 1). In the federal fiscal year (IV) 1998 (October 1, 1997 through September 30, 1998), the total impact of DOEs local $1.6 billion budget was felt through payrolls of $519 million and local purchases of goods and services of $246 million. The total local spending of $765 million was down slightly from the FY 1997 total of $774 million. Taking into account the slightly greater multiplier effects of this spending due to changes in its mix, the DOE/RL budget sustained an estimated 36% of all local employment (31,200 out of 86,000 jobs) and up to 64% of local wage income ($1.55 billion out of $2.40 billion). This was up slightly from the year before (29,500 jobs, $1.49 billion income). DOE budget increases in FY 1999 are expected to result in a net increase of about 200 local DOE contractor jobs over the September 30, 1998 level, or about equal to the FY 1998 average. In addition, economic diversification more than offset the impact of the local DOE losses in FY 1998 and, together with an initial economic boost from privatization of Hanford's tank waste cleanup, is expected to play a

  20. PMSE Observations With the Tri-Static EISCAT VHF Radars

    Science.gov (United States)

    Mann, I.; Tjulin, A.; Häggström, I.

    2013-12-01

    The polar mesospheric summer echoes (PMSE) are generated in the ionosphere at roughly 80 to 90 altitude by electron irregularities in the presence of charged solid particles and PMSE are most likely observed when ice particles form onto nanodust. PMSE formation is an important part in understanding mesospheric processes, but is also an interesting example for dusty plasma phenomena occurring in space. To investigate the phenomena that lead to formation of PMSE it is helpful to study the radar reflectivity of the mesosphere at different angles. PMSE were previously studied at different aspect angles in order to better understand the scattering process. Another way is observing PMSE from multiple sites simultaneously. During this summer the EISCAT radars that are located in Northern Scandinavia could for the first time be used for tri-static observations in the VHF band and we carried out observations during three subsequent days in June 2013. The radar signal was transmitted in zenith direction with the EISCAT VHF antenna near Tromsø (69.59 deg N, 19.23 deg E) and the scattered signal was measured from Tromsø, Kiruna (67.86 deg N, 20.44 deg E) and Sodankylä (67.36 deg N, 26.63 deg E). Zenith observations were simultaneously carried out with the Tromsø UHF radar (933 MHz). Other groups have previously reported the observations of PMSE simultaneously with the EISCAT VHF and UHF radars, but with a much lower occurrence rate for the UHF. UHF observations made during this campaign are dominated by incoherent scatter. The VHF system in Tromsø detected PMSE for a large fraction of the observation time. The VHF receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. These observations are among the first tri-static observations of PMSE. Preliminary results from the campaign will be presented and discussed.

  1. Monitoring of odor nuisance in the tri-city agglomeration

    Science.gov (United States)

    Gebicki, Jacek; Dymerski, Tomasz; Namieśnik, Jacek

    2016-11-01

    The paper describes a principle of operation of odor nuisance monitoring network, which is being designed in the tri-city agglomeration. Moreover, it presents the preliminary results of an investigation on ambient air quality with respect to odour nuisance in a vicinity of the municipal landfill. The investigation was performed during spring-winter season using a prototype of electronic nose and the Nasal Ranger field olfactometers. The prototype was equipped with a set of six semiconductor sensors by FIGARO Co. and one PID-type sensor. The field olfactometers were used to determine mean concentration of odorants, which amounted from 2.2 to 30.2 ou/m3 depending on the place of measurement. In case of the investigation with the electronic nose prototype a classification of the ambient air samples with respect to the place of sampling was performed utilizing kNN algorithm supported with a cross-validation method. Correct classification of the ambient air samples was at the level of 66.7%. Performed investigation revealed that discrimination of the ambient air samples differing in concentration of odorants and place of origin was possible.

  2. Characterizing the effective bandwidth of tri-stable energy harvesters

    Science.gov (United States)

    Panyam, Meghashyam; Daqaq, Mohammed F.

    2017-01-01

    Recently, it has been shown that nonlinear vibratory energy harvesters possessing a tri-stable potential function are capable of harvesting energy efficiently over a wider range of frequencies in comparison to harvesters with a double-well potential function. However, the effect of the design parameters of the harvester on the dynamic response and the effective bandwidth of such devices remains uninvestigated. To fill this void, this paper establishes an analytical approach to characterize the effective frequency bandwidth of harvesters that possess a hexic potential energy function. To achieve this goal, the method of multiple scales is utilized to construct analytical solutions describing the amplitude and stability of the intra- and inter-well dynamics of the harvester. Using these solutions, critical bifurcations in the parameter's space are identified and used to define an effective frequency bandwidth of the harvester. The influence of the electric parameters, namely, the time constant ratio (ratio between the period of the mechanical system and the time constant of the harvesting circuit) and the electromechanical coupling, on the effective frequency bandwidth is analyzed. Experimental studies performed on the harvester are presented to validate some of the theoretical findings.

  3. Defects in the tri-critical Ising model

    Science.gov (United States)

    Makabe, Isao; Watts, Gérard M. T.

    2017-09-01

    We consider two different conformal field theories with central charge c = 7 /10. One is the diagonal invariant minimal model in which all fields have integer spins; the other is the local fermionic theory with superconformal symmetry in which fields can have half-integer spin. We construct new conformal (but not topological or factorised) defects in the minimal model. We do this by first constructing defects in the fermionic model as boundary conditions in a fermionic theory of central charge c = 7 /5, using the folding trick as first proposed by Gang and Yamaguchi [1]. We then act on these with interface defects to find the new conformal defects. As part of the construction, we find the topological defects in the fermionic theory and the interfaces between the fermionic theory and the minimal model. We also consider the simpler case of defects in the theory of a single free fermion and interface defects between the Ising model and a single fermion as a prelude to calculations in the tri-critical Ising model.

  4. Single Time-Stamped Tries for Retroactive Call Subsumption

    CERN Document Server

    Cruz, Flavio

    2011-01-01

    Tabling is an evaluation strategy for Prolog programs that works by storing answers in a table space and then by using them in similar subgoals. Some tabling engines use call by subsumption, where it is determined that a subgoal will consume answers from a more general subgoal in order to reduce the search space and increase efficiency. We designed an extension, named Retroactive Call Subsumption (RCS), that implements call by subsumption independently of the call order, thus allowing a more general subgoal to force previous called subgoals to become answer consumers. For this extension, we propose a new table space design, the Single Time Stamped Trie (STST), that is organized to make answer sharing across subsumed/subsuming subgoals simple and efficient. In this paper, we present the new STST table space design and we discuss the main modifications made to the original Time Stamped Tries approach to non-retroactive call by subsumption. In experimental results, with programs that stress some deficiencies of ...

  5. A regularized tri-linear approach for optical interferometric imaging

    Science.gov (United States)

    Birdi, Jasleen; Repetti, Audrey; Wiaux, Yves

    2017-06-01

    In the context of optical interferometry, only undersampled power spectrum and bispectrum data are accessible. It poses an ill-posed inverse problem for image recovery. Recently, a tri-linear model was proposed for monochromatic imaging, leading to an alternated minimization problem. In that work, only a positivity constraint was considered, and the problem was solved by an approximated Gauss-Seidel method. In this paper, we propose to improve the approach on three fundamental aspects. First, we define the estimated image as a solution of a regularized minimization problem, promoting sparsity in a fixed dictionary using either an ℓ1 or a (re)weighted-ℓ1 regularization term. Secondly, we solve the resultant non-convex minimization problem using a block-coordinate forward-backward algorithm. This algorithm is able to deal both with smooth and non-smooth functions, and benefits from convergence guarantees even in a non-convex context. Finally, we generalize our model and algorithm to the hyperspectral case, promoting a joint sparsity prior through an ℓ2,1 regularization term. We present simulation results, both for monochromatic and hyperspectral cases, to validate the proposed approach.

  6. What Did You Try Last Semester? How Did It Work?

    Science.gov (United States)

    Moore, John W.

    1999-02-01

    As I write this, the end of the semester is less than a week away. This is a good time to reflect on what I tried this time that I had not done before, how well it worked, and how that applies to the process of change and reform in chemical education. Nearly a year ago, a good friend gave me a copy of a brief note by the Executive Director of the National Science Teachers Association, Gerald Wheeler (1). Its title was "Why doesn't change stick?" Quoting the Red Queen from Alice in Wonderland, Wheeler suggested that it might be taking all the running we could do just to maintain the status quo. He asked readers to look systematically at "the failed reform efforts begun in the 1960s" and questioned whether those efforts had actually changed anything. Although the reform efforts Wheeler questioned were aimed at the pre-college level, his point is a good one for college as well as high school teachers to consider, especially at a time when new projects are aiming to reform science education systemically. (See pages 158-160 and page 163 for more information on these projects.) If reform efforts are typically meteoric, burning brightly for but a short time and then disappearing, what might we do to make them less so? I think that the power to make reform less meteoric lies within all of us. It involves incremental, rather than revolutionary, change. My model for reform is one in which each of us continually experiments with manageable changes in courses and pedagogy, evaluating their effectiveness, casting out the less than successful ones, retaining and refining those that help students learn more effectively, and keeping the rest of the community informed about what works and what does not. This model requires continual work and dedication from all of us, but not superhuman effort that is impossible to sustain over the long term. A meteor shower definitely gets our attention, but far more light is shed by the fixed stars, and they'll still be there next week. The

  7. A regularized tri-linear approach for optical interferometric imaging

    CERN Document Server

    Birdi, Jasleen; Wiaux, Yves

    2016-01-01

    In the context of optical interferometry, only under-sampled power spectrum and bispectrum data are accessible. It poses an ill-posed inverse problem for image recovery. Recently, a tri-linear model was proposed for monochromatic imaging, leading to an alternated minimization problem. In that work, only a positivity constraint was considered, and the problem was solved by an approximated Gauss-Seidel method. In this paper, we propose to improve the approach on three fundamental aspects. Firstly, we define the estimated image as a solution of a regularized minimization problem, promoting sparsity in a fixed dictionary using either an $\\ell_1$ or a weighted-$\\ell_1$ regularization term. Secondly, we solve the resultant non-convex minimization problem using a block-coordinate forward-backward algorithm. This algorithm is able to deal both with smooth and non-smooth functions, and benefits from convergence guarantees even in a non-convex context. Finally, we generalize our model and algorithm to the hyperspectral...

  8. Leadership development for clinicians: what are we trying to achieve?

    Science.gov (United States)

    McKimm, Judy; Swanwick, Tim

    2011-09-01

    The role of all health practitioners is changing as a result of social, technological and demographic shifts, and clinicians are increasingly required to participate in leadership activities. Worldwide, there are emerging examples of policy agendas, professional standards and competency frameworks and approaches to leadership development for clinicians. This article looks at what leadership development programmes for clinicians are trying to achieve, the rationale behind them and the outcomes that are deemed to be important. It offers a critical description of competency frameworks and their use in practice. The UK, along with other Western countries, has embedded leadership and management learning outcomes into professional frameworks for students and qualified clinicians. There is increasing recognition that leadership development is best rooted in work-based activities, reflecting the realities of clinical life, with an emphasis on learning across the education and training continuum. If leadership is deemed to be relevant 'at all levels', then 'leadership development' must be addressed throughout the education and training undertaken by health professionals. Leadership as a topic is gathering momentum as a key curriculum area. But effective clinical leaders and managers need to be nurtured and supported by the organisations and health systems within which they work and learn. Although a wide range of leadership development activities exist for individuals, without system-wide change these initiatives may not produce the most effective 'leadership', nor the health improvements to which they aspire. © Blackwell Publishing Ltd 2011.

  9. STS-103 MS Clervoy tries on oxygen mask

    Science.gov (United States)

    1999-01-01

    In the bunker at Launch Pad 39B, STS-103 Mission Specialist Jean-Frangois Clervoy of France, who is with the European Space Agency (ESA), tries on an oxygen mask during Terminal Countdown Demonstration Test (TCDT) activities. The TCDT provides the crew with emergency egress training, opportunities to inspect their mission payloads in the orbiter's payload bay, and simulated countdown exercises. Other crew members taking part are Commander Curtis L. Brown Jr. and Mission Specialists Steven L. Smith, C. Michael Foale (Ph.D.), John M. Grunsfeld (Ph.D.), plus Claude Nicollier of Switzerland, who is also with ESA. STS-103 is a 'call-up' mission due to the need to replace and repair portions of the Hubble Space Telescope, including the gyroscopes that allow the telescope to point at stars, galaxies and planets. The STS-103 crew will be replacing a Fine Guidance Sensor, an older computer with a new enhanced model, an older data tape recorder with a solid-state digital recorder, a failed spare transmitter with a new one, and degraded insulation on the telescope with new thermal insulation. The crew will also install a Battery Voltage/Temperature Improvement Kit to protect the spacecraft batteries from overcharging and overheating when the telescope goes into a safe mode. Four EVA's are planned to make the necessary repairs and replacements on the telescope. The mission is targeted for launch Dec. 6 at 2:37 a.m. EST.

  10. Superfund record of decision (EPA Region 9): McClellan Air Force Base, Basewide Groundwater Operable Unit, Sacramento, CA, May 11, 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-07-01

    The Interim Record of Decision (ROD) presents the interim remedial action for the Groundwater Operable Unit (Groundwater OU) at the McClellan Air Force Base (McClellan AFB) Superfund site in Sacramento, California. The Groundwater OU addresses all of the VOC-contaminated groundwater at McClellan AFB. The Groundwater OU remedy is designed to prevent the spread of contamination that is already in the groundwater by containing groundwater with concentrations greater than maximum contaminant levels (MCLs). The remedy is also designed to remove to the maximum extent practicable the mass of contamination that lies in that volume of the groundwater.

  11. A Try-Out of the February Revolution?

    Directory of Open Access Journals (Sweden)

    Sergei A. Nefedov

    2016-12-01

    Full Text Available The question about the causes and actors of the February revolution can be understood only in the context of previous events. In this connection, of great importance is the analysis of the causes and circumstances of a strike wave that swept through Petrograd in October 1916. Up to 100 thousand strikers (together with locked-out workers were involved in these labor unrests that were accompanied by demonstrations and clashes with the police. In many ways (bread shortage as the main motivation, bakeshops pillage, spontaneity, suddenness, involvement of adolescents and women, Cossacks’ refusal to shoot into the crowd, solders’ desertion to the side of people, these events recall those of February 23–28, 1917. The American historians L. Haimson and E. Brian called them “a try-out of the February revolution”. Short information about these strikes is available in the papers of a number of Soviet authors; however, it is presented to some extent tendentiously, based on the desire to show the directing and organizational role of the Bolshevik party. In this regard, it seems important to restore the actual course of the events and give them an objective interpretation. The study shows that the October strikes were the first reaction of Petrograd workers to the emerging food crisis, whereas the February revolution was the reaction to the second, a much more acute phase of this crisis. The mechanism of these events was similar: in the both cases, famine was the major factor pushing for protests. In the both cases, protests were spontaneous and massive, externally similar to a hunger riot. The food crisis determined the army’s position as well: both in October and in February, Cossacks and soldiers sympathized with the starving population and refused to use weapons to crackdown demonstrators

  12. Try-A Global Database of Plant Traits

    Energy Technology Data Exchange (ETDEWEB)

    Thornton, Peter E [ORNL

    2011-01-01

    Plant traits the morphological, anatomical, physiological, biochemical and phenological characteristics of plants and their organs determine how primary producers respond to environmental factors, affect other trophic levels, influence ecosystem processes and services and provide a link from species richness to ecosystem functional diversity. Trait data thus represent the raw material for a wide range of research from evolutionary biology, community and functional ecology to biogeography. Here we present the global database initiative named TRY, which has united a wide range of the plant trait research community worldwide and gained an unprecedented buy-in of trait data: so far 93 trait databases have been contributed. The data repository currently contains almost three million trait entries for 69 000 out of the world s 300 000 plant species, with a focus on 52 groups of traits characterizing the vegetative and regeneration stages of the plant life cycle, including growth, dispersal, establishment and persistence. A first data analysis shows that most plant traits are approximately log-normally distributed, with widely differing ranges of variation across traits. Most trait variation is between species (interspecific), but significant intraspecific variation is also documented, up to 40% of the overall variation. Plant functional types (PFTs), as commonly used in vegetation models, capture a substantial fraction of the observed variation but for several traits most variation occurs within PFTs, up to 75% of the overall variation. In the context of vegetation models these traits would better be represented by state variables rather than fixed parameter values. The improved availability of plant trait data in the unified global database is expected to support a paradigm shift from species to trait-based ecology, offer new opportunities for synthetic plant trait research and enable a more realistic and empirically grounded representation of terrestrial vegetation in

  13. Magnetic field uniformity of the practical tri-axial Helmholtz coils systems.

    Science.gov (United States)

    Beiranvand, R

    2014-05-01

    In this paper, effects of the assembly misalignments and the manufacturing mismatches on the magnetic field uniformity of a practical tri-axial Helmholtz coils system have been modeled mathematically. These undesired effects regularly occur in any practical tri-axial Helmholtz coils system. To confirm the mathematical calculations, a tri-axial Helmholtz coils system has been constructed and the uniformity of its magnetic field has been measured under different conditions. The experimental results are in good agreement with the mathematical analyses.

  14. Relating Magnetic Parameters to Heavy Metal Concentrations and Environmental Factors at Formosa Mine Superfund Site, Douglas County, OR

    Science.gov (United States)

    Upton, T. L.

    2016-12-01

    Advances in the field of environmental magnetism have led to exciting new applications for this field. Magnetic minerals are ubiquitous in the environment and tend to have an affinity for heavy metals. Hence, it has been demonstrated that magnetic properties are often significantly related to concentrations of heavy metals and other pollutants. As a result, magnetic techniques have been used as proxy for determining hot spots of several types of pollution produced from a diversity of anthropogenic sources. Magnetic measurements are non-destructive and relatively inexpensive compared to geochemical analyses. The utility of environmental magnetic methods varies widely depending on biological, chemical and physical processes that create and transform soils and sediments. Applications in the direction of mapping heavy metals have been studied and shown to be quite useful in countries such as China and India but to date, little research has been done in the US. As such, there is need to expand the scope of research to a wider range of soil types and land uses, especially within the US. This study investigates the application of environmental magnetic techniques to mapping of heavy metal concentrations at the Formosa Mine Superfund Site, an abandoned mine about 25 miles southwest of Roseburg, OR. The soils and sediment at this site are derived from pyrite-rich bedrock which is weak in terms of magnetic susceptibility. Using hotspot analysis, correlation and cluster analyses, interactions between metals and magnetic parameters are investigated in relation to environmental factors such as proximity to seeps and adits. Preliminary results suggest significant correlation of magnetic susceptibility with certain heavy metals, signifying that magnetic methods may be useful in mapping heavy metal hotspots at this site. Further analysis examines the relation of various land use differences in magnetic signatures obtained throughout the Cow Creek watershed.

  15. Test Reference Year (TRY). Final report. [Weather data collection for building energy demand calculations

    Energy Technology Data Exchange (ETDEWEB)

    1977-08-01

    The Test Reference Year (TRY) for a specified location is a data collection consisting of 8760 sets of hourly weather data. Its main objective is to provide data for computerized calculations regarding energy conservation, energy consumption in buildings, and indoor climate. This report recommends a suitable format for such a TRY, describes which weather data are mandatory for such a TRY to meet the main objective, and recommends how it can be published. The report does not recommend any specific procedure for generating or selecting a TRY for a given location.

  16. Modulation of STAT3 folding and function by TRiC/CCT chaperonin.

    Directory of Open Access Journals (Sweden)

    Moses Kasembeli

    2014-04-01

    Full Text Available Signal transducer and activator of transcription 3 (Stat3 transduces signals of many peptide hormones from the cell surface to the nucleus and functions as an oncoprotein in many types of cancers, yet little is known about how it achieves its native folded state within the cell. Here we show that Stat3 is a novel substrate of the ring-shaped hetero-oligomeric eukaryotic chaperonin, TRiC/CCT, which contributes to its biosynthesis and activity in vitro and in vivo. TRiC binding to Stat3 was mediated, at least in part, by TRiC subunit CCT3. Stat3 binding to TRiC mapped predominantly to the β-strand rich, DNA-binding domain of Stat3. Notably, enhancing Stat3 binding to TRiC by engineering an additional TRiC-binding domain from the von Hippel-Lindau protein (vTBD, at the N-terminus of Stat3, further increased its affinity for TRiC as well as its function, as determined by Stat3's ability to bind to its phosphotyrosyl-peptide ligand, an interaction critical for Stat3 activation. Thus, Stat3 levels and function are regulated by TRiC and can be modulated by manipulating its interaction with TRiC.

  17. TRI HITA KARANA AND HYDROLIC CYCLE BASED ON VEDA

    Directory of Open Access Journals (Sweden)

    A.A. Kade Sri Yudari

    2015-10-01

    Full Text Available Hydrologic cycle refers to the route of water cycle or the journey made by water on the earth’s surface. Water can change in form, and flows in various places before finally it gets back to the biggest source, that is, the ocean. Approximately 71% of the earth is covered with the ocean. Talking about the hydrologic cycle cannot be separated from talking about the sun and the ocean, that is, the impact of the rise and fall of the tides. In Veda, the traditional geography, in general, and in Tatwa and Purana, in particular, it is stated that the earth is divided into two parts; they are the main land and the ocean. The question is how deep the Hindu theology and philosophy about the hydrologic cycle is. The water on the earth’s surface evaporates, resulting from the hot ray radiated by the sun. In Reg. Veda Samhita.I.164.51, it is strongly stated that “the water on the earth’s surface rises due to evaporation”. After evaporation, water changes into water drops or fine dews referred to as clouds. There are many types and forms of clouds which may lead to storms; however, some have no impact. When such clouds are already formed, they are brought to every area of the earth’s surface. When they reach the saturation point, a natural phenomenon appears which is referred to as rain. The falling water makes the earth wet, fills up dams, flows along rivers, and fertilize every type of life on earth. Rain measures how the hydrologic cycle takes place. Therefore, it should be recognized that it is important to maintain the hydrologic cycle, which determines that the earth’s fertility and prosperity will not be disturbed. The Hindu teaching is rich in such a philosophy referred to as Tri Hita Karana. Even in very religious ritual water is always mainly used for purification. The sources of water such as wells, rivers, lakes, showers, and oceans are made to be physically and spiritually sacred. The concepts of balance and harmony are easily found

  18. 75 FR 34735 - Adequacy Status of the Alabama Portion (Jackson County) of the Chattanooga, Tennessee Tri-State...

    Science.gov (United States)

    2010-06-18

    ... AGENCY Adequacy Status of the Alabama Portion (Jackson County) of the Chattanooga, Tennessee Tri-State... the tri-state Chattanooga, Tennessee nonattainment area (hereafter referred to as the ``Jackson County... County, Alabama as part of the tri-state Chattanooga 1997 PM 2.5 nonattainment area. The tri-state...

  19. 77 FR 10475 - Tri-State Generation and Transmission Association, Inc., Notice of Intent To Hold Public Scoping...

    Science.gov (United States)

    2012-02-22

    ... Rural Utilities Service Tri-State Generation and Transmission Association, Inc., Notice of Intent To... Tri-State Generation and Transmission Association, Inc. (Tri-State). The proposed Burlington-Wray 230... the existing Wray Substation in Yuma County. Tri-State is requesting that RUS provide financial...

  20. A review of the Texas, USA San Jacinto Superfund site and the deposition of polychlorinated dibenzo-p-dioxins and dibenzofurans in the San Jacinto River and Houston Ship Channel.

    Science.gov (United States)

    Iyer, Rupa; Aggarwal, Juhi; Iken, Brian

    2016-12-01

    The San Jacinto River (SJR) waste pits that lie just under the 1-10 overpass in eastern Harris County east of Houston, Texas, USA, were created in the 1960s as dumping grounds for paper mill waste. The deposition of this waste led to accumulation of highly toxic polychlorinated dibenzo-p-dioxins and dibenzofurans (PCCDDs/PCDFs) over the course of several decades. After abandonment, the waste material eventually became submerged under the waters of the SJR, resulting in widespread environmental contamination that currently constitutes a significant health concern for eastern Harris County communities. The original waste pits were rediscovered in 2005, and the San Jacinto waste site is now a designated EPA superfund site. The objective of this review then is to discuss the history and current state of containment around the San Jacinto waste pits and analyze spatial and temporal trends in the PCDD/PCDF deposition through the SJR system from the data available. We will discuss the current exposure and health risks represented by the Superfund site and the SJR system itself, as well as the discovery of liver, kidney, brain (glioma), and retinoblastoma cancer clusters in eastern Harris County across multiple census tracts that border the Superfund site. We will also cover the two primary management options, containment versus removal of the waste from the Superfund and provide recommendations for increased monitoring of existing concentrations of polychlorinated waste in the SJR and its nearby associated communities.

  1. TREATABILITY STUDY REPORT OF GREEN MOUNTAIN LABORATORIES, INC.'S BIOREMEDIATION PROCESS, TREATMENT OF PCB CONTAMINATED SOILS, AT BEEDE WASTE OIL/CASH ENERGY SUPERFUND SITE, PLAISTOW, NEW HAMPSHIRE

    Science.gov (United States)

    In 1998, Green Mountain Laboratories, Inc. (GML) and the USEPA agreed to carry out a Superfund Innovative Technology Evaluation (SITE) project to evaluate the effectiveness of GML's Bioremediation Process for the treatment of PCB contaminated soils at the Beede Waste Oil/Cash Ene...

  2. EPA Encourages the Public to Provide Input on Plan to Address Contaminated Groundwater at Curtis Specialty Papers Superfund Site in Milford and Alexandria Township, New Jersey, Public Meeting to Take Place May 28

    Science.gov (United States)

    (New York, N.Y.) The U.S. Environmental Protection Agency has proposed a plan to clean up contaminated groundwater at the Curtis Specialty Papers Superfund site in Milford and Alexandria Township, New Jersey. The site includes the 86-acre historic former M

  3. Developmental differences in sensory decision making involved in deciding to try a novel fruit.

    Science.gov (United States)

    Dovey, Terence M; Aldridge, Victoria K; Dignan, Wendy; Staples, Paul A; Gibson, E Leigh; Halford, Jason C G

    2012-05-01

    This research compared sensory processing and personality traits involved in deciding to try a novel fruit (guava) in adults and children. The research employed an age, sex, and food neophobia matched between-participant design to examine sensory decision making in choosing to eat a novel fruit. Forty-four adults (Study 1) and 68 children (Study 2) took part. In each study, participants were separated into two groups to investigate whether prior assessment of a familiar and liked fruit (apple) that shares similar visual characteristics to the target novel fruit (guava) increased the likelihood that an individual would decide to try it. All participants completed appetitive and familiarity ratings by sensory stages: vision, smell, and touch, prior to trying (tasting) the fruit. Participants (or their parents) also completed the general and food neophobia scales and adults also completed the sensation-seeking scale. Twenty-eight adults (64%) tried the guava and 16 did not (36%). In the second study, 22 children decided not to try the novel fruit (32%). Significant predictors of whether the adult tried the target fruit were Thrill and Adventure Seeking, Experience Seeking, General Neophobia, and 'appealing to touch'. In children, Food Neophobia, concurrent presentation of a familiar fruit alongside the target and visual assessment of the target predicted decision to try the novel fruit. This study suggests that touch is pertinent to adults' decision to try a novel fruit, whereas visual cues appear to be more important for children. ©2011 The British Psychological Society.

  4. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  5. [Effect of Tri-V-Plus preparation on experimental echinococcal pathology in rats].

    Science.gov (United States)

    Zanginian, A V; Kazarian, G S; Ovselian, L M

    2013-01-01

    The effects of Tri-V-Plus preparation in experimental rats with echinococcal pathology have been studied by monitoring the indices of free-radical oxidation of lipids, oxidative degradation of proteins, and variation of the content of nitric oxide during experimental echinococcosis and upon the introduction of Tri-V-Plus as a therapeutic agent.

  6. Trying Physics: Analyzing the Motion of the Quickest Score in International Rugby

    Science.gov (United States)

    Goff, John Eric; Lipscombe, Trevor Davis

    2015-01-01

    The hearts of sports fans were stirred recently by the fastest-ever try scored in international rugby. Welsh winger Dafydd Howells crossed the Fijian try line to score a mere six seconds after Angus O'Brien had started the game with a kickoff, in one of the fixtures in rugby's Junior World Cup played on June 2, 2014, in New Zealand. This…

  7. 21 CFR 178.3505 - Glyceryl tri-(12-acetoxy-stearate).

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) INDIRECT FOOD ADDITIVES: ADJUVANTS, PRODUCTION AIDS, AND SANITIZERS Certain Adjuvants and Production Aids § 178.3505 Glyceryl tri-(12-acetoxy-stearate). Glyceryl tri-(12-acetoxystearate) (CAS Reg. No. 139-43-5) may be safely used as a component of articles...

  8. Evaluation of tri-n-octylamine oxide as phenol extractant in a solvent impregnated resin

    NARCIS (Netherlands)

    Burghoff, B.; Cuypers, R.; Ettinger, van M.; Sudhölter, E.J.R.; Zuilhof, H.; Haan, de A.B.

    2009-01-01

    Tri-n-ocytlamine oxide (TOAO) is evaluated as alternative to the state-of-the-art phenol extractants tri-n-octylphosphine oxide (TOPO) and Cyanex 923. Liquid¿liquid equilibrium experiments show that TOAO in 1,3-dimethylnaphthalene achieves higher phenol distribution coefficients in an extractant con

  9. 77 FR 65545 - Tri-State Generation and Transmission Association, Inc. v. Western Electric Coordinating Council...

    Science.gov (United States)

    2012-10-29

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Tri-State Generation and Transmission Association, Inc. v. Western Electric... (2011), Tri-State Generation and Transmission Association, Inc. (Complainants) filed a complaint and...

  10. Evaluation of tri-n-octylamine oxide as phenol extractant in a solvent impregnated resin

    NARCIS (Netherlands)

    Burghoff, B.; Cuypers, R.; Ettinger, van M.; Sudhölter, E.J.R.; Zuilhof, H.; Haan, de A.B.

    2009-01-01

    Tri-n-ocytlamine oxide (TOAO) is evaluated as alternative to the state-of-the-art phenol extractants tri-n-octylphosphine oxide (TOPO) and Cyanex 923. Liquid¿liquid equilibrium experiments show that TOAO in 1,3-dimethylnaphthalene achieves higher phenol distribution coefficients in an extractant con

  11. Tri-Laboratory Linux Capacity Cluster 2007 SOW

    Energy Technology Data Exchange (ETDEWEB)

    Seager, M

    2007-03-22

    ). However, given the growing need for 'capability' systems as well, the budget demands are extreme and new, more cost effective ways of fielding these systems must be developed. This Tri-Laboratory Linux Capacity Cluster (TLCC) procurement represents the ASC first investment vehicle in these capacity systems. It also represents a new strategy for quickly building, fielding and integrating many Linux clusters of various sizes into classified and unclassified production service through a concept of Scalable Units (SU). The programmatic objective is to dramatically reduce the overall Total Cost of Ownership (TCO) of these 'capacity' systems relative to the best practices in Linux Cluster deployments today. This objective only makes sense in the context of these systems quickly becoming very robust and useful production clusters under the crushing load that will be inflicted on them by the ASC and SSP scientific simulation capacity workload.

  12. Cyclodiene insecticide, DDE, DDT, arsenic, and mercury contamination of big brown bats (Eptesicus fuscus) foraging at a Colorado Superfund site

    Science.gov (United States)

    O'Shea, T.J.; Everette, A.L.; Ellison, L.E.

    2001-01-01

    Rocky Mountain Arsenal (RMA) National Wildlife Area, near Denver, Colorado, is a Superfund site contaminated by past military and industrial uses, including pesticide manufacturing. From an ecosystem standpoint, the most critical contaminants at RMA are certain cyclodiene insecticides and metabolites, p,p???-DDE, p,p???-DDT, arsenic, and mercury. Bats are important ecosystem components that can be impacted by persistent contaminants because of their position in the food chain and their potential longevity and thus duration of exposure. Big brown bats (Eptesicus fuscus) were captured (n = 51) while foraging at RMA in the summers of 1997 and 1998 for determination of concentrations of contaminants of concern in carcasses, brains, and stomach contents. Adult females (n = 15) were also tracked by radiotelemetry to determine locations of nearest maternity roosts for sampling of guano for contaminant analysis and inspection for potential contaminant-induced mortality. Bats captured while foraging at RMA had measurable quantities of dieldrin and DDE in masticated insect samples from stomach contents and significantly higher concentrations of dieldrin, DDE, DDT, and mercury (juveniles) in carcasses than big brown bats (n = 26) sampled at a reference area 80 km to the north. Concentrations of dieldrin and DDE in brains of bats captured while foraging at RMA were also greater than in bats from the reference area, but not high enough to suggest mortality. Maximum concentrations of DDE, DDT, and cyclodienes in brains of big brown bats were found in adult males from RMA. Guano from the two closest known roosts had significantly higher concentrations of dieldrin, DDE, and mercury than guano from two roosts at the reference area. Dieldrin concentrations in carcasses of bats from RMA were highest in juveniles, followed by adult males and adult females. DDE concentrations in carcasses were lowest in adult females at both sites and highest in adult males at RMA. No contaminant

  13. Description of borehole geophysical and geologist logs, Berks Sand Pit Superfund Site, Longswamp Township, Berks County, Pennsylvania

    Science.gov (United States)

    Low, Dennis J.; Conger, Randall W.

    2003-01-01

    Between October 2002 and January 2003, geophysical logging was conducted in six boreholes at the Berks Sand Pit Superfund Site, Longswamp Township, Berks County, Pa., to determine (1) the waterproducing zones, water-receiving zones, zones of vertical borehole flow, orientation of fractures, and borehole and casing depth; and (2) the hydraulic interconnection between the six boreholes and the site extraction well. The boreholes range in depth from 61 to 270 feet. Geophysical logging included collection of caliper, natural-gamma, single-point-resistance, fluid-temperature, fluid-flow, and acoustic-televiewer logs. Caliper and acoustic-televiewer logs were used to locate fractures, joints, and weathered zones. Inflections on fluid-temperature and single-point-resistance logs indicated possible water-bearing fractures, and flowmeter measurements verified these locations. Single-point-resistance, natural-gamma, and geologist logs provided information on stratigraphy. Flowmeter measurements were conducted while the site extraction well was pumping and when it was inactive to determine the hydraulic connections between the extraction well and the boreholes. Borehole geophysical logging and heatpulse flowmetering indicate active flow in the boreholes. Two of the boreholes are in ground-water discharge areas, two boreholes are in ground-water recharge areas, and one borehole is in an intermediate regime. Flow was not determined in one borehole. Heatpulse flowmetering, in conjunction with the geologist logs, indicates highly weathered zones in the granitic gneiss can be permeable and effective transmitters of water, confirming the presence of a two-tiered ground-water-flow system. The effort to determine a hydraulic connection between the site extraction well and six logged boreholes was not conclusive. Three boreholes showed decreases in depth to water after pumping of the site extraction well; in two boreholes, the depth to water increased. One borehole was cased its

  14. Tri-allelic pattern at the TPOX locus: a familial study.

    Science.gov (United States)

    Picanço, Juliane Bentes; Raimann, Paulo Eduardo; Paskulin, Giorgio Adriano; Alvarez, Luís; Amorim, António; Batista Dos Santos, Sidney Emanuel; Alho, Clarice Sampaio

    2014-02-10

    Alleles at the TPOX STR locus have 6-14 different numbers of a four-nucleotide (AATG) repeat motif arranged in tandem. Although tri-allelic genotypes are generally rare, the TPOX tri-allelic pattern has a higher frequency, varying widely among populations. Despite this, there are few accurate reports to disclose the nature of the TPOX third allele. In this work we present data obtained from 45 individuals belonging to the same pedigree, in which there are cases of tri-allelic TPOX genotypes. The subjects were apparently healthy with a normal biological development. We noticed six tri-allelic cases in this family, and all of them were women. Karyotype analysis showed no occurrence of partial 2p trisomy. All the tri-allelic cases had the genotype 8-10-11, probably due to three copies of the TPOX STR sequence in all cells (Type 2 tri-allelic pattern). Based on previous data we assumed the allele 10 as the TPOX third allele. The pedigree analyses show evidences that the TPOX extra-allele was the allele10, it is placed far from the main TPOX locus, and that there is a potential linkage of the TPOX extra-allele-10 with Xq. This was the first study that included a large pedigree analysis in order to understand the nature TPOX tri-allelic pattern. © 2013.

  15. Bronchial Challenge With Tri a 14 as an Alternative Diagnostic Test for Baker's Asthma.

    Science.gov (United States)

    Armentia, A; Garrido-Arandia, M; Cubells-Baeza, N; Gómez-Casado, C; Díaz-Perales, A

    2015-01-01

    Baker's asthma (BA) is the most prevalent occupational respiratory disease in developed countries. It is caused by inhalation of wheat dust in the working environment and affects 1%-10% of workers in the baking industry. Diagnosis of BA is based on bronchial challenge with wheat, a technique that carries a high risk for patients. The wheat lipid transfer protein Tri a 14 is a major allergen in BA. The aim of our study was to characterize Tri a 14 as a marker of BA in order to prevent patients from having to undergo bronchial challenge with wheat. The study population comprised 55 patients selected at the Rio Hortega Hospital, Valladolid, Spain. Patients with BA were diagnosed using a skin prick test (SPT) with wheat and Tri a 14 and bronchial challenge test (BCT) with wheat. Patients with food allergy had a clear clinical history of allergy to peach confirmed by positive SPT to peach extract and Pru p 3. All patients in the BA group had a positive SPT result with wheat (100%), and most had positive results with Tri a 14 (95%). A positive BCT result with Tri a 14 was also observed in 22 of 27 of the patients with BA (82%). The response to Tri a 14 was specifically associated with BA. Tri a 14 is a good marker of BA and can be used in SPT and BCT as an alternative diagnostic method, thus avoiding bronchial challenge with wheat and reducing the risk associated with this technique.

  16. Real-Time and Delayed Analysis of Tree and Shrub Cores as Indicators of Subsurface Volatile Organic Compound Contamination, Durham Meadows Superfund Site, Durham, Connecticut, August 29, 2006

    Science.gov (United States)

    Vroblesky, Don A.; Willey, Richard E.; Clifford, Scott; Murphy, James J.

    2008-01-01

    This study examined volatile organic compound concentrations in cores from trees and shrubs for use as indicators of vadose-zone contamination or potential vapor intrusion by volatile organic compounds into buildings at the Durham Meadows Superfund Site, Durham, Connecticut. The study used both (1) real-time tree- and shrub-core analysis, which involved field heating the core samples for 5 to 10 minutes prior to field analysis, and (2) delayed analysis, which involved allowing the gases in the cores to equilibrate with the headspace gas in the sample vials unheated for 1 to 2 days prior to analysis. General correspondence was found between the two approaches, indicating that preheating and field analysis of vegetation cores is a viable approach to real-time monitoring of subsurface volatile organic compounds. In most cases, volatile organic compounds in cores from trees and shrubs at the Merriam Manufacturing Company property showed a general correspondence to the distribution of volatile organic compounds detected in a soil-gas survey, despite the fact that most of the soil-gas survey data in close proximity to the relevant trees were collected about 3 years prior to the tree-core collection. Most of the trees cored at the Durham Meadows Superfund Site, outside of the Merriam Manufacturing Company property, contained no volatile organic compounds and were in areas where indoor air sampling and soil-gas sampling showed little or no volatile organic compound concentrations. An exception was tree DM11, which contained barely detectable concentrations of trichloroethene near a house where previous investigations found low concentrations of trichloroethene (0.13 to 1.2 parts per billion by volume) in indoor air and 7.7 micrograms per liter of trichloroethene in the ground water. The barely detectable concentration of trichloroethene in tree DM11 and the lack of volatile organic compound detection in nearby tree DM10 (adjacent to the well having 7.7 micrograms of

  17. Selected Water- and Sediment-Quality, Aquatic Biology, and Mine-Waste Data from the Ely Copper Mine Superfund Site, Vershire, VT, 1998-2007

    Science.gov (United States)

    Argue, Denise M.; Kiah, Richard G.; Piatak, Nadine M.; Seal, Robert R., II; Hammarstrom, Jane M.; Hathaway, Edward; Coles, James F.

    2008-01-01

    The data contained in this report are a compilation of selected water- and sediment-quality, aquatic biology, and mine-waste data collected at the Ely Copper Mine Superfund site in Vershire, VT, from August 1998 through May 2007. The Ely Copper Mine Superfund site is in eastern, central Vermont (fig. 1) within the Vermont Copper Belt (Hammarstrom and others, 2001). The Ely Copper Mine site was placed on the U.S. Environmental Protection Agency (USEPA) National Priorities List in 2001. Previous investigations conducted at the site documented that the mine is contributing metals and highly acidic waters to local streams (Hammarstrom and others, 2001; Holmes and others, 2002; Piatak and others, 2003, 2004, and 2006). The U.S. Geological Survey (USGS), in cooperation with the USEPA, compiled selected data from previous investigations into uniform datasets that will be used to help characterize the extent of contamination at the mine. The data may be used to determine the magnitude of biological impacts from the contamination and in the development of remediation activities. This report contains analytical data for samples collected from 98 stream locations, 6 pond locations, 21 surface-water seeps, and 29 mine-waste locations. The 98 stream locations are within 3 streams and their tributaries. Ely Brook flows directly through the Ely Copper Mine then into Schoolhouse Brook (fig. 2), which joins the Ompompanoosuc River (fig. 1). The six pond locations are along Ely Brook Tributary 2 (fig. 2). The surface-water seeps and mine-waste locations are near the headwaters of Ely Brook (fig. 2 and fig. 3). The datasets 'Site_Directory' and 'Coordinates' contain specific information about each of the sample locations including stream name, number of meters from the mouth of stream, geographic coordinates, types of samples collected (matrix of sample), and the figure on which the sample location is depicted. Data have been collected at the Ely Copper Mine Superfund site by the

  18. Various notions of positivity for bi-linear maps and applications to tri-partite entanglement

    Energy Technology Data Exchange (ETDEWEB)

    Han, Kyung Hoon, E-mail: kyunghoon.han@gmail.com [Department of Mathematics, The University of Suwon, Gyeonggi-do 445-743 (Korea, Republic of); Kye, Seung-Hyeok, E-mail: kye@snu.ac.kr [Department of Mathematics and Institute of Mathematics, Seoul National University, Seoul 151-742 (Korea, Republic of)

    2016-01-15

    We consider bi-linear analogues of s-positivity for linear maps. The dual objects of these notions can be described in terms of Schmidt ranks for tri-tensor products and Schmidt numbers for tri-partite quantum states. These tri-partite versions of Schmidt numbers cover various kinds of bi-separability, and so we may interpret witnesses for those in terms of bi-linear maps. We give concrete examples of witnesses for various kinds of three qubit entanglement.

  19. Fast Bayesian Non-Negative Matrix Factorisation and Tri-Factorisation

    DEFF Research Database (Denmark)

    Brouwer, Thomas; Frellsen, Jes; Liò, Pietro

    We present a fast variational Bayesian algorithm for performing non-negative matrix factorisation and tri-factorisation. We show that our approach achieves faster convergence per iteration and timestep (wall-clock) than Gibbs sampling and non-probabilistic approaches, and do not require additional...... samples to estimate the posterior. We show that in particular for matrix tri-factorisation convergence is difficult, but our variational Bayesian approach offers a fast solution, allowing the tri-factorisation approach to be used more effectively....

  20. Semi-supervised adaptation in ssvep-based brain-computer interface using tri-training

    DEFF Research Database (Denmark)

    Bender, Thomas; Kjaer, Troels W.; Thomsen, Carsten E.

    2013-01-01

    This paper presents a novel and computationally simple tri-training based semi-supervised steady-state visual evoked potential (SSVEP)-based brain-computer interface (BCI). It is implemented with autocorrelation-based features and a Naïve-Bayes classifier (NBC). The system uses nine characters...... presented on a 100 Hz CRT-monitor, three scalp electrodes for signal acquisition, a gUSB-amp for preamplification and two PCs for data-processing and stimulus control respectively. Preliminary test results of the system on nine healthy subjects, with and without tri-training, indicates that the accuracy...... improves as a result of tri-training....

  1. The VA, VCD, Raman and ROA spectra of tri-L-serine in aqueous solution

    DEFF Research Database (Denmark)

    Jürgensen, Vibeke Würtz; Jalkanen, Karl J.

    2006-01-01

    The structures of one conformer of the nonionic neutral and zwitterionic species of L-serinyl L-serinyl L-serine (SSS or tri-L-serine), together with its cationic and anionic species and the capped N-acetyl tri-L-serine N'-methylamide analog were optimized with density functional theory...... the latest methods in experimental and theoretical vibrational spectroscopy are used to gain useful information about the coupling of the nuclear, electronic and magnetic degrees of freedom and structure of tri-L-serine and its capped peptide analog with the environment....

  2. Viability of the exact tri-bimaximal mixing at M_{GUT} in SO(10)

    CERN Document Server

    Joshipura, Anjan S

    2011-01-01

    General structures of the charged lepton and the neutrino mixing matrices leading to tri-bimaximal leptonic mixing are determined. These are then integrated into an SO(10) model within which detailed fits to fermion masses and mixing angles are given. It is shown that one can obtain excellent fits to all the fermion masses and quark mixing angles keeping tri-bimaximal leptonic mixing intact. Various perturbations to tri-bimaximal mixing which can arise in the model are considered and their impact on the predictions of the reactor mixing angle \\theta_{13} is numerically discussed.

  3. Treatability Study of In Situ Technologies for Remediation of Hexavalent Chromium in Groundwater at the Puchack Well Field Superfund Site, New Jersey

    Energy Technology Data Exchange (ETDEWEB)

    Vermeul, Vince R.; Szecsody, Jim E.; Truex, Michael J.; Burns, Carolyn A.; Girvin, Donald C.; Phillips, Jerry L.; Devary, Brooks J.; Fischer, Ashley E.; Li, Shu-Mei W.

    2006-11-13

    This treatability study was conducted by Pacific Northwest National Laboratory (PNNL), at the request of the U. S. Environmental Protection Agency (EPA) Region 2, to evaluate the feasibility of using in situ treatment technologies for chromate reduction and immobilization at the Puchack Well Field Superfund Site in Pennsauken Township, New Jersey. In addition to in situ reductive treatments, which included the evaluation of both abiotic and biotic reduction of Puchack aquifer sediments, natural attenuation mechanisms were evaluated (i.e., chromate adsorption and reduction). Chromate exhibited typical anionic adsorption behavior, with greater adsorption at lower pH, at lower chromate concentration, and at lower concentrations of other competing anions. In particular, sulfate (at 50 mg/L) suppressed chromate adsorption by up to 50%. Chromate adsorption was not influenced by inorganic colloids.

  4. Geophysical log analysis of selected test and residential wells at the Shenandoah Road National Superfund Site, East Fishkill, Dutchess County, New York

    Science.gov (United States)

    Reynolds, Richard J.; Anderson, J. Alton; Williams, John H.

    2015-01-01

    The U.S. Geological Survey collected and analyzed geophysical logs from 20 test wells and 23 residential wells at the Shenandoah Road National Superfund Site in East Fishkill, New York, from 2006 through 2010 as part of an Interagency Agreement to provide hydrogeologic technical support to the U.S. Environmental Protection Agency, Region 2. The geophysical logs collected include caliper, gamma, acoustic and optical televiewer, deviation, electromagnetic-induction, magnetic-susceptibility, fluid-property, and flow under ambient and pumped conditions. The geophysical logs were analyzed along with single-well aquifer test data and drilling logs to characterize the lithology, fabric, fractures, and flow zones penetrated by the wells. The results of the geophysical log analysis were used as part of the hydrogeologic characterization of the site and in the design of discrete-zone monitoring installations in the test wells and selected residential wells.

  5. TRI Community Engagement: Four New EPA Pilot Projects Challenge Us to Communicate More Effectively with Communities

    Science.gov (United States)

    Overview of pilot projects conducted to test new approaches for raising awareness about TRI at the community level, including discussion of the results, lessons learned, and responses from communities

  6. Try Drug-Free Options First for Low Back Pain, New Guidelines Say

    Science.gov (United States)

    ... In general, the ACP said, people with low back pain should first try nondrug options. For pain that has lasted fewer than 12 weeks, research suggests heat wraps, massage, acupuncture and spinal manipulation may ease pain and restore ...

  7. Fabrication of Tri-axially Oriented RE-Ba-Cu-O Ceramics by Magnetic Alignment

    Science.gov (United States)

    Yamaki, M.; Furuta, M.; Doi, T.; Shimoyama, J.; Horii, S.

    Magnetic alignment is a new crystal alignment process which enables tri-axial orientation without epitaxial growth at room temperature. In order to investigate the effectiveness of this magnetic tri-axial alignment process, we attempted to fabricate tri-axially oriented ErBa2Cu4O8 (Er124) ceramics by a slip-casting technique under two different modulated rotation magnetic fields (MRFs); uni-directional rotation type and oscillation type. For improvement of the degrees of tri-axial orientation in the Er124 green compacts slip-casted under MRFs, appropriate choice of sample-rotation method, magnetic field condition, control of mean diameter of source powders, and viscosity of slurry was found to be important in the case of MRFs induced by the sample-rotation. At the current stage, the degree of inplane orientation with ∼10̊ in Er124 was achieved.

  8. First-Try Antibiotics Now Fail in 1 in 4 Adult Pneumonia Cases

    Science.gov (United States)

    ... medlineplus.gov/news/fullstory_165801.html First-Try Antibiotics Now Fail in 1 in 4 Adult Pneumonia ... 2017 (HealthDay News) -- The first prescription of an antibiotic that the average U.S. adult with pneumonia receives ...

  9. Tri-generation goes nano scale: solar trigeneration system for green buildings

    Energy Technology Data Exchange (ETDEWEB)

    Kilkis, Birol I. [Baskent University, Energy Engineering Graduate Program Head (Turkey)], email: bkilkis@baskent.edu.tr

    2011-07-01

    Significant amounts of energy are consumed by the building sector and sustainable solutions need to be implemented. A new approach, the solar tri-generation system, with photovoltaic system and thermo-electric modules, has been developed to provide buildings with electricity, solar heating and cooling, and hot water. This paper presents the application of this system to increase the utilization rate of solar energy with simple solar daylight tubes. The example of the ESER green office building, which uses the solar tri-generation system and is a net zero exergy building, is presented herein. It was shown that solar tri-generation is an advantageous solution but that its performance depends on local meteorological conditions. This paper demonstrated that the utilization of solar tri-generation, if optimized in line with local conditions and design constraints, is a good solution for developing sustainable buildings.

  10. R2 TRI facilities with 1999-2011 risk related estimates throughout the census blockgroup

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset delineates the distribution of estimate risk from the TRI facilities for 1999 - 2011 throughout the census blockgroup of the region using Office of...

  11. Willingness to try new foods as predicted by social representations and attitude and trait scales.

    Science.gov (United States)

    Bäckström, A; Pirttilä-Backman, A-M; Tuorila, H

    2004-08-01

    The structure and predictive ability of social representation of new foods were investigated and compared with instruments measuring relevant attitudes and traits using a questionnaire quantifying these aspects, completed by 743 respondents. Based on their rated willingness to try, new foods were categorized as modified dairy products, genetically modified (GM), organic, and ethnic products (two examples, snails and passion fruit, were treated separately). The social representation (SR) consisted of five dimensions: suspicion of novelties, adherence to technology, adherence to natural food, eating as an enjoyment, and eating as a necessity. The SR dimensions were strong predictors of willingness to try GM foods (predicted by adherence to technology) and organic foods (predicted by adherence to natural foods). Low food neophobia predicted the rated willingness to try snails and passion fruit. Thus, different constructs predicted willingness to try different categories of new foods, and as a whole, SR dimensions markedly improved the prediction.

  12. Synthesis of Tri(indolyl)methanes Mediated by Acidic Ionic Liquid

    Institute of Scientific and Technical Information of China (English)

    GU Da-Gong; JI Shun-Jun

    2008-01-01

    Various tri(indolyl)methanes were synthesized by condensation of indole and its derivatives with indole-3-carboxaldehyde using acidic ionic liquids [hmim]HSO4/EtOH as an efficient and green catalyst system.

  13. TRI as a Tool to Measure Green Chemistry Progress: A Pharmaceutical Case Study

    Science.gov (United States)

    Presentation of research using TRI data to investigate whether the pharmaceutical industry's implementation of green chemistry practices in manufacturing processes have significantly reduced the quantities of toxic chemicals it uses and releases.

  14. Analysis and Design of Tri-Gate MOSFET with High Dielectrics Gate

    Directory of Open Access Journals (Sweden)

    Viranjay M. Srivastava

    2012-05-01

    Full Text Available The scaling of simple gate transistors requires the scaling and transistor elements like source/drain junction became difficult to scale further after a limit due to adverse effect of electrostatic and short-channel performance. The solution of the problem is tri-gate where we can increase the performance without increasing the width and without scaling. In this paper we have described the parameter of tri-gate and taking the high dielectric as substrate.

  15. Structural and functional characterization of TRI3 trichothecene 15-O-acetyltransferase from Fusarium sporotrichioides

    Energy Technology Data Exchange (ETDEWEB)

    Garvey, Graeme S.; McCormick, Susan P.; Alexander, Nancy J.; Rayment, Ivan; (US-Agriculture); (UW)

    2009-08-14

    Fusarium head blight is a devastating disease of cereal crops whose worldwide incidence is increasing and at present there is no satisfactory way of combating this pathogen or its associated toxins. There is a wide variety of trichothecene mycotoxins and they all contain a 12,13-epoxytrichothecene skeleton but differ in their substitutions. Indeed, there is considerable variation in the toxin profile across the numerous Fusarium species that has been ascribed to differences in the presence or absence of biosynthetic enzymes and their relative activity. This article addresses the source of differences in acetylation at the C15 position of the trichothecene molecule. Here, we present the in vitro structural and biochemical characterization of TRI3, a 15-O-trichothecene acetyltransferase isolated from F. sporotrichioides and the 'in vivo' characterization of Deltatri3 mutants of deoxynivalenol (DON) producing F. graminearum strains. A kinetic analysis shows that TRI3 is an efficient enzyme with the native substrate, 15-decalonectrin, but is inactive with either DON or nivalenol. The structure of TRI3 complexed with 15-decalonectrin provides an explanation for this specificity and shows that Tri3 and Tri101 (3-O-trichothecene acetyltransferase) are evolutionarily related. The active site residues are conserved across all sequences for TRI3 orthologs, suggesting that differences in acetylation at C15 are not due to differences in Tri3. The tri3 deletion mutant shows that acetylation at C15 is required for DON biosynthesis even though DON lacks a C15 acetyl group. The enzyme(s) responsible for deacetylation at the 15 position of the trichothecene mycotoxins have not been identified.

  16. Direct observation of heavy metal-mineral association from the Clark Fork River Superfund Complex: Implications for metal transport and bioavailability

    Science.gov (United States)

    Hochella, M.F.; Moore, J.N.; Putnis, C.V.; Putnis, A.; Kasama, T.; Eberl, D.D.

    2005-01-01

    Two sets of samples from riverbeds and adjacent floodplains, separated by 80 river kilometers, were collected from the Clark Fork River Superfund Complex, Montana, (the largest Superfund site in the United States), and studied primarily with transmission electron microscopy (TEM) with several supporting techniques to determine heavy metal-mineral association. Seven of the eight samples studied were strongly influenced by material that once resided in mining and smelting dumps and impoundments; this material was transported downstream sometime during the last century and a half from the Butte/Anaconda areas. The eighth sample was from a deeper floodplain level and dates to premining days. The TEM observations afford a direct look, down to the nanometer level, at secondary mineral formation as a result of the breakdown of sulfides and silicates in the acid environment of this massive mine-drainage system. In the shallow, oxic floodplain sediments, heavy metals of concern in this system (As, Cu, Pb, and Zn) are taken up by the formation of sulfates (particularly Pb in jarosite), as well as hydrous metal oxides (As, Cu, Pb, and Zn in and on ferrihydrite, and a possibly new vernadite-like mineral). The oxides are long-lived in these systems, as they were also found in the anoxic riverbeds. Metals are also taken up by the formation of sulfides in sulfate-reducing environments as observed in the formation of nanoclusters of chalcopyrite and sphalerite. In all samples, clays make up between 5 and 20% of the sediment and carry significant amounts of Cu and Zn. The hydrous oxides, secondary sulfides, and clays provide several routes for metal transport downstream over long distances. Besides the potential bioavailability of heavy metals exchanged on and off the hydrous metal oxides and clays, nanometer-sized sulfides may also be highly reactive in the presence of biologic systems. Copyright ?? 2005 Elsevier Ltd.

  17. Post-Remediation Biomonitoring of Pesticides and Other Contaminants in Marine Waters and Sediment Near the United Heckathorn Superfund Site, Richmond, California

    Energy Technology Data Exchange (ETDEWEB)

    LD Antrim; NP Kohn

    2000-09-06

    This report, PNNL-1 3059 Rev. 1, was published in July 2000 and replaces PNNL-1 3059 which is dated October 1999. The revision corrects tissue concentration units that were reported as dry weight but were actually wet weight, and updates conclusions based on the correct reporting units. Marine sediment remediation at the United Heckathorn Superfund Site was completed in April 1997. Water and mussel tissues were sampled in February 1999 from four stations near Lauritzen Canal in Richmond, California, for Year 2 of post-remediation monitoring of marine areas near the United Heckathom Site. Dieldrin and dichlorodiphenyl trichloroethane (DDT) were analyzed in water samples, tissue samples from resident mussels, and tissue samples from transplanted mussels deployed for 4 months. Concentrations of dieldrin and total DDT in water and total DDT in tissue were compared with Year 1 of post-remediation monitoring, and with preremediation data from the California State Mussel Watch program (tissue s) and the Ecological Risk Assessment for the United Heckathorn Superfund Site (tissues and water). Mussel tissues were also analyzed for polychlorinated biphenyls (PCB), which were detected in sediment samples. Chlorinated pesticide concentrations in water samples were similar to preremediation levels and did not meet remediation goals. Mean dieldrin concentrations in water ranged from 0.62 ng/L to 12.5 ng/L and were higher than the remediation goal (0.14 ng/L) at all stations. Mean total DDT concentrations in water ranged from 14.4 ng/L to 62.3 ng/L and exceeded the remediation goal (0.59 ng/L) at all stations. The highest concentrations of both DDT and dieldrin were found at the Lauritzen Canal/End station. Despite exceedence of the remediation goals, chlorinated pesticide concentrations in Lauritzen Canal water samples were notably lower in 1999 than in 1998. PCBS were not detected in water samples in 1999.

  18. ANALISIS KONSEP TRI HITA KARANA PADA DAYA TARIK WARISAN BUDAYA: STUDI KASUS PURI AGUNG KARANGASEM, BALI

    Directory of Open Access Journals (Sweden)

    Kadek Wiweka

    2014-09-01

    Full Text Available This article discusses how local wisdom, namely                      Tri Hita Karana (three cause of harmony and prosperity, can support sustainable tourism, such as in cultural tourism attraction of Puri Agung Karangasem, Bali. This Puri (palace has a great potency to become a cultural tourism product an can be developed with considerable community involvement. The Puri has selected Tri Hita Karana concept as the basis of tourist attraction’s management by giving specific attention to the three elements of Tri Hita Karana including parahyangan (spiritual/culture, pawongan (community, and palemahan (environment. Data for this study was collected through interview method to find description of the implementation of the concept of Tri Hita Karana in managing Puri Agung Karangasem as tourist attraction. Hereinafter, informants involved are the Puri’s management, local community and experts associated with Tri Hita Karana or sustainable tourism. These data were combined with secondary data such as reports or literature related with the object of research and presented in the form of description. This study concludes that the implementation of Tri Hita Karana in Puri Agung Karangasem have positive impact on all aspects involved in tourism activities, such as community, local culture and environment. These aspects are also considered as an important factor and attraction for both domestic and international tourists.

  19. THE INFLUENCE OF JOB STRESS AND COMPENSATION TO JOB SATISFACTION AT PT. TRI MEGAH MAKMUR

    Directory of Open Access Journals (Sweden)

    I Ketut R Sudiarditha

    2016-09-01

    Full Text Available The purpose of this research are: 1 To know description and how picture level job stress, compensation and job satisfaction at PT Tri Megah Makmur. 2 To know the influence of job stress tojob satisfaction at PT Tri Megah Makmur. 3 To know the influence of compensation to job satisfaction at PT Tri Megah Makmur. 4 To know empirically the influence of job stress and compensation tojob satisfaction at PT Tri Megah Makmur. 5 To know how far the contribution of job stress and compensation to job satisfaction at PT Tri Megah Makmur. This research is using descriptive and explanatory survey analysis. This research is taken to 70 sales employees at PT Tri Megah Makmur, While the data collection technique was carried out by spreading kuisioner, which are then processed using SPSS versi 21.00.The analysis shows that: 1 level of compensation and job satisfaction are on a lower level, while the job stress are high. 2Job stress have negative effects and significantly on job satisfaction. 3 compensation have positive effect and significantly on job satisfaction. 4 job stress and compensation significantly influence on job satisfaction.

  20. Tri-s-triazine-Based Crystalline Carbon Nitride Nanosheets for an Improved Hydrogen Evolution.

    Science.gov (United States)

    Ou, Honghui; Lin, Lihua; Zheng, Yun; Yang, Pengju; Fang, Yuanxing; Wang, Xinchen

    2017-06-01

    Tri-s-triazine-based crystalline carbon nitride nanosheets (CCNNSs) have been successfully extracted via a conventional and cost-effective sonication-centrifugation process. These CCNNSs possess a highly defined and unambiguous structure with minimal thickness, large aspect ratios, homogeneous tri-s-triazine-based units, and high crystallinity. These tri-s-triazine-based CCNNSs show significantly enhanced photocatalytic hydrogen generation activity under visible light than g-C3 N4 , poly (triazine imide)/Li(+) Cl(-) , and bulk tri-s-triazine-based crystalline carbon nitrides. A highly apparent quantum efficiency of 8.57% at 420 nm for hydrogen production from aqueous methanol feedstock can be achieved from tri-s-triazine-based CCNNSs, exceeding most of the reported carbon nitride nanosheets. Benefiting from the inherent structure of 2D crystals, the ultrathin tri-s-triazine-based CCNNSs provide a broad range of application prospects in the fields of bioimaging, and energy storage and conversion. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Tri-Squared Mean Cross Comparative Analysis: An Advanced Post Hoc Qualitative and Quantitative Metric for a More In-Depth Examination of the Initial Research Outcomes of the Tri-Square Test

    Science.gov (United States)

    Osler, James Edward

    2013-01-01

    This monograph provides an epistemological rational for the design of an advanced novel analysis metric. The metric is designed to analyze the outcomes of the Tri-Squared Test. This methodology is referred to as: "Tri-Squared Mean Cross Comparative Analysis" (given the acronym TSMCCA). Tri-Squared Mean Cross Comparative Analysis involves…

  2. Surface-Water Hydrology and Quality at the Pike Hill Superfund Site, Corinth, Vermont, October 2004 to December 2005

    Science.gov (United States)

    Kiah, Richard G.; Deacon, Jeffrey R.; Piatak, Nadine M.; Seal, Robert R.; Coles, James F.; Hammarstrom, Jane M.

    2007-01-01

    The hydrology and quality of surface water in and around the Pike Hill Brook watershed, in Corinth, Vermont, was studied from October 2004 to December 2005 by the U.S. Geological Survey in cooperation with the U.S. Environmental Protection Agency (USEPA). Pike Hill was mined intermittently for copper from 1847 to 1919 and the site is known to be contributing trace elements and acidity to Pike Hill Brook and an unnamed tributary to Cookville Brook. The site has been listed as a Superfund site since 2004. Streamflow, specific conductance, pH, and water temperature were measured continuously and monthly at three sites on Pike Hill Brook to determine the variation in these parameters over an annual cycle. Synoptic water-quality sampling was done at 10 stream sites in October 2004, April 2005, and June 2005 and at 13 stream sites in August 2005 to characterize the quality of surface water in the watershed on a seasonal and spatial basis, as well as to assess the effects of wetlands on water quality. Samples for analysis of benthic macroinvertebrate populations were collected at 11 stream sites in August 2005. Water samples were analyzed for 5 major ions and 32 trace elements. Concentrations of trace elements at sites in the Pike Hill Brook watershed exceeded USEPA National Recommended Water Quality Criteria acute and chronic toxicity standards for aluminum, iron, cadmium, copper, and zinc. Concentrations of copper exceeded the chronic criteria in an unnamed tributary to Cookville Brook in one sample. Concentrations of sulfate, calcium, aluminum, iron, cadmium, copper, and zinc decreased with distance from a site directly downstream from the mine (site 1), as a result of dilution and through sorption and precipitation of the trace elements. Maximum concentrations of aluminum, iron, cadmium, copper, and zinc were observed during spring snowmelt. Concentrations of sulfate, calcium, cadmium, copper, and zinc, and instantaneous loads of calcium and aluminum were

  3. Arsenic species in weathering mine tailings and biogenic solids at the Lava Cap Mine Superfund Site, Nevada City, CA

    Directory of Open Access Journals (Sweden)

    Ashley Roger P

    2011-01-01

    Full Text Available Abstract Background A realistic estimation of the health risk of human exposure to solid-phase arsenic (As derived from historic mining operations is a major challenge to redevelopment of California's famed "Mother Lode" region. Arsenic, a known carcinogen, occurs in multiple solid forms that vary in bioaccessibility. X-ray absorption fine-structure spectroscopy (XAFS was used to identify and quantify the forms of As in mine wastes and biogenic solids at the Lava Cap Mine Superfund (LCMS site, a historic "Mother Lode" gold mine. Principal component analysis (PCA was used to assess variance within water chemistry, solids chemistry, and XAFS spectral datasets. Linear combination, least-squares fits constrained in part by PCA results were then used to quantify arsenic speciation in XAFS spectra of tailings and biogenic solids. Results The highest dissolved arsenic concentrations were found in Lost Lake porewater and in a groundwater-fed pond in the tailings deposition area. Iron, dissolved oxygen, alkalinity, specific conductivity, and As were the major variables in the water chemistry PCA. Arsenic was, on average, 14 times more concentrated in biologically-produced iron (hydroxide than in mine tailings. Phosphorous, manganese, calcium, aluminum, and As were the major variables in the solids chemistry PCA. Linear combination fits to XAFS spectra indicate that arsenopyrite (FeAsS, the dominant form of As in ore material, remains abundant (average: 65% in minimally-weathered ore samples and water-saturated tailings at the bottom of Lost Lake. However, tailings that underwent drying and wetting cycles contain an average of only 30% arsenopyrite. The predominant products of arsenopyrite weathering were identified by XAFS to be As-bearing Fe (hydroxide and arseniosiderite (Ca2Fe(AsO43O3•3H2O. Existence of the former species is not in question, but the presence of the latter species was not confirmed by additional measurements, so its identification is

  4. Surface-Water Hydrology and Quality at the Pike Hill Superfund Site, Corinth, Vermont, October 2004 to December 2005

    Science.gov (United States)

    Kiah, Richard G.; Deacon, Jeffrey R.; Piatak, Nadine M.; Seal, Robert R., II; Coles, James F.; Hammarstrom, Jane M.

    2007-01-01

    The hydrology and quality of surface water in and around the Pike Hill Brook watershed, in Corinth, Vermont, was studied from October 2004 to December 2005 by the U.S. Geological Survey in cooperation with the U.S. Environmental Protection Agency (USEPA). Pike Hill was mined intermittently for copper from 1847 to 1919 and the site is known to be contributing trace elements and acidity to Pike Hill Brook and an unnamed tributary to Cookville Brook. The site has been listed as a Superfund site since 2004. Streamflow, specific conductance, pH, and water temperature were measured continuously and monthly at three sites on Pike Hill Brook to determine the variation in these parameters over an annual cycle. Synoptic water-quality sampling was done at 10 stream sites in October 2004, April 2005, and June 2005 and at 13 stream sites in August 2005 to characterize the quality of surface water in the watershed on a seasonal and spatial basis, as well as to assess the effects of wetlands on water quality. Samples for analysis of benthic macroinvertebrate populations were collected at 11 stream sites in August 2005. Water samples were analyzed for 5 major ions and 32 trace elements. Concentrations of trace elements at sites in the Pike Hill Brook watershed exceeded USEPA National Recommended Water Quality Criteria acute and chronic toxicity standards for aluminum, iron, cadmium, copper, and zinc. Concentrations of copper exceeded the chronic criteria in an unnamed tributary to Cookville Brook in one sample. Concentrations of sulfate, calcium, aluminum, iron, cadmium, copper, and zinc decreased with distance from a site directly downstream from the mine (site 1), as a result of dilution and through sorption and precipitation of the trace elements. Maximum concentrations of aluminum, iron, cadmium, copper, and zinc were observed during spring snowmelt. Concentrations of sulfate, calcium, cadmium, copper, and zinc, and instantaneous loads of calcium and aluminum were

  5. Superfund Programmatic Information

    Data.gov (United States)

    U.S. Environmental Protection Agency — This asset includes an inventory of program policy and guidance documents that are used by the EPA regions, states, tribes and private parties to implement the...

  6. Tri-Gas Pressurization System Testing and Modeling for Cryogenic Applications

    Science.gov (United States)

    Taylor, B.; Polsgrove, R.; Stephens, J.; Hedayat, A.

    2014-01-01

    The use of Tri-gas in rocket propulsion systems is somewhat of a new technology. This paper defines Tri-gas as a mixture of gases composed largely of helium with a small percentage of a stoichiometric mixture of hydrogen and oxygen. When exposed to a catalyst the hydrogen and oxygen in the mixture combusts, significantly raising the temperature of the mixture. The increase in enthalpy resulting from the combustion process significantly decreases the required quantity of gas needed to pressurize the ullage of the vehicle propellant tanks. The objective of this effort was to better understand the operating characteristics of Tri-gas in a pressurization system with low temperature applications. In conjunction with ongoing programs at NASA Marshall Space Flight Center, an effort has been undertaken to evaluate the operating characteristics of Tri-gas through modeling and bench testing. Through improved understanding of the operating characteristics, the risk of using this new technology in a launch vehicle propulsion system was reduced. Bench testing of Tri-gas was a multistep process that targeted gas characteristics and performance aspects that pose a risk to application in a pressurization system. Pressurization systems are vital to propulsion system performance. Keeping a target ullage pressure in propulsions tanks is necessary to supply propellant at the conditions and flow rates required to maintain desired engine functionality. The first component of testing consisted of sampling Tri-gas sources that had been stagnant for various lengths of time in order to determine the rate at which stratification takes place. Second, a bench test was set up in which Tri-gas was sent through a catalyst bed. This test was designed to evaluate the performance characteristics of Tri-gas, under low temperature inlet temperatures, in a flight-like catalyst bed reactor. The third, most complex, test examined the performance characteristics of Tri-gas at low temperature temperatures

  7. 75 FR 65705 - Notice of Intent To Rule on Request To Release Airport Property at the Tri-Cities Regional...

    Science.gov (United States)

    2010-10-26

    ... Federal Aviation Administration Notice of Intent To Rule on Request To Release Airport Property at the Tri... the release of land at the Tri-Cities Regional Airport in the city of Blountville, Tennessee. This... 26, 2010. ADDRESSES: Documents are available for review at the Tri-Cities Regional Airport, 2525...

  8. Dye-sensitized solar cells with a tri-layer ZnO photo-electrode

    Energy Technology Data Exchange (ETDEWEB)

    Li, Hui; Bai, Jiafan; Feng, Bo; Lu, Xiong; Weng, Jie; Jiang, Chongxi; Wang, Jianxin, E-mail: j.wang63@gmail.com

    2013-11-25

    Graphical abstract: Schematic diagram for the energy-level, the paths of charge transfer, the model of light scattering in the top layer and the assembly of the DSSC. Highlights: •We successfully fabricated ZnO photo-anodes with a tri-layer ZnO structure. •The ZnO seed layer decreased the transfer resistance at the ZnO/FTO interface. •The ZnO light scattering layer could increase the number of photoelectrons. •J{sub sc} and V{sub oc} were greatly enhanced via the use of the tri-layer ZnO structure. •The efficiency of the DSSCs for a tri-layer ZnO structure was the highest. -- Abstract: In this paper, a tri-layer ZnO structure was designed to fabricate the photo-anodes of dye-sensitized solar cells (DSSC). The results showed that an overall energy-conversion efficiency of 1.18% was achieved for DSSC with the tri-layer photo-anode, which was 14% higher than that obtained from a bilayer ZnO photo-anode (with an efficiency of 1.04%) and 76% higher than that fabricated with a single layer photo-anode (with an efficiency of 0.67%). The photo-current density and the open circuit voltage have greatly increased via the use of the tri-layer ZnO structure. Thus, the tri-layer ZnO structure might provide a new route for the improvement of the overall energy-conversion efficiency for the DSSC of ZnO.

  9. TRY-5 is a sperm-activating protease in Caenorhabditis elegans seminal fluid.

    Directory of Open Access Journals (Sweden)

    Joseph R Smith

    2011-11-01

    Full Text Available Seminal fluid proteins have been shown to play important roles in male reproductive success, but the mechanisms for this regulation remain largely unknown. In Caenorhabditis elegans, sperm differentiate from immature spermatids into mature, motile spermatozoa during a process termed sperm activation. For C. elegans males, sperm activation occurs during insemination of the hermaphrodite and is thought to be mediated by seminal fluid, but the molecular nature of this activity has not been previously identified. Here we show that TRY-5 is a seminal fluid protease that is required in C. elegans for male-mediated sperm activation. We observed that TRY-5::GFP is expressed in the male somatic gonad and is transferred along with sperm to hermaphrodites during mating. In the absence of TRY-5, male seminal fluid loses its potency to transactivate hermaphrodite sperm. However, TRY-5 is not required for either hermaphrodite or male fertility, suggesting that hermaphrodite sperm are normally activated by a distinct hermaphrodite-specific activator to which male sperm are also competent to respond. Within males, TRY-5::GFP localization within the seminal vesicle is antagonized by the protease inhibitor SWM-1. Together, these data suggest that TRY-5 functions as an extracellular activator of C. elegans sperm. The presence of TRY-5 within the seminal fluid couples the timing of sperm activation to that of transfer of sperm into the hermaphrodite uterus, where motility must be rapidly acquired. Our results provide insight into how C. elegans has adopted sex-specific regulation of sperm motility to accommodate its male-hermaphrodite mode of reproduction.

  10. Evaluation of the Performance of Tri-Flo Separators in Tabas (Parvadeh Coal Washing Plant

    Directory of Open Access Journals (Sweden)

    Reza Dehghan

    2014-01-01

    Full Text Available Parvadeh Coal Preparation Plant (CPP was installed in 2008 for the production of the 750000 TPY of clean coal containing 10.5% ash from the raw feed having 44% ash and mainly coming from the long-wall mine. Three units of high capacity centrifugal separators (Tri-Flo are used for the preparation of the coal in the size ranges of -50+6 mm and -6+0.5 mm. Tri-Flo separators are operating in double stages, so they can produce three products. The nominal feed capacities of the 700 mm Tri-Flo and each unit of 500 mm Tri-Floes are 120 and 70 TPH respectively. However, due to some of the operating difficulties in the coal mine, the current feed capacities to the separators are changed to 160 and 30 TPH accordingly. In this research, sink-float experiments on the representative samples of the Tri-Flo separators were used for the evaluation and optimization of their performance. The experiments were performed in six different densities. On the basis of the experimental results, the operating Ep (Ecart Probable value of the 700 mm Tri-Flowas 0.075 which was more than the design figure (0.035. Such a difference was mainly attributed to the changes in the feed characteristics. In the small Tri-Flo separator, Ep values were measured as 0.062 and 0.087 for the size ranges of (-1+0.5 mm and (-6+1 mm respectively and were in good agreement with the design criteria. The optimization of the heavy media separation circuit of the plant is underway using the results presented here.

  11. Dual-/tri-apodization techniques for high frequency ultrasound imaging: a simulation study.

    Science.gov (United States)

    Sung, Jin Ho; Jeong, Jong Seob

    2014-10-11

    In the ultrasound B-mode (Brightness-mode) imaging, high side-lobe level reduces contrast to noise ratio (CNR). A linear apodization scheme by using the window function can suppress the side-lobe level while the main-lobe width is increased resulting in degraded lateral resolution. In order to reduce the side-lobe level without sacrificing the main-lobe width, a non-linear apodization method has been suggested. In this paper, we computationally evaluated the performance of the non-linear apodization method such as dual-/tri-apodization focusing on the high frequency ultrasound image. The rectangular, Dolph-Chebyshev, and Kaiser window functions were employed to implement dual-/tri-apodization algorithms. The point and cyst target simulations were conducted by using a dedicated ultrasound simulation tool called Field-II. The center frequency of the simulated linear array transducer was 40 MHz and the total number of elements was 128. The performance of dual-/tri-apodization was compared with that of the rectangular window function focusing on the side-lobe level and the main-lobe widths (at -6 dB and -35 dB). In the point target simulation, the main-lobe widths of the dual-/tri-apodization were very similar to that of the rectangular window, and the side-lobe levels of the dual-/tri-apodization were more suppressed by 9~10 dB. In the cyst target simulation, CNR values of the dual-/tri-apodization were improved by 41% and 51%, respectively. The performance of the non-linear apodization was numerically investigated. In comparison with the rectangular window function, the non-linear apodization method such as dual- and tri-apodization had low side-lobe level without sacrificing the main-lobe width. Thus, it can be a potential way to increase CNR maintaining the main-lobe width in the high frequency ultrasound imaging.

  12. Third phase formation in the extraction of Th(NO{sub 3}){sub 4} by Tri-sec-butyl phosphate. A comparison with Tri-n-butyl phosphate

    Energy Technology Data Exchange (ETDEWEB)

    Chandrasekar, Aditi; Suresh, A.; Sivaraman, N. [Indira Gandhi Centre for Atomic Research, Kalpakkam (India). Chemistry Group

    2017-06-01

    Earlier studies carried out in our laboratory indicated that Tri-sec-butyl phosphate (TsBP) is a potential extractant for U/Th separation. Also, the third phase formation tendency of TsBP is lower compared to its isomers, Tri-n-butyl-phosphate (TBP) and Tri-iso-butyl phosphate (TiBP). In this context, the extraction and third phase formation behaviour of 1.1 M solutions of TiBP and TsBP in n-dodecane in the extraction of Th(IV) from 1 M HNO{sub 3} at 303 K over a wide range of Th concentrations were investigated in the present study and the results are compared with the literature data on TBP system. Concentrations of Th(IV) and HNO{sub 3} loaded in the organic phase before third phase formation (biphasic region) as well as in third phase and diluent-rich phase after third phase formation (triphasic region) were measured as a function of equilibrium aqueous phase Th(IV) concentration. The density of loaded organic phase was also measured at various Th(IV) concentrations. The extraction profiles in the biphasic region indicated that extraction of Th(IV) by TBP is higher than that of TiBP which in turn is higher than that of TsBP. Extractant concentration in the diluent-rich phase and third phase was measured for the triphasic region.

  13. TriAnd and its siblings: satellites of satellites in the Milky Way halo

    Science.gov (United States)

    Deason, A. J.; Belokurov, V.; Hamren, K. M.; Koposov, S. E.; Gilbert, K. M.; Beaton, R. L.; Dorman, C. E.; Guhathakurta, P.; Majewski, S. R.; Cunningham, E. C.

    2014-11-01

    We explore the Triangulum-Andromeda (TriAnd) overdensity in the SPLASH (Spectroscopic and Photometric Landscape of Andromeda's Stellar Halo) and SEGUE (the Sloan Extension for Galactic Understanding and Exploration) spectroscopic surveys. Milky Way main-sequence turn-off stars in the SPLASH survey reveal that the TriAnd overdensity and the recently discovered Pan-Andromeda Archaeological Survey (PAndAS) stream share a common heliocentric distance (D ˜ 20 kpc), position on the sky, and line-of-sight velocity (VGSR ˜ 50 km s-1). Similarly, A-type, giant, and main-sequence turn-off stars selected from the SEGUE survey in the vicinity of the Segue 2 satellite show that TriAnd is prevalent in these fields, with a velocity and distance similar to Segue 2. The coincidence of the PAndAS stream and Segue 2 satellite in positional and velocity space to TriAnd suggests that these substructures are all associated, and may be a fossil record of group-infall on to the Milky Way halo. In this scenario, the Segue 2 satellite and PAndAS stream are `satellites of satellites', and the large, metal-rich TriAnd overdensity is the remains of the group central.

  14. Shade evaluation of ceramic laminates according to different try-in materials.

    Science.gov (United States)

    Lopes, Lawrence Gonzaga; Vaz, Maysa Magalhaes; de Magalhaes, Ana Paula Rodrigues; Cardoso, Paula Carvalho; de Souza, Joao Batista; de Torres, Erica Miranda

    2014-01-01

    The porcelain laminate replaces the visible portion of enamel with a ceramic, which is attached to the dental surface. To enhance cosmetic results, a preliminary color matching procedure is performed prior to cementing the veneers. This procedure can be performed using water, water-soluble gel, or try-in paste. The different shades of cement and try-in pastes are intended to obtain better color and esthetics of the final restoration. This study sought to evaluate the shade of ceramic veneers produced by different try-in materials. Forty bovine teeth and 40 ceramic discs (0.6 mm thick) were prepared. The samples were divided into 4 groups (n = 10). For Group 1 samples, no material was used between the tooth and the ceramic, Group 2 interposed samples with water, Group 3 used a water-soluble gel, and Group 4 used try-in paste (value 0). The color was measured with a spectrophotometer, obtaining L*, a*, and b* values to calculate the color difference (ΔE*). The data were subjected to normality tests and 1-way ANOVA. No significant statistical differences were found among the groups, indicating that the different try-in materials had similar effects on the color of the ceramic laminates.

  15. Square lattice honeycomb tri-carbide fuels for 50 to 250 KN variable thrust NTP design

    Science.gov (United States)

    Anghaie, Samim; Knight, Travis; Gouw, Reza; Furman, Eric

    2001-02-01

    Ultrahigh temperature solid solution of tri-carbide fuels are used to design an ultracompact nuclear thermal rocket generating 950 seconds of specific impulse with scalable thrust level in range of 50 to 250 kilo Newtons. Solid solutions of tri-carbide nuclear fuels such as uranium-zirconium-niobium carbide. UZrNbC, are processed to contain certain mixing ratio between uranium carbide and two stabilizing carbides. Zirconium or niobium in the tri-carbide could be replaced by tantalum or hafnium to provide higher chemical stability in hot hydrogen environment or to provide different nuclear design characteristics. Recent studies have demonstrated the chemical compatibility of tri-carbide fuels with hydrogen propellant for a few to tens of hours of operation at temperatures ranging from 2800 K to 3300 K, respectively. Fuel elements are fabricated from thin tri-carbide wafers that are grooved and locked into a square-lattice honeycomb (SLHC) shape. The hockey puck shaped SLHC fuel elements are stacked up in a grooved graphite tube to form a SLHC fuel assembly. A total of 18 fuel assemblies are arranged circumferentially to form two concentric rings of fuel assemblies with zirconium hydride filling the space between assemblies. For 50 to 250 kilo Newtons thrust operations, the reactor diameter and length including reflectors are 57 cm and 60 cm, respectively. Results of the nuclear design and thermal fluid analyses of the SLHC nuclear thermal propulsion system are presented. .

  16. Toxics Release Inventory Expansion Rule Phase 3 (TRI-P3)

    Energy Technology Data Exchange (ETDEWEB)

    Evans, R.A.; Saunders, A.D.; Worley, G.G.

    1998-09-01

    The ORR [East Tennessee Technology Park (ETTP), Y-12 Plant, and Oak Ridge National Laboratory (ORNL)] is considered a single facility for reporting by the DOE prime contractors. The processing, manufacturing, or "otherwise use" Section313 chemicals are combined to determine TRI reportability. Such is the case with lead metal, which is one of two chemicals for which reportin~ forms were prepared in this pilot study (Task 2;1. The lead shop at ORNL exceeded the reporting threshold, causing a lead activity at a Y-1 2 machine shop and lead in waste at ETTP to be reportable. TRI-P3 report preparation time for lead totaled 36.5 hours. The second chemical investigated and reported (chromium) also required nearly a man-week for report preparation and documentation by experienced TRI personnel. The ORR TRI report typically includes about six chemicals, so an estimate of the TRI-P3 incremental reporting burden for ORR would be six weeks for experienced personnel axI d two/three man-months for first-time ORR preparers.

  17. Photoelectric properties of ZnS/Au/ZnS transparent conductive tri-layer films

    Science.gov (United States)

    Wang, Caifeng; Hu, Bo

    2017-09-01

    ZnS/Au/ZnS tri-layer films are deposited on quartz glass by pulsed laser deposition (PLD) at room temperature, and have been annealed in air at different temperatures. The effect of annealing temperature on the optical and electrical properties of ZnS/Au/ZnS tri-layer films is investigated. X-ray diffraction (XRD) patterns show that the increase in annealing temperature improves the crystallinity of the structures. Scanning electron microscope (SEM) images of the samples show that the particle size becomes larger as the annealing temperature increases. Moreover, with the increase of annealing temperature, sheet resistance of the tri-layer films decreases initially, and increases further by increasing the annealing temperature to 300 °C. High quality ZnS/Au/ZnS tri-layer films with the sheet resistance of 27 Ω/sq and the maximum optical transmittance of 86.2% in the visible light region (400-800 nm) are obtained when the sample is annealed at 200 °C. The figure of merit is calculated to evaluate the performance of ZnS/Au/ZnS tri-layer films.

  18. Effect of Tri-sa-maw recipe on gastrointestinal regulation and motility. .

    Science.gov (United States)

    Wannasiri, Supaporn; Jaijoy, Kanjana; Chiranthanut, Natthakarn; Soonthornchareonnon, Noppamas; Sireeratawong, Seewaboon

    2015-03-01

    Tri-sa-maw recipe is comprised ofequal proportions of three herbal fruits, including Terminalia chebula Retz., Terminalia sp. and Terminalia bellirica Roxb. The traditional use of this recipe has been reported as a medication for fever; expectorant, relief of tightness in the stomach, laxative and antidiarrheal agent. To study the effects of Tri-sa-maw recipe extract on gastrointestinal tract in both in vitro and in vivo. Gastrointestinal effect of Tri-sa-maw recipe was studied by using two in vivo models (gastric emptying, gastrointestinal transit) and in vitro isolated guinea pig ileum experiment. Tri-sa-maw recipe showed both stimulatory and inhibitory effects on the stomach function. Not only did the extract at the dose of 1,000 mg/kg inhibit the gastric emptying time, but also stimulate the movement of the digestive tract by increasing the mobility of charcoal. In the isolated guinea pig ileum experiment, the extract at low concentration (0.1 ng/mL) induced the contraction of isolated guinea pig ileum. However the stimulation effect on contractions of isolated guineapig ileum was very much decreased at the high concentration (0.2-1 ng/mL) of the extract. The findings of this study support to traditional uses of Tri-sa-maw recipe as a laxative and antidiarrheal agent.

  19. Investigations of groundwater system and simulation of regional groundwater flow for North Penn Area 7 Superfund site, Montgomery County, Pennsylvania

    Science.gov (United States)

    Senior, Lisa A.; Goode, Daniel J.

    2013-01-01

    Groundwater in the vicinity of several industrial facilities in Upper Gwynedd Township and vicinity, Montgomery County, in southeast Pennsylvania has been shown to be contaminated with volatile organic compounds (VOCs), the most common of which is the solvent trichloroethylene (TCE). The 2-square-mile area was placed on the National Priorities List as the North Penn Area 7 Superfund site by the U.S. Environmental Protection Agency (USEPA) in 1989. The U.S. Geological Survey (USGS) conducted geophysical logging, aquifer testing, and water-level monitoring, and measured streamflows in and near North Penn Area 7 from fall 2000 through fall 2006 in a technical assistance study for the USEPA to develop an understanding of the hydrogeologic framework in the area as part of the USEPA Remedial Investigation. In addition, the USGS developed a groundwater-flow computer model based on the hydrogeologic framework to simulate regional groundwater flow and to estimate directions of groundwater flow and pathways of groundwater contaminants. The study area is underlain by Triassic- and Jurassic-age sandstones and shales of the Lockatong Formation and Brunswick Group in the Mesozoic Newark Basin. Regionally, these rocks strike northeast and dip to the northwest. The sequence of rocks form a fractured-sedimentary-rock aquifer that acts as a set of confined to partially confined layers of differing permeabilities. Depth to competent bedrock typically is less than 20 ft below land surface. The aquifer layers are recharged locally by precipitation and discharge locally to streams. The general configuration of the potentiometric surface in the aquifer is similar to topography, except in areas affected by pumping. The headwaters of Wissahickon Creek are nearby, and the stream flows southwest, parallel to strike, to bisect North Penn Area 7. Groundwater is pumped in the vicinity of North Penn Area 7 for industrial use, public supply, and residential supply. Results of field investigations

  20. Collaboration and Participation in the trying-out of welfare technologies

    DEFF Research Database (Denmark)

    Krummheuer, Antonia Lina; Raudaskoski, Pirkko Liisa; Samuelsson, Christina

    , a person living with acquired brain injury is introduced to a new walking help. Our interest is directed to the multimodal practices through which Jette, whose ability to speak and move is impaired, becomes a competent and mobile participant. The analysis describes the situated and multimodal practices...... and material artefacts are during the trying-out practices. As these practices of seeing and feeling are reflexively interwoven with the actual activities the participants are engaged in, the paper also describes and analyses the interactional management of the trying-out period. Questions...... that will be addressed are: • How do the participants coordinate their actions to engage in the joint activity of a trying-out? • How do the participants make others 'see' what they see or experience? • Which participation roles do the different parties take up and/or get ascribed? • How does the person with acquired...

  1. Try-It-On: Experiential Learning of Holistic Stress Management in a Graduate Nursing Curriculum.

    Science.gov (United States)

    Gregg, S Renee; Twibell, K Renee

    2016-09-01

    The aim of this article is to relate how nursing students in a graduate curriculum can learn, personally practice, and prepare to disseminate stress management strategies to patients. Advanced practice nurses often provide care for patients experiencing stress-related disorders while concurrently trying to manage their own high levels of stress. Through the innovative Try-It-On teaching-learning strategy, graduate students experimented with holistic stress management approaches, with the intention of sharing with patients what worked effectively. Student comments on course evaluations were positive regarding Try-It-On. In the pilot trial of a quantitative survey to expand the evaluation of the strategy, students who trialed holistic stress management techniques reported satisfaction, engagement, perceived relevance, and intention to trial techniques with patients in future clinical courses. Modeling role modeling theory and the Kirkpatrick evaluation model guided the project, which filled gaps in current knowledge about experiential learning in graduate nursing programs.

  2. A Tri-Factor Model for Integrating Ratings Across Multiple Informants

    Science.gov (United States)

    Bauer, Daniel J.; Howard, Andrea L.; Baldasaro, Ruth E.; Curran, Patrick J.; Hussong, Andrea M.; Chassin, Laurie; Zucker, Robert A.

    2014-01-01

    Psychologists often obtain ratings for target individuals from multiple informants such as parents or peers. In this paper we propose a tri-factor model for multiple informant data that separates target-level variability from informant-level variability and item-level variability. By leveraging item-level data, the tri-factor model allows for examination of a single trait rated on a single target. In contrast to many psychometric models developed for multitrait-multimethod data, the tri-factor model is predominantly a measurement model. It is used to evaluate item quality in scale development, test hypotheses about sources of target variability (e.g., sources of trait differences) versus informant variability (e.g., sources of rater bias), and generate integrative scores that are purged of the subjective biases of single informants. PMID:24079932

  3. Evaluation of tri-steps modified styrene-butadiene-styrene block copolymer membrane for wound dressing

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Jen Ming, E-mail: jmyang@mail.cgu.edu.tw; Huang, Huei Tsz

    2012-08-01

    Tri-steps modified styrene-butadiene-styrene block copolymer (SBS) membrane was prepared with epoxidation, ring opening reaction with maleated ionomer and layer-by-layer assembled polyelectrolyte technique. The tri-steps modified SBS membrane was characterized by infrared spectroscopy and X-ray photoelectron spectroscope (XPS). The structures of the modified SBS membranes were identified with methylene blue and azocarmine G. The content of amino group on the surface of the modified membrane was calculated from uptake of an acid dye. The values of the contact angle, water absorption, water vapor transmission rate and the adsorption of fibronectin on the membranes were determined. To evaluate the biocompatibility of the tri-steps modified SBS membrane, the cytotoxicity, antibacterial and growth profile of the cell culture of 3T3 fibroblasts on the membrane were evaluated. The bactericidal activity was found on the modified SBS. From the cell culture of 3T3 fibroblasts on the membrane, it revealed that the cells not only remained viable but also proliferated on the surface of the tri-steps modified SBS membranes. As the membranes are sterile semipermeable with bactericidal activity and transparent allowing wound checks, they can be considered for shallow wound with low exudates. - Highlights: Black-Right-Pointing-Pointer Styrene-butadiene-styrene block copolymer (SBS) was modified with tri-steps. Black-Right-Pointing-Pointer The tri-steps are epoxidation, ring opening reaction and layer-by-layer assembly. Black-Right-Pointing-Pointer Modified SBS membrane for wound dressing is evaluated. Black-Right-Pointing-Pointer Membranes are sterile semipermeable with bactericidal activity and transparent. Black-Right-Pointing-Pointer Membranes can be considered for shallow wound with low exudates.

  4. Analysis of weak signal detection based on tri-stable system under Levy noise

    Science.gov (United States)

    Li-Fang, He; Ying-Ying, Cui; Tian-Qi, Zhang; Gang, Zhang; Ying, Song

    2016-06-01

    Stochastic resonance system is an effective method to extract weak signal. However, system output is directly influenced by system parameters. Aiming at this, the Levy noise is combined with a tri-stable stochastic resonance system. The average signal-to-noise ratio gain is regarded as an index to measure the stochastic resonance phenomenon. The characteristics of tri-stable stochastic resonance under Levy noise is analyzed in depth. First, the method of generating Levy noise, the effect of tri-stable system parameters on the potential function and corresponding potential force are presented in detail. Then, the effects of tri-stable system parameters w, a, b, and Levy noise intensity amplification factor D on the resonant output can be explored with different Levy noises. Finally, the tri-stable stochastic resonance system is applied to the bearing fault detection. Simulation results show that the stochastic resonance phenomenon can be induced by tuning the system parameters w, a, and b under different distributions of Levy noise, then the weak signal can be detected. The parameter intervals which can induce stochastic resonances are approximately equal. Moreover, by adjusting the intensity amplification factor D of Levy noise, the stochastic resonances can happen similarly. In bearing fault detection, the detection effect of the tri-stable stochastic resonance system is superior to the bistable stochastic resonance system. Project supported by the National Natural Science Foundation of China (Grant No. 61371164), the Chongqing Municipal Distinguished Youth Foundation, China (Grant No. CSTC2011jjjq40002), and the Research Project of Chongqing Municipal Educational Commission, China (Grant No. KJ130524).

  5. TGF-beta1 immobilized tri-co-polymer for articular cartilage tissue engineering.

    Science.gov (United States)

    Chou, Cheng-Hung; Cheng, Winston T K; Lin, Chien-Cheng; Chang, Chih-Hung; Tsai, Chien-Chen; Lin, Feng-Huei

    2006-05-01

    Tri-co-polymer with composition of gelatin, hyaluronic acid and chondroitin-6-sulfate has been used to mimic the cartilage extracellular matrix as scaffold for cartilage tissue engineering. In this study, we try to immobilize TGF-beta1 onto the surface of the tri-co-polymer sponge to suppress the undesired differentiation during the cartilage growth in vitro. The scaffold was synthesized with a pore size in a range of 300-500 microm. TGF-beta1 was immobilized on the surface of the tri-co-polymer scaffold with 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide (EDC) as a crosslinking agent. Tri-co-polymer scaffolds with and without TGF-beta1 were seeded with porcine chondrocytes and cultured in a spinner flask for 2, 4, and 6 weeks. The chondrocytes were characterized by the methods of immunohistochemical staining with anti-type II collagen and anti-S-100 protein monoclonal antibody, and RT-PCR. After culturing for 4 weeks, chondrocytes showed positive in S-100 protein, Alcian blue, and type II collagen for the scaffold with TGF-beta1 immobilization. There is no observed type I and type X collagen expression in the scaffolds from the observation of RT-PCR. In addition, the scaffold without TGF-beta1 immobilization, type X collagen, can be detected after cultured for 2 weeks. Type I collagen was progressively expressed after 4 weeks. These results can conclude that TGF-beta1 immobilized scaffold can suppress chondrocytes toward prehypertrophic chondrocytes and osteolineage cells. The tri-co-polymer sponge with TGF-beta1 immobilization should have a great potential in cartilage tissue engineering in the future.

  6. Multi-try Counter-meshing Gears Discrimination Device Based on MEMS Technology

    Institute of Scientific and Technical Information of China (English)

    LI Sheng-yong; CHEN Wen-yuan; ZHANG Wei-ping; GAO Xiao-yu; XIAO Qi-jun; TAN Shun-yi; FENG Min-hua

    2008-01-01

    A multi-try counter-meshing gears (CMG) discrimination device based on micro electromechani-cal system (MEMS) technology was designed for some specified information fields. The discrimination deviceconsists of two groups of metal CMG, two pawl/ratchet mechanisms, two driving micromotors and two re-setting micromotors, which make the CMG withdraw by raising the pawls. The energy-coupling element isa photoelectric sensor with a circular plate which is notched. Micromotor is fabricated using the ultravioletLiGA (UV-LiGA) fabrication process and precision mechanical engineering. The discrimination device has thefunction which can automatically reset, with the correct resetting code, it can be tried another times.

  7. Solution of the Problem of the Identified Minimum for the Tri-Variate Normal

    Indian Academy of Sciences (India)

    A Mukherjea; M Elnaggar

    2012-11-01

    Let $X=(X_1,X_2,X_3)$ be a non-singular tri-variate normal vector with zero means. Let $T=\\min\\{X_1,X_2,X_3\\}$, and $I=i \\mathrm{ iff } T=X_i,i=1,2,3$. The problem of the identified minimum (,) is then to find if its joint distribution determines uniquely . This problem is solved here in the affirmative. To the best of our knowledge, it was first solved in the bivariate normal case (and partially in the tri-variate normal case) in 1978 in [1].

  8. Comprehensive Calibration of Strap-Down Tri-Axis Accelerometer Unit

    Directory of Open Access Journals (Sweden)

    Xi Zhang

    2017-02-01

    Full Text Available This paper proposes a comprehensive calibration method to improve the precision of a strap-down tri-axis accelerometer unit, in which parameters are divided into static and dynamic ones. The contribution of the manuscript is that it solves the problem of inappropriate installation and the size effect error for tri-axis accelerometer unit at high speed by using static and dynamic calibration method, respectively. The experiment results show the measuring accuracy of accelerometers is increased by more than one order of magnitude, and the navigation precision is increased by more than two orders of magnitude.

  9. A tri-modality image fusion method for target delineation of brain tumors in radiotherapy.

    Directory of Open Access Journals (Sweden)

    Lu Guo

    Full Text Available To develop a tri-modality image fusion method for better target delineation in image-guided radiotherapy for patients with brain tumors.A new method of tri-modality image fusion was developed, which can fuse and display all image sets in one panel and one operation. And a feasibility study in gross tumor volume (GTV delineation using data from three patients with brain tumors was conducted, which included images of simulation CT, MRI, and 18F-fluorodeoxyglucose positron emission tomography (18F-FDG PET examinations before radiotherapy. Tri-modality image fusion was implemented after image registrations of CT+PET and CT+MRI, and the transparency weight of each modality could be adjusted and set by users. Three radiation oncologists delineated GTVs for all patients using dual-modality (MRI/CT and tri-modality (MRI/CT/PET image fusion respectively. Inter-observer variation was assessed by the coefficient of variation (COV, the average distance between surface and centroid (ADSC, and the local standard deviation (SDlocal. Analysis of COV was also performed to evaluate intra-observer volume variation.The inter-observer variation analysis showed that, the mean COV was 0.14(± 0.09 and 0.07(± 0.01 for dual-modality and tri-modality respectively; the standard deviation of ADSC was significantly reduced (p<0.05 with tri-modality; SDlocal averaged over median GTV surface was reduced in patient 2 (from 0.57 cm to 0.39 cm and patient 3 (from 0.42 cm to 0.36 cm with the new method. The intra-observer volume variation was also significantly reduced (p = 0.00 with the tri-modality method as compared with using the dual-modality method.With the new tri-modality image fusion method smaller inter- and intra-observer variation in GTV definition for the brain tumors can be achieved, which improves the consistency and accuracy for target delineation in individualized radiotherapy.

  10. Tri-residue contact potential: a new knowledge-based energetic method

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    A new knowledge-based potential method, the tri-residue contact potential (TRICP), is proposed. This approach resembles the idea of environment-dependent residue contact energy reported by Zhang et al. We statistically study the 3-dimensional structure of proteins and calculate the knowledge-based contact potential of tri-residue clusters. These contact potentials are carefully compared to pairwise contact potentials (PCP). TRICP helps us to systematically examine the impact on the interactions of residue pairs by the third residue. Moreover, TRICP provides us with many clues to identify high frequency characteristic structural units in protein structures.

  11. Multi-bi- and tri-stability using nonlinear plasmonic Fano resonators

    KAUST Repository

    Amin, Muhammad

    2013-09-01

    A plasmonic Fano resonator embedding Kerr nonlinearity is used to achieve multi-bi- and tri-stability. Fano resonance is obtained by inducing higher-order plasmon modes on metallic surfaces via geometrical symmetry breaking. The presence of the multiple higher order plasmon modes provides the means for producing multi-bi- or tri-stability in the response of the resonator when it is loaded with a material with Kerr nonlinearity. The multi-stability in the response of the proposed resonator enables its use in three-state all optical memory and switching applications. © 2013 IEEE.

  12. Enhanced Faraday Rotation via Resonant Tunnelling in Tri-Layers Containing Magneto-Optical Metals

    CERN Document Server

    Moccia, Massimo; Galdi, Vincenzo; Alu', Andrea; Engheta, Nader

    2013-01-01

    We study resonant tunnelling effects that can occur in tri-layer structures featuring a dielectric layer sandwiched between two magneto-optical-metal layers. We show that the resonance splitting associated with these phenomena can be exploited to enhance Faraday rotation at optical frequencies. Our results indicate that, in the presence of realistic loss levels, a tri-layer structure of sub-wavelength thickness is capable of yielding sensible (~10{\\deg}) Faraday rotation with transmittance levels that are an order of magnitude larger than those attainable with a standalone slab of magneto-optical metal of same thickness.

  13. Hanford and the tri-cities economy: Review and outlook, March 1989

    Energy Technology Data Exchange (ETDEWEB)

    Scott, M.J.; Belzer, D.B.; March, S.J.; Beck, D.M.; Schultz, R.W.; Harkreader, S.A.

    1989-03-01

    The economy of the Tri-Cities, Washington area (primarily, Benton and Franklin Counties) is in transition due to major changes in two Department of Energy programs at Hanford---the abrupt ending of the Basalt Waste Isolation Project (BWIP) in December 1987 and the placing of the N Reactor in ''cold standby'' status in February 1988. This report reviews the economic situation in the Tri-Cities during 1988 and presents forecasts for key economic indicators for 1989. This report will be updated about every six months to review the changes in the area economy and forecast the near-term outlook. 6 figs., 33 tabs.

  14. Viability of the exact tri-bimaximal mixing at M GUT in SO(10)

    Science.gov (United States)

    Joshipura, Anjan S.; Patel, Ketan M.

    2011-09-01

    General structures of the charged lepton and the neutrino mixing matrices leading to tri-bimaximal leptonic mixing are determined. These are then integrated into an SO(10) model within which detailed fits to fermion masses and mixing angles are given. It is shown that one can obtain excellent fits to all the fermion masses and quark mixing angles keeping tri-bimaximal leptonic mixing intact. Different perturbations to the basic structure are considered and those which can or which cannot account for the recent T2K and MINOS results on the reactor mixing angle θ 13 l are identified.

  15. Identification of a 35S U4/U6.U5 Tri-snRNP Complex Intermediate in Spliceosome Assembly.

    Science.gov (United States)

    Chen, Zhe; Gui, Bin; Zhang, Yu; Xie, Guojia; Li, Wanjin; Liu, Shumeng; Xu, Bosen; Wu, Chongyang; He, Lin; Yang, Jianguo; Yi, Xia; Yang, Xiaohan; Sun, Luyang; Liang, Jing; Shang, Yongfeng

    2017-09-06

    The de novo assembly and post-splicing reassembly of the U4/U6.U5 tri-snRNP remain to be investigated. We report here that ZIP, a protein containing a CCCH type of zinc finger and a G-patch domain as we characterized previously, regulates pre-mRNA splicing in a RNA binding-independent manner. We found that ZIP is physically associated with the U4/U6.U5 tri-snRNP. Remarkably, ZIP-containing tri-snRNP has a sedimentation coefficient ~35S, a tri-snRNP that has not been described before. We showed that the 35S tri-snRNP contains hPrp24, indicative of a state when the U4/U6 di-snRNP is just integrating with the U5 snRNP. We found that the 35S tri-snRNP is enriched in the Cajal body, indicating that it is an assembly intermediate during 25S tri-snRNP maturation. We showed that the 35S tri-snRNP also contains hPrp43, whose ATPase/RNA helicase activities are stimulated by ZIP. Our study identified, for the first time, a tri-snRNP intermediate, shedding new light on the de novo assembly and recycling of the U4/U6.U5 tri-snRNP. Copyright © 2017, The American Society for Biochemistry and Molecular Biology.

  16. Exergetic Analysis of an Integrated Tri-Generation Organic Rankine Cycle

    Directory of Open Access Journals (Sweden)

    Ratha Z. Mathkor

    2015-08-01

    Full Text Available This paper reports on a study of the modelling, validation and analysis of an integrated 1 MW (electrical output tri-generation system energized by solar energy. The impact of local climatic conditions in the Mediterranean region on the system performance was considered. The output of the system that comprised a parabolic trough collector (PTC, an organic Rankine cycle (ORC, single-effect desalination (SED, and single effect LiBr-H2O absorption chiller (ACH was electrical power, distilled water, and refrigerant load. The electrical power was produced by the ORC which used cyclopentane as working fluid and Therminol VP-1 was specified as the heat transfer oil (HTO in the collectors with thermal storage. The absorption chiller and the desalination unit were utilize the waste heat exiting from the steam turbine in the ORC to provide the necessary cooling energy and drinking water respectively. The modelling, which includes an exergetic analysis, focuses on the performance of the solar tri-generation system. The simulation results of the tri-generation system and its subsystems were produced using IPSEpro software and were validated against experimental data which showed good agreement. The tri-generation system was able to produce about 194 Ton of refrigeration, and 234 t/day distilled water.

  17. Development of education program for physical therapy assistant in Quang Tri province of Vietnam.

    Science.gov (United States)

    Noh, Jin Won; Cho, Sang Hyun; Kim, Min Hee; Kim, Eun Joo

    2017-02-01

    [Purpose] The purpose of the present study was to develop an education program for physical therapy assistants in order to provide high quality physical therapy for the province of Quang Tri in Vietnam. [Subjects and Methods] Subjects consisted of 9 professors in Quang Tri medical college and 1 physical therapist in Quang Tri General hospital. The survey research to lecturer for education of physical therapy assistant in Quang Tri medical college was conducted as pre-analysis of demand for the physical therapy assistant curriculum development. The priority rank of expectation and consciousness were measured in curriculum subjects. [Results] Results of educational expectation of the curriculum total educational expectation were presented as minimum 4 to maximum 5. In the result of educational expectation according to background variable, the differences of educational expectation on scores according to the educational experience were significant. Among the consciousness priority of each curriculum subject, the priority rank of basic kinesiology and physical therapy for international medicine & surgery were 9, the highest first rank frequency. [Conclusion] The curriculum for physical therapy assistant was developed to 5 main subjects including a total of 420 hours (120 hours of theory and 300 hours of practice).

  18. Sulfated di-, tri- and tetraantennary N-glycans in human Tamm-Horsfall glycoprotein

    NARCIS (Netherlands)

    Vliegenthart, J.F.G.; Rooijen, J.J.M. van; Kamerling, J.P.

    1998-01-01

    The primary structures of 32 sulfated di-, tri- and tetraantennary N-glycans of human Tamm-Horsfall glycoprotein (THP) have been determined. THP was isolated from the urine of one healthy male donor. The intact carbohydrate chains were released by PNGase-F and fractionated via FPLC on Resource Q, HP

  19. Investment in hydrogen tri-generation for wastewater treatment plants under uncertainties

    Science.gov (United States)

    Gharieh, Kaveh; Jafari, Mohsen A.; Guo, Qizhong

    2015-11-01

    In this article, we present a compound real option model for investment in hydrogen tri-generation and onsite hydrogen dispensing systems for a wastewater treatment plant under price and market uncertainties. The ultimate objective is to determine optimal timing and investment thresholds to exercise initial and subsequent options such that the total savings are maximized. Initial option includes investment in a 1.4 (MW) Molten Carbonate Fuel Cell (MCFC) fed by mixture of waste biogas from anaerobic digestion and natural gas, along with auxiliary equipment. Produced hydrogen in MCFC via internal reforming, is recovered from the exhaust gas stream using Pressure Swing Adsorption (PSA) purification technology. Therefore the expansion option includes investment in hydrogen compression, storage and dispensing (CSD) systems which creates additional revenue by selling hydrogen onsite in retail price. This work extends current state of investment modeling within the context of hydrogen tri-generation by considering: (i) Modular investment plan for hydrogen tri-generation and dispensing systems, (ii) Multiple sources of uncertainties along with more realistic probability distributions, (iii) Optimal operation of hydrogen tri-generation is considered, which results in realistic saving estimation.

  20. Development of education program for physical therapy assistant in Quang Tri province of Vietnam

    Science.gov (United States)

    Noh, Jin Won; Cho, Sang Hyun; Kim, Min Hee; Kim, Eun Joo

    2017-01-01

    [Purpose] The purpose of the present study was to develop an education program for physical therapy assistants in order to provide high quality physical therapy for the province of Quang Tri in Vietnam. [Subjects and Methods] Subjects consisted of 9 professors in Quang Tri medical college and 1 physical therapist in Quang Tri General hospital. The survey research to lecturer for education of physical therapy assistant in Quang Tri medical college was conducted as pre-analysis of demand for the physical therapy assistant curriculum development. The priority rank of expectation and consciousness were measured in curriculum subjects. [Results] Results of educational expectation of the curriculum total educational expectation were presented as minimum 4 to maximum 5. In the result of educational expectation according to background variable, the differences of educational expectation on scores according to the educational experience were significant. Among the consciousness priority of each curriculum subject, the priority rank of basic kinesiology and physical therapy for international medicine & surgery were 9, the highest first rank frequency. [Conclusion] The curriculum for physical therapy assistant was developed to 5 main subjects including a total of 420 hours (120 hours of theory and 300 hours of practice). PMID:28265176

  1. Formation and stability of tri-polar vortices in stratified geostrophic flows

    Energy Technology Data Exchange (ETDEWEB)

    Corread, S.M.; Carton, X.J. [French Navy Oceanography Center, Brest (France)

    1999-12-01

    The formation, stationary and stability of tri-polar vortices are investigated in a two-layer quasi-geostrophic model. On the f-plane, these tripoles form from the barotropic and baroclinic instabilities of circular isolated vortices. Various horizontal and vertical potential vorticity distributions, both piecewise constant and continuous, are considered here for these circular vortices.

  2. Coronary Heart Disease Knowledge and Risk Factors among Tri-Ethnic College Students

    Science.gov (United States)

    Koutoubi, Samer; Huffman, Fatma G.; Ciccazzo, Michele W.; Himburg, Susan P.; Johnson, Paulette

    2005-01-01

    Objectives: Coronary heart disease (CHD) is the leading cause of death in the United States and Europe. This study identified and compared nutritional knowledge associated with CHD risk factors among tri-ethnic college students. Design: A quantitative, cross-sectional, observational study using questionnaires. Setting: University laboratory.…

  3. TriAnd and its Siblings: Satellites of Satellites in the Milky Way Halo

    CERN Document Server

    Deason, A J; Hamren, K M; Koposov, S E; Gilbert, K M; Beaton, R L; Dorman, C E; Guhathakurta, P; Majewski, S R; Cunningham, E C

    2014-01-01

    We explore the Triangulum-Andromeda (TriAnd) overdensity in the SPLASH (Spectroscopic and Photometric Landscape of Andromeda's Stellar Halo) and SEGUE (the Sloan Extension for Galactic Understanding and Exploration) spectroscopic surveys. Milky Way main sequence turn-off stars in the SPLASH survey reveal that the TriAnd overdensity and the recently discovered PAndAS stream (Martin et al. 2014) share a common distance (D ~ 20 kpc), position on the sky, and line-of-sight velocity (V_GSR ~ 50 km/s). Similarly, A-type, giant, and main sequence turn-off stars selected from the SEGUE survey in the vicinity of the Segue 2 dwarf show that TriAnd is prevalent in these fields, with a velocity and distance similar to the Segue 2 satellite. The coincidence of the PAndAS stream and Segue 2 satellite in positional and velocity space to TriAnd suggests that these substructures are all associated, and may be a fossil record of group-infall onto the Milky Way halo. In this scenario, the Segue 2 satellite and PAndAS stream are...

  4. Subchronic toxicity and reproduction effects of tri-n-butyltin oxide in Japanese Quail.

    NARCIS (Netherlands)

    Coenen, T.M.M.; Brouwer, A.; Eiminga, I.C.; Koeman, J.H.

    1992-01-01

    A subchronic toxicity/reproduction study was performed in Japanese quails that were fed a diet containing 0, 24, 60, and 150 mg tri-n-butyltin oxide (TBTO) per kg basal diet for 6 weeks. Eggs produced during the 6 weeks of treatment were incubated and hatched, and chicks hatched from eggs collected

  5. ”I tried so many diets, now I want to do it differently”

    DEFF Research Database (Denmark)

    Stelter, Reinhard

    2015-01-01

    over the years – with little and no lasting effect. In his coaching approach, the author went beyond a pure behavioural change model, i.e. based on the Health Belief Model, and tried to take a whole-life perspective, where the client learned to link specific events and habits in her work life...

  6. Design of tri-level excitation signals for broadband bioimpedance spectroscopy.

    Science.gov (United States)

    Yang, Yuxiang; Wang, Lianhuan; Wang, Peipei; Yang, Xiufang; Zhang, Fu; Wen, He; Teng, Zhaosheng

    2015-09-01

    Bioimpedance spectroscopy (BIS) measurement methods have been evolving from the traditional frequency-sweep approach to the multi-frequency simultaneous measurement technique which can drastically reduce measuring time and will be increasingly attractive for time-varying biological applications. Multi-frequency mixed (MFM) signals with sparsely distributed spectra are desirable for broadband BIS measurement. This paper proposes a synthesis method to design a series of tri-level MFM signals which contain only three values (+1, 0, -1), and has majority energy distributed on its (2(n))th primary harmonics. Tri-level MFM signals have both high energy efficiency and a low crest factor. An impedance measurement experiment excited by an 8th-order tri-level MFM signal on a RC three-element equivalent model has been performed, and the results on 8 primary harmonic frequencies ranging from 8 to 1024 kHz show a high accuracy with the mean amplitude relative error of 0.41% and mean phase absolute error of 0.18°, which has validated the feasibility of the tri-level MFM signals for broadband BIS measurement.

  7. Tri-Band PCB Antenna for Wireless Sensor Network Transceivers in Home Automation Applications

    DEFF Research Database (Denmark)

    Rohde, John; Toftegaard, Thomas Skjødeberg

    2012-01-01

    A novel tri-band antenna design for wireless sensor network devices in home automation applications is proposed. The design is based on a combination of a conventional monopole wire antenna and discrete distributed load impedances. The load impedances are employed to ensure the degrees of freedom...

  8. Bioprospecting for TRI101 in Fusarium: Searching for a Better Enzyme to Detoxify Deoxynivalenol (DON)

    Science.gov (United States)

    The mycotoxin deoxynivalenol (DON) is a common contaminant of wheat and barley in the United States. New strategies to mitigate the threat of DON need to be developed and implemented. Previous research has shown the value of an enzyme (TRI101) to modify DON and reduce its toxicity. Recent work by...

  9. Using Constructivist Career Development to Improve Career Decision Self-Efficacy in TRiO Students

    Science.gov (United States)

    Grier-Reed, Tabitha; Ganuza, Zoila

    2012-01-01

    Although more high school graduates are attending college, many are not graduating (The Bill and Melinda Gates Foundation, 2004). First-generation, low-income, and underrepresented students are especially at risk for falling through the cracks. To help address this issue, programs such as TRiO Student Support Services (SSS) assist…

  10. 只要努力,不要后悔%Do Try without Regretting

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ There are numbers of crossroads on our long and unpredictable life journey where we totally have no idea about which direction to choose. No matter what our decision is, we should not turn back, but face the music and go ahead instead. I am this kind of girl who always does try without regretting, one example is how I dealt with my love.

  11. Finite-gap systems, tri-supersymmetry and self-isospectrality

    CERN Document Server

    Correa, Francisco; Plyushchay, Mikhail S

    2008-01-01

    We show that an n-gap periodic quantum system with parity-even smooth potential admits $2^n-1$ isospectral super-extensions. Each is described by a tri-supersymmetry that originates from a higher-order differential operator of the Lax pair and two-term nonsingular decompositions of it; its local part corresponds to a spontaneously partially broken centrally extended nonlinear N=4 supersymmetry. We conjecture that any finite-gap system having antiperiodic singlet states admits a self-isospectral tri-supersymmetric extension with the partner potential to be the original one translated for a half-period. Applying the theory to a broad class of finite-gap elliptic systems described by a two-parametric associated Lame equation, our conjecture is supported by the explicit construction of the self-isospectral tri-supersymmetric pairs. We find that the spontaneously broken tri-supersymmetry of the self-isospectral periodic system is recovered in the infinite period limit.

  12. Meshing Theoretical Study and Simulation on Cylindrical Tri-sine Oscillating Tooth Gear Drive

    Institute of Scientific and Technical Information of China (English)

    李瑰贤; 孙瑜; 张欣

    2004-01-01

    The structure of cylindrical tri-sine oscillating tooth gear drive is presented. Based on the space meshing theory, equations of meshing and tooth profile are established and its meshing theory is studied. Using Pro/E, this system is modeled and simulated,which is compared with the above-established equations.

  13. The TriLab, a Novel ICT Based Triple Access Mode Laboratory Education Model

    Science.gov (United States)

    Abdulwahed, Mahmoud; Nagy, Zoltan K.

    2011-01-01

    This paper introduces a novel model of laboratory education, namely the TriLab. The model is based on recent advances in ICT and implements a three access modes to the laboratory experience (virtual, hands-on and remote) in one software package. A review of the three modes is provided with highlights of advantages and disadvantages of each mode.…

  14. Semi-supervised adaptation in ssvep-based brain-computer interface using tri-training

    DEFF Research Database (Denmark)

    Bender, Thomas; Kjaer, Troels W.; Thomsen, Carsten E.;

    2013-01-01

    This paper presents a novel and computationally simple tri-training based semi-supervised steady-state visual evoked potential (SSVEP)-based brain-computer interface (BCI). It is implemented with autocorrelation-based features and a Naïve-Bayes classifier (NBC). The system uses nine characters...

  15. Arabidopsis TTG2 regulates TRY expression through enhancement of activator complex-triggered activation.

    Science.gov (United States)

    Pesch, Martina; Dartan, Burcu; Birkenbihl, Rainer; Somssich, Imre E; Hülskamp, Martin

    2014-10-01

    Trichome patterning in Arabidopsis thaliana is regulated by a regulatory feedback loop of the trichome promoting factors TRANSPARENT TESTA GLABRA1 (TTG1), GLABRA3 (GL3)/ENHANCER OF GL3 (EGL3), and GL1 and a group of homologous R3MYB proteins that act as their inhibitors. Together, they regulate the temporal and spatial expression of GL2 and TTG2, which are considered to control trichome cell differentiation. In this work, we show that TTG2 is a specific activator of TRY (but not CPC or GL2). The WRKY protein TTG2 binds to W-boxes in a minimal promoter fragment of TRY, and these W-boxes are essential for rescue of the try mutant phenotype. We further show that TTG2 alone is not able to activate TRY expression, but rather drastically enhances the activation by TTG1 and GL3. As TTG2 physically interacts with TTG1 and because TTG2 can associate with GL3 through its interaction with TTG1, we propose that TTG2 enhances the activity of TTG1 and GL3 by forming a protein complex.

  16. Real Time Filtering of Tweets Using Wikipedia Concepts and Google Tri-gram Semantic Relatedness

    Science.gov (United States)

    2015-11-20

    Tri-gram Method (GTM) of Aminul et. al [2]. GTM is an unsupervised corpus-based approach for computing se- mantic relatedness between texts. It uses...Resnick, and Q. Mei, “Req-rec: High recall retrieval with query pooling and interactive classification ,” in Proceedings of the 37th international ACM

  17. Molecular Medicine - CHI's 17th International Tri-Conference: Mastering Medicinal Chemistry - CHI's Seventh Annual Conference.

    Science.gov (United States)

    Semple, Graeme

    2010-04-01

    CHI's 17th International Tri-Conference on Molecular Medicine, held in San Francisco, included topics covering the drug discovery process, with an emphasis on lead optimization. This conference report highlights selected presentations on the development of several launched and investigational drugs, including Plerixafor, Trox-1 (CombinatoRX Inc), lorcaserin (Arena Pharmaceuticals Inc), vorapaxar (Merck & Co Inc) and ulimorelin (Tranzyme Pharma Inc).

  18. Youth Experience of Trying to Get off the Street: What Has Helped and Hindered

    Science.gov (United States)

    Brown, Tracy L.; Amundson, Norman E.

    2010-01-01

    This qualitative study involved 20 youth (18 males, 1 female, 1 transgender, ages 19-24) living in Vancouver, British Columbia, who reported 259 critical incidents of what helped or hindered their experiences as they tried to get off the street. What helped included (a) taking responsibility, (b) engaging in constructive activities, (c) friends…

  19. A Tri-Reference Point Theory of Decision Making under Risk

    Science.gov (United States)

    Wang, X. T.; Johnson, Joseph G.

    2012-01-01

    The tri-reference point (TRP) theory takes into account minimum requirements (MR), the status quo (SQ), and goals (G) in decision making under risk. The 3 reference points demarcate risky outcomes and risk perception into 4 functional regions: success (expected value of x greater than or equal to G), gain (SQ less than x less than G), loss (MR…

  20. Columbia TriStar omandas "Nimed marmortahvlil" leviõigused / Kairit Tsäro

    Index Scriptorium Estoniae

    Tsäro, Kairit, 1974-

    2002-01-01

    Lõppes Albert Kivikase romaani "Nimed marmortahvlil" järgi tehtava mängufilmi võtteperiood. Filmi tootja Taska Productionsi koostööpartner Matila-Röhr Productions sõlmis Columbia TriStariga lepingu, mis tagab filmi levitamise Soomes

  1. TriQuint的GaN/Si HEMT达到创纪录功率水平

    Institute of Scientific and Technical Information of China (English)

    陈裕权

    2004-01-01

    <正> TriQuint Semiconductor公司的研究人员宣布制造出世界上最大功率的Si衬底Al-GaN/GaN HEMT。该公司理查森研究室的D.Dumka及其同事报导其制造的上述器件10GHz下的连

  2. Production and trapping of radioactive atoms at the TRI mu P facility

    NARCIS (Netherlands)

    Traykov, E.; Dammalapati, U.; De, S.; Dermois, O. C.; Huisman, L.; Jungmann, K.; Kruithof, W.; Mol, A. J.; Onderwater, C. T. G.; Rogachevskiy, A; da Silva e Silva, M.; Sohani, M.; Versolato, O.; Willmann, L.; Wilschut, H. W.

    2008-01-01

    The structures for the TRI mu P facility have been completed and commissioned. At the facility radioactive nuclides are produced to study fundamental interactions and symmetries. An important feature is the possibility to trap radioactive atoms in order to obtain and hold a pure substrate-free sampl

  3. Tri-state Modulation Power Driving of Electro-hydraulic Proportional Amplifier

    Institute of Scientific and Technical Information of China (English)

    NIE Yong; WANG Qingfeng

    2009-01-01

    Switch electro-hydraulic proportional amplifier(PA) widely employs single switch modulation power driving(SSMPD) or reverse discharging power driving(RDPD) at present. SSMPD has slow dynamic response, and can't adjust independently the dither signal's amplitude and frequency;RDPD accelerates the current decay;consequently, it increases current ripple and power loss. For the purpose of solving the above mentioned problem, the tri-state modulation power driving(TSMPD) scheme was proposed for improving the performance of power driving. Detailedly, the hardware circuit for the tri-state modulation power driving is designed;the tri-state modulation algorithm is realized by digital signal processor(DSP). The tri-state modulation power driving is investigated by experiments, comparetive experiments among the single switch modulation power driving(SSMPD), reverse discharging power driving(RDPD), and the TSMPD are implemented, and the experimental results demonstrate that the linearity error of TSMDP meets the requirement of PA;the current response of TSMSP is the best;the amplitude of ripple current of the TSMPD can be reduced without increasing frequency of PWM, in addition, dither signal amplitude and frequency can be adjusted independently for each other. It is very meaningful to guide the development of high performance proportional amplifier for high frequency response proportional solenoid.

  4. Crystal structures of three complexes of zinc chloride with tri-tert-butylphosphane

    Directory of Open Access Journals (Sweden)

    Aaron D. Finke

    2016-01-01

    Full Text Available Under anhydrous conditions and in the absence of a Lewis-base solvent, a zinc chloride complex with tri-tert-butylphosphane as the μ-bridged dimer is formed, viz. di-μ-chlorido-bis[chloridobis(tri-tert-butylphosphanezinc], [ZnCl4(C12H27P2], (1, which features a nearly square-shaped (ZnCl2 cyclic core and whose Cl atoms interact weakly with C—H groups on the phosphane ligand. In the presence of THF, monomeric dichlorido(tetrahydrofuran-κO(tri-tert-butylphosphane-κPzinc, [ZnCl2(C4H8O(C12H27P] or [P(tBu3(THFZnCl2], (2, is formed. This slightly distorted tetrahedral Zn complex has weak C—H...Cl interactions between the Cl atoms and phosphane and THF C—H groups. Under ambient conditions, the hydrolysed complex tri-tert-butylphosphonium aquatrichloridozincate 1,2-dichloroethane monosolvate, (C12H28P[ZnCl3(H2O]·C2H4Cl2 or [HPtBu3]+ [(H2OZnCl3]−·C2H4Cl2, (3, is formed. This complex forms chains of [(H2OZnCl3]− anions from hydrogen-bonding interactions between the water H atoms and Cl atoms that propagate along the b axis.

  5. A Tri-Reference Point Theory of Decision Making under Risk

    Science.gov (United States)

    Wang, X. T.; Johnson, Joseph G.

    2012-01-01

    The tri-reference point (TRP) theory takes into account minimum requirements (MR), the status quo (SQ), and goals (G) in decision making under risk. The 3 reference points demarcate risky outcomes and risk perception into 4 functional regions: success (expected value of x greater than or equal to G), gain (SQ less than x less than G), loss (MR…

  6. Analysis of a Liquid Nitrogen-Cooled Tri-Axial High-Temperature Superconducting Cable System

    Science.gov (United States)

    Demko, J. A.; Lue, J. W.; Gouge, M. J.; Fisher, P. W.; Lindsay, D.; Roden, M.

    2004-06-01

    This tri-axial high-temperature superconducting (HTS) cable design uses three concentric superconducting layers for the phase conductors, separated by a cold dielectric material. The design offers an efficient HTS cable configuration by reducing the amount of superconductor needed and places all three phases in a single cryostat. The tri-axial cable cooling circuit analyzed includes heat loads at the ends for the cable terminations and cable heat loads due to ac, dielectric, and thermal losses. The HTS cable critical current and ac loss are functions of the local temperature that must be determined by the analysis. The radial heat transfer also has an influence on these parameters due to the relatively low thermal conductivity of the dielectric material separating the HTS phases. The study investigates whether the tri-axial cable must be cooled both inside the former and outside of the cable. In this study, the range of operating parameters for a tri-axial HTS cable system and refrigeration requirements are determined based on expected HTS tape performance.

  7. Tri(t-butyl)phosphine-assisted selective hydrosilylation of terminal alkynes

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    A highly efficient and regio-/stereoselective method of hydrosilylating terminal alkynes was developed using Pt(DVDS)-tri(t-butyl) phosphine catalyst system at room temperature.Trans-products or alpha-products were obtained almost exclusively depending on the alkynes and silanes employed.

  8. TRI mu P - A radioactive-atom mrapping facility at KVI

    NARCIS (Netherlands)

    Berg, G. P. A.; Dammalapati, U.; Dean, S.; Dendooven, P.; Dermois, O.; Jungmann, K.; Rogachevskiy, A.; Sohani, A.; Traykov, E.; Willmann, L.; Wischut, H. W.; Harissopulos, S; Demetriou, P; Julin, R

    2006-01-01

    The TRI mu P facility, under construction at KVI, requires the production and separation of short-lived and rare isotopes. For this purpose, we have designed, constructed and commissioned a versatile magnetic separator that allows efficient injection into an ion catcher, i.e., gas-filled stopper/coo

  9. Surface charge-specific cytotoxicity and cellular uptake of tri-block copolymer nanoparticles

    NARCIS (Netherlands)

    Bhattacharjee, S.; Ershov, D.S.; Gucht, van der J.; Alink, G.M.; Rietjens, I.; Zuilhof, H.; Marcelis, A.T.M.

    2013-01-01

    A series of monodisperse (45 ± 5 nm) fluorescent nanoparticles from tri-block copolymers (polymeric nanoparticles (PNPs)) bearing different surface charges were synthesised and investigated for cytotoxicity in NR8383 and Caco-2 cells. The positive PNPs were more cytotoxic and induced a higher intrac

  10. TRI mu P - A new facility to produce and trap radioactive isotopes

    NARCIS (Netherlands)

    Sohani, M

    At the Kernfysisch Vensneller Institiutr (KVI) in Groningen, NL, a new facility (TRI mu P) is under development. It aims for producing, slowing down, and trapping of radioactive isotopes in order to perform accurate measurements on fundamental symmetries and interactions. A production target station

  11. Wood-based Tri-Axial Sandwich Composite Materials: Design, Fabrication, Testing, Modeling and Application

    Science.gov (United States)

    Jinghao Li; John F. Hunt; Shaoqin Gong; Zhiyong Cai

    2014-01-01

    As the demand for sustainable materials increases, there are unique challenges and opportunities to develop light-weight green composites materials for a wide range of applications. Thus wood-based composite materials from renewable forests may provide options for some niche applications while helping to protect our environment. In this paper, the wood-based tri-axial...

  12. A continuous tri-phase transition effect for HIFU-mediated intravenous drug delivery.

    Science.gov (United States)

    Zhang, Kun; Chen, Hangrong; Li, Faqi; Wang, Qi; Zheng, Shuguang; Xu, Huixiong; Ma, Ming; Jia, Xiaoqing; Chen, Yu; Mou, Juan; Wang, Xia; Shi, Jianlin

    2014-07-01

    Aiming at substantially enhanced efficacy and biosafety of clinical HIFU therapy, a natural solid medium, L-menthol (LM), characteristic of mild and controllable "solid-liquid-gas" (SLG) tri-phase transition, was adopted, instead of those conventional explosive liquid-gas (LG) bi-phase transitional media, in constructing a multifunctional theranostic system. Owing to the continuous and controllable characteristics of SLG tri-phase transition, such a novel tri-phase transition-based theranostic system has been demonstrated of the repeatedly enhanced HIFU efficacy ex vivo and in vivo under once intravenous injection and the significantly improved treatment precision, controllability and biosafety when comparing to the traditional bi-phase transition medium, perfluorohexane (PFH), thus promising great application potential in clinical HIFU treatment. Moreover, this theranostic system has been demonstrated a long blood-circulation lifetime and continuous accumulation in tumor in 24 h, which is very beneficial for the enhanced tumor ablation in vivo along with SLG tri-phase transition. More importantly, after loading multiple model drugs and real drug, such a theranostic system presents a HIFU-mediated temperature-responsive drug release property, and depending on the versatile miscibility of LM, co-loadings with hydrophobic and hydrophilic drugs are also achieved, which provides the possibility of synergistic treatment combining HIFU therapy and chemotherapy. Copyright © 2014 Elsevier Ltd. All rights reserved.

  13. Changes in lipid membrane mechanics induced by di- and tri-phenyltins

    DEFF Research Database (Denmark)

    Przybyło, Magda; Drabik, Dominik; Szostak, Kamila

    2017-01-01

    properties of biological membranes. It was found that the membrane/water partition coefficient equals 4, a value significantly higher than octanol/water partition coefficient. In addition, the effect of di- and tri-phenyltin chlorides on the mechanics of model lipid membranes was measured for the first time...

  14. Tri-P-LETS: Changing the Face of High School Computer Science

    Science.gov (United States)

    Sherrell, Linda; Malasri, Kriangsiri; Mills, David; Thomas, Allen; Greer, James

    2012-01-01

    From 2004-2007, the University of Memphis carried out the NSF-funded Tri-P-LETS (Three P Learning Environment for Teachers and Students) project to improve local high-school computer science curricula. The project reached a total of 58 classrooms in eleven high schools emphasizing problem solving skills, programming concepts as opposed to syntax,…

  15. The TriCouncil for Nursing: An Interorganizational Collaboration for Advancing the Profession.

    Science.gov (United States)

    Bednash, Geraldine Polly

    2015-01-01

    The TriCouncil for Nursing is a coalition of 4 leading nursing organizations: the American Association of Colleges of Nursing, the American Nurses Association, the American Organization of Nurse Executives, and the National League for Nursing. This informal, yet highly complex, collaboration has endeavored to advance the profession for almost 4 decades despite the inherent challenges in coalition formation and sustainment. Coalition building occurs when organizations seek the potential to advance common issues or protect individual resources or status, and by their very nature have the potential to fail. The history of the TriCouncil for Nursing provides evidence of the challenges associated with the process of developing consensus and the benefits of working to create consensus to achieve common goals. The commitment of the TriCouncil member organizations to sustain this coalition and find consensus across an array of challenging issues and in complex environments has created significant policy advances for the profession, which provides evidence of the benefits associated with this type of collaborative work. This coalition has continued despite the inherent challenges for organizations seeking consensus. The TriCouncil commitment to lead in advocacy for the profession and create significant policy to change health care models the value of this type of effort.

  16. Large-scale integrated optics using TriPleXTM waveguide technology: from UV to IR

    NARCIS (Netherlands)

    Heideman, Rene; Leinse, Arne; Hoving, Willem; Dekker, R.; Geuzebroek, D.H.; Klein, E.J.; Stoffer, Remco; Roeloffzen, C.G.H.; Zhuang, L.; Meijerink, Arjan; Glebov, Alexei L.; Chen, Ray T.

    2009-01-01

    We present a new class of low-loss integrated optical waveguide structures as CMOS-compatible industrial standard for photonic integration on silicon or glass. A TriPleXTM waveguide is basically formed by a -preferably rectangular- silicon nitride (Si3N4) shell filled with and encapsulated by

  17. 77 FR 54811 - Safety Zone; TriRock San Diego, San Diego Bay, San Diego, CA

    Science.gov (United States)

    2012-09-06

    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriRock San Diego, San Diego Bay, San Diego... safety zone upon the navigable waters of the San Diego Bay, San Diego, CA, in support of a bay swim in San Diego Harbor. This safety zone is necessary to provide for the safety of the participants, crew...

  18. 78 FR 53243 - Safety Zone; TriRock San Diego, San Diego Bay, San Diego, CA

    Science.gov (United States)

    2013-08-29

    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriRock San Diego, San Diego Bay, San Diego... temporary safety zone upon the navigable waters of the San Diego Bay, San Diego, CA, in support of a... Bryan Gollogly, Waterways Management, U.S. Coast Guard Sector San Diego; telephone (619) 278-7656, email...

  19. A Tri-Citation Analysis Exploring the Citation Image of Kurt Lewin.

    Science.gov (United States)

    Marion, Linda S.

    2002-01-01

    Presents the initial phase of a comparison of cocitation and social network analysis methods for the study of scholarly communication, based on a case study of the intellectual contributions of Kurt Lewin, a social psychologist. Highlights include an author tri-citation analysis; cluster analysis; multidimensional scaling; and diffusion of ideas.…

  20. Continued development of a tried-and-tested safety system; Weiterentwicklung eines bewaehrten Sicherheitskonzepts

    Energy Technology Data Exchange (ETDEWEB)

    Blume, K.H.; Schray, B. [DaimlerChrysler AG, Stuttgart (Germany); Mueller, C.F.; Schoeneburg, R. [DaimlerChrysler AG, Stuttgart (DE). Mercedes Car Group (Germany)

    2004-10-15

    With the new A-Class, by finely tuning the shape, material strength, and material quality of each body design element, we have succeeded in perfecting a tried-and-tested safety system. New restraint systems and crash sensor technology ensure that the vehicle structure provides optimum occupant protection. (orig.)

  1. Biochemical, biophysical and IgE-epitope characterization of the wheat food allergen, Tri a 37.

    Directory of Open Access Journals (Sweden)

    Sandra Pahr

    Full Text Available Wheat is an important staple food and potent allergen source. Recently, we isolated a cDNA coding for wheat alpha-purothionin which is recognized by wheat food allergic patients at risk for severe wheat-induced allergy. The purpose of the present study was the biochemical, biophysical and IgE epitope characterization of recombinant alpha-purothionin. Synthetic genes coding for alpha-purothionin were expressed in a prokaryotic system using Escherichia coli and in a eukaryotic expression system based on baculovirus-infected Sf9-insect cells. Recombinant proteins were purified and characterized by SDS-PAGE, mass spectrometry, circular dichroism, chemical cross-linking and size exclusion chromatography. Five overlapping peptide were synthesized for epitope mapping. Alpha-purothionin-specific rabbit antibodies were raised to perform IgE-inhibition experiments and to study the resistance to digestion. The IgE reactivity of the proteins and peptides from ten wheat food allergic patients was studied in non-denaturing RAST-based binding assays. Alpha-purothionin was expressed in the prokaryotic (EcTri a 37 and in the eukaryotic system (BvTri a 37 as a soluble and monomeric protein. However, circular dichroism analysis revealed that EcTri a 37 was unfolded whereas BvTri a 37 was a folded protein. Both proteins showed comparable IgE-reactivity and the epitope mapping revealed the presence of sequential IgE epitopes in the N-terminal basic thionin domain (peptide1:KSCCRSTLGRNCYNLCRARGAQKLCAGVCR and in the C-terminal acidic extension domain (peptide3:KGFPKLALESNSDEPDTIEYCNLGCRSSVC, peptide4:CNLGCRSSVCDYMVNAAADDEEMKLYVEN. Natural Tri a 37 was digested under gastric conditions but resistant to duodenal digestion. Immunization with EcTri a 37 induced IgG antibodies which recognized similar epitopes as IgE antibodies from allergic patients and inhibited allergic patients' IgE binding. Reactivity to Tri a 37 does not require a folded protein and the presence of

  2. Biochemical, Biophysical and IgE-Epitope Characterization of the Wheat Food Allergen, Tri a 37

    Science.gov (United States)

    Pahr, Sandra; Selb, Regina; Weber, Milena; Focke-Tejkl, Margarete; Hofer, Gerhard; Dordić, Andela; Keller, Walter; Papadopoulos, Nikolaos G.; Giavi, Stavroula; Mäkelä, Mika; Pelkonen, Anna; Niederberger, Verena; Vrtala, Susanne; Valenta, Rudolf

    2014-01-01

    Wheat is an important staple food and potent allergen source. Recently, we isolated a cDNA coding for wheat alpha-purothionin which is recognized by wheat food allergic patients at risk for severe wheat-induced allergy. The purpose of the present study was the biochemical, biophysical and IgE epitope characterization of recombinant alpha-purothionin. Synthetic genes coding for alpha-purothionin were expressed in a prokaryotic system using Escherichia coli and in a eukaryotic expression system based on baculovirus-infected Sf9-insect cells. Recombinant proteins were purified and characterized by SDS-PAGE, mass spectrometry, circular dichroism, chemical cross-linking and size exclusion chromatography. Five overlapping peptid were synthesized for epitope mapping. Alpha-purothionin-specific rabbit antibodies were raised to perform IgE-inhibition experiments and to study the resistance to digestion. The IgE reactivity of the proteins and peptides from ten wheat food allergic patients was studied in non-denaturing RAST-based binding assays. Alpha-purothionin was expressed in the prokaryotic (EcTri a 37) and in the eukaryotic system (BvTri a 37) as a soluble and monomeric protein. However, circular dichroism analysis revealed that EcTri a 37 was unfolded whereas BvTri a 37 was a folded protein. Both proteins showed comparable IgE-reactivity and the epitope mapping revealed the presence of sequential IgE epitopes in the N-terminal basic thionin domain (peptide1:KSCCRSTLGRNCYNLCRARGAQKLCAGVCR) and in the C-terminal acidic extension domain (peptide3:KGFPKLALESNSDEPDTIEYCNLGCRSSVC, peptide4:CNLGCRSSVCDYMVNAAADDEEMKLYVEN). Natural Tri a 37 was digested under gastric conditions but resistant to duodenal digestion. Immunization with EcTri a 37 induced IgG antibodies which recognized similar epitopes as IgE antibodies from allergic patients and inhibited allergic patients' IgE binding. Reactivity to Tri a 37 does not require a folded protein and the presence of sequential Ig

  3. A tri-modality image fusion method for target delineation of brain tumors in radiotherapy.

    Science.gov (United States)

    Guo, Lu; Shen, Shuming; Harris, Eleanor; Wang, Zheng; Jiang, Wei; Guo, Yu; Feng, Yuanming

    2014-01-01

    To develop a tri-modality image fusion method for better target delineation in image-guided radiotherapy for patients with brain tumors. A new method of tri-modality image fusion was developed, which can fuse and display all image sets in one panel and one operation. And a feasibility study in gross tumor volume (GTV) delineation using data from three patients with brain tumors was conducted, which included images of simulation CT, MRI, and 18F-fluorodeoxyglucose positron emission tomography (18F-FDG PET) examinations before radiotherapy. Tri-modality image fusion was implemented after image registrations of CT+PET and CT+MRI, and the transparency weight of each modality could be adjusted and set by users. Three radiation oncologists delineated GTVs for all patients using dual-modality (MRI/CT) and tri-modality (MRI/CT/PET) image fusion respectively. Inter-observer variation was assessed by the coefficient of variation (COV), the average distance between surface and centroid (ADSC), and the local standard deviation (SDlocal). Analysis of COV was also performed to evaluate intra-observer volume variation. The inter-observer variation analysis showed that, the mean COV was 0.14(± 0.09) and 0.07(± 0.01) for dual-modality and tri-modality respectively; the standard deviation of ADSC was significantly reduced (ptri-modality; SDlocal averaged over median GTV surface was reduced in patient 2 (from 0.57 cm to 0.39 cm) and patient 3 (from 0.42 cm to 0.36 cm) with the new method. The intra-observer volume variation was also significantly reduced (p = 0.00) with the tri-modality method as compared with using the dual-modality method. With the new tri-modality image fusion method smaller inter- and intra-observer variation in GTV definition for the brain tumors can be achieved, which improves the consistency and accuracy for target delineation in individualized radiotherapy.

  4. Fully integrated optical coherence tomography, ultrasound, and indocyanine green-based fluorescence tri-modality system for intravascular imaging.

    Science.gov (United States)

    Li, Yan; Jing, Joseph; Qu, Yueqiao; Miao, Yusi; Zhang, Buyun; Ma, Teng; Yu, Mingyue; Zhou, Qifa; Chen, Zhongping

    2017-02-01

    We present a tri-modality imaging system and fully integrated tri-modality probe for intravascular imaging. The tri-modality imaging system is able to simultaneously acquire optical coherence tomography (OCT), ultrasound (US), and fluorescence imaging. Moreover, for fluorescence imaging, we used the FDA-approved indocyanine green (ICG) dye as the contrast agent to target lipid-loaded macrophages. We conducted imaging from a male New Zealand white rabbit to evaluate the performance of the tri-modality system. In addition, tri-modality images of rabbit aortas were correlated with hematoxylin and eosin (H&E) histology to check the measurement accuracy. The fully integrated miniature tri-modality probe, together with the use of ICG dye suggest that the system is of great potential for providing a more accurate assessment of vulnerable plaques in clinical applications.

  5. Synthesis of mercuric iodide and bismuth tri-iodide nanoparticles for heavy metal iodide films nucleation

    Energy Technology Data Exchange (ETDEWEB)

    Fornaro, L.; Pereira, H.Bentos [Compound Semiconductors Group, CURE, Universidad de la Republica, Rocha (Uruguay); Aguiar, I.; Perez Barthaburu, M. [Compound Semiconductors Group, Facultad de Quimica, Univ. de la Republica, Montevideo (Uruguay)

    2011-12-15

    We synthesized mercuric iodide and bismuth tri-iodide nanoparticles by suspension in octadecene, from Hg(NO{sub 3}){sub 2}.H{sub 2}O and I{sub 2}, and from Bi(NO{sub 3}){sub 3}.5H{sub 2}O and I{sub 2}, respectively. The best synthesis conditions were 2 h at 70-80 C, followed by 10 min at 110 C for mercuric iodide nanoparticles, and 4 h at 80-110 C, followed by 10 min at 180-210 C for bismuth tri-iodide ones. Nanoparticles were then washed and centrifuged with ether repeatedly. Compounds identity was confirmed by X-ray diffraction (XRD) and energy dispersive spectrometry (EDS). We found shifts of the X-ray diffraction maxima for nanoparticles of both compounds. We characterized the nanoparticles by transmission (TEM) and scanning (SEM) electron microscopy. We obtained disk-like and squared mercuric iodide nanostructures, 80-140 nm and 100-125 nm in size respectively. We also obtained rounded and rod-like bismuth tri-iodide nanoparticles, 30-500 nm in size. Acetonitrile and isopropanol suspensions of mercuric iodide nanoparticles, and acetonitrile suspension of bismuth tri-iodide nanoparticles exhibited peak maxima shifts in their UV-Vis spectra. We synthesized for the first time mercuric iodide and bismuth tri-iodide nanoparticles by the suspension method, although we have not yet obtained uniform shape and size distributions. They offer interesting perspectives for crystalline film nucleation and for improving current applications of these materials, as well as for opening new ones. (copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  6. High Performance Computing for Dsm Extraction from ZY-3 Tri-Stereo Imagery

    Science.gov (United States)

    Lu, Shuning; Huang, Shicun; Pan, Zhiqiang; Deng, Huawu; Stanley, David; Xin, Yubin

    2016-06-01

    ZY-3 has been acquiring high quality imagery since its launch in 2012 and its tri-stereo (three-view or three-line-array) imagery has become one of the top choices for extracting DSM (Digital Surface Model) products in China over the past few years. The ZY-3 tri-stereo sensors offer users the ability to capture imagery over large regions including an entire territory of a country, such as China, resulting in a large volume of ZY-3 tri-stereo scenes which require timely (e.g., near real time) processing, something that is not currently possible using traditional photogrammetry workstations. This paper presents a high performance computing solution which can efficiently and automatically extract DSM products from ZY-3 tri-stereo imagery. The high performance computing solution leverages certain parallel computing technologies to accelerate computation within an individual scene and then deploys a distributed computing technology to increase the overall data throughput in a robust and efficient manner. By taking advantage of the inherent efficiencies within the high performance computing environment, the DSM extraction process can exploit all combinations offered from a set of tri-stereo images (forward-backword, forward-nadir and backword-nadir). The DSM results merged from all of the potential combinations can minimize blunders (e.g., incorrect matches) and also offer the ability to remove potential occlusions which may exist in a single stereo pair, resulting in improved accuracy and quality versus those that are not merged. Accelerated performance is inherent within each of the individual steps of the DSM extraction workflow, including the collection of ground control points and tie points, image bundle adjustment, the creation of epipolar images, and computing elevations. Preliminary experiments over a large area in China have proven that the high performance computing system can generate high quality and accurate DSM products in a rapid manner.

  7. Locality Aware Optimal Task Scheduling Algorithm for TriBA——A Novel Scalable Architecture

    Institute of Scientific and Technical Information of China (English)

    KHAN Haroon-Ur-Rashid; SHI Feng

    2008-01-01

    An optimal algorithmic approach to task scheduling for,triplet based architecture(TriBA),is proposed in this paper.TriBA is considered to be a high performance,distributed parallel computing architecture.TriBA consists of a 2D grid of small,programmable processing units,each physically connected to its three neighbors.In parallel or distributed environment an efficient assignment of tasks to the processing elements is imperatire to achieve fast job turnaround time.Moreover,the sojourn time experienced by each individual job should be minimized.The arriving jobs are comprised of parallel applications,each consisting of multiple-independent tasks that must be instantaneously assigned to processor queues,as they arrive.The processors indeDendently and concurrently service these tasks.The key scheduling issues is,when some queue backlogs are small,an incoming job should first spread its tasks to those lightly loaded queues in order to take advantage of the parallel processing gain.Our algorithmic approach achieves optimality in task scheduling by assigning consecutive tasks to a triplet of processors exploiting locality in tasks.The experimental results show that tasks allocatian to triplets of processing elements is efficient and optimal.Comparison to well accepted interconnection strategy,2D mesh,is shown to prove the effectiveness of our algorithmic approach for TriBA.Finally we conclude that TriBA can be an efficient interconnection strategy for computations intensive applications,if tasks assignment is carried out optimally using algorithmic approach.

  8. Single-stage management with combined tri-endoscopic approach for concomitant cholecystolithiasis and choledocholithiasis.

    Science.gov (United States)

    Lv, Fujing; Zhang, Shutian; Ji, Ming; Wang, Yongjun; Li, Peng; Han, Wei

    2016-12-01

    The aim of this study was to investigate the value of a single stage with combined tri-endoscopic (duodenoscopy, laparoscopy and choledochoscopy) approach for patients with concomitant cholecystolithiasis and choledocholithiasis. Fifty-three patients with combined gallbladder stones and common bile duct stones from February 2014 to April 2015 were randomized assigned to two groups: 29 patients underwent single-stage surgery with combined duodenoscope, laparoscope and choledochoscope (combined tri-endoscopic group), and 29 patients underwent endoscopic sphincterotomy to remove common bile duct stones followed by laparoscopic cholecystectomy several days later (control group). The success rate of complete stone removal, procedure-related complication, hospital stay and the cost of hospitalization were compared between the two groups. Altogether, 53 patients (29 patients in combined tri-endoscopic group and 24 patients in control group) successfully underwent the surgery and ERCP procedure. Three patients in the control group developed post-ERCP pancreatitis. One case of bile leaking and one case of residual stone were noted in the combined tri-endoscopic group. There were no significant differences between the two groups with regard to both complete stone removal [96.6 % (28/29) vs. 100 % (24/24)] and procedure-related complication rate [3.4 % (1/29) vs. 12.5 % (3/24)] (p > 0.05). No open surgery was required in either group. There were significant differences between the two groups with regard to hospital stay (6.72 ± 1.3 days vs. 10.91 ± 1.6 days, p tri-endoscopic approach for concomitant cholecystolithiasis and choledocholithiasis was just as safe and successful as the control group. In addition, it resulted in a shorter hospital stay and less cost.

  9. Tri-linear interpolation-based cerebral white matter fiber imaging.

    Science.gov (United States)

    Jiang, Shan; Zhang, Pengfei; Han, Tong; Liu, Weihua; Liu, Meixia

    2013-08-15

    Diffusion tensor imaging is a unique method to visualize white matter fibers three-dimensionally, non-invasively and in vivo, and therefore it is an important tool for observing and researching neural regeneration. Different diffusion tensor imaging-based fiber tracking methods have been already investigated, but making the computing faster, fiber tracking longer and smoother and the details shown clearer are needed to be improved for clinical applications. This study proposed a new fiber tracking strategy based on tri-linear interpolation. We selected a patient with acute infarction of the right basal ganglia and designed experiments based on either the tri-linear interpolation algorithm or tensorline algorithm. Fiber tracking in the same regions of interest (genu of the corpus callosum) was performed separately. The validity of the tri-linear interpolation algorithm was verified by quantitative analysis, and its feasibility in clinical diagnosis was confirmed by the contrast between tracking results and the disease condition of the patient as well as the actual brain anatomy. Statistical results showed that the maximum length and average length of the white matter fibers tracked by the tri-linear interpolation algorithm were significantly longer. The tracking images of the fibers indicated that this method can obtain smoother tracked fibers, more obvious orientation and clearer details. Tracking fiber abnormalities are in good agreement with the actual condition of patients, and tracking displayed fibers that passed though the corpus callosum, which was consistent with the anatomical structures of the brain. Therefore, the tri-linear interpolation algorithm can achieve a clear, anatomically correct and reliable tracking result.

  10. Tri-linear interpolation-based cerebral white matter fiber imaging*

    Institute of Scientific and Technical Information of China (English)

    Shan Jiang; Pengfei Zhang; Tong Han; Weihua Liu; Meixia Liu

    2013-01-01

    Diffusion tensor imaging is a unique method to visualize white matter fibers three-dimensional y, non-invasively and in vivo, and therefore it is an important tool for observing and researching neural regeneration. Different diffusion tensor imaging-based fiber tracking methods have been already investigated, but making the computing faster, fiber tracking longer and smoother and the details shown clearer are needed to be improved for clinical applications. This study proposed a new fiber tracking strategy based on tri-linear interpolation. We selected a patient with acute infarction of the right basal ganglia and designed experiments based on either the tri-linear interpolation algorithm or tensorline algorithm. Fiber tracking in the same regions of interest (genu of the corpus cal osum) was performed separately. The validity of the tri-linear interpolation algorithm was verified by quan-titative analysis, and its feasibility in clinical diagnosis was confirmed by the contrast between tracking results and the disease condition of the patient as wel as the actual brain anatomy. Statis-tical results showed that the maximum length and average length of the white matter fibers tracked by the tri-linear interpolation algorithm were significantly longer. The tracking images of the fibers indicated that this method can obtain smoother tracked fibers, more obvious orientation and clearer details. Tracking fiber abnormalities are in good agreement with the actual condition of patients, and tracking displayed fibers that passed though the corpus cal osum, which was consistent with the anatomical structures of the brain. Therefore, the tri-linear interpolation algorithm can achieve a clear, anatomical y correct and reliable tracking result.

  11. Shock initiation of the tri-amino-tri-nitro-benzene based explosive PBX 9502 cooled to -55 bold">°C

    Science.gov (United States)

    Gustavsen, Richard L.; Gehr, Russell J.; Bucholtz, Scott M.; Alcon, Robert R.; Bartram, Brian D.

    2012-10-01

    We report a series of shock initiation experiments on PBX 9502 cooled to -55 °C. PBX 9502 consists of 95% dry aminated tri-amino-tri-nitro-benzene (TATB) and 5% poly-chloro-trifluoro-ethylene5 (Kel-F 800) binder. PBX 9502 samples were shock initiated by projectile impact from a two stage gas gun. Buildup to detonation was measured with 10 or more particle velocity gauges embedded at different depths in the sample. Three shock wave trackers measured the position of the shock front with time. Particle velocity vs. time wave-profiles and coordinates for onset of detonation were obtained as a function of the impact stress or pressure. PBX 9502 sample temperatures were monitored using type-E thermocouples, two inside the sample and two on the sample surface. Additional thermocouples were mounted on other parts of the cooling apparatus. Wave profiles from embedded gauges are qualitatively similar to those observed at 23 °C. However, at -55 °C, PBX 9502 is much less sensitive than at 23 °C. For example, at an inpact stress of 15.4 GPa, the distance to detonation at -55 °C is 7.8 mm. At 23 °C, the distance is 4.3 mm.

  12. Comprehensive Environmental Response, Compensation, and Liability Act, as amended by the Superfund Amendments and Reauthorization Act Section 120(e)(5). Annual report to Congress for Fiscal year 1992

    Energy Technology Data Exchange (ETDEWEB)

    1993-08-01

    The US Department of Energy (DOE) is committed to conducting its operations in a safe and environmentally sound manner. High priorities for the Department are identifying and correcting environmental problems at DOE facilities that resulted from past operations, and preventing environmental problems from occurring during present and future operations. In this regard, the Department is committed to clean up the 1989 inventory of sites in the Environmental Restoration Program by the year 2019. DOE has issued an Order and guidance establishing policy and procedures for activities conducted under the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA), as amended by the Superfund Amendments and Reauthorization Act (SARA), and has developed a Five-Year Plan, updated annually, that integrates planning for corrective activities, environmental restoration and waste management operations at its facilities. DOE also continues to conduct assessments (e.g., Management Audits, Environmental Safety and Health (ES & H) Progress Assessments, Internal Self Assessments) at its operating facilities to provide the Secretary of Energy with information on current environmental compliance status and follow-up on findings.

  13. Evaluation of geophysical logs and slug tests, phase II, at AIW Frank/Mid-County Mustang Superfund Site, Chester County, Pennsylvania

    Science.gov (United States)

    Conger, R.W.; Goode, D.J.; Sloto, R.A.

    2000-01-01

    Between September 1997 and October 1998, nine monitor wells were drilled at the AIW Frank/Mid-County Mustang Superfund Site in Chester County, Pa., to determine the horizontal and vertical distribution of contaminated ground water migrating from known contaminant sources. The U.S. Geological Survey conducted borehole geophysical logging and borehole television surveys in these boreholes to identify water-producing zones so that appropriate intervals could be screened in each borehole. Caliper logs and borehole television surveys were used to locate fractures; inflections on fluid-temperature and fluid-resistivity logs were used to locate possible water-bearing fractures, and heatpulseflowmeter measurements verified these locations. The borehole television surveys indicated that locally, the rocks of the Conestoga Limestone and Ledger Dolomite that underlie the site strike generally from northeast-southwest to east-west and dip steeply to the southeast and south approximately 63? to 76?. Slug tests were conducted at six boreholes to estimate transmissivity. Transmissivity from slug tests ranged from 21 feet squared per day in borehole CH-5669 to greater than 12,000 feet squared per day in boreholes CH-5665 and CH-5667. After interpretation of geophysical logs, borehole television surveys, and driller's logs, all boreholes were screened such that water-level fluctuations could be monitored and discrete water samples collected from one or more water-producing zones in each borehole.

  14. Identification of potential water-bearing zones by the use of borehole geophysics in the vicinity of Keystone Sanitation Superfund Site, Adams County, Pennsylvania and Carroll County, Maryland

    Science.gov (United States)

    Conger, Randall W.

    1997-01-01

    Between April 23, 1996, and June 21, 1996, the U.S. Environmental Protection Agency contracted Haliburton-NUS, Inc., to drill four clusters of three monitoring wells near the Keystone Sanitation Superfund Site. The purpose of the wells is to allow monitoring and sampling of shallow, intermediate, and deep waterbearing zones for the purpose of determining the horizontal and vertical distribution of any contaminated ground water migrating from the Keystone Site. Twelve monitoring wells, ranging in depth from 50 to 397.9 feet below land surface, were drilled in the vicinity of the Keystone Site. The U.S. Geological Survey conducted borehole-geophysical logging and determined, with geophysical logs and other available data, the ideal intervals to be screened in each well. Geophysical logs were run on four intermediate and four deep wells, and a caliper log only was run on shallow well CL-AD-173 (HN-1S). Interpretation of geophysical logs and existing data determined the placement of screens within each borehole.

  15. Evaluation of geophysical logs and video surveys in boreholes adjacent to the Berkley Products Superfund Site, West Cocalico Township, Lancaster County, Pennsylvania

    Science.gov (United States)

    Low, Dennis J.; Conger, Randall W.

    1998-01-01

    Between February 1998 and April 1998, geophysical logs were collected in nine boreholes adjacent to the Berkley Products Superfund Site, West Cocalico Township, Lancaster County, Pa. Video surveys were conducted on four of the nine boreholes. The boreholes range in depth from 320 to 508 feet below land surface, are completed open holes, have ambient vertical flow of water, and penetrate a series of interbedded siltstone, sandstone, and conglomerate units. The purpose of collecting geophysical-log data was to help determine horizontal and vertical distribution of contaminated ground water migrating from known or suspected sources and to aid in the placement of permanent borehole packers. The primary contaminants were derived from paint waste that included pigment sludges and wash solvents. The chlorinated volatile organic compounds probably originated from the wash solvents. Caliper logs and video surveys were used to locate fractures; inflections on fluid-resistivity and fluid-temperature logs were used to locate possible water-bearing fractures. Heatpulse-flowmeter measurements were used to verify the locations of water-producing or water-receiving zones and to measure rates of flow between water-bearing fractures. Single-point-resistance and natural-gamma logs provided information on stratigraphy. After interpretation of geophysical logs, video surveys, and driller's logs, permanent multiple-packer systems were installed in each borehole to obtain depth specific water samples from one or more water-bearing fractures in each borehole.

  16. PCBs and DDE in tree swallow (Tachycineta bicolor) eggs and nestlings from an estuarine PCB superfund site, New Bedford Harbor, MA, U.S.A.

    Science.gov (United States)

    Jayaraman, Saro; Nacci, Diane E.; Champlin, Denise M.; Pruell, Richard J.; Rocha, Kenneth J.; Custer, Christine M.; Custer, Thomas W.; Cantwell, Mark

    2009-01-01

    While breeding tree swallows (Tachycineta bicolor) have been used as biomonitors for freshwater sites, we report the first use of this species to assess contaminant bioaccumulation from estuarine breeding grounds into these aerial insectivores. Eggs and nestlings were collected from nest boxes in a polychlorinated biphenyl (PCB) contaminated estuary, the New Bedford Harbor Superfund site (NBH, Massachusetts, USA), and a reference salt marsh, Fox Hill (FH, Jamestown, Rhode Island, USA). Sediments, eggs, and nestlings were compared on a ng g−1 wet weight basis for total PCBs and DDE (1,1-bis-(4-chlorophenyl)-2,2-dichloroethene), metabolite of DDT (1,1,1-trichloro-2,2-bis-(p-chlorophenyl)ethane). NBH samples contained high concentrations of PCBs compared to FH for sediment (36,500 and 0.2), eggs (11,200 and 323), and nestlings (16,800 and 26). PCB homologue patterns linked tree swallow contamination to NBH sediment. NBH samples were also contaminated with DDE compared to FH for sediment (207 and 0.9) and nestlings (235 and 30) but not for eggs (526 and 488), suggesting both NBH and nonbreeding ground sources for DDE. The relationships between sediment and tree swallow egg and nestling PCBs were similar to those reported for freshwater sites. Like some highly contaminated freshwater sites, NBH PCB bioaccumulation had little apparent effect on reproductive success.

  17. Time series geophysical monitoring of permanganate injections and in situ chemical oxidation of PCE, OU1 area, Savage Superfund Site, Milford, NH, USA.

    Science.gov (United States)

    Harte, Philip T; Smith, Thor E; Williams, John H; Degnan, James R

    2012-05-01

    In situ chemical oxidation (ISCO) treatment with sodium permanganate, an electrically conductive oxidant, provides a strong electrical signal for tracking of injectate transport using time series geophysical surveys including direct current (DC) resistivity and electromagnetic (EM) methods. Effective remediation is dependent upon placing the oxidant in close contact with the contaminated aquifer. Therefore, monitoring tools that provide enhanced tracking capability of the injectate offer considerable benefit to guide subsequent ISCO injections. Time-series geophysical surveys were performed at a superfund site in New Hampshire, USA over a one-year period to identify temporal changes in the bulk electrical conductivity of a tetrachloroethylene (PCE; also called tetrachloroethene) contaminated, glacially deposited aquifer due to the injection of sodium permanganate. The ISCO treatment involved a series of pulse injections of sodium permanganate from multiple injection wells within a contained area of the aquifer. After the initial injection, the permanganate was allowed to disperse under ambient groundwater velocities. Time series geophysical surveys identified the downward sinking and pooling of the sodium permanganate atop of the underlying till or bedrock surface caused by density-driven flow, and the limited horizontal spread of the sodium permanganate in the shallow parts of the aquifer during this injection period. When coupled with conventional monitoring, the surveys allowed for an assessment of ISCO treatment effectiveness in targeting the PCE plume and helped target areas for subsequent treatment.

  18. Occurrences and fate of DDT principal isomers/metabolites, DDA, and o,p'-DDD enantiomers in fish, sediment and water at a DDT-impacted Superfund site.

    Science.gov (United States)

    Garrison, A W; Cyterski, M; Roberts, K D; Burdette, D; Williamson, J; Avants, J K

    2014-11-01

    In the 1950s and 60s, discharges from a DDT manufacturing plant contaminated a tributary system of the Tennessee River near Huntsville, Alabama, USA. Regulatory action resulted in declaring the area a Superfund site which required remediation and extensive monitoring. Monitoring data collected from 1988, after remediation, through 2011 showed annual decreases approximating first-order decay in concentrations of total DDT and its six principal congeners (p,p'-DDT, o,p'-DDT, p,p'-DDD, o,p'-DDD, p,p'-DDE and o,p'-DDE) in filets from three species of fish. As of 2013, these concentrations met the regulatory requirements of 5 mg/kg or less total DDT for each fish tested. The enantiomer fractions (EF) of chiral o,p'-DDD in smallmouth buffalo and channel catfish were always below 0.5, indicating preferential decay of the (+)-enantiomer of this congener; this EF did not change significantly over 15 years. The often-neglected DDT metabolite p,p'-DDA was found at a concentration of about 20 μg/l in the ecosystem water.

  19. Geophysical Logs, Specific Capacity, and Water Quality of Four Wells at Rogers Mechanical (former Tate Andale) Property, North Penn Area 6 Superfund Site, Lansdale, Pennsylvania, 2006-07

    Science.gov (United States)

    Senior, Lisa A.; Bird, Philip H.

    2010-01-01

    As part of technical assistance to the U.S. Environmental Protection Agency (USEPA) in the remediation of properties on the North Penn Area 6 Superfund Site in Lansdale, Pa., the U.S. Geological Survey (USGS) in 2006-07 collected data in four monitor wells at the Rogers Mechanical (former Tate Andale) property. During this period, USGS collected and analyzed borehole geophysical and video logs of three new monitor wells (Rogers 4, Rogers 5, and Rogers 6) ranging in depth from 80 to 180 feet, a borehole video log and additional heatpulse-flowmeter measurements (to quantify vertical borehole flow) in one existing 100-foot deep well (Rogers 3S), and water-level data during development of two wells (Rogers 5 and Rogers 6) to determine specific capacity. USGS also summarized results of passive-diffusion bag sampling for volatile organic compounds (VOCs) in the four wells. These data were intended to help understand the groundwater system and the distribution of VOC contaminants in groundwater at the property.

  20. POST-REMEDIATION BIOMONITORING OF PESTICIDES AND OTHER CONTAMINANTS IN MARINE WATERS AND SEDIMENT NEAR THE UNITED HECKATHORN SUPERFUND SITE, RICHMOND, CALIFORNIA

    Energy Technology Data Exchange (ETDEWEB)

    Antrim, Liam D.; Kohn, Nancy P.

    2000-09-06

    Marine sediment remediation at the United Heckathorn Superfund Site was completed in April 1997. Water and mussel tissues were sampled in February 1999 from four stations near Lauritzen Canal in Richmond, California, for Year 2 of post-remediation monitoring of marine areas near the United Heckathorn Site. Dieldrin and dichlorodiphenyl trichloroethane (DDT) were analyzed in water samples, tissue samples from resident mussels, and tissue samples from transplanted mussels deployed for 4 months. Mussel tissues were also analyzed for polychlorinated biphenyls (PCB), which were detected in sediment samples. Chlorinated pesticide concentrations in water samples were similar to preremediation levels and did not meet remediation goals. Biomonitoring results indicated that the bioavailability of chlorinated pesticides has been reduced from preremediation levels both in the dredged area and throughout Richmond Harbor. Total DDT and dieldrin concentrations in mussel tissues were lower than measured levels from preremediation surveys and also lower than Year 1 levels from post-remediation biomonitoring. Sediment analyses showed the presence of elevated DDT, dieldrin, PCB aroclor 1254, and very high levels of polynuclear aromatic hydrocarbons (PAH) in Lauritzen Channel.

  1. Time series geophysical monitoring of permanganate injections and in situ chemical oxidation of PCE, OU1 area, Savage Superfund Site, Milford, NH, USA

    Science.gov (United States)

    Harte, Philip T.; Smith, Thor E.; Williams, John H.; Degnan, James R.

    2012-05-01

    In situ chemical oxidation (ISCO) treatment with sodium permanganate, an electrically conductive oxidant, provides a strong electrical signal for tracking of injectate transport using time series geophysical surveys including direct current (DC) resistivity and electromagnetic (EM) methods. Effective remediation is dependent upon placing the oxidant in close contact with the contaminated aquifer. Therefore, monitoring tools that provide enhanced tracking capability of the injectate offer considerable benefit to guide subsequent ISCO injections. Time-series geophysical surveys were performed at a superfund site in New Hampshire, USA over a one-year period to identify temporal changes in the bulk electrical conductivity of a tetrachloroethylene (PCE; also called tetrachloroethene) contaminated, glacially deposited aquifer due to the injection of sodium permanganate. The ISCO treatment involved a series of pulse injections of sodium permanganate from multiple injection wells within a contained area of the aquifer. After the initial injection, the permanganate was allowed to disperse under ambient groundwater velocities. Time series geophysical surveys identified the downward sinking and pooling of the sodium permanganate atop of the underlying till or bedrock surface caused by density-driven flow, and the limited horizontal spread of the sodium permanganate in the shallow parts of the aquifer during this injection period. When coupled with conventional monitoring, the surveys allowed for an assessment of ISCO treatment effectiveness in targeting the PCE plume and helped target areas for subsequent treatment.

  2. PERANAN “DESA PAKRAMAN “ DALAM MEMPERKUAT KETAHANAN SOSIAL BUDAYA MELALUI KONSEP AJARAN “TRI HITA KARANA”

    Directory of Open Access Journals (Sweden)

    Ni Wayan Suarmini

    2011-06-01

    Full Text Available Arus globalisasi telah melanda dunia saat ini, batas-batas suatu wilayah ataupun negara seolah-olah semakin transparan. Hal ini membawa dampak pada kehidupan masyarakatnya. Desa-desa di Bali memiliki lembaga adat yang khusus mengurusi tentang Adat disebut Desa Pakraman. Dalam mengatur desa Pakraman menggunakan filosofi Tri Hita Karana (tiga penyebab kesejahteraan, diwujudkan dalam tiga hubungan, yakni hubungan manusia dengan Tuhan, hubungan manusia dengan manusia, dan hubungan manusia dengan lingkungannya. Tiga hubungan itu sebagai landasan dalam memperkuat ketahanan sosial budaya. Permasalahan dalam penelitian ini adalah bagaimanakah implementasi Tri Hita Karana dan bagaimanakah peranan Tri Hita Karana dalam memperkuat ketahanan sosial budaya di Desa Pakraman. Tujuan penelitian yang ingin dicapai adalah mengetahui implementasi Tri Hita Karana, dan mengetahui peranan Tri Hita Karana dalam memperkuat ketahanan sosial budaya. Penelitian ini dilakukan di Desa Pakraman Darmasaba. Data dikumpulkan menggunakan teknik wawancara, observasi dan dokumentasi, dan data dianalisis secara kualitatif. Hasil penelitian yang dicapai adalah Tri hita Karana diimplementasikan secara nyata pada Desa Pakraman dengan wujud Kahyangan Tiga sebagai media hubungan manusia dengan Tuhan, menyama braya sebagai media hubungan manusia dengan sesama manusia, dan penataan ruang dengan konsep Tri Mandala dan Tri Angga sebagai wujud kepedulian manusia terhadap lingkungan. Implementasi Tri Hita Karana yang dilaksanakan secara nyata dan turun temurun di Desa Pakraman dapat memperkuat ketahanan sosial budaya sebagai penanggkal pengaruh global yang tidak sesuai dengan nilai-nilai lokal

  3. Dual and tri-band bandpass filters based on novel Π-shaped resonator

    Science.gov (United States)

    Xiao, Jian-Kang; Zhu, Wen-Jun; Zhao, Wei

    2014-05-01

    A novel Π-shaped resonator is proposed, and compact dual-band and tri-band bandpass filters that meet IEEE 802.11 application requirements by using the new resonator are designed. The dual-band bandpass filter centres at 2.45 and 5.6 GHz with a simulated passband insertion loss of no more than 0.8 dB, and the tri-band bandpass filter which is got by two-path coupling achieves simulated passband insertion loss of no more than 1.1 dB. The new designs are demonstrated by experiment. The new filters have advantages of simple and compact structures, low passband insertion losses, good frequency selectivity and miniature circuit sizes. All these have prospect to be applied in future wireless communication systems.

  4. Adaptive behaviour, tri-trophic food-web stability and damping of chaos

    DEFF Research Database (Denmark)

    Visser, Andre; Mariani, Patrizio; Pigolotti, Simone

    2012-01-01

    We examine the effect of adaptive foraging behaviour within a tri-trophic food web with intra-guild predation. The intra-guild prey is allowed to adjust its foraging effort so as to achieve an optimal per capita growth rate in the face of realized feeding, predation risk and foraging cost. Adaptive...... directly. The latter condition is a general criterion for the feasibility of intra-guild predation as a trophic mode. Under these conditions, we demonstrate rigorously that adaptive behaviour will always promote stability of community dynamics in the sense that the region of parameter space in which...... fitness-seeking behaviour of the intra-guild prey has a stabilizing effect on the tri-trophic food-web dynamics provided that (i) a finite optimal foraging effort exists and (ii) the trophic transfer efficiency from resource to predator via the intra-guild prey is greater than that from the resource...

  5. Third family corrections to tri-bimaximal lepton mixing and a new sum rule

    Energy Technology Data Exchange (ETDEWEB)

    Antusch, Stefan [Max-Planck-Institut fuer Physik (Werner-Heisenberg-Institut) Foehringer Ring 6, D-80805 Muenchen (Germany)], E-mail: antusch@mppmu.mpg.de; King, Stephen F. [School of Physics and Astronomy, University of Southampton, SO16 1BJ Southampton (United Kingdom)], E-mail: sfk@hep.phys.soton.ac.uk; Malinsky, Michal [School of Physics and Astronomy, University of Southampton, SO16 1BJ Southampton (United Kingdom)], E-mail: malinsky@phys.soton.ac.uk

    2009-01-19

    We investigate the theoretical stability of the predictions of tri-bimaximal neutrino mixing with respect to third family wave-function corrections. Such third family wave-function corrections can arise from either the canonical normalisation of the kinetic terms or renormalisation group running effects. At leading order both sorts of corrections can be subsumed into a single universal parameter. For hierarchical neutrinos, this leads to a new testable lepton mixing sum rule s=rcos{delta}+2/3 a (where s,r,a describe the deviations of solar, reactor and atmospheric mixing angles from their tri-bimaximal values, and {delta} is the observable Dirac CP phase) which is stable under all leading order third family wave-function corrections, as well as Cabibbo-like charged lepton mixing effects.

  6. A tri-continuous mesoporous material with a silica pore wall following a hexagonal minimal surface

    KAUST Repository

    Han, Yu

    2009-04-06

    Ordered porous materials with unique pore structures and pore sizes in the mesoporous range (2-50nm) have many applications in catalysis, separation and drug delivery. Extensive research has resulted in mesoporous materials with one-dimensional, cage-like and bi-continuous pore structures. Three families of bi-continuous mesoporous materials have been made, with two interwoven but unconnected channels, corresponding to the liquid crystal phases used as templates. Here we report a three-dimensional hexagonal mesoporous silica, IBN-9, with a tri-continuous pore structure that is synthesized using a specially designed cationic surfactant template. IBN-9 consists of three identical continuous interpenetrating channels, which are separated by a silica wall that follows a hexagonal minimal surface. Such a tri-continuous mesostructure was predicted mathematically, but until now has not been observed in real materials. © 2009 Macmillan Publishers Limited. All rights reserved.

  7. Biomass production, symbiotic nitrogen fixation and inorganic N use in dual tri-component annual intercrops

    DEFF Research Database (Denmark)

    Andersen, M.K.; Hauggaard-Nielsen, H.; Ambus, P.

    2005-01-01

    an initial competitive advantage, an advantage that in the two dual intercrops was strengthened by the addition of N. Apparently the competitive superiority of barley was less strong in the tri-component intercrop, indicating that the impact of the dominant may, through improved growth of both rape and pea......The interspecific complementary and competitive interactions between pea (Pisum sativum L.), barley (Hordeum vulgare L.) and oilseed rape (Brassica napus L.), grown as dual and tri-component intercrops were assessed in a field study in Denmark. Total biomass production and N use at two levels of N......, have been diminished through indirect facilitation. Interspecific competition had a promoting effect on the percent of nitrogen derived from N(2) fixation of pea, and most so at the low N fertilisation level. Results indicate that the benefits achieved from the association of a legume and nonlegume...

  8. Structure study of the tri-continuous mesoporous silica IBN-9 by electron crystallography

    KAUST Repository

    Zhang, Daliang

    2011-12-01

    High resolution electron microscopy (HRTEM) has unique advantages for structural determination of nano-sized porous materials compared to X-ray diffraction, because it provides the important structure factor phase information which is lost in diffraction. Here we demonstrate the structure determination of the first tri-continuous mesoporous silica IBN-9 by electron crystallography. IBN-9 has a hexagonal unit cell with the space group P6 3/mcm and a = 88.4 , c = 84.3 . HRTEM images taken along three main directions, [0 0 1], [11̄0] and [1 0 0] were combined to reconstruct the 3D electrostatic potential map, from which the tri-continuous pore structure of IBN-9 was discovered. The different steps of structure determination of unknown mesoporous structures by electron crystallography are described in details. Similar procedures can also be applied for structure determination of other porous and nonporous crystalline materials. © 2011 Elsevier Inc. All rights reserved.

  9. NASA Marshall Space Flight Center Tri-gas Thruster Performance Characterization

    Science.gov (United States)

    Dorado, Vanessa; Grunder, Zachary; Schaefer, Bryce; Sung, Meagan; Pedersen, Kevin

    2013-01-01

    Historically, spacecraft reaction control systems have primarily utilized cold gas thrusters because of their inherent simplicity and reliability. However, cold gas thrusters typically have a low specific impulse. It has been determined that a higher specific impulse can be achieved by passing a monopropellant fluid mixture through a catalyst bed prior to expulsion through the thruster nozzle. This research analyzes the potential efficiency improvements from using tri-gas, a mixture of hydrogen, oxygen, and an inert gas, which in this case is helium. Passing tri-gas through a catalyst causes the hydrogen and oxygen to react and form water vapor, ultimately heating the exiting fluid and generating a higher specific impulse. The goal of this project was to optimize the thruster performance by characterizing the effects of varying several system components including catalyst types, catalyst lengths, and initial catalyst temperatures.

  10. Forecasting TRY/USD Exchange Rate with Various Artificial Neural Network Models

    Directory of Open Access Journals (Sweden)

    Cagatay Bal

    2017-02-01

    Full Text Available Exchange rate forecasting is one of the most common subjects among the forecasting problem field. Researchers and academicians from many different disciplines proposed various approaches for better exchange rate forecasting. In recent years, for solving the stated forecasting problem artificial neural networks have become successful tool to obtain solutions. Many different artificial neural networks have been used, developed and still developing for even better and trustable forecasts. In this study, TRY/USD exchange rate forecasting is modeled with different learning algorithms, activations functions and performance measures. Various Artificial Neural Network (ANN models for better forecasting were investigated, compared and the obtained forecasting results interpreted respectively. The results of the application show that Variable Learning Rate Backpropagation learning algorithm with tan-sigmoid activation function has the best performance for TRY/USD exchange rate forecasting.

  11. The VA, VCD, Raman and ROA spectra of tri-L-serine in aqueous solution

    DEFF Research Database (Denmark)

    Jürgensen, Vibeke Würtz; Jalkanen, Karl J.

    2006-01-01

    investigated for one conformer, with the goal to determine which level of theory is appropriate to use in the systematic search of the conformational space. In addition, the effects of the counterion, here Cl- anion, are also investigated. Here we present the current state of the art in nanobiology, where......The structures of one conformer of the nonionic neutral and zwitterionic species of L-serinyl L-serinyl L-serine (SSS or tri-L-serine), together with its cationic and anionic species and the capped N-acetyl tri-L-serine N'-methylamide analog were optimized with density functional theory...... with the Becke 3LYP hybrid exchange correlation (XC) functional and the PW91 GGA XC functional and the 6-31G* and aug-cc-pVDZ basis sets. Subsequently, the vibrational absorption, vibrational circular dichroism, Raman and Raman optical activity spectra were simulated in order to compare them to experimentally...

  12. Histone acetylation dependent energy landscapes in tri-nucleosome revealed by residue-resolved molecular simulations

    Science.gov (United States)

    Chang, Le; Takada, Shoji

    2016-01-01

    Histone tail acetylation is a key epigenetic marker that tends to open chromatin folding and activate transcription. Despite intensive studies, precise roles of individual lysine acetylation in chromatin folding have only been poorly understood. Here, we revealed structural dynamics of tri-nucleosomes with several histone tail acetylation states and analyzed histone tail interactions with DNA by performing molecular simulations at an unprecedentedly high resolution. We found versatile acetylation-dependent landscapes of tri-nucleosome. The H4 and H2A tail acetylation reduced the contact between the first and third nucleosomes mediated by the histone tails. The H3 tail acetylation reduced its interaction with neighboring linker DNAs resulting in increase of the distance between consecutive nucleosomes. Notably, two copies of the same histone in a single nucleosome have markedly asymmetric interactions with DNAs, suggesting specific pattern of nucleosome docking albeit high inherent flexibility. Estimated transcription factor accessibility was significantly high for the H4 tail acetylated structures. PMID:27698366

  13. The meaning of tri-junction point in laparoscopic gastric cancer surgery

    Institute of Scientific and Technical Information of China (English)

    2015-01-01

    Objective:It is admitted that, within gastric cancer surgery, the right layers as well as appropriate spaces demobilized between the target carcinoma mass and peripheral parts are worthy properly researching. This article is trying to delineate the entrances to the right layers in alimentary tract cancer surgery, especially in laparoscopic gastric cancer, with a brand new conception called ‘Tri-junction Point’, abbreviated as TJ point.Methods: Based on experienced laparoscopic surgeons indications and microscopy histological slices observation on dissected peripheral adipose tissues in laparoscopic gastric cancer surgery.Results:The TJ points have been found located in different parts of abdominal mesenteries.Conclusion:The four TJ points in gastric peripheral adipose can be useful to guide a bloodless laparoscopic surgery with a promising start.

  14. Efficient tri-wavelength actively Q-switched Yb:GAGG laser

    Science.gov (United States)

    Zhao, Ruwei; Zhang, Baitao; Jia, Zhitai; Su, Xiancui; Lou, Fei; Zhang, Haikun; He, Jingliang; Liu, Fengqin

    2015-01-01

    An efficient acousto-optic Q-switched Yb-doped Gd3AlxGa5-xO12 (GAGG) (x = 0.5) laser is demonstrated. Under the absorbed pump power of 7.4 W, the maximum average output power of 1.4 W is obtained at the pulse repletion rate of 1 kHz , with the slope efficiency as high as 32%. The pulse width of 40 ns is achieved with the pulse energy and peak power of 1.4 mJ and 35 kW, respectively. What' more, the output spectrum shows itself tri-wavelength in either CW or Q-switching mode. To our knowledge, this is the first time for realizing simultaneous tri-wavelength Yb:GAGG laser actively Q-switched operation.

  15. Energy transfer and NIR emission in rare earth tri-doped barium lanthanum fluoro tellurite glasses

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, J. Suresh; Pavani, K.; Graca, M.P.F.; Soares, M.J. [Department of Physics and I3N, University of Aveiro (Portugal); Venkataiah, G. [Department of Physics, Sri Venkateswara University, Tirupati (India); Jayasimhadri, M. [Department of Applied Physics, Delhi Technological University, Delhi (India)

    2014-09-15

    Barium lanthanum fluoro tellurite (BLFT) glasses doped with rare earth ions (ErF{sub 3}, PrF{sub 3} and YbF{sub 3}) both singly or in combinations were prepared by melt-quench technique and analysed spectroscopically. The prepared glasses were found to be mechanically strong and transparent. Optical absorption and NIR fluorescence were measured to the highly transparent and stable glass samples. Judd-Ofelt parameters and radiative properties were estimated for the single rare earth doped BLFT glasses using the optical absorption spectra. NIR fluorescence is measured using laser excitation. From the NIR emission spectra, energy transfer among the rare earth ions is analysed in the rare earth tri-doped BLFT glasses. These rare earth tri-doped BLFT glasses are found to be highly useful for the multi- wavelength emission in the NIR region for opto-electronic applications. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  16. Fabrication and evaluation of auto-stripped tri-layer wound dressing for extensive burn injury

    Energy Technology Data Exchange (ETDEWEB)

    Lin, F.-H. [Institute of Biomedical Engineering, College of Medicine and College of Engineering, National Taiwan University, Taipei, Taiwan (China); Department of Biomedical Engineering, National Taiwan University Hospital, Taipei, Taiwan (China); Tsai, J.-C. [Department of Materials Engineering, Ta Tung University, Taipei, Taiwan (China); Chen, T.-M. [Department of Plastic Surgery, Tri-service Hospital, Taipei, Taiwan (China); Chen, K.-S. [Department of Materials Engineering, Ta Tung University, Taipei, Taiwan (China); Yang, J.-M. [Department of Chemical Engineering, Chang Gung University, Tao-Yuan, Taiwan (China); Kang, P.-L. [Cardiovascular Division, Department of Surgery, Kaohsiung Veterans General Hospital, Kaohsiung, Taiwan (China)]. E-mail: plkang@vghks.gov.tw; Wu, T-H. [Institute of Nuclear Energy Research, ROCEA, Tao-Yuan, Taiwan (China)

    2007-04-15

    In the study, we are going to develop a tri-layer membrane as the artificial skin for extensive burn injury. The first layer is a three-dimensional tri-copolymer sponge of gelatin/hyaluronan/chodroitin-6-sulfate with 70% in porosity and 20-100 {mu}m in pore size. The layer is constructed as a dermis analogous layer to stimulate capillaries penetration, to promote dermal fibroblast migration and to induce the secretion of extra-cellular matrix, which provides a better physiological environment for burn patient recovery. The second layer is as so called auto-stripped layer composed by poly-N-isopropyacrylamide (PNIPAAm). The layer will be automatically peeled off from the tri-copolymer layer once the wound site closed and recovered. The third layer is composed by polypropylene (PP) non-woven fabric, which provides an open structure for exudates drainage out that will reduce the risk of second infection. The tri-layer wound dressing has been successfully prepared by subsequently high-energy plasma treatment, {gamma}-ray irradiation, UV light exposure, and lyophilized process. From the results of MTT, IL-8, IL-1{alpha}, IL-6, and TNF-{alpha} measurement, the developed material will not induce tissue inflammatory or immune response. The dermal fibroblasts showed initial contact with the material surface through the radial extension of filopodia followed by cytoplasmic webbing that could be examined by SEM. Dermal fibroblasts subsequently flattened for further proliferation and extra-cellular matrix secretion. Dermal analog layer provides a three-dimensional architecture for normal dermis regeneration. The layer can be completely biodegraded within 4 weeks post-operation. After served as a scaffold for the ingrowth of self-fibroblasts, a normal dermis like layer will be regenerated. The dressing will fall off automatically without any damage once the wound site healed completely.

  17. TRI{mu}P - A radioactive isotope trapping facility at KVI

    Energy Technology Data Exchange (ETDEWEB)

    Berg, G.P.A.; Dendooven, P.; Dermois, O.; Harakeh, M.N.; Hoekstra, R.; Hoekstra, S.; Jungmann, K.; Kopecky, S.; Kravchuk, V.; Morgenstern, R.; Rogachevskiy, A.; Willmann, L.; Wilschut, H.W

    2003-06-30

    TRI{mu}P, a new research facility to produce and trap rare and short-lived isotopes for high precision physics experiments is under design and construction at KVI. This facility makes use of the existing super-conducting cyclotron and the infrastructure of the laboratory. To be able to study a large variety of heavy ions a new dual function magnetic separator has been developed. Details of the separator and the status of the project will be presented.

  18. Crystal structures of three 3,4,5-tri-meth-oxy-benzamide-based derivatives.

    Science.gov (United States)

    Gomes, Ligia R; Low, John Nicolson; Oliveira, Catarina; Cagide, Fernando; Borges, Fernanda

    2016-05-01

    The crystal structures of three benzamide derivatives, viz. N-(6-hy-droxy-hex-yl)-3,4,5-tri-meth-oxy-benzamide, C16H25NO5, (1), N-(6-anilinohex-yl)-3,4,5-tri-meth-oxy-benzamide, C22H30N2O4, (2), and N-(6,6-di-eth-oxy-hex-yl)-3,4,5-tri-meth-oxy-benzamide, C20H33NO6, (3), are described. These compounds differ only in the substituent at the end of the hexyl chain and the nature of these substituents determines the differences in hydrogen bonding between the mol-ecules. In each mol-ecule, the m-meth-oxy substituents are virtually coplanar with the benzyl ring, while the p-meth-oxy substituent is almost perpendicular. The carbonyl O atom of the amide rotamer is trans related with the amidic H atom. In each structure, the benzamide N-H donor group and O acceptor atoms link the mol-ecules into C(4) chains. In 1, a terminal -OH group links the mol-ecules into a C(3) chain and the combined effect of the C(4) and C(3) chains is a ribbon made up of screw related R 2 (2)(17) rings in which the ⋯O-H⋯ chain lies in the centre of the ribbon and the tri-meth-oxy-benzyl groups forms the edges. In 2, the combination of the benzamide C(4) chain and the hydrogen bond formed by the terminal N-H group to an O atom of the 4-meth-oxy group link the mol-ecules into a chain of R 2 (2)(17) rings. In 3, the mol-ecules are linked only by C(4) chains.

  19. Intelligence Networks and the Tri Border Area of South America: The Dilemma of Efficiency Versus Oversight

    Science.gov (United States)

    2002-12-01

    in partial fulfillment of the requirements for the degree of MASTER OF ARTS IN NATIONAL SECURITY AFFAIRS AND CIVIL- MILITARY RELATIONS from...States as trying to be the dominant player in the Western Hemisphere. By selling Brazil an advanced aircraft with state of the art technology, the...terrorist activity within the area. This was in direct conflict to the statements made by the Paraguayan representative, Marcial Bobadilla, Deputy Chief

  20. Tri-Level Optimization Algorithms for Solving Defender-Attacker-Defender Network Models

    Science.gov (United States)

    2016-06-01

    linear , integer and binary programs. A common application for the DAD model is a network flow problem. As an example, we formally define the tri-level...analysis is required for unknown budgetary parameters. Vector norm and matrix norm methods are from linear algebra ; optimality gap analysis is adapted...problem. Transportation Science, 9(3), 183-199. Retrieved from http://dx.doi.org.libproxy.nps.edu/10.1287/trsc.9.3.183 Leon, S. (2010). Linear algebra

  1. Probing neutrino masses and tri-bimaximality with lepton flavor violation searches

    CERN Document Server

    Kojima, Kentaro

    2009-01-01

    We examine relation between neutrino oscillation parameters and prediction of lepton flavor violation, in light of deviations from tri-bimaximal mixing. Our study shows that upcoming experimental searches for lepton flavor violation process can provide useful implications for neutrino mass spectrum and mixing angles. With simple structure of heavy right-handed neutrino and supersymmetry breaking sectors, the discovery of tau \\to mu gamma decay determines neutrino mass hierarchy if large (order 0.1) reactor angle is established.

  2. Terrorism Base Potential in the Tri-Border Area of Latin America

    Science.gov (United States)

    2006-12-01

    Jihad, tracing the dollars behind the terror networks. 20 Raymond Baker, “Money Laundering and Flight Capital: The Impact on Private Banking... Bayer .40 The Tri-border area also plays a huge role in car smuggling that are stolen in Argentina. According to statements made by the head of the...2001). Baker, Raymond . “Money Laundering and Flight Capital: The Impact on Private Banking,” Senate Committee on Governmental Affairs, Permanent

  3. Tri-n-butylphosphane catalyzed ring opening of aziridines with secondary amines

    Institute of Scientific and Technical Information of China (English)

    Wan Xuan Zhang; Li Su; Wei Gang Hu; Jie Zhou

    2012-01-01

    Ring opening of aziridine with dialkyl amine took place readily in the presence of catalytic amounts of tri-n-butylphosphane (10 mol%) in the mixture of CH3CN/H2O (10:1),giving corresponding vicinal diamines in mediate to high yields (58-95%) with good regioselecfivifie,while aromatic secondary amine could not react under the same condifions.Tti-n-butylphosphane exhibited different catalytic selectivity to amines from Lewis acid catalysts.

  4. The Influence of Tri-language Transfer on the English Learning among the Uygur Students

    Institute of Scientific and Technical Information of China (English)

    赵文龙

    2014-01-01

    Language transfer(LA) is the fundamental notion in language learning. Owing to the difference in area and minorities, the language teaching is particular in Xinjiang Uygur Autonomous Region. This article aims at presenting the Tri-language Transfer among Uygur, English and Chinese and the interrelationship between them to explore the significant role LA plays. Hopefully, it will give some constructive advice and enlightenment on the development of English teaching and learning among the Uygur students.

  5. TriQuint Semiconductor开发出高功率GaN HEMT

    Institute of Scientific and Technical Information of China (English)

    陈裕权

    2004-01-01

    <正> 美国TriQuint Semiconductor公司和Lockheed Martin公司开发出一种可提高功率、效率和稳定性的先进GaN工艺方法。 GaN HEMT器件具有高功率,用于相控阵雷达、电子战及通信系统。提高该器件的

  6. Ambipolar Organic Tri-Gate Transistor for Low-Power Complementary Electronics.

    Science.gov (United States)

    Torricelli, Fabrizio; Ghittorelli, Matteo; Smits, Edsger C P; Roelofs, Christian W S; Janssen, René A J; Gelinck, Gerwin H; Kovács-Vajna, Zsolt M; Cantatore, Eugenio

    2016-01-13

    Ambipolar transistors typically suffer from large off-current inherently due to ambipolar conduction. Using a tri-gate transistor it is shown that it is possible to electrostatically switch ambipolar polymer transistors from ambipolar to unipolar mode. In unipolar mode, symmetric characteristics with an on/off current ratio of larger than 10(5) are obtained. This enables easy integration into low-power complementary logic and volatile electronic memories.

  7. Operator Interface and Control Software for the Reconfigurable Surface System Tri-ATHLETE

    Science.gov (United States)

    Norris, Jeffrey S.; Vona, Marsette A.; Rus, Daniela

    2012-01-01

    Graphical operator interface methods have been developed for modular, reconfigurable articulated surface systems in general, and a specific instantiation thereof for JPL's Tri-ATHLETE. The All- Terrain Hex-Limbed Extra-Terrestrial Explorer Robot (ATHLETE) has six limbs with six kinematic degrees of freedom each. The core advancement of this work was the development of a novel set of algorithms for dynamically maintaining a reduced coordinate model of any connected assembly of robot modules.

  8. Tri-modal Person Re-identification with RGB, Depth and Thermal Features

    DEFF Research Database (Denmark)

    Møgelmose, Andreas; Bahnsen, Chris; Moeslund, Thomas B.

    2013-01-01

    Person re-identification is about recognizing people who have passed by a sensor earlier. Previous work is mainly based on RGB data, but in this work we for the first time present a system where we combine RGB, depth, and thermal data for re-identification purposes. First, from each of the three ...... classifier. The tri-modal system is evaluated on a new RGB-D-T dataset, showing successful results in re-identification scenarios....

  9. Transport of peptidomimetic drugs by the intestinal Di/tri-peptide transporter, PepT1

    DEFF Research Database (Denmark)

    Brodin, Birger; Nielsen, Carsten Uhd; Steffansen, Bente

    2002-01-01

    The apical membrane of small intestinal enterocytes possess an uptake system for di- and tripeptides. The physiological function of the system is to transport small peptides resulting from digestion of dietary protein. Moreover, due to the broad substrate specificity of the system, it is also cap...... an updated introduction to the transport system and discuss the substrate characteristics of the di/tri-peptide transporter system with special emphasis on chemically modified substrates and prodrugs....

  10. Synthesis of the Naturally Occurring (-)-1,3,5-Tri-O-Caffeoylquinic Acid.

    Science.gov (United States)

    Brummond, Kay M; Deforrest, Jolie E

    2009-02-11

    Ribonuclease H (RNase H) is an essential component to the replication of human immunodeficiency virus (HIV), and only a few inhibitors of this enzyme are known. Millenia Hope Pharmaceuticals Inc. found that (-)-1,3,5-tri-O-caffeoylquinic acid is a potent RNase H inhibitor and antiviral agent. A facile route leading to this inhibitor from commercially available (-)-quinic acid is reported within.

  11. Synthesis of the Naturally Occurring (–)-1,3,5-Tri-O-Caffeoylquinic Acid

    Science.gov (United States)

    DeForrest, Jolie E.

    2009-01-01

    Ribonuclease H (RNase H) is an essential component to the replication of human immunodeficiency virus (HIV), and only a few inhibitors of this enzyme are known. Millenia Hope Pharmaceuticals Inc. found that (–)-1,3,5-tri-O-caffeoylquinic acid is a potent RNase H inhibitor and antiviral agent. A facile route leading to this inhibitor from commercially available (–)-quinic acid is reported within. PMID:20157344

  12. 75 FR 24799 - Safety Zone; Tri-City Water Follies Hydroplane Races Practice Sessions, Columbia River, Kennewick...

    Science.gov (United States)

    2010-05-06

    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Tri-City Water Follies Hydroplane Races..., Washington for hydroplane race practice sessions being held in preparation for the Tri-City Water Follies... associated with the hydroplane practice sessions could lead to severe injury, fatalities, and/or...

  13. In vivo kinetics of U4/U6·U5 tri-snRNP formation in Cajal bodies.

    Science.gov (United States)

    Novotný, Ivan; Blažíková, Michaela; Staněk, David; Herman, Petr; Malinsky, Jan

    2011-02-15

    The U4/U6·U5 tri-small nuclear ribonucleoprotein particle (tri-snRNP) is an essential pre-mRNA splicing factor, which is assembled in a stepwise manner before each round of splicing. It was previously shown that the tri-snRNP is formed in Cajal bodies (CBs), but little is known about the dynamics of this process. Here we created a mathematical model of tri-snRNP assembly in CBs and used it to fit kinetics of individual snRNPs monitored by fluorescence recovery after photobleaching. A global fitting of all kinetic data determined key reaction constants of tri-snRNP assembly. Our model predicts that the rates of di-snRNP and tri-snRNP assemblies are similar and that ∼230 tri-snRNPs are assembled in one CB per minute. Our analysis further indicates that tri-snRNP assembly is approximately 10-fold faster in CBs than in the surrounding nucleoplasm, which is fully consistent with the importance of CBs for snRNP formation in rapidly developing biological systems. Finally, the model predicted binding between SART3 and a CB component. We tested this prediction by Förster resonance energy transfer and revealed an interaction between SART3 and coilin in CBs.

  14. 78 FR 17652 - Tri-State Generation and Transmission Association, Inc. v. Public Service Company of New Mexico...

    Science.gov (United States)

    2013-03-22

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Tri-State Generation and Transmission Association, Inc. v. Public Service... Energy Regulatory Commission (Commission), 18 CFR 385.206 and 18 CFR 385.212, Tri-State Generation and...

  15. Evaluations of Flow and Mixing Efficiency in the Kneading Disks of a Novel Tri-Screw Extruder

    Directory of Open Access Journals (Sweden)

    X. Z. Zhu

    2016-01-01

    Full Text Available The forward or backward stagger angles of the kneading disks have great effects on configures of the special center region along axial length in a novel tri-screw extruder. In this paper, the flow and mixing of a nonNewtonian polyethylene in kneading disks of a tri-screw extruder were simulated using three-dimensional finite element modeling based on mesh superposition technique. Three types of kneading disks, neutral stagger, staggered 30° forward and staggered 30° reverse were considered for the tri-screw extruder. The effects of stagger angles of kneading disks on the flow pattern in the tri-screw extruder were investigated. Moreover, at different stagger angles, the dispersive and distributive mixing efficiencies in the kneading disks of the tri-screw extruder and the twin-screw extruder were calculated and compared by means of mean shear rate, stretching rates, maximal stress magnitudes, mixing index, residence time distribution (RTD and logarithm of area stretch. It is found that increasing the stagger angles decreases the axial velocities of polymer melt in the center region for the tri-screw extruder. The staggered 30° reverse is relatively reasonable for the tri-screw extruder and neutral stagger for the twin-screw extruder for the mixing efficiency. In comparison, the kneading disks in the tri-screw extruder have higher distributive and dispersive mixing efficiencies than those in the twin-screw extruder with the same stagger angles.

  16. Overexpression of the trichodiene synthase gene tri5 increases trichodermin production and antimicrobial activity in Trichoderma brevicompactum.

    Science.gov (United States)

    Tijerino, Anamariela; Cardoza, R Elena; Moraga, Javier; Malmierca, Mónica G; Vicente, Francisca; Aleu, Josefina; Collado, Isidro G; Gutiérrez, Santiago; Monte, Enrique; Hermosa, Rosa

    2011-03-01

    Trichoderma brevicompactum produces trichodermin, a simple trichothecene-type toxin that shares the first steps of the sesquiterpene biosynthetic pathway with other phytotoxic trichothecenes from Fusarium spp. Trichodiene synthase catalyses the conversion of farnesyl pyrophosphate to trichodiene and it is encoded by the tri5 gene that was cloned and analysed functionally by homologous overexpression in T. brevicompactum. tri5 expression was up-regulated in media with glucose, H(2)O(2) or glycerol. tri5 repression was observed in cultures supplemented with the antioxidants ferulic acid and tyrosol. Acetone extracts of tri5-overexpressing transformants displayed higher antifungal activity than those from the wild-type. Chromatographic and spectroscopic analyses revealed that tri5 overexpression led to an increased production of trichodermin and tyrosol. Agar diffusion assays with these two purified metabolites from the tri5-overexpressing transformant T. brevicompactum Tb41tri5 showed that only trichodermin had antifungal activity against Saccharomyces cerevisiae, Kluyveromyces marxianus, Candida albicans, Candida glabrata, Candida tropicalis and Aspergillus fumigatus, in most cases such activity being higher than that observed for amphotericin B and hygromycin. Our results point to the significant role of tri5 in the production of trichodermin and in the antifungal activity of T. brevicompactum.

  17. A self-calibration method for tri-axis rotational inertial navigation system

    Science.gov (United States)

    Gao, Pengyu; Li, Kui; Wang, Lei; Liu, Zengjun

    2016-11-01

    The navigation accuracy of the rotational inertial navigation system (RINS) could be greatly improved by periodically rotating the inertial measurement unit (IMU) with gimbals. However, error parameters in RINS should be effectively calibrated and compensated. In this paper, a self-calibration method is proposed for tri-axis RINS using attitude errors and velocity errors as measurements. The proposed calibration scheme is designed as three separate steps, and a certain gimbal rotates continuously in each step. All the error parameters in the RINS are calibrated when the whole scheme finishes. The separate calibration steps reduce the correlations between error parameters, and the observability of errors in this method is clear to demonstrate according to the relations between navigation errors and error parameters when gimbals rotate. Each calibration step only lasts 12 min, thus gyro drifts and accelerometers biases could be regarded as constant. The proposed calibration scheme is tested in both simulation and actual tri-axis RINS, and simulation and experimental results show that all 23 error parameters could be well estimated in tri-axis RINS. A long-term vehicle navigation experiment results show that after calibration and compensation, the navigation performance has doubled approximately, and the velocity accuracy is less than 2 m s-1 while the position accuracy is less than 1500 m, fully illustrating the significance of the proposed self-calibration method in improving the navigation performance of RINS.

  18. [Factors associated with overweight in students from tri-border region: Argentina, Brazil and Paraguay].

    Science.gov (United States)

    Legnani, Elto; Legnani, Rosimeide Francisco Santos; Filho, Valter Cordeiro Barbosa; Krinski, Kleverton; Elsangedy, Hassan Muhamed; de Campos, Wagner; da Silva, Sergio Gregório; Lopes, Adair da Silva

    2010-12-01

    The Tri-Border Region has several social and health problems among young people, however, there are no data about the overweight between adolescents. This study investigated the prevalence of overweight and associated factors in students from Tri-Border Region: Argentina, Brazil and Paraguay. Study participants were 1.183 students, ages from 15 to 18 years. The overweight was identified according to body mass index cut-off points proposed by the World Health Organization. The Global School-Based Student Health Survey questionnaire was used to identify sociodemographic (gender and age) and behavioral factors (physical activity outside of school, commuting to school, time watching TV and fruits, vegetables, sweet, and salty snack consumption) associated with overweight in adolescents. It was used the descriptive statistics, analysis of variance, chi-square and binary logistic regression, adopting p < 0.05. Thirteen percent of students were overweight. Boys were approximately two times more likely to have overweight than girls, independently of nationality. Brazilian students that realized passive commuting to school and Argentineans students with low consumption of vegetables (< 1 time/day) were 2.2 and 2.9 times more likely to have overweight than their counterparts who performed active commuting to school and consumed vegetables daily, respectively. These results suggest that public policies to combat overweight should attention on promoting healthy lifestyle among young people from Tri-Border Region.

  19. Total hip arthroplasty using TRI-LOCK® DePuy bone preservation femoral stem: our experience.

    Science.gov (United States)

    Sperati, G; Ceri, L

    2014-09-24

    In this study we report our 3-years experience (from January 2010 to December 2013) of 101 total hip arthroplasties using Tri-Lock® DePuy bone preservation femoral stem, all performed in our clinic. 101 patients (F54-M47; median age around 69 yrs, range 42-84 yrs). 51 arthroplasties were implanted on the right side whereas 50 on the left side. The average follow-up was 27,3 months. All the arthroplasties were coupled with Pinnacle® polyethylene acetabular cup system; 98 prostheses were implanted cementless whereas cement was used in 3 cases. The Tri-Lock® femoral stem allows both soft tissues and bone stock preservation, leading to greater trochanter maintenance, less spongy bone removal and distal cavity bone tissue conservation. In our experience, we were able to implant the Tri-Lock® femoral stem even in osteoporotic and overweight patients using Gription® porous coating. This allowed for commencing an intensive rehabilitation program with stable load from the following day, without observing any early complications or loosening. According to us, this device is solid and safe, providing remarkable sparing of both soft tissues and bone stock.

  20. Generate tri-directional spectra-compatible time histories using HHT method

    Energy Technology Data Exchange (ETDEWEB)

    Li, Bo; Xie, Wei-Chau, E-mail: xie@uwaterloo.ca; Pandey, Mahesh D.

    2016-11-15

    Highlights: • Hilbert–Huang Transform are applied to modify real earthquake records. • Generate tri-directional time histories compatible with target spectra. • Both GRS and FRS are considered as target spectra. • Target spectra with multiple damping ratios are considered. - Abstract: This paper proposes two algorithms to generate spectrum-compatible time histories based on two approaches recommended by USNRC Standard Review Plan 3.7.1. Hilbert–Huang Transform technique is used to analyze frequency contents and amplitudes of seed motions. Through adjusting the frequency contents and amplitudes of seed motions, spectrum-compatible time histories are obtained. The first algorithm is to generate tri-directional time histories compatible with multi-damping target design spectra (ground response spectra or floor response spectra). The second algorithm is to generate tri-directional time histories compatible with single-damping target design spectra. Examples are presented to demonstrate versatility of these two proposed algorithms to generate spectra-compatible time histories.

  1. Enhanced separation and analysis procedure reveals production of tri-acylated mannosylerythritol lipids by Pseudozyma aphidis.

    Science.gov (United States)

    Goossens, Eliane; Wijnants, Marc; Packet, Dirk; Lemière, Filip

    2016-11-01

    Mannosylerythritol lipids (MELs) are one of the most promising biosurfactants because of their high fermentation yields (>100 g l(-1)) and during the last two decades they have gained a lot of attention due to their interesting self-assembling properties and biological activities. In this study, MELs were produced by fed-batch bioreactor fermentation of rapeseed oil with Pseudozyma aphidis MUCL 27852. This high-level MEL-producing yeast secretes four conventional MEL structures, -A, -B, -C and -D, which differ in their degree of acetylation. During our research, unknown compounds synthesized by P. aphidis were detected by thin-layer chromatography. The unknown compounds were separated by flash chromatography and identified as tri-acylated MELs by high-performance liquid chromatography tandem mass spectrometry (HPLC-MS/MS). The third fatty acid chain on the tri-acylated MELs was positioned on the primary alcohol of the erythritol moiety and comprised long-chain acids, mainly oleic and linoleic acid, which are not found in conventional di-acylated MELs. Furthermore, the LC-MS analysis time of conventional MELs was reduced to almost one-third by switching from HPLC-MS/MS to ultraperformance liquid chromatography tandem mass spectrometry (UPLC-MS/MS). Provided optimization of the fermentation yield, P. aphidis could be an interesting novel producer of tri-acylated MELs and, thereby expand the supply and applicability of biosurfactants.

  2. The architecture of the spliceosomal U4/U6.U5 tri-snRNP

    Science.gov (United States)

    Nguyen, Thi Hoang Duong; Galej, Wojciech P.; Bai, Xiao-chen; Savva, Christos G.; Newman, Andrew J.; Scheres, Sjors H. W.; Nagai, Kiyoshi

    2015-01-01

    U4/U6.U5 tri-snRNP is a 1.5 MDa pre-assembled spliceosomal complex comprising U5 snRNA, extensively base-paired U4/U6 snRNAs and >30 proteins, including the key components Prp8, Brr2 and Snu114. The tri-snRNP combines with a pre-mRNA substrate bound to U1 and U2 snRNPs and transforms into a catalytically active spliceosome following extensive compositional and conformational changes triggered by unwinding of the U4/U6 snRNAs. CryoEM single-particle reconstruction of yeast tri-snRNP at 5.9Å resolution reveals the essentially complete organization of its RNA and protein components. The single-stranded region of U4 snRNA between its 3′-stem-loop and the U4/U6 snRNA stem I is loaded into the Brr2 helicase active site ready for unwinding. Snu114 and the N-terminal domain of Prp8 position U5 snRNA to insert its Loop I, which aligns the exons for splicing, into the Prp8 active site cavity. The structure provides crucial insights into the activation process and the active site of the spliceosome. PMID:26106855

  3. An iterative method for tri-level quadratic fractional programming problems using fuzzy goal programming approach

    Science.gov (United States)

    Kassa, Semu Mitiku; Tsegay, Teklay Hailay

    2017-08-01

    Tri-level optimization problems are optimization problems with three nested hierarchical structures, where in most cases conflicting objectives are set at each level of hierarchy. Such problems are common in management, engineering designs and in decision making situations in general, and are known to be strongly NP-hard. Existing solution methods lack universality in solving these types of problems. In this paper, we investigate a tri-level programming problem with quadratic fractional objective functions at each of the three levels. A solution algorithm has been proposed by applying fuzzy goal programming approach and by reformulating the fractional constraints to equivalent but non-fractional non-linear constraints. Based on the transformed formulation, an iterative procedure is developed that can yield a satisfactory solution to the tri-level problem. The numerical results on various illustrative examples demonstrated that the proposed algorithm is very much promising and it can also be used to solve larger-sized as well as n-level problems of similar structure.

  4. Influence of nutritional knowledge on perceived healthiness and willingness to try functional foods.

    Science.gov (United States)

    Ares, Gastón; Giménez, Ana; Gámbaro, Adriana

    2008-11-01

    In order to assess the influence of nutritional knowledge on perceived healthiness and willingness to try functional foods, 104 consumers filled out a Nutritional Knowledge Questionnaire and answered a conjoint task. Participants had to evaluate 16 concepts consisting of combinations of carrier products (yogurt, milk desserts, pan bread and mayonnaise) and nutritional modifications (regular product, low-fat, enriched with antioxidants, and enriched with fibre). Three groups of consumers were identified with different level of nutritional knowledge. Highly significant differences were found in the healthiness evaluations of the clusters, which mainly depended on nutritional knowledge related to the links of diet and diseases. Highly significant differences in willingness to try functional foods were also found between the clusters. Whereas consumers with the lowest nutritional knowledge were not interested in consuming functional foods, the addition of fibre or antioxidants to healthy products increased the willingness of consumers with the highest level of nutritional knowledge to try the evaluated functional foods. These results suggested that lack of nutritional knowledge might limit the acceptance of functional foods and thus the use of health claims might be necessary to assure that consumers are aware of their health benefits.

  5. NMSSM Inflation and Domain Walls from a Tri-critical Point of View

    CERN Document Server

    Aval, Hadi Gholian

    2016-01-01

    In this paper we want to study the conditions in which we could bring a universe filled with different $Z_3$ vacua created during the Next to Minimal Supersymmetric Standard Model (NMSSM) electroweak symmetry breaking at $\\textit{O} (10)^2$ GeV and a three dimensional three states diluted Potts model together in the same universality class. Then we use Cardy-Jacobsen conjecture to prove that there might be a tri-critical point in the NMSSM electroweak epoch of early universe. We prove that due to the existence of this point there would be no cosmological domain wall problem. Moreover, at this point the heat capacity and correlation length diverge which lead to a huge amount of energy release at constant temperature and a new mechanism for cosmological structure formation. Also, the entropy decrease after the tri-critical phase transition could explain the problem of low initial entropy in early universe. Finally, we combine Cardy-Jacobsen and Yaffe-Svetitsky conjectures to show that there might be a tri-criti...

  6. Design of a Tri-PET collimator for high-resolution whole-body mouse imaging.

    Science.gov (United States)

    DiFilippo, Frank P

    2017-08-01

    Tri-PET refers to high-resolution 511-keV emission tomography using a multipinhole collimator in conjunction with lower resolution PET detectors operating in coincidence mode. Tri-PET is unique in that three spatial locations are associated with each event (two detector coordinates and one pinhole location). Spatial resolution and sensitivity are similar to that of 511-keV SPECT and are governed mainly by the collimator design. However because of a third spatial location in Tri-PET, the line-of-response is overdetermined. This feature permits new opportunities in data processing which impact collimator design. In particular, multiplexing can be avoided since the coincidence data identify the pinhole through which the photon passed. In this paper, the principles of Tri-PET collimator design are reviewed and then applied to the case of high-resolution imaging of a small animal in a clinical PET scanner. The design of a 148-pinhole collimator for whole-body imaging of a mouse is presented. Two pinhole designs were investigated: knife-edge pinholes with 1.1 mm aperture and novel hyperboloidal pinholes with 1.2 mm aperture, both having 18° cone angle. The pinhole configuration is unfocused, covering a whole-body mouse field of view with nearly uniform sensitivity. Computer simulations were performed of a micro hot rods phantom imaged with this collimator in a clinical PET scanner. Sensitivity was estimated by simulating a point source centered on-axis at locations spanning a 70-mm axial range, similar to the NEMA NU-4 standard for whole-body mouse imaging. Reconstructed images of the hot rods phantom demonstrated the ability to resolve 1.1 mm structures with the knife-edge pinholes and 1.0 mm structures with the hyperboloidal pinholes. Sensitivity was found to be 0.093% and 0.054% for the knife-edge and hyperboloidal pinholes, respectively. With a properly designed multipinhole collimator, high-resolution and acceptable sensitivity are achievable with Tri-PET using

  7. Repeated High-Intensity Effort Activity in Relation to Tries Scored and Conceded during Rugby League Match-Play.

    Science.gov (United States)

    Gabbett, Tim J; Gahan, Caleb W

    2015-09-21

    To examine the nature and frequency of rugby league repeated high-intensity effort (RHIE) activity in relation to tries scored and conceded in successful and unsuccessful teams. One-hundred and eighty-five semi-professional rugby league players (mean ± SD age: 23.7 ± 3.2 yr) from 11 teams participated in this study. Global positioning system (GPS) data was collected during 21 matches. Data were analysed for the total number of RHIE bouts, efforts per bout, duration of efforts and recovery between efforts. Using notational analysis, a RHIE bout frequency distribution, representing 0-60s, 61-120s, 121-180s, 181-240s, and 241-300s prior to scoring and conceding a try was established. Over 50% of RHIE bouts occurred within five minutes of a try. Bottom 4 teams performed a greater proportion of bouts within five minutes of a try than Top 4 teams (61.5% vs. 48.2%, effect size, ES = 0.69 ± 0.28, p=0.0001). Top 4 teams performed a greater number of RHIE bouts per conceded try (3.0 ± 2.1 vs. 1.6 ± 0.7, ES = 0.74 ± 0.51, pteams performed a greater number of RHIE bouts per try scored (3.6 ± 2.5 vs. 2.1 ± 1.7, ES = 0.70 ± 0.71, p=0.10). The majority of rugby league RHIE bouts occur at critical periods during match-play. Successful rugby league teams perform more RHIE bouts prior to conceding tries, while unsuccessful teams perform more bouts prior to scoring tries. These findings demonstrate that unsuccessful teams are required to work harder to score tries while successful teams work harder to prevent tries.

  8. Post-remediation biomonitoring of pesticides and other contaminants in marine waters and sediment near the United Heckathorn Superfund Site, Richmond, California

    Energy Technology Data Exchange (ETDEWEB)

    LD Antrim; NP Kohn

    2000-05-26

    Marine sediment remediation at the United Heckathorn Superfund Site was completed in April 1997. Water and mussel tissues were sampled in February 1999 from four stations near Lauritzen Canal in Richmond, California, for Year 2 of post-remediation monitoring of marine areas near the United Heckathorn Site. Dieldrin and dichlorodiphenyl trichloroethane (DDT) were analyzed in water samples, tissue samples from resident mussels, and tissue samples from transplanted mussels deployed for 4 months. Concentrations of dieldrin and total DDT in water and total DDT in tissue were compared with Year 1 of post-remediation monitoring, and with preremediation data from the California State Mussel Watch program (tissues) and the Ecological Risk Assessment for the United Heckathorn Superfund Site (tissues and water). Mussel tissues were also analyzed for polychlorinated biphenyls (PCB), which were detected in sediment samples. Chlorinated pesticide concentrations in water samples were similar to preremediation levels and did not meet remediation goals. Mean dieidrin concentrations in water ranged from 0.62 rig/L to 12.5 ng/L and were higher than the remediation goal (0.14 ng/L) at all stations. Mean total DDT concentrations in water ranged from 14.4 ng/L to 62.3 ng/L and exceeded the remediation goal (0.59 ng/L) at all stations. The highest concentrations of both pesticides were found at the Lauritzen Canal/End station. Despite exceedence of the remediation goals, chlorinated pesticide concentrations in Lauritzen Canal water samples were notably lower in 1999 than in 1998. Tissue samples from biomonitoring organisms (mussels) provide an indication of the longer-term integrated exposure to contaminants in the water column, which overcomes the limitations of grab samples of water. Biomonitoring results indicated that the bioavailability of chlorinated pesticides has been reduced from preremediation levels both in the dredged area and throughout Richmond Harbor. Total DDT and

  9. Radiochemical Analyses of the Filter Cake, Granular Activated Carbon, and Treated Ground Water from the DTSC Stringfellow Superfund Site Pretreatment Plant

    Energy Technology Data Exchange (ETDEWEB)

    Esser, B K; McConachie, W; Fischer, R; Sutton, M; Szechenyi, S

    2005-09-16

    The Department of Toxic Substance Control (DTSC) requested that Lawrence Livermore National Laboratory (LLNL) evaluate the treatment process currently employed at the Department's Stringfellow Superfund Site Pretreatment Plant (PTP) site to determine if wastes originating from the site were properly managed with regards to their radioactivity. In order to evaluate the current management strategy, LLNL suggested that DTSC characterize the effluents from the waste treatment system for radionuclide content. A sampling plan was developed; samples were collected and analyzed for radioactive constituents. Following is brief summary of those results and what implications for waste characterization may be made. (1) The sampling and analysis provides strong evidence that the radionuclides present are Naturally Occurring Radioactive Material (NORM). (2) The greatest source of radioactivity in the samples was naturally occurring uranium. The sample results indicate that the uranium concentration in the filter cake is higher than the Granular Activated Carbon (GAC) samples. (11 -14 and 2-6 ppm respectively). (3) No radiologic background for geologic materials has been established for the Stringfellow site, and comprehensive testing of the process stream has not been conducted. Without site-specific testing of geologic materials and waste process streams, it is not possible to conclude if filter cake and spent GAC samples contain radioactivity concentrated above natural background levels, or if radionuclides are being concentrated by the waste treatment process. Recommendation: The regulation of Technologically Enhanced, Naturally Occurring Radioactive Materials (T-NORM) is complex. Since the results of this study do not conclusively demonstrate that natural radioactive materials have not been concentrated by the treatment process it is recommended that the DTSC consult with the Department of Health Services (DHS) Radiological Health Branch to determine if any further

  10. Transcriptomic assessment of resistance to effects of an aryl hydrocarbon receptor (AHR agonist in embryos of Atlantic killifish (Fundulus heteroclitus from a marine Superfund site

    Directory of Open Access Journals (Sweden)

    Franks Diana G

    2011-05-01

    Full Text Available Abstract Background Populations of Atlantic killifish (Fundulus heteroclitus have evolved resistance to the embryotoxic effects of polychlorinated biphenyls (PCBs and other halogenated and nonhalogenated aromatic hydrocarbons that act through an aryl hydrocarbon receptor (AHR-dependent signaling pathway. The resistance is accompanied by reduced sensitivity to induction of cytochrome P450 1A (CYP1A, a widely used biomarker of aromatic hydrocarbon exposure and effect, but whether the reduced sensitivity is specific to CYP1A or reflects a genome-wide reduction in responsiveness to all AHR-mediated changes in gene expression is unknown. We compared gene expression profiles and the response to 3,3',4,4',5-pentachlorobiphenyl (PCB-126 exposure in embryos (5 and 10 dpf and larvae (15 dpf from F. heteroclitus populations inhabiting the New Bedford Harbor, Massachusetts (NBH Superfund site (PCB-resistant and a reference site, Scorton Creek, Massachusetts (SC; PCB-sensitive. Results Analysis using a 7,000-gene cDNA array revealed striking differences in responsiveness to PCB-126 between the populations; the differences occur at all three stages examined. There was a sizeable set of PCB-responsive genes in the sensitive SC population, a much smaller set of PCB-responsive genes in NBH fish, and few similarities in PCB-responsive genes between the two populations. Most of the array results were confirmed, and additional PCB-regulated genes identified, by RNA-Seq (deep pyrosequencing. Conclusions The results suggest that NBH fish possess a gene regulatory defect that is not specific to one target gene such as CYP1A but rather lies in a regulatory pathway that controls the transcriptional response of multiple genes to PCB exposure. The results are consistent with genome-wide disruption of AHR-dependent signaling in NBH fish.

  11. Microbial Diversity and Metal Speciation Changes in Mine Tailings Following Compost-Assisted Direct Planting: A Four-Year Superfund Site Field Study

    Science.gov (United States)

    Maier, R. M.; Gil-Loaiza, J.; Honeker, L. K.; Hottenstein, J. D.; Valentin-Vargas, A.; Jennings, L. L.; Hammond, C.; Neilson, J. W.; Root, R. A.; Chorover, J.

    2015-12-01

    EPA estimates that future mine tailings remediation costs will exceed US $50 billion using present technologies based on constructing an inert or biological cap on the tailings. Both approaches require large amounts of capping materials that can be difficult and expensive to obtain especially for sites several thousand hectares in size. An alternative technology is direct planting into tailings. However, direct planting alone is not feasible for many legacy sites due to extreme acidity and high metal content which prevent plant germination and growth. Therefore the process must be "assisted" through the addition of amendments such as compost. Here we present results from the first four years of a field study at the Iron King Mine and Humboldt Smelter Superfund site demonstrating the feasibility of compost-assisted direct planting. Parameters measured during the field study included: canopy cover, pH, nutrient content, plant metal uptake, metal(loid) speciation, mineral analysis, microbiome analysis, and plant root-metal-microbe interactions. Integrated analysis of these parameters suggests that even in this "worst-case scenario" mine tailings site (pH 2.5; As and Pb each exceeding 2 g kg-1), we have created a sustainable system. In this system, phyto-catalyzed stabilization of inorganic contaminants in the root zone is driven by plant root exudates and the associated rhizosphere microbial community. The results of this research will be put into context of a larger topic- that of ecological engineering of mine tailings sites - a technique being proposed to prevent creation of acidic conditions and metal(loid) mobilization in the first place.

  12. ELECTRE TRI aplicado a avaliação da satisfação de consumidores ELECTRE TRI applied to costumers satisfaction evaluation

    Directory of Open Access Journals (Sweden)

    Helder Gomes Costa

    2007-08-01

    Full Text Available As abordagens usuais para conhecer a percepção do consumidor quanto ao desempenho de serviços baseiam-se em impressões do consumidor (julgamentos subjetivos à luz de múltiplos critérios. Em geral estas abordagens consideram uma função de agregação do tipo média ponderada, que apresenta efeitos compensatórios indesejáveis. O presente trabalho explora a aplicação do Auxílio Multicritério à Decisão, mais especificamente no método ELECTRE TRI, à classificação ordenada da satisfação dos consumidores. Isto adapta uma modelagem de apoio à decisão para um problema de diagnóstico do grau de satisfação. Um tratamento inédito para a estimativa dos parâmetros p e q (limites de preferência e de indiferença, respectivamente é incorporado a modelagem, incorporando maior robustez ao uso de um método de AMD monodecisor na resolução de um problema multidecisor. Trata-se de forma inédita a questão de incomparabilidade, destacando que nem sempre a mesma é originada por imperícia na modelagem ou nas avaliações de desempenho. Uma importante diferença em relação aos métodos tradicionais de avaliação de desempenho é a independência do emprego do resultado em relação ao valor numérico da escala de julgamento de desempenho. A aplicação desta abordagem proposta é experimentada na avaliação da satisfação dos consumidores de uma bombonnière instalada em um shopping center.Usual approaches to identify costumer’s perceptions about service are based on subjective evaluations under multiple criteria. Generally, an aggregation function based on weighted average method is used to solve this type of problem, in despite of the compensatory problems that it causes. Present work explores the application of an MCDM based method in order to solve this problem. An original approach to estimates p and q parameters in ELECTRE TRI is inserted on the model building, incorporating robustness to the proposal. Also, an original

  13. The effects of traditional, superset, and tri-set resistance training structures on perceived intensity and physiological responses.

    Science.gov (United States)

    Weakley, Jonathon J S; Till, Kevin; Read, Dale B; Roe, Gregory A B; Darrall-Jones, Joshua; Phibbs, Padraic J; Jones, Ben

    2017-07-11

    Investigate the acute and short-term (i.e., 24 h) effects of traditional (TRAD), superset (SS), and tri-set (TRI) resistance training protocols on perceptions of intensity and physiological responses. Fourteen male participants completed a familiarisation session and three resistance training protocols (i.e., TRAD, SS, and TRI) in a randomised-crossover design. Rating of perceived exertion, lactate concentration ([Lac]), creatine kinase concentration ([CK]), countermovement jump (CMJ), testosterone, and cortisol concentrations was measured pre, immediately, and 24-h post the resistance training sessions with magnitude-based inferences assessing changes/differences within/between protocols. TRI reported possible to almost certainly greater efficiency and rate of perceived exertion, although session perceived load was very likely lower. SS and TRI had very likely to almost certainly greater lactate responses during the protocols, with changes in [CK] being very likely and likely increased at 24 h, respectively. At 24-h post-training, CMJ variables in the TRAD protocol had returned to baseline; however, SS and TRI were still possibly to likely reduced. Possible increases in testosterone immediately post SS and TRI protocols were reported, with SS showing possible increases at 24-h post-training. TRAD and SS showed almost certain and likely decreases in cortisol immediately post, respectively, with TRAD reporting likely decreases at 24-h post-training. SS and TRI can enhance training efficiency and reduce training time. However, acute and short-term physiological responses differ between protocols. Athletes can utilise SS and TRI resistance training, but may require additional recovery post-training to minimise effects of fatigue.

  14. Tri-Variate Relationships among Vegetation, Soil, and Topography along Gradients of Fluvial Biogeomorphic Succession

    Science.gov (United States)

    Kim, Daehyun; Kupfer, John A.

    2016-01-01

    This research investigated how the strength of vegetation–soil–topography couplings varied along a gradient of biogeomorphic succession in two distinct fluvial systems: a forested river floodplain and a coastal salt marsh creek. The strength of couplings was quantified as tri-variance, which was calculated by correlating three singular axes, one each extracted using three-block partial least squares from vegetation, soil, and topography data blocks. Within each system, tri-variance was examined at low-, mid-, and high-elevation sites, which represented early-, intermediate-, and late-successional phases, respectively, and corresponded to differences in ongoing disturbance frequency and intensity. Both systems exhibited clearly increasing tri-variance from the early- to late-successional stages. The lowest-lying sites underwent frequent and intense hydrogeomorphic forcings that dynamically reworked soil substrates, restructured surface landforms, and controlled the colonization of plant species. Such conditions led vegetation, soil, and topography to show discrete, stochastic, and individualistic behaviors over space and time, resulting in a loose coupling among the three ecosystem components. In the highest-elevation sites, in contrast, disturbances that might disrupt the existing biotic–abiotic relationships were less common. Hence, ecological succession, soil-forming processes, and landform evolution occurred in tight conjunction with one another over a prolonged period, thereby strengthening couplings among them; namely, the three behaved in unity over space and time. We propose that the recurrence interval of physical disturbance is important to—and potentially serves as an indicator of—the intensity and mechanisms of vegetation–soil–topography feedbacks in fluvial biogeomorphic systems. PMID:27649497

  15. Cretaceous biota of the Triângulo Mineiro region (Brazil: A review of recent finds

    Directory of Open Access Journals (Sweden)

    Candeiro, C. R. A.

    2007-06-01

    Full Text Available The Bauru Group (Adamantina, Uberaba, and Marília Formations crop out in the Triângulo Mineiro region, Minas Gerais State, Brazil, and yield a rich continental biota. Invertebrate and vertebrate taxa from underlying and overlying strata, as well as biostratigraphical correlations with other fossil sites in Argentina, suggest an Upper Cretaceous age for this biota. The diversity of the fossil assemblage recorded in these formations is summarized here and includes: frogs, lizards, crocodiles, titanosaurs, abelisaurid and carcharodontosaurid dinosaurs. This fossil assemblage provides important clues to understand faunas from other southern landmasses, particularly those from the Cretaceous of the African continent.Los afloramientos del Grupo Bauru (formaciones Adamantina, Uberaba y Marília en la región del Triângulo Mineiro, Provincia de Minas Gerais, Brasil, posee un rico contenido de biota continental. Los taxa de invertebrados y vertebrados de estos estratos, así como las correlaciones biostratigráficas con otros yacimientos fósiles de Argentina, sugieren una edad del Cretácico Tardío. La diversidad de la asociación fósil registrada en las formaciones del Triângulo Mineiro se resume en el presente trabajo e incluye: sapos, lagartos, tortugas, cocodrilianos, titanosaurideos, dinosaurios abelisaurideos y carcharodontosaurideos. Esta asociación es importante para la comprensión de las faunas del sur de América y también de las del Cretácico de África.

  16. An Effective Tri-Clustering Algorithm Combining Expression Data with Gene Regulation Information

    Directory of Open Access Journals (Sweden)

    Ao Li

    2009-04-01

    Full Text Available Motivation: Bi-clustering algorithms aim to identify sets of genes sharing similar expression patterns across a subset of conditions. However direct interpretation or prediction of gene regulatory mechanisms may be difficult as only gene expression data is used. Information about gene regulators may also be available, most commonly about which transcription factors may bind to the promoter region and thus control the expression level of a gene. Thus a method to integrate gene expression and gene regulation information is desirable for clustering and analyzing. Methods: By incorporating gene regulatory information with gene expression data, we define regulated expression values (REV as indicators of how a gene is regulated by a specific factor. Existing bi-clustering methods are extended to a three dimensional data space by developing a heuristic TRI-Clustering algorithm. An additional approach named Automatic Boundary Searching algorithm (ABS is introduced to automatically determine the boundary threshold. Results: Results based on incorporating ChIP-chip data representing transcription factor-gene interactions show that the algorithms are efficient and robust for detecting tri-clusters. Detailed analysis of the tri-cluster extracted from yeast sporulation REV data shows genes in this cluster exhibited significant differences during the middle and late stages. The implicated regulatory network was then reconstructed for further study of defined regulatory mechanisms. Topological and statistical analysis of this network demonstrated evidence of significant changes of TF activities during the different stages of yeast sporulation, and suggests this approach might be a general way to study regulatory networks undergoing transformations.

  17. Integrated piezoelectric actuators in deep drawing tools to reduce the try-out

    Science.gov (United States)

    Neugebauer, Reimund; Mainda, Patrick; Kerschner, Matthias; Drossel, Welf-Guntram; Roscher, Hans-Jürgen

    2011-05-01

    Tool making is a very time consuming and expensive operation because many iteration loops are used to manually adjust tool components during the try-out process. That means that trying out deep drawing tools is 30% of the total costs. This is the reason why an active deep drawing tool was developed at the Fraunhofer Institute for Machine Tools and Forming Technology IWU in cooperation with Audi and Volkswagen to reduce the costs and production rates. The main difference between the active and conventional deep drawing tools is using piezoelectric actuators to control the forming process. The active tool idea, which is the main subject of this research, will be presented as well as the findings of experiments with the custom-built deep drawing tool. This experimental tool was designed according to production requirements and has been equipped with piezoelectric actuators that allow active pressure distribution on the sheet metal flange. The disposed piezoelectric elements are similar to those being used in piezo injector systems for modern diesel engines. In order to achieve the required force, the actuators are combined in a cluster that is embedded in the die of the deep drawing tool. One main objective of this work, i.e. reducing the time-consuming try-out-period, has been achieved with the experimental tool which means that the actuators were used to set static pressure distribution between the blankholder and die. We will present the findings of our analysis and the advantages of the active system over a conventional deep drawing tool. In addition to the ability of changing the static pressure distribution, the piezoelectric actuator can also be used to generate a dynamic pressure distribution during the forming process. As a result the active tool has the potential to expand the forming constraints to make it possible to manage forming restrictions caused by light weight materials in future.

  18. Synthesis and characterization of a new family of bi-, tri-, tetra-, and pentanuclear ferric complexes.

    Science.gov (United States)

    Boskovic, Colette; Sieber, Andreas; Chaboussant, Grégory; Güdel, Hans U; Ensling, Jürgen; Wernsdorfer, Wolfgang; Neels, Antonia; Labat, Gael; Stoeckli-Evans, Helen; Janssen, Stefan

    2004-08-09

    Nine members of a new family of polynuclear ferric complexes have been synthesized and characterized. The reaction of Fe(O(2)CMe)(2) with polydentate Schiff base proligands (H(2)L) derived from salicylidene-2-ethanolamine, followed in some cases by reaction with carboxylic acids, has afforded new complexes of general formulas [Fe(2)(pic)(2)(L)(2)] (where pic(-) is the anion of 2-picolinic acid), [Fe(3)(O(2)CMe)(3)(L)(3)], [Fe(4)(OR)(2)(O(2)CMe)(2)(L)(4)], and [Fe(5)O(OH)(O(2)CR)(4)(L)(4)]. The tri-, tetra-, and pentanuclear complexes all possess unusual structures and novel core topologies. Mössbauer spectroscopy confirms the presence of high-spin ferric centers in the tri- and pentanuclear complexes. Variable-temperature magnetic measurements suggest spin ground states of S = 0, 1/2, 0, and 5/2 for the bi-, tri-, tetra-, and pentanuclear complexes, respectively. Fits of the magnetic susceptibility data have provided the magnitude of the exclusively antiferromagnetic exchange interactions. In addition, an easy-axis-type magnetic anisotropy has been observed for the pentanuclear complexes, with D values of approximately -0.4 cm(-)(1) determined from modeling the low-temperature magnetization data. A low-temperature micro-SQUID study of one of the pentanuclear complexes reveals magnetization hysteresis at nonzero field. This is attributed to an anisotropy-induced energy barrier to magnetization reversal that is of molecular origin. Finally, an inelastic neutron scattering study of one of the trinuclear complexes has revealed that the magnetic behavior arises from two distinct species.

  19. Tri-Variate Relationships among Vegetation, Soil, and Topography along Gradients of Fluvial Biogeomorphic Succession.

    Science.gov (United States)

    Kim, Daehyun; Kupfer, John A

    2016-01-01

    This research investigated how the strength of vegetation-soil-topography couplings varied along a gradient of biogeomorphic succession in two distinct fluvial systems: a forested river floodplain and a coastal salt marsh creek. The strength of couplings was quantified as tri-variance, which was calculated by correlating three singular axes, one each extracted using three-block partial least squares from vegetation, soil, and topography data blocks. Within each system, tri-variance was examined at low-, mid-, and high-elevation sites, which represented early-, intermediate-, and late-successional phases, respectively, and corresponded to differences in ongoing disturbance frequency and intensity. Both systems exhibited clearly increasing tri-variance from the early- to late-successional stages. The lowest-lying sites underwent frequent and intense hydrogeomorphic forcings that dynamically reworked soil substrates, restructured surface landforms, and controlled the colonization of plant species. Such conditions led vegetation, soil, and topography to show discrete, stochastic, and individualistic behaviors over space and time, resulting in a loose coupling among the three ecosystem components. In the highest-elevation sites, in contrast, disturbances that might disrupt the existing biotic-abiotic relationships were less common. Hence, ecological succession, soil-forming processes, and landform evolution occurred in tight conjunction with one another over a prolonged period, thereby strengthening couplings among them; namely, the three behaved in unity over space and time. We propose that the recurrence interval of physical disturbance is important to-and potentially serves as an indicator of-the intensity and mechanisms of vegetation-soil-topography feedbacks in fluvial biogeomorphic systems.

  20. El problema de la propagación del refinamiento en cuatro triángulos por la arista mayor

    OpenAIRE

    Suárez, José Pablo; Plaza, Ángel; Padrón, Miguel A.

    2006-01-01

    En este artículo se introducen dos propiedades asintóticas asociadas al proceso iterativo del refinamiento de una malla de triángulos. Primeramente se desarrollarán resultados teóricos, que mostrarían, que la aplicación recursiva de la partición uniforme en cuatro triángulos por la arista mayor a una malla triangular arbitraria no estructurada produce mallas, en las que los pares de triángulos, que comparten la arista mayor, tienden a cubrir el área de toda la malla. Como consecuencia se d...

  1. Pengaruh Locus Of Control terhadap Kinerja dan Kepuasan Kerja Internal Auditor dengan Tri Hita Karana sebagai Variabel Moderasi

    Directory of Open Access Journals (Sweden)

    Komang Adi Kurniawan Saputra

    2012-04-01

    Full Text Available Abstract: The Effect of Locus of Control on Performance and Auditor internal Work Satisfaction with Tri Hita Karana Local Culture as Moderating Variable. This study aims to determine the effect of Locus of Control on performance and job satisfaction of internal auditors star hotels in Bali, as well as local culture Tri Hita Karana as a moderation of this influence. There were 62 internal auditors of star hotels involved in this research. The results of this study indicate a significant influence between Locus of Control on performance and job satisfaction of internal auditors with the local culture Tri Hita Karana as a variable moderation.

  2. Tri-reforming as a process of CO2 utilization and a novel concept of energy storage in chemical products

    Directory of Open Access Journals (Sweden)

    Świrk Katarzyna

    2017-01-01

    In this paper two scenarios for methane tri-reforming implementation are discussed: (i Tri-reforming as a effective way for chemical CO2 utilization, without the separation of carbon dioxide from flue gases from fossil fuel-fired power stations, and (ii dry reforming of methane improved by the addition of water and oxygen, which may be applied as a chemical energy storage process. The literature on the subject of trireforming is shortly reviewed, including thermodynamics of the process, the possible conversions of methane and carbon dioxide, and proposed catalysts, both studied in tri-reforming, and in single processes (SRM, DRM and POM.

  3. Molecular Medicine - CHI's 17th International Tri-Conference: Mastering Medicinal Chemistry - CHI's Seventh Annual Conference.

    Science.gov (United States)

    Terrett, Nick

    2010-04-01

    CHI's 17th International Tri-Conference on Molecular Medicine, held in San Francisco, included topics covering new developments in the field of medicinal chemistry. This conference report highlights selected presentations on fragment-based drug discovery, quantum mechanical energy decomposition for the analysis of SARs, medicinal chemistry strategies and the role of imaging in drug discovery. Investigational drugs discussed include MLN-4924 (Millennium Pharmaceuticals Inc), GDC-0449 (Chugai Pharmaceutical Co Ltd/Curis Inc/F Hoffmann-La Roche Ltd/Genentech Inc/NCI), RDEA-119 (Ardea Biosciences Inc/Bayer HealthCare AG) and tafamidis (Fx-1006A; FoldRx Pharmaceuticals Inc).

  4. Lithium tri borate (LiB3O5) embedded polymer electret for mechanical sensing application

    Science.gov (United States)

    Murugan, S.; Praveen, E.; Prasad, M. V. N.; Jayakumar, K.

    2017-05-01

    Lithium tri borate (LiB3O5) particles were synthesized by precipitation assisted high temperature solid state reaction. The particles were embedded in chitosan polymer and used as an electret. This electret was characterized for the suitability as a sensing element in vibration accelerometer. It is observed that LiB3O5 embedded electret exhibiting piezoelectric property. The electret is also giving an isolation of > 999 MΩ at 100 Vdc, 250 Vdc, 500 Vdc and 1kVdc confirms compatible for intrinsically safe sensing alternative in vibration accelerometer.

  5. VizieR Online Data Catalog: Spectroscopy of V Tri (Ren+, 2017)

    Science.gov (United States)

    Ren, A. B.; Zhang, X. B.; Fu, J. N.; Zhang, Y. P.; Cang, T. Q.; Fox-Machado, L.; Li, C. Q.; Khokhuntod, P.; Luo, Y. P.

    2017-08-01

    The spectroscopic observations for V Tri were carried out with the 2.12m telescope at the Observatorio Astronemico Nacional on the Sierra San Pedro Martir (OAN-SPM) in Mexico on 2015 November 03 and 05. We used a 2048*2048 E2V CCD-4240 to collect the high-resolution (the maximum resolution is R=18000 at 5000Å) echelle spectra at the slit size 1''. The spectral range coverage was from 3800 to 7100Å (4 data files).

  6. Synthesis of ABA Tri-Block Co-Polymer Magnetopolymersomes via Electroporation for Potential Medical Application

    Directory of Open Access Journals (Sweden)

    Jennifer Bain

    2015-12-01

    Full Text Available The ABA tri-block copolymer poly(2-methyloxazoline–poly(dimethylsiloxane–poly(2-methyloxazoline (PMOXA–PDMS–PMOXA is known for its capacity to mimic a bilayer membrane in that it is able to form vesicular polymersome structures. For this reason, it is the subject of extensive research and enables the development of more robust, adaptable and biocompatible alternatives to natural liposomes for biomedical applications. However, the poor solubility of this polymer renders published methods for forming vesicles unreproducible, hindering research and development of these polymersomes. Here we present an adapted, simpler method for the production of PMOXA–PDMS–PMOXA polymersomes of a narrow polydispersity (45 ± 5.8 nm, via slow addition of aqueous solution to a new solvent/polymer mixture. We then magnetically functionalise these polymersomes to form magnetopolymersomes via in situ precipitation of iron-oxide magnetic nanoparticles (MNPs within the PMOXA–PDMS–PMOXA polymersome core and membrane. This is achieved using electroporation to open pores within the membrane and to activate the formation of MNPs. The thick PMOXA–PDMS–PMOXA membrane is well known to be relatively non-permeable when compared to more commonly used di-block polymer membranes due a distinct difference in both size and chemistry and therefore very difficult to penetrate using standard biological methods. This paper presents for the first time the application of electroporation to an ABA tri-block polymersome membrane (PMOXA–PDMS–PMOXA for intravesicular in situ precipitation of uniform MNPs (2.6 ± 0.5 nm. The electroporation process facilitates the transport of MNP reactants across the membrane yielding in situ precipitation of MNPs. Further to differences in length and chemistry, a tri-block polymersome membrane structure differs from a natural lipid or di-block polymer membrane and as such the application and effects of electroporation on this type of

  7. The Algol-Type Eclipsing Binary X Tri: BVRI modeling and O-C Diagram Analysis

    Science.gov (United States)

    Liakos, A.; Zasche, P.; Niarchos, P.

    2010-12-01

    CCD photometric observations of the Algol-type eclipsing binary X Tri have been obtained. The light curves are analyzed with the Wilson-Devinney (WD) code and new geometric and photometric elements are derived. A new O-C analysis of the system, based on the most reliable timings of minima found in the literature, is presented and apparent period changes are discussed with respect to possible and multiple Light-Time Effect (LITE) in the system. Moreover, the results for the existence of additional bodies around the eclipsing pair, derived from the period study, are compared with those for extra luminosity, derived from the light curve analysis.

  8. The Algol type eclipsing binary X Tri: BVRI modelling and O-C diagram analysis

    CERN Document Server

    Liakos, A; Niarchos, P

    2009-01-01

    CCD photometric observations of the Algol-type eclipsing binary X Tri have been obtained. The light curves are analyzed with the Wilson-Devinney (WD) code and new geometric and photometric elements are derived. A new O-C analysis of the system, based on the most reliable timings of minima found in the literature, is presented and apparent period changes are discussed with respect to possible and multiple Light-Time Effect (LITE) in the system. Moreover, the results for the existence of additional bodies around the eclipsing pair, derived from the period study, are compared with those for extra luminosity, derived from the light curve analysis.

  9. Bis{2-formyl-4-methyl-6-[(tri-2-pyridylmethyliminomethyl]phenolato}nickel(II

    Directory of Open Access Journals (Sweden)

    Lai-Jin Tian

    2009-02-01

    Full Text Available The title compound, [Ni(C25H19N4O22], which was obtained by the reaction of nickel(II perchlorate with 2,6-diformyl-4-methylphenol and (tri-2-pyridylmethylamine in methanol solution, is a discrete monometallic complex. The NiII atom is six-coordinated by the phenolate O, imine N and pyridine N atoms from two tridentate Schiff base ligands in a distorted NiN4O2 octahedral geometry. The dihedral angles between the noncoordinated pyridyl rings of each ligand are 72.95 (8 and 69.59 (7°.

  10. Exposure to tri-o-cresyl phosphate detected in jet airplane passengers

    Energy Technology Data Exchange (ETDEWEB)

    Liyasova, Mariya, E-mail: mliyasov@unmc.edu [Eppley Institute, University of Nebraska Medical Center, Omaha, NE 68198-5950 (United States); Department of Environmental, Agricultural, and Occupational Health, University of Nebraska Medical Center, Omaha, NE (United States); Li, Bin, E-mail: binli@unmc.edu [Eppley Institute, University of Nebraska Medical Center, Omaha, NE 68198-5950 (United States); Schopfer, Lawrence M., E-mail: lmschopf@unmc.edu [Eppley Institute, University of Nebraska Medical Center, Omaha, NE 68198-5950 (United States); Nachon, Florian, E-mail: fnachon@nachon.net [Departement de Toxicologie, Institut de Recherche Biomedicale des Armees, 24 avenue des Marquis du Gresivaudan, 38702 La Tronche (France); Masson, Patrick, E-mail: pmasson@unmc.edu [Departement de Toxicologie, Institut de Recherche Biomedicale des Armees, 24 avenue des Marquis du Gresivaudan, 38702 La Tronche (France); Eppley Institute, University of Nebraska Medical Center, Omaha, NE 68198-5950 (United States); Furlong, Clement E., E-mail: clem@uw.edu [Department of Medicine (Div. Medical Genetics) and Genome Sciences, University of Washington, Seattle, WA 98195 (United States); Lockridge, Oksana, E-mail: olockrid@unmc.edu [Eppley Institute, University of Nebraska Medical Center, Omaha, NE 68198-5950 (United States); Department of Environmental, Agricultural, and Occupational Health, University of Nebraska Medical Center, Omaha, NE (United States)

    2011-11-15

    The aircraft cabin and flight deck ventilation are supplied from partially compressed unfiltered bleed air directly from the engine. Worn or defective engine seals can result in the release of engine oil into the cabin air supply. Aircrew and passengers have complained of illness following such 'fume events'. Adverse health effects are hypothesized to result from exposure to tricresyl phosphate mixed esters, a chemical added to jet engine oil and hydraulic fluid for its anti-wear properties. Our goal was to develop a laboratory test for exposure to tricresyl phosphate. The assay was based on the fact that the active-site serine of butyrylcholinesterase reacts with the active metabolite of tri-o-cresyl phosphate, cresyl saligenin phosphate, to make a stable phosphorylated adduct with an added mass of 80 Da. No other organophosphorus agent makes this adduct in vivo on butyrylcholinesterase. Blood samples from jet airplane passengers were obtained 24-48 h after completing a flight. Butyrylcholinesterase was partially purified from 25 ml serum or plasma, digested with pepsin, enriched for phosphorylated peptides by binding to titanium oxide, and analyzed by mass spectrometry. Of 12 jet airplane passengers tested, 6 were positive for exposure to tri-o-cresyl phosphate that is, they had detectable amounts of the phosphorylated peptide FGEpSAGAAS. The level of exposure was very low. No more than 0.05 to 3% of plasma butyrylcholinesterase was modified. None of the subjects had toxic symptoms. Four of the positive subjects were retested 3 to 7 months following their last airplane trip and were found to be negative for phosphorylated butyrylcholinesterase. In conclusion, this is the first report of an assay that detects exposure to tri-o-cresyl phosphate in jet airplane travelers. -- Highlights: Black-Right-Pointing-Pointer Travel on jet airplanes is associated with an illness, aerotoxic syndrome. Black-Right-Pointing-Pointer A possible cause is exposure to

  11. A Radiation Learning Support System by Tri-sensory Augmented Reality using a Mobile Phone

    Energy Technology Data Exchange (ETDEWEB)

    Shimoda, Hiroshi; Zhao, Yue; Yan, Weida; Ishii, Hirotake [Kyoto University, Kyoto (Japan)

    2011-08-15

    A radiation learning support system has been developed to support learning basic knowledge of radiation and its influence on the human body by using tri-sensory Augmented Reality (AR) technology with presenting information to visual, auditory and tactile sensation. The system consists of a knowledge learning mode in which learners can learn basic knowledge of radiation and an experience learning mode in which they can virtually experience its influence on the human body under various conditions. As the result of a simple evaluation, it was suggested that the system improves the learners' intuitive understanding, and information presentation to auditory and tactile sensation is more effective than that to visual sensation.

  12. Measurement of Creep on the Calaveras Fault at Coyote Dam using Terrestrial Radar Interferometry (TRI).

    Science.gov (United States)

    Baker, B.; Cassotto, R.; Fahnestock, M. A.; Werner, C. L.; Boettcher, M. S.

    2015-12-01

    The Calaveras fault in central California is part of the San Andreas fault system. Coyote Dam, an earthen dam that straddles the fault ~13km northeast of Gilroy, experiences creep style deformation that ranges from 10 to 15 mm/yr. Uncertainty in the location of the fault, coupled with the historic rate of deformation, affect the dam's safety factor. Assessing the impact of fault creep on the dam's stability is paramount to its safety evaluation, but is difficult to resolve due to limited spatial and temporal sampling of conventional methods. Terrestrial radar interferometry (TRI), like satellite-based observations, produces high spatial resolution maps of ground deformation. Unlike space-based sensors, TRI can be readily deployed and the observation geometry selected to get the maximum line of sight (LOS) signal. TRI also benefits from high temporal sampling which can be used to reduce errors related to atmospheric phase delays and high temporal sampling also facilitates tracking rapidly moving features such as landslides and glaciers. GAMMA Portable Radar Interferometer (GPRI) measurements of Coyote Dam rock faces were made from concrete piers built upstream and downstream of the dam. The GPRI operates at a radar frequency of 17.2 GHz with a spatial resolution at the dam of approximately 0.9 m x 2.0 m. Changes in LOS path length smaller than 0.1mm can be measured. Data were acquired approximately every 2 to 3 weeks over a 7-month period to map the fault trace through the dam faces. Our study exploits the dense record of observations obtained, and the relatively short distance of the radar to the dam to minimize atmospheric affects. We investigate how the deformation evolves in time and the orientation of fault through the dam, including the strike and dip as measured along the dam surface. Our results show rates consistent with GPS data and regional satellite observations, but produce a much more detailed map of the fault on the dam than possible with GPS or

  13. Phase diagrams and magnetic properties of tri-layer superlattices: Mean field study

    Science.gov (United States)

    Naji, S.; Belhaj, A.; Labrim, H.; Bahmad, L.; Benyoussef, A.; El Kenz, A.

    2014-04-01

    Motivated by spintronic device applications, we engineer a superlattice model based on periodic tri-layers consisting of spins σ={1}/{2}, S=1 and q={3}/{2} residing on the sites of a square lattice, interacting with an external magnetic field. We study its phase diagrams and magnetic properties. We determine the corresponding ground state phase diagrams. Then, we show that this Ising lattice model exhibits a ferromagnetic phase F1, two ferrimagnetic phases F2, F3 and an antiferromagnetic phase F4. It is found that the magnetic behaviors depend on the moduli space controlled by the exchange interaction couplings. More precisely, the hysteresis loops have been established.

  14. High-throughput tri-colour flow cytometry technique to assess Plasmodium falciparum parasitaemia in bioassays

    DEFF Research Database (Denmark)

    Tiendrebeogo, Regis W; Adu, Bright; Singh, Susheel K

    2014-01-01

    BACKGROUND: Unbiased flow cytometry-based methods have become the technique of choice in many laboratories for high-throughput, accurate assessments of malaria parasites in bioassays. A method to quantify live parasites based on mitotracker red CMXRos was recently described but consistent...... distinction of early ring stages of Plasmodium falciparum from uninfected red blood cells (uRBC) remains a challenge. METHODS: Here, a high-throughput, three-parameter (tri-colour) flow cytometry technique based on mitotracker red dye, the nucleic acid dye coriphosphine O (CPO) and the leucocyte marker CD45...

  15. TriRod Adrenaline F3限量版三轮摩托车

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    这辆酷酷的三轮摩托车叫做TriRod Adrenaline F3,重量只有340千克,采用的是前两个车轮,后面一个车轮的设计,车身采用的是碳纤维材料。除此之外,还采用了与哈雷相似的11966ccV型发动机,比起一般的小型摩托引擎更漂亮。

  16. Nonlinear Constitutive Equation for Green Sand Considering the Tri-axial Compression Behavior

    Institute of Scientific and Technical Information of China (English)

    曾攀; 孔劲

    2004-01-01

    The compression characteristics of green sand were investigated experimentally, including the squeezing and yielding during deformation. An expression was developed for the transient compression modulus of sand during compression. Based on the hypothesis put forward of the compression state, the differential equation for the nonlinear constitutive equation was deduced by introducing a move-yield potential function. The state constitutive equation under the tri-axial experiment is further studied according to the sand attributes, considering the differential form of Hooke's law and the Mohr-Coulomb condition. The related experiment data are applied to verify the proposed constitutive model of sand.

  17. TriQuint的GaN/Si HEMT达到创纪录的功率水平

    Institute of Scientific and Technical Information of China (English)

    刘广荣

    2005-01-01

    <正>TriQuint Semiconductor公司的研究人员宣布制造出世界上最大功率的Si 衬底AlGaN/GaN HEMT。这种器件10 GHz下的连续波输出功率密度达到7 W/mm。此结果表明, GaN/Si已发展到对中、大功率晶体管具有吸引力的水平,可望用于X波段功率 MMIC甚至更高的频率。

  18. First Record of Tri-spine Horseshoe Crab, Tachypleus tridentatus (Merostomata: Xiphosurida: Limulidae from Korean Waters

    Directory of Open Access Journals (Sweden)

    Yang, Kea Cheong

    2015-01-01

    Full Text Available A tri-spine horseshoe crab, Tachypleus tridentatus (Leach, 1819 was collected from a sandy beach of Udo Island of Jeju during the full moon tides in November 1997. Three spines on the posterior margin of the opisthosoma were characterized indicating that the specimen was T. tridentatus. This specimen was a female with the total length of 49.5 cm and prosoma width of 23.0 cm. Tachypleus tridentatus was the first record from Korean waters. A brief description and figures of the species were given. This finding indicates that Korea is included to the distribution range of the species.

  19. Triiodide and mixed tri-halide anions from negative ion electrospray ionization of alkali halide solutions

    Science.gov (United States)

    Shukla, Anil

    2017-10-01

    Electrospray ionization of alkali halide solutions in the negative ion mode results in the formation of cluster ions of the general formula, (MX)nX-. However, alkali iodides form triiodide anion, I3-, in high abundance in addition to cluster ions. Br3- ions are observed in low abundance. Also, mixed tri-halide anions, I2Y-, are observed in high abundance when a small amount (<1%) of KI is added to other alkali halide solutions. These results are explained by the uniquely different physical characteristics of lithium and the iodide ions compared with others in the series.

  20. Tri-directional anaphases as a novel chromosome segregation defect in human oocytes.

    Science.gov (United States)

    Haverfield, Jenna; Dean, Nicola L; Nöel, Diana; Rémillard-Labrosse, Gaudeline; Paradis, Veronique; Kadoch, Isaac-Jacques; FitzHarris, Greg

    2017-06-01

    What are the chromosome segregation errors in human oocyte meiosis-I that may underlie oocyte aneuploidy? Multiple modes of chromosome segregation error were observed, including tri-directional anaphases, which we attribute to loss of bipolar spindle structure at anaphase-I. Oocyte aneuploidy is common and associated with infertility, but mechanistic information on the chromosome segregation errors underlying these defects is scarce. Lagging chromosomes were recently reported as a possible mechanism by which segregation errors occur. Long-term confocal imaging of chromosome dynamics in 50 human oocytes collected between January 2015 and May 2016. Germinal vesicle (GV) stage oocytes were collected from women undergoing intracytoplasmic sperm injection cycles and also CD1 mice. Oocytes were microinjected with complementary RNAs to label chromosomes, and in a subset of oocytes, the meiotic spindle. Oocytes were imaged live through meiosis-I using confocal microscopy. 3D image reconstruction was used to classify chromosome segregation phenotypes at anaphase-I. Segregation phenotypes were related to spindle dynamics and cell cycle timings. Most (87%) mouse oocytes segregated chromosomes with no obvious defects. We found that 20% of human oocytes segregated chromosomes bi-directionally with no lagging chromosomes. The rest were categorised as bi-directional anaphase with lagging chromosomes (20%), bi-directional anaphase with chromatin mass separation (34%) or tri-directional anaphase (26%). Segregation errors correlated with chromosome misalignment prior to anaphase. Spindles were tripolar when tri-directional anaphases occurred. Anaphase phenotypes did not correlate with meiosis-I duration (P = 0.73). Not applicable. Oocytes were recovered at GV stage after gonadotrophin-stimulation, and the usual oocyte quality caveats apply. Whilst the possibility that imaging may affect oocyte physiology cannot be formally excluded, detailed controls and justifications are presented