WorldWideScience

Sample records for superexchange ci gvb-x-ci

  1. Superexchange-Driven Magnetoelectricity in Magnetic Vortices

    NARCIS (Netherlands)

    Delaney, Kris T.; Mostovoy, Maxim; Spaldin, Nicola A.

    2009-01-01

    We demonstrate that magnetic vortices in which spins are coupled to polar lattice distortions via superexchange exhibit an unusually large linear magnetoelectric response. We show that the periodic arrays of vortices formed by frustrated spins on kagome lattices provide a realization of this concept

  2. Charge Transport by Superexchange in Molecular Host-Guest Systems

    Science.gov (United States)

    Symalla, Franz; Friederich, Pascal; Massé, Andrea; Meded, Velimir; Coehoorn, Reinder; Bobbert, Peter; Wenzel, Wolfgang

    2016-12-01

    Charge transport in disordered organic semiconductors is generally described as a result of incoherent hopping between localized states. In this work, we focus on multicomponent emissive host-guest layers as used in organic light-emitting diodes (OLEDs), and show using multiscale ab initio based modeling that charge transport can be significantly enhanced by the coherent process of molecular superexchange. Superexchange increases the rate of emitter-to-emitter hopping, in particular if the emitter molecules act as relatively deep trap states, and allows for percolation path formation in charge transport at low guest concentrations.

  3. [Hopping and superexchange mechanisms of charge transport to DNA].

    Science.gov (United States)

    Lakhno, V D; Sultanov, V B

    2003-01-01

    A theory for charge transport in nucleobase sequences was constructed in which the hole migration proceeds via hopping between guanines. Each hop over the adenine-thymine (A-T) bridge connecting neighboring guanines occurs by means of the superexchange mechanism. The experimental data and theoretical results for various types of nucleobase sequences are compared.

  4. The superexchange interactions in mixed Co-Fe ludwigite

    Energy Technology Data Exchange (ETDEWEB)

    Kazak, N.V., E-mail: nat@iph.krasn.r [L.V. Kirensky Institute of Physics, SB of RAS, 660036, Akademgorodok 50-38, Krasnoyarsk (Russian Federation); Ivanova, N.B. [Siberian Federal University, 660074, Kirensky str. 26, Krasnoyarsk (Russian Federation); Krasnoyarsk State Agrarian University, 660049, Mira str. 90, Krasnoyarsk (Russian Federation); Bayukov, O.A; Ovchinnikov, S.G [L.V. Kirensky Institute of Physics, SB of RAS, 660036, Akademgorodok 50-38, Krasnoyarsk (Russian Federation); Vasiliev, A.D. [L.V. Kirensky Institute of Physics, SB of RAS, 660036, Akademgorodok 50-38, Krasnoyarsk (Russian Federation); Siberian Federal University, 660074, Kirensky str. 26, Krasnoyarsk (Russian Federation); Rudenko, V.V. [L.V. Kirensky Institute of Physics, SB of RAS, 660036, Akademgorodok 50-38, Krasnoyarsk (Russian Federation); Bartolome, J. [Instituto de Ciencia de Materiales de Aragon. CSIC-Universidad de Zaragoza abd Departamento de Fisica de la Materia Condensada, 50009 Zaragoza (Spain); Arauzo, A. [Servicio de Instrumentacion Cientifica-Area de Medidas Fisicas. Universidad de Zaragoza, Pedro Cerbuna 12, 50009 Zaragoza (Spain); Knyazev, Yu.V. [Siberian Federal University, 660074, Kirensky str. 26, Krasnoyarsk (Russian Federation)

    2011-03-15

    The crystal structure, cation distribution and exchange interactions in the Co{sub 2.25}Fe{sub 0.75}O{sub 2}BO{sub 3} ludwigite have been explored through X-ray diffraction, electrical resistivity, ac-susceptibility and Mossbauer effect measurements. The crystal data have shown that iron atoms occupy the most symmetric crystallographic sites Fe4 and Fe2. The complex magnetic behavior with two magnetic transitions near 70 and 115 K at low temperatures was found. The Mossbauer data have displayed the trivalent iron states only. The values of superexchange energies have been estimated for Co{sub 3}O{sub 2}BO{sub 3} and Co{sub 2.25}Fe{sub 0.75}O{sub 2}BO{sub 3} yielding a significant role of frustrations in the ludwigite magnetic system. Variable range Mott hopping conductivity law was proved to be valid in the wide temperature region, pointing out a localized character of charge carriers rather than collective. - Research Highlights: The high quality single crystals of Co{sub 2.25}Fe{sub 0.75}O{sub 2}BO{sub 3} ludwigite were synthesized. The orthorhombic crystal symmetry with P{sub bam} space group was found. The Fe{sup 3+} ions predominantly occupy the octahedral positions 2 and 4. The complex magnetic behavior and magnetic transitions at 70 and 115 K were found. The values of superexchange energies have been estimated.

  5. CI Implementation

    DEFF Research Database (Denmark)

    Jørgensen, Frances; Boer, Harry; Laugen, Bjørge Timenes

    2006-01-01

    There are a number of tools available for organizations wishing to measure and subsequently develop Continuous Improvement (CI). In this article, we review and evaluate a well-accepted CI development model, namely the CI Maturity Model (Bessant and Caffyn, 1997), against data collected from the 2...

  6. Ci PERMIT

    CERN Multimedia

    Relations with the Host States Service

    1999-01-01

    The Swiss Permanent Mission to the International Organisations at Geneva recalls that only the spouses and children of members of personnel resident in Switzerland and in possession of a legitimation card of types 'B', 'C', 'D' or 'E' issued by the Swiss Federal Department of Foreign Affairs are entitled to benefit from a Ci Permit.The 'demande d'attestation de permis Ci' (request for a Ci permit attestation) can be sent to the Mission only through Personnel Division (Administrative Services, Office 33/1-025).Additional information on access by family members of CERN officials to the Swiss labour market are available to you on the Web site of the Relations with the Host States Service (cf. document entitled 'Employment in Switzerland for spouses and children of CERN officials' dated March 1996).Relations with the Host States Servicehttp://www.cern.ch/relations/Tel. 72848

  7. Monte Carlo study of the double and super-exchange model with lattice distortion

    Energy Technology Data Exchange (ETDEWEB)

    Suarez, J R; Vallejo, E; Navarro, O [Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexico, Apartado Postal 70-360, 04510 Mexico D. F. (Mexico); Avignon, M, E-mail: jrsuarez@iim.unam.m [Institut Neel, Centre National de la Recherche Scientifique (CNRS) and Universite Joseph Fourier, BP 166, 38042 Grenoble Cedex 9 (France)

    2009-05-01

    In this work a magneto-elastic phase transition was obtained in a linear chain due to the interplay between magnetism and lattice distortion in a double and super-exchange model. It is considered a linear chain consisting of localized classical spins interacting with itinerant electrons. Due to the double exchange interaction, localized spins tend to align ferromagnetically. This ferromagnetic tendency is expected to be frustrated by anti-ferromagnetic super-exchange interactions between neighbor localized spins. Additionally, lattice parameter is allowed to have small changes, which contributes harmonically to the energy of the system. Phase diagram is obtained as a function of the electron density and the super-exchange interaction using a Monte Carlo minimization. At low super-exchange interaction energy phase transition between electron-full ferromagnetic distorted and electron-empty anti-ferromagnetic undistorted phases occurs. In this case all electrons and lattice distortions were found within the ferromagnetic domain. For high super-exchange interaction energy, phase transition between two site distorted periodic arrangement of independent magnetic polarons ordered anti-ferromagnetically and the electron-empty anti-ferromagnetic undistorted phase was found. For this high interaction energy, Wigner crystallization, lattice distortion and charge distribution inside two-site polarons were obtained.

  8. [Combined hopping-superexchange mechanism of charge transfer in DNA; a model with nearest interactions].

    Science.gov (United States)

    Lakhno, V D; Sultanov, V B

    2007-01-01

    In the framework of the earlier developed combined hopping-superexchange mechanism of charge transfer in DNA, a model with all nearest interactions between nucleobases is proposed. It is shown that the transfer rates for various types of nucleotide sequences calculated within this model are in a good agreement with experimental data.

  9. Photoinduced electron transfer across molecular bridges: electron- and hole-transfer superexchange pathways.

    Science.gov (United States)

    Natali, Mirco; Campagna, Sebastiano; Scandola, Franco

    2014-06-21

    Photoinduced electron transfer plays key roles in many areas of chemistry. Superexchange is an effective model to rationalize photoinduced electron transfer, particularly when molecular bridges between donor and acceptor subunits are present. In this tutorial review we discuss, within a superexchange framework, the complex role played by the bridge, with an emphasis on differences between thermal and photoinduced electron transfer, oxidative and reductive photoinduced processes, charge separation and charge recombination. Modular bridges are also considered, with specific attention to the distance dependence of donor-acceptor electronic coupling and electron transfer rate constants. The possibility of transition, depending on the bridge energetics, from coherent donor-acceptor electron transfer to incoherent charge injection and hopping through the bridge is also discussed. Finally, conceptual analogies between bridge effects in photoinduced electron transfer and optical intervalence transfer are outlined. Selected experimental examples, instrumental to illustration of the principles, are discussed.

  10. Quantum treatment of the Anderson–Hasegawa model in the presence of superexchange

    Indian Academy of Sciences (India)

    P A Sreeram; Manidipa Mitra; Sushanta Dattagupta

    2003-09-01

    We revisit the Anderson–Hasegawa double-exchange model and critically examine its exact solution when the core spins are treated quantum mechanically. We show that the quantum effects, in the presence of an additional superexchange interaction between the core spins, yield a term, the significance of which has been hitherto ignored. The importance of this term is further assessed by numerically exact computation for a four-spin system.

  11. Superexchange coupling and electron transfer in globular proteins via polaron excitations.

    Science.gov (United States)

    Chuev, G N; Lakhno, V D; Ustitnin, M N

    2000-06-01

    The polaron approach is used to treat long-range electron transfersbetween globular proteins. A rate expression for the polaron transfer model is given along with a description of appropriate conditions forits use. Assuming that electrons transfer via a superexchange couplingdue to a polaron excitation, we have estimated the distance dependenceof the rate constant for the self-exchange reactions between globularproteins in solutions. The distance dependence of the polaron coupling andsolvent reorganization energy are provided as a basis forunderstanding and interpreting a long-range electron transfer experiment.The difficulties and problems of the polaron treatment of long-rangeelectron transfers are discussed, and suggestions for new experimentsare made.

  12. Theory of ferromagnetism driven by superexchange in dilute magnetic semi-conductors

    Directory of Open Access Journals (Sweden)

    Simserides C.

    2014-07-01

    Full Text Available Magnetic properties of Ga1−xMnxN are studied theoretically by employing a tight binding approach to determine exchange integrals Jij characterizing the coupling between Mn spin pairs located at distances Rij up to the 16th cation coordination sphere in zinc-blende GaN. It is shown that for a set of experimentally determined input parameters there are no itinerant carriers and the coupling between localized Mn3+ spins in GaN proceeds via superexchange that is ferromagnetic for all explored Rij values. Extensive Monte Carlo simulations serve to evaluate the magnitudes of Curie temperature TC by the cumulant crossing method. The theoretical values of TC(x are in quantitative agreement with the experimental data that are available for Ga1−xMnxN with randomly distributed Mn3+ ions with the concentrations 0.01 ≤ x ≤ 0.1.

  13. Competition between strain and superexchange mediated magnetism in modified cobalt ferrite

    Science.gov (United States)

    Kumar, Rajnish; Aman, Abhay Kr.; Singh, Rakesh Kr.; Kar, Manoranjan

    2017-05-01

    Co1-xSrxFe2-xTixO4 (x = 0.01, 0.05, 0.1, 0.15, 0.2) has been synthesized using the sol-gel technique. The phase purity of the material has been studied by employing the X-ray powder diffraction (XRD) technique. The obtained XRD pattern shows the characteristic of F d 3 ¯m space group in cubic symmetry. The magnetic hysteresis loop has been recorded using vibrating sample magnetometer (VSM) at room temperature in the field range of ±2T. The loop has been studied using Law of Approach (LA) to saturation to calculate magnetocrystalline anisotropy. The magnetocrystalline anisotropy and saturation magnetization decrease with increase in doping concentration. Competition between strain mediated magnetism and magnetism due to superexchange interactions between cations has been observed.

  14. Superconductivity in optimally doped cuprates: BZA program works well and superexchange is the glue

    Directory of Open Access Journals (Sweden)

    G. Baskaran

    2006-09-01

    Full Text Available   Resonating valence bond states in a doped Mott insulator was proposed to explain superconductivity in cuprates in January 1987 by Anderson. A challenging task then was proving existence of this unconventional mechanism and a wealth of possibilities, with a rigor acceptable in standard condensed matter physics, in a microscopic theory and develop suitable many body techniques. Shortly, a paper by Anderson, Zou and us (BZA undertook this task and initiated a program. Three key papers that followed, shortly, essentially completed the program, as far as superconductivity is concerned,i a gauge theory approach by Anderson and us, that went beyond mean field theory ii Kotliar’s d -wave solution in BZA theory iii improvement of a renormalized Hamiltonian in BZA theory, using a Gutzwiller approximation by Zhang, Gros, Rice and Shiba. In this article I shall focus on the merits of BZA and gauge theory papers. They turned out to be a foundation for subsequent developments dealing with more aspects that were unconventional - d -wave order parameter with nodal Bogoliubov quasi particles, Affleck-Marston’s π-flux condensed spin liquid phase, unconventional spin-1 collective mode at (π, π, and other fascinating developments. Kivelson, Rokhsar and Sethna’s idea of holons and their bose condensation found expression in the slave boson formalism and lead to results similar to BZA program. At optimal doping, correlated electrons acquire sufficient fermi sea character, at the same time retain enough superexchange inherited from a Mott insulator parentage, ending in a BCS like situation with superexchange as a glue! Not surprisingly, mean field theory works well at optimal doping, even quantitatively. Further, t-J model is a minimal model only around optimal doping, where RVB superconductivity is also at its best.

  15. Understanding the charge transport and polarities in organic donor-acceptor mixed-stack crystals: molecular insights from the super-exchange couplings.

    Science.gov (United States)

    Geng, Hua; Zheng, Xiaoyan; Shuai, Zhigang; Zhu, Lingyun; Yi, Yuanping

    2015-02-25

    Charge transport and polarity in organic D-A mixed-stack crystals are examined in terms of super-exchange electronic couplings. When the super-exchange coupling is dominated by the interaction between donor HOMO and acceptor LUMO, ambipolar transport is achieved. Otherwise, involvement of other bridge orbitals can lead to unbalanced, even to unipolar transport in a special case that the HOMO-LUMO interaction vanishes.

  16. Intramolecular Charge Transfer of Carotene-porphyrin-fullerene Triad: Sequential or Superexchange Cechanism

    Institute of Scientific and Technical Information of China (English)

    SUN,Yu; CHEN,Yue-Hui; LI,Yuan-Zuo; LI,Yong-Qing; MA,Feng-Cai

    2008-01-01

    As an excellent artificial photosynthetic reaction center,the carotene (C)-porphyrin (P)-fullerene (F) triad was extensively investigated experimentally.To reveal the mechanism of the intramolecular charge transfer (ICT) on the mimic of photosynthetic solar energy conversion (such as singlet energy transfer between pigments,and photoinduced electron transfer from excited singlet states to give long-lived charge-separated states),the ICT mechanisms of C-P-F triad on the exciton were theoretically studied with quantum chemical methods as well as the 2D and 3D real space analysis approaches.The results of quantum chemical methods reveal that the excited states are the ICT states,since the densities of HOMO are localized in the carotene or porphyrin unit,and the densities of LUMO are localized in the fullerene unit.Furthermore,the excited states should be the intramolecular superexchange charge transfer (ISCT) states for the orbital transition from the HOMO whose densities are localized in the carotene to the LUMO whose densities are localized in the fullerene unit.The 3D charge difference densities can clearly show that some excited states are ISCT excited states,since the electron and hole are resident in the fullerene and carotene units,respectively.From the results of the electron-hole coherence of the 2D transition density matrix,not only 3D results are supported,but also the delocalization size on the exciton can be observed.These phenomena were further interpreted with non-linear optical effect.The large changes of the linear and non-linear polarizabilities on the exciton result in the charge separate states,and if their changes are large enough,the ICT mechanism can become the ISCT on the exciton.

  17. (Human) Resourcing For CI

    DEFF Research Database (Denmark)

    Jørgensen, Frances; S., Jacob; Kofoed, Lise Busk

    2005-01-01

    More and more, the ability to compete in today’s market is viewed as being dependent on human capital. One of the most challenging aspects of human resource management involves supplying the organization with the human capital necessary to fulfill its objectives. This task becomes especially...... challenging in organizations involved in change processes such as Continuous Improvement (CI), as the technical skills traditionally valued are no longer adequate. These companies are faced with the question: “What competencies should our employees possess in order to contribute to our success, given...... the change processes in which we are engaged?” Without a clear picture of the types of competencies required to implement CI, it is impossible for companies to make informed decisions regarding recruitment, hiring, and training of their workforce. The objective of this paper is therefore to define...

  18. Mössbauer studies on cation distributions and superexchange interactions in Cu0.2Fe2.8O4

    Science.gov (United States)

    Kim, Sam Jin; Choi, Hyunkyung; Lim, Jung Tae; Kim, Chul Sung; Hahn, Eun Joo

    2016-02-01

    The cation distributions and the superexchange interactions of Cu0.2Fe2.8O4 have been studied by Mössbauer spectroscopy and X-ray diffraction. The crystal is found to have a cubic spinel structure with the lattice constant a 0 = 8.4007 ± 0.0004 ˚A. The Mössbauer spectra show line broadening in the octahedral ( B) site, which is interpreted by probability distribution of cations. The dominant superexchange interaction is found to be an antiferromagnetic intersublattice A- O- B superexchange interaction, and its strength is J A- B = -20.7 k B . The intrasublattice A- O- A superexchange interaction is also antiferromagnetic and its strength is J A- A = -9.3 k B . The weakest superexchange interaction is the ferromagnetic B-O-B interaction: J B- B = 0.7 k B . The Debye temperatures of the tetrahedral and the octahedral sites are found to be Θ A = 459 ± 5 K and Θ B = 351 ± 5 K, respectively.

  19. Antiferromagnetic superexchange via 3d states of titanium in EuTiO3 as seen from hybrid Hartree-Fock density functional calculations

    Science.gov (United States)

    Akamatsu, Hirofumi; Kumagai, Yu; Oba, Fumiyasu; Fujita, Koji; Murakami, Hideo; Tanaka, Katsuhisa; Tanaka, Isao

    2011-06-01

    A superexchange mechanism between Eu2+ 4f spins via the 3d states of nonmagnetic Ti4+ ions is proposed through first-principles calculations based on a hybrid Hartree-Fock density functional approach to explain G-type antiferromagnetism in EuTiO3. This mechanism is supported by systematic calculations for related Eu2+-based perovskite oxides. In EuTiO3, the competition between the antiferromagnetic superexchange and an indirect ferromagnetic exchange via the Eu 5d states leads to a delicate balance between antiferromagnetic and ferromagnetic phases. The superexchange mechanism involving the Ti 3d states hints at the microscopic origin of the strong spin-lattice coupling in EuTiO3.

  20. Pressure effect on the energy structure and superexchange interaction in undoped orthorhombic La2CuO4

    Science.gov (United States)

    Gavrichkov, Vladimir A.; Pchelkina, Zlata V.; Nekrasov, Igor A.; Ovchinnikov, Sergey G.

    2016-09-01

    We studied the pressure dependences of the electronic structure and superexchange interaction J(P) = JA - JB (where JA and JB are antiferromagnetic (AFM) and ferromagnetic (FM) contributions) in antiferromagnetic La214 under hydrostatic, uniaxial (along c-axial) 3% compressions and 1% in-plane compressions by the local density approximation with generalized tight-binding method (LDA + GTB cell approach). The changes in J(P) correlated with the experimentally known TC(P) dependence are in accordance with the relation dTC/dP = (∂TC/∂J)(∂J/∂P), where ∂TC/∂J ˜ 0.1. The in-plane pressure more effectively stabilizes the ground singlet two-hole state A1 than the simple hydrostatic pressure, its effect on J and TC is the largest. Within the same cell approach together with the superexchange interaction J(P), the valence band structure was calculated. Its changes with pressure clearly reproduce the k-distribution of the singlet and triplet quasi-particles over the Brillouin zone (BZ).

  1. Verification of Anderson Superexchange in MnO via Magnetic Pair Distribution Function Analysis and ab initio Theory

    Science.gov (United States)

    Frandsen, Benjamin A.; Brunelli, Michela; Page, Katharine; Uemura, Yasutomo J.; Staunton, Julie B.; Billinge, Simon J. L.

    2016-05-01

    We present a temperature-dependent atomic and magnetic pair distribution function (PDF) analysis of neutron total scattering measurements of antiferromagnetic MnO, an archetypal strongly correlated transition-metal oxide. The known antiferromagnetic ground-state structure fits the low-temperature data closely with refined parameters that agree with conventional techniques, confirming the reliability of the newly developed magnetic PDF method. The measurements performed in the paramagnetic phase reveal significant short-range magnetic correlations on a ˜1 nm length scale that differ substantially from the low-temperature long-range spin arrangement. Ab initio calculations using a self-interaction-corrected local spin density approximation of density functional theory predict magnetic interactions dominated by Anderson superexchange and reproduce the measured short-range magnetic correlations to a high degree of accuracy. Further calculations simulating an additional contribution from a direct exchange interaction show much worse agreement with the data. The Anderson superexchange model for MnO is thus verified by experimentation and confirmed by ab initio theory.

  2. The effect of uniaxial crystal-field anisotropy on magnetic properties of the superexchange antiferromagnetic Ising model

    Directory of Open Access Journals (Sweden)

    L.Canová

    2006-01-01

    Full Text Available The generalized Fisher super-exchange antiferromagnetic model with uniaxial crystal-field anisotropy is exactly investigated using an extended mapping technique. An exact relation between partition function of the studied system and that of the standard zero-field spin-1/2 Ising model on the corresponding lattice is obtained applying the decoration-iteration transformation. Consequently, exact results for all physical quantities are derived for arbitrary spin values S of decorating atoms. Particular attention is paid to the investigation of the effect of crystal-field anisotropy and external longitudinal magnetic field on magnetic properties of the system under investigation. The most interesting numerical results for ground-state and finite-temperature phase diagrams, thermal dependences of the sublattice magnetization and other thermodynamic quantities are discussed.

  3. An adjustable contracted CI method

    Institute of Scientific and Technical Information of China (English)

    王育彬; 甘正汀; 苏克和; 文振翼

    1999-01-01

    A new contracted CI scheme——adjustable contracted CI scheme——is presented and programed. The efficiency of this scheme is tested by some example calculations. The result shows that the application of the new scheme is flexible and the correlation energy loss is lower than that of the original externally contracted CI method.

  4. Probing the magnetic superexchange couplings between terminal CuII ions in heterotrinuclear bis(oxamidato type complexes

    Directory of Open Access Journals (Sweden)

    Mohammad A. Abdulmalic

    2017-04-01

    Full Text Available The reaction of one equivalent of [n-Bu4N]2[Ni(opboR2] with two equivalents of [Cu(pmdta(X2] afforded the heterotrinuclear CuIINiIICuII containing bis(oxamidato type complexes [Cu2Ni(opboR2(pmdta2]X2 (R = Me, X = NO3– (1; R = Et, X = ClO4– (2; R = n-Pr, X = NO3– (3; opboR2 = o-phenylenebis(NR-substituted oxamidato; pmdta = N,N,N’,N”,N”-pentamethyldiethylenetriamine. The identities of the heterotrinuclear complexes 1–3 were established by IR spectroscopy, elemental analysis and single-crystal X-ray diffraction studies, which revealed the cationic complex fragments [Cu2Ni(opboR2(pmdta2]2+ as not involved in any further intermolecular interactions. As a consequence thereof, the complexes 1–3 possess terminal paramagnetic [Cu(pmdta]2+ fragments separated by [NiII(opboR2]2– bridging units representing diamagnetic SNi = 0 states. The magnetic field dependence of the magnetization M(H of 1–3 at T = 1.8 K has been determined and is shown to be highly reproducible with the Brillouin function for an ideal paramagnetic spin = 1/2 system, verifying experimentally that no magnetic superexchange couplings exists between the terminal paramagnetic [Cu(pmdta]2+ fragments. Susceptibility measurements versus temperature of 1–3 between 1.8–300 K were performed to reinforce the statement of the absence of magnetic superexchange couplings in these three heterotrinuclear complexes.

  5. Effect of super-exchange interaction on ground state magnetic properties of spin-dependent Falicov-Kimball model on a triangular lattice

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Sant, E-mail: santkumar1210@gmail.com; Maitra, Tulika; Singh, Ishwar [Department of Physics, Indian Institute of Technology Roorkee, Roorkee-247667, Uttarakhand (India); Yadav, Umesh K. [Center for Condensed Matter Theory, Indian Institute of Science, Bangalore-560012 (India)

    2015-06-24

    Ground state magnetic properties are studied by incorporating the super-exchange interaction (J{sub se}) in the spin-dependent Falicov-Kimball model (FKM) between localized (f-) electrons on a triangular lattice for half filled case. Numerical diagonalization and Monte-Carlo simulation are used to study the ground state magnetic properties. We have found that the magnetic moment of (d-) and (f-) electrons strongly depend on the value of Hund’s exchange (J), super-exchange interaction (J{sub se}) and also depends on the number of (d-) electrons (N{sub d}). The ground state changes from antiferromagnetic (AFM) to ferromagnetic (FM) state as we decrease (N{sub d}). Also the density of d electrons at each site depends on the value of J and J{sub se}.

  6. Effect of super-exchange interaction on ground state magnetic properties of spin-dependent Falicov-Kimball model on a triangular lattice

    Science.gov (United States)

    Kumar, Sant; Yadav, Umesh K.; Maitra, Tulika; Singh, Ishwar

    2015-06-01

    Ground state magnetic properties are studied by incorporating the super-exchange interaction (Jse) in the spin-dependent Falicov-Kimball model (FKM) between localized (f-) electrons on a triangular lattice for half filled case. Numerical diagonalization and Monte-Carlo simulation are used to study the ground state magnetic properties. We have found that the magnetic moment of (d-) and (f-) electrons strongly depend on the value of Hund's exchange (J), super-exchange interaction (Jse) and also depends on the number of (d-) electrons (Nd). The ground state changes from antiferromagnetic (AFM) to ferromagnetic (FM) state as we decrease (Nd). Also the density of d electrons at each site depends on the value of J and Jse.

  7. Ciência E Capitalismo

    OpenAIRE

    Julia Paula Motta de Souza

    2010-01-01

    Este artigo reflete sobre as relações entre a ciência moderna e o capitalismo. Historicamente a ciência moderna nasce ligada ao capitalismo, pretendendo-se impor como saber hegemônico, livre de valores e baseada em quantificações. Na presente fase neoliberal do capitalismo, na qual se acentua a tendência a transformar tudo em mercadoria, a ciência vem sendo mercantilizada e as condições de trabalho dos pesquisadores vem s...

  8. Effects of energy correlations and superexchange on charge transport and exciton formation in amorphous molecular semiconductors: An ab initio study

    Science.gov (United States)

    Massé, Andrea; Friederich, Pascal; Symalla, Franz; Liu, Feilong; Meded, Velimir; Coehoorn, Reinder; Wenzel, Wolfgang; Bobbert, Peter A.

    2017-03-01

    In this study, we investigate on the basis of ab initio calculations how the morphology, molecular on-site energies, reorganization energies, and charge transfer integral distribution affect the hopping charge transport and the exciton formation process in disordered organic semiconductors. We focus on three materials applied frequently in organic light-emitting diodes: α -NPD , TCTA, and Spiro-DPVBi. Spatially correlated disorder and, more importantly, superexchange contributions to the transfer integrals, are found to give rise to a significant increase of the electric field dependence of the electron and hole mobility. Furthermore, a material-specific correlation is found between the HOMO and LUMO energy on each specific molecular site. For α -NPD and TCTA, we find a positive correlation between the HOMO and LUMO energies, dominated by a Coulombic contribution to the energies. In contrast, Spiro-DPVBi shows a negative correlation, dominated by a conformational contribution. The size and sign of this correlation have a strong influence on the exciton formation rate.

  9. Reentrant phenomenon and inverse magnetocaloric effect in a generalized spin-(1/2,  s) Fisher’s super-exchange antiferromagnet

    Science.gov (United States)

    Gálisová, Lucia

    2016-11-01

    The thermodynamic and magnetocaloric properties of a generalized spin-(1/2,  s) Fisher’s super-exchange antiferromagnet are investigated precisely by using the decoration-iteration mapping transformation. Besides the critical temperature, sublattice magnetization, total magnetization, entropy and specific heat, the isothermal entropy change and adiabatic temperature change are also rigorously calculated in order to examine the cooling efficiency of the model in the vicinity of the first- and second-order phase transitions. It is shown that an enhanced inverse magnetocaloric effect occurs around the temperature interval {{T}\\text{c}}(B\

  10. VELoCiRaPTORS.

    Science.gov (United States)

    Lundgren, J.; Esham, B.; Padalino, S. J.; Sangster, T. C.; Glebov, V.

    2007-11-01

    The Venting and Exhausting of Low Level Air Contaminants in the Rapid Pneumatic Transport of Radioactive Samples (VELoCiRaPTORS) system is constructed to transport radioactive materials quickly and safely at the NIF. A radioactive sample will be placed inside a carrier that is transported via an airflow system produced by controlled differential pressure. Midway through the transportation process, the carrier will be stopped and vented by a powered exhaust blower which will remove radioactive gases within the transport carrier. A Geiger counter will monitor the activity of the exhaust gas to ensure that it is below acceptable levels. If the radiation level is sufficient, the carrier will pass through the remainder of the system, pneumatically braking at the counting station. The complete design will run manually or automatically with control software. Tests were performed using an inactive carrier to determine possible transportation problems. The system underwent many consecutive trials without failure. VELoCiRaPTORS is a prototype of a system that could be installed at both the Laboratory for Laser Energetics at the University of Rochester and the National Ignition Facility at LLNL.

  11. Long-range superexchange in Cu2A2O7 (A= P, As, V) as a key element of the microscopic magnetic model

    Science.gov (United States)

    Janson, O.; Tsirlin, A. A.; Sichelschmidt, J.; Skourski, Y.; Weickert, F.; Rosner, H.

    2011-03-01

    A microscopic magnetic model for α-Cu2P2O7 is evaluated in a combined theoretical and experimental study. Despite a dominant intradimer coupling J1, sizable interdimer couplings enforce long-range magnetic ordering at TN=27 K. The spin model for α-Cu2P2O7 is compared to the models of the isostructural β-Cu2V2O7 and α-Cu2As2O7 systems. As a surprise, coupled dimers in α-Cu2P2O7 and alternating chains in α-Cu2As2O7 contrast with a honeycomb lattice in β-Cu2V2O7. We find that the qualitative difference in the coupling regime of these isostructural compounds is governed by the nature of AO4 side groups: d elements (A=V) hybridize with nearby O atoms forming a Cu-O-A-O-Cu superexchange path, while for p elements (A= P, As) the superexchange is realized via O-O edges of the tetrahedron. Implications for a broad range of systems are discussed.

  12. Influence of polaron effects on superexchange interaction. Isotopic shifts of T sub N , T sub c and T* in laminated copper oxides

    CERN Document Server

    Eremin, M V; Larionov, I A; Terzi, A V

    2002-01-01

    The compact formula for the parameter for the magnetic ions superexchange interaction through intermediate anions with an account of the polaron effects both on the magnetic ions and intermediate anions is obtained. It is applied for the analysis of the basic peculiarities of these types of temperature in the layered cuprates on the HTSC basis: the Neel temperature (T sub N), critical temperatures of the transition into the superconducting state (T sub c) and characteristic temperatures of the normal phases pseudogap state (T*). The calculations are based on the scenario of competition of the superconducting phase with the charge-current waves phase. The agreement of the calculation with the experiment testifies to the benefit of the above scenario

  13. Ferromagnetic exchange anisotropy from antiferromagnetic superexchange in the mixed 3d-5d transition-metal compound Sr3CuIrO6.

    Science.gov (United States)

    Yin, Wei-Guo; Liu, X; Tsvelik, A M; Dean, M P M; Upton, M H; Kim, Jungho; Casa, D; Said, A; Gog, T; Qi, T F; Cao, G; Hill, J P

    2013-08-02

    We report a combined experimental and theoretical study of the unusual ferromagnetism in the one-dimensional copper-iridium oxide Sr(3)CuIrO(6). Utilizing Ir L(3) edge resonant inelastic x-ray scattering, we reveal a large gap magnetic excitation spectrum. We find that it is caused by an unusual exchange anisotropy generating mechanism, namely, strong ferromagnetic anisotropy arising from antiferromagnetic superexchange, driven by the alternating strong and weak spin-orbit coupling on the 5d Ir and 3d Cu magnetic ions, respectively. From symmetry consideration, this novel mechanism is generally present in systems with edge-sharing Cu(2+)O(4) plaquettes and Ir(4+)O(6) octahedra. Our results point to unusual magnetic behavior to be expected in mixed 3d-5d transition-metal compounds via exchange pathways that are absent in pure 3d or 5d compounds.

  14. Main: 2CI2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 2CI2 大麦 Barley Hordeum vulgare l. Subtilisin-Chymotrypsin Inhibitor-2a Hordeum Vulg...DB; 1YPC; X-ray; I=20-83.|PDB; 2CI2; X-ray; I=1-83.|PDB; 2SNI; X-ray; I=1-83.|PDB; 3CI2...ecular weight: 9250 Da SSVEKKPEGVNTGAGDRHNLKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLFVDKLDNIAQVPRVG barley_2CI2.jpg ...

  15. Main: 3CI2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 3CI2 大麦 Barley Hordeum vulgare l. Subtilisin-Chymotrypsin Inhibitor-2a Hordeum Vulg...ray; I=20-83.|PDB; 1YPC; X-ray; I=20-83.|PDB; 2CI2; X-ray; I=1-83.|PDB; 2SNI; X-ray; I=1-83.|PDB; 3CI2; NMR;... Length: 83 AA, Molecular weight: 9250 Da SSVEKKPEGVNTGAGDRHNLKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLFVDKLDNIAQVPRVG barley_3CI2.jpg ...

  16. É o marketing uma ciência

    OpenAIRE

    Bulcão, Maria Cristina Correa

    1982-01-01

    Trata da controvérsia "é o Marketing uma Ciência?" apontando, como possibilidade para o desenvolvimento de uma Ciência de Marketing, uma abordagem do Marketing como Instituição Social, implicando, entre outras coisas, na transferência de seu objeto central de estudo da transação para o mercado.

  17. Reentrant phenomenon and inverse magnetocaloric effect in a generalized spin-(1/2,  s) Fisher's super-exchange antiferromagnet.

    Science.gov (United States)

    Gálisová, Lucia

    2016-11-30

    The thermodynamic and magnetocaloric properties of a generalized spin-(1/2,  s) Fisher's super-exchange antiferromagnet are investigated precisely by using the decoration-iteration mapping transformation. Besides the critical temperature, sublattice magnetization, total magnetization, entropy and specific heat, the isothermal entropy change and adiabatic temperature change are also rigorously calculated in order to examine the cooling efficiency of the model in the vicinity of the first- and second-order phase transitions. It is shown that an enhanced inverse magnetocaloric effect occurs around the temperature interval [Formula: see text] for any magnetic-field change [Formula: see text]. The most pronounced inverse magnetocaloric effect can be found nearby the critical field, which corresponds to the zero-temperature phase transition from the long-range ordered ground state to the paramagnetic one. The observed phenomenon increases with an increasing value of decorating spins. Furthermore, sufficiently high values of decorating spins have also been linked to the possibility of observing reentrant phase transitions at finite temperatures.

  18. Doubly TEMPO-coordinated gadolinium(III), lanthanum(III), and yttrium(III) complexes. Strong superexchange coupling across rare earth ions.

    Science.gov (United States)

    Murakami, Rina; Nakamura, Takeshi; Ishida, Takayuki

    2014-04-21

    We prepared crystalline [RE(III)(hfac)3(TEMPO)2] (RE = Gd, La, Y), where TEMPO and hfac stand for 2,2,6,6-tetramethylpiperidin-1-oxyl and 1,1,1,5,5,5-hexafluoropentane-2,4-dionate, respectively. The X-ray crystal structure of TEMPO-coordinated RE compounds was determined for the first time. The Gd and Y analogues are isomorphous, and the La derivative has a similar molecular skeleton. The Gd-O(TEMPO) bond lengths were 2.322(3) and 2.354(3) Å with the O-Gd-O angle of 140.36(11)°. The magnetic study clarified that [Gd(hfac)3(TEMPO)2] behaved as a ground Stotal = 7/2 species. The La and Y analogues showed the superexchange interactions across the diamagnetic ions with 2JTEMPO1-TEMPO2/kB = -14.9(1) and -49.8(2) K, respectively. Assuming the presence of a similar interaction like the Y derivative, the Gd-TEMPO exchange couplings are estimated with 2JGd-TEMPO/kB = -12.9(5) and +8.0(6) K.

  19. High temperature susceptibility in electron doped Ca sub 1 sub - sub x Y sub x MnO sub 3 double exchange versus superexchange

    CERN Document Server

    Aliaga, H; Tovar, M; Butera, A; Alascio, B; Vega, D; Leyva, G; Polla, G; König, P

    2003-01-01

    We present a study of the magnetic properties of the electron doped manganites Ca sub 1 sub - sub x Y sub x MnO sub 3 (for 0 sup 450 K and, below this temperature, chi sup - sup 1 (T) shows a ferrimagnetic-like curvature. We approached the discussion of these results in terms of a simple mean-field model where double exchange, approximated by a ferromagnetic Heisenberg-like interaction between Mn sup 3 sup + and Mn sup 4 sup + ions, competes with classical superexchange. For higher levels of doping (x sup>= 0.15), the CW behaviour is observed down to the magnetic ordering temperature (T sub m sub o) and a better description of chi(T) was obtained by assuming full delocalization of the e sub g electrons. In order to explore the degree of delocalization as a function of T and x, we analysed the problem through Monte Carlo simulations. Within this picture we found that at high T the electrons doped are completely delocalized but, when T sub m sub o is approached, they form magnetic polarons of large spin that ca...

  20. Nietzsche e a Gaia ciência

    Directory of Open Access Journals (Sweden)

    Rodrigo de Souza Dantas Mendonça Pinto

    2007-12-01

    Full Text Available Este breve ensaio é uma interpretação da epígrafe escolhida por Nietzsche para seu livro gaia ciência.Através dela se pretende demonstrar em que medida a noção de 'gaia ciência', erigida a partir da compreensão do mundo como fenômeno essencialmente poético,nos leva a uma reflexão sobre o sentido e a articulação fundamental entre arte, sabedoria,conhecimento,ciêcia, filosofia,ética e educação. 

  1. Language Practices in the Ci-Classroom

    DEFF Research Database (Denmark)

    Mourtou, Eleni

    2014-01-01

    Prelingually deafened children are nowadays likely to receive a cochlear implant (ci). As these children do their language acquisition with a cochlear implant they require a constant rehabilitation and support. Educational staff is instructed on how to work with children with ci in form...... during the storytelling activity: repeat requests and questions. Whereas repeat requests are used in ci-therapy, questions have been shown to be instrumentalized for educational purposes in the setting of a school. I will reveal the educational/rehabilitational issues that are linked to these practices....

  2. ANALIZA NIEZAWODNOŚCI STACJI UZDATNIANIA WODY

    Directory of Open Access Journals (Sweden)

    Barbara TCHÓRZEWSKA-CIEŚLAK

    Full Text Available Systemy zbiorowego zaopatrzenia w wodę składają się z połączonych ze sobą elementów (podsystemów stanowiących integralna całość, współpracujących ze sobą w sposób ciągły w celu zapewnienia dla konsumentów wody o odpowiedniej jakości. W przypadku gdy jakość wody w źródle nie odpowiada normatywom stawianym wodzie przeznaczonej do spożycia przez ludzi, woda musi być poddana procesom uzdatniania. Niezawodność funkcjonowania stacji uzdatniania wody jest jednym z podstawowych elementów szeroko rozumianej analizy niezawodności i bezpieczeństwa całego systemu zbiorowego zaopatrzenia w wodę. Niezawodność dostawy wody polega na zapewnieniu stabilnych warunków, umożliwiających pokrycie bieżącego i perspektywicznego zapotrzebowania na wodę w odpowiedniej ilości i wymaganej jakości w dowolnym, dogodnym dla konsumentów wody czasie. W pracy przedstawiono podstawy analizy niezawodności, podano podstawowe miary oraz zasady wykorzystania struktur niezawodnościowych. Obliczenia wykonano dla stacji uzdatniania wody na podstawie schematu niezwodnościowego metodą jednoparametryczną. Na podstawie danych z eksploatacyjnych stacji uzdatniania wody (SUW wchodzącej w skład systemu zbiorowego zaopatrzenia w wodę miasta liczącego ok 80 tys. mieszkańców sporządzono schemat niewodności stacji oraz przeprowadzono obliczenia wskaźnika gotowości K. W metodzie wykorzystano podstawowe struktury niezawodnościowe. Wyznaczoną miarę niezawodności porównano z wartościami kryterialnymi.

  3. Aerobiologia: uma ciência para quem ?

    OpenAIRE

    Fabião, António; Fabião, André

    2006-01-01

    A aerobiologia pode ser definida como a ciência que estuda o material biológico e os organismos que se encontram na atmosfera, incluindo a sua libertação para a mesma, bem como a sua dispersão e transporte, deposição ou outra forma de remoção da atmos fera, e os seus impactes na vida vegetal, animal e humana. Trata-se de uma ciência interdisciplinar, com ligações a variadas áreas do conhecimento, incluindo a botânica, a ecologia, a meteorologia, a agricultura, a silvicultura e a alergologia c...

  4. Aerobiologia: uma ciência para quem ?

    OpenAIRE

    Fabião, António; Fabião, André

    2006-01-01

    A aerobiologia pode ser definida como a ciência que estuda o material biológico e os organismos que se encontram na atmosfera, incluindo a sua libertação para a mesma, bem como a sua dispersão e transporte, deposição ou outra forma de remoção da atmos fera, e os seus impactes na vida vegetal, animal e humana. Trata-se de uma ciência interdisciplinar, com ligações a variadas áreas do conhecimento, incluindo a botânica, a ecologia, a meteorologia, a agricultura, a silvicultura e a alergologia c...

  5. Language Practices in the Ci-Classroom

    DEFF Research Database (Denmark)

    Mourtou, Eleni

    2014-01-01

    Prelingually deafened children are nowadays likely to receive a cochlear implant (ci). As these children do their language acquisition with a cochlear implant they require a constant rehabilitation and support. Educational staff is instructed on how to work with children with ci in form...... of guidelines and workshops. This paper discusses language practices used in the setting of a school for cochlear-implanted children. These children encounter language and pronunciation problems that accompany prelingual deafness and hearing with a cochlear implant. I examine two practices, which are used...

  6. Modelling [CI] emission from turbulent molecular clouds

    CERN Document Server

    Glover, Simon C O; Micic, Milica; Molina, Faviola

    2014-01-01

    We use detailed numerical simulations of the coupled chemical, thermal and dynamical evolution of the gas in a turbulent molecular cloud to study the usefulness of the [CI] 609 micron and 370 micron fine structure emission lines as tracers of cloud structure. Emission from these lines is observed throughout molecular clouds, and yet the question of what we can learn from them about the physics of the clouds remains largely unexplored. We show that the fact that [CI] emission is widespread within molecular clouds is a simple consequence of the fact that the clouds are dominated by turbulent motions. Turbulence creates large density inhomogeneities, allowing radiation to penetrate deeply into the clouds. As a result, [CI] emitting gas is found throughout the cloud, rather than being concentrated at the edges. We examine how well we can use [CI] emission to trace the structure of the cloud, and show that the integrated intensity of the 609 micron line traces column density accurately over a wide range of visual ...

  7. Etyka (w) codzienności wychowania – od nieuchronności do możliwości

    OpenAIRE

    Walczak, Anna

    2016-01-01

    Codzienność wychowania jako skrzyżowanie światów życia pedagoga i wychowanka, będąca wieloznaczną i zróżnicowaną, zmienną, bo tworzącą się, racjonalną i nieracjonalną et cetera, nie pozwala na „przycięcie” w rozmiarze uniwersalnym zasad i przewidywanych efektów etycznego działania. Jest placem gry między nieuchronnością i możliwością etycznego działania pedagogicznego. Tym samym w artykule została podważona zasadność tworzenia kodeksu etycznego jako „dokumentu” uprawomocniające...

  8.  Spis treści

    Directory of Open Access Journals (Sweden)

    Mieczysław Dobija

    2014-04-01

    Full Text Available  Od Zespołu Redakcyjnego ............................................................................... 5 Mieczysław Dobija – Rachunkowość w systemie pomiaru aktywności ekonomicznej państwa – Accounting as part of an economic activity measurement system ............... 7 Renata Dyląg, Ewelina Puchalska – Raportowanie zagadnień środowiskowych i społecznych – Reporting on social and environmental issues .............................................. 23 Jacek Gad – Sprawozdanie z wyniku całościowego jako źródło informacji na temat kapitałowych przychodów i kosztów – doświadczenia polskiego i niemieckiego rynku kapitałowego – Statement of comprehensive income as a source of information on capital income and expenses – experience of Polish and German capital markets...... 47 Piotr Luty – Ocena kondycji finansowej łączących się spółek na przykładzie jednostek z wybranych województw Polski Zachodniej – Assessment of financial position of merging companies based on selected provinces of Western Poland ............................................................................ 69 Irena Sobańska – Znaczenie dorobku naukowego Profesor Elżbiety Burzym dla rozwoju nauki i praktyki rachunkowości w Polsce – The importance of Professor Elżbieta Burzym’s contribution to the development of accounting theory, research and practice in Poland ........................ 83 Arleta Szadziewska – Rachunkowość jako źródło informacji na temat realizacji strategii społecznej odpowiedzialności biznesu – Accounting as a source of information for CSR strategy ............................. 95 Halina Waniak-Michalak – Informacja o pracy wolontariuszy w sprawozdaniach organizacji pożytku publicznego w Polsce – Information on volunteer labour in reports of public benefit organizations in Poland ............................................................................................................ 125

  9. Cognitivismo e ciência cognitiva

    Directory of Open Access Journals (Sweden)

    Marcos Barbosa de Oliveira

    1990-01-01

    Full Text Available O objetivo da comunicação é caracterizar uma escola de pensamento-o cognitivismo-e a disciplina a que ela deu origem. Depois de um breve apanhado das origens do cognitivismo descrevem-se os princípios ontológicos e metodológicos que o definem. Mostra-se a seguir a relação que há entre os computadores e a idéia funcionalista de considerar a mente como um sistema cujos elementos são caracterizados por suas funções, e não por sua constituição material. Discute-se finalmente a natureza e o nome da disciplina gerada pelo cognitivismo, sugerindo-se que se trata de uma proto-ciência, a qual deve ser denominada "Estudos Cognitivos" de preferência a "Ciência Cognitiva".

  10. Model of the Recurrent Nova CI Aql

    Science.gov (United States)

    Lederle, C.; Kimeswenger, S.

    CI Aql was observed with the Innsbruck 60cm telescope in VRIC from June to October 2001. To reproduce the resulting light curves, a geometrical model of the double star system was realized in MATLAB-code. Already existing and rather basic routines were used to implement difficult ray-tracing and rendering tasks. For the geometrical model itself an extended rim of the accretion disk and the illumination of the other components by the white dwarf turned out to be very important.

  11. Para além da ciência: por uma gaia ciência

    OpenAIRE

    Galvão, Túlio Madson de Oliveira

    2012-01-01

    Em A gaia ciência Nietzsche irá abordar a ciência, especificamente a sua finalidade, sob uma perspectiva crítica, apontando a necessidade de um conhecimento científico mais humano e menos mecanicista, uma ciência mais próxima à arte, que ao invés de descobrir verdades, se ocupe em criar novos valores, visões e perspectivas. Ao longo da obra fica evidente a intenção do filósofo em não apenas criticar a ciência, mas também, conceber um novo método, uma nova ciência, uma gaya scienza, em alus...

  12. Para além da ciência: por uma gaia ciência

    OpenAIRE

    Galvão, Túlio Madson de Oliveira

    2012-01-01

    Em A gaia ciência Nietzsche irá abordar a ciência, especificamente a sua finalidade, sob uma perspectiva crítica, apontando a necessidade de um conhecimento científico mais humano e menos mecanicista, uma ciência mais próxima à arte, que ao invés de descobrir verdades, se ocupe em criar novos valores, visões e perspectivas. Ao longo da obra fica evidente a intenção do filósofo em não apenas criticar a ciência, mas também, conceber um novo método, uma nova ciência, uma gaya scienza, em alus...

  13.  Spis treści

    Directory of Open Access Journals (Sweden)

    ANNA BARTOSZEWICZ

    2015-03-01

    Full Text Available  Od Zespołu Redakcyjnego – Editorial .......................................................................................................... 7 Anna Bartoszewicz – Praktyczna realizacja Programu zapewnienia i poprawy jakości w komórkach audytu wewnętrznego na wybranych przykładach – Implementation of Quality Assurance and Improvement Program by internal audit teams on selected examples ................................................................ 9 Anna Białek-Jaworska, Natalia Nehrebecka – Struktura kapitałowa przedsiębiorstw w świetle wyników badań – Capital structure of companies in the light of research results ..................... 29 Magda Chraścina – Determinanty tworzenia rezerw oraz ich skutki bilansowo- -wynikowe na przykładzie spółek notowanych na Giełdzie Papierów Wartościowych w Warszawie – Determinants of creating provisions and their effect on the balance sheet and income statement on the example of companies listed on the Warsaw Stock Exchange .................................................................................................. 53 Małgorzata Garstka – Dobry obyczaj jako norma kształtująca zachowanie księgowych – Good practice as a norm shaping the behavior of accountants ...................... 73 Przemysław Kabalski, Joanna Szwajcar – Feminizacja studiów w zakresie rachunkowości w Polsce – przyczyny i skutki – Feminization of accounting studies in Poland – causes and consequences .. 85 Anna Kasperowicz – Znaki i kody rachunkowości w procesie komunikacji – Accounting signs and codes in the communication process .......................... 107 Marcin Kędzior – Dobrowolne stosowanie MSSF przez spółki giełdowe w wybranych krajach Europy Zachodniej – Voluntary adoption of IFRS by listed companies in selected Western European countries ................................................................................................. 123 Ewelina Zarzycka

  14. Kuhn e as ciências sociais

    Directory of Open Access Journals (Sweden)

    Jesus de Paula Assis

    1993-12-01

    Full Text Available No texto, são expostos os motivos básicos pelos quais o vocabulário emprestado de Thomas Kuhn - notadamente o termo paradigma - e o modelo de desenvolvimento científico exposto pelo autor em seu A estrutura das revoluções científicas foram tomados de empréstimo em textos que discutem a epistemologia das ciências sociais. A conclusão é que as supostas aplicações do modelo kuhniano às ciências sociais se baseiam em leitura que não encontra qualquer apoio no autor e, principalmente, obscurecem as implicações mais amplas de sua obra.The article shows for what reasons the vocabulary and the model for scientific growth of Thomas Kuhn were borrowed by epistemologists of the social sciences. The conclusion is that the texts produced in this vein are based in a shallow understanding of the author's main implications.

  15. Ascoltando il cuore quando ci parla

    Directory of Open Access Journals (Sweden)

    Maria Grazia Soldati

    2011-04-01

    Full Text Available La scrittura di sé è approccio educativo, di cura, in cui la posta in gioco è la possibilità di attivare parti di sé inespresse, scommette sul desiderio di un divenire, di un modo di essere in cui sia possibile stare nel presente in modo creativo, di pensarlo e trasfigurarlo con narrazioni ed incontri tra persone. Oggi c’è una povertà di relazioni umane, c’è una perdita di linguaggio: accade quindi che le singolarità si spengono. Ma ognuno di noi ha una singolarità parlante, che ha bisogno di essere ascoltata. È un bisogno simbolico prima che psicologico. E questo spiega la necessità di spazi dove la propria storia di vita sia ascoltata, perché nel nostro presente ci sia tanto interesse per il biografico C’è la necessità di pratiche che aiutano a cercare forme di vita che siano più vive e più desiderabili. C’è la necessità di contesti dove sperimentare un percorso che cerchi le parole per dirsi, per cercare un legame soggettivo tra sé e ciò che si dice, si scrive, in un percorso di comunicazione, di auto-conoscenza, di comprensione.

  16. Wycena należności kredytowycha standardy sprawozdawczości finansowej

    Directory of Open Access Journals (Sweden)

    Izabela Emerling

    2009-12-01

    Full Text Available Jednym z najistotniejszych obszarów działalności banków komercyjnych jest działalność kredytowa, której sposób ujęcia w księgach rachunkowych i sprawozdaniach finansowych determinuje obraz sytuacji majątkowej i finansowej odzwierciedlony w sprawozdawczości finansowej banku komercyjnego. Podstawowym celem artykułu jest zbadanie ujęcia w sprawozdaniach finansowych banków komercyjnych różnych form działalności kredytowej i ich metod wyceny. Zastosowanie różnych metod wyceny bilansowej wierzytelności kredytowych wpływa na obraz sytuacji majątkowej i finansowej banku komercyjnego.

  17. Natureza e ciências sociais

    Directory of Open Access Journals (Sweden)

    Gloria Maria Vargas

    2003-12-01

    Full Text Available A construção do sentido do termo natureza abrange diferentes áreas do conhecimento e tem sido objeto de reflexão tanto das ciências naturais quanto sociais. Nos desdobramentos do conhecimento produzido sobre esta temática existem diversas abordagens que, da perspectiva das ciências sociais, podem ser identificadas. O propósito deste artigo é considerar algumas dessas abordagens e relacioná-las com as novas práticas sociais que determinam formas de intervenção inéditas sobre a natureza, e que colocam questões para estas ciências, enquanto produtoras de conhecimento sobre o tema. De igual forma, explicita-se a substituição deste termo pelo de ambiente e, posteriormente, o aparecimento do desenvolvimento sustentável, como parte do cabedal conceitual com que a problemática em torno das relações naturezasociedade é abordada nas ciências sociais.La construcción del sentido del término naturaleza abarca diferentes áreas del conocimiento y ha sido objeto de reflexión tanto de las ciencias naturales como sociales. Los desdoblamientos del conocimiento producido sobre este tema muestran que existen diversos abordajes que pueden ser identificados desde la perspectiva de las ciencias sociales. El objetivo de este artículo es considerar algunos de esos abordajes y relacionarlos con las nuevas prácticas sociales que determinan formas de intervención inéditas sobre la naturaleza y que sugieren cuestionamientos para estas ciencias, como productoras de conocimiento sobre este tema. De igual manera, se explicita la substitución de este término por el de ambiente e, posteriormente, el aparecimiento del término desarrollo sostenible como parte del acervo conceptual con que es abordada la problemática alrededor de las relaciones naturaleza-sociedad en las ciencias sociales.The construction of the term nature involves different areas of knowledge and has been the object of inquiry of both natural and social sciences. The knowledge

  18. Doubly contracted CI method and applications

    Institute of Scientific and Technical Information of China (English)

    WANG; Yubin; HAN; Huixian; ZHAI; Gaohong; SUO; Bin; WEN; Zh

    2004-01-01

    [1]Buenker, R. J., Peyerrimhoff, S. D., Theor. Chim. Acta, 1968, 12:5803.[2]Hanrath, M., Engels, B., New algorithms for an individually selecting MR-CI program, Chem. Phys., 1997, 225: 197-202.[3]Werner, H. -J, Knowles, P. J., An efficient internally contracted multiconfiguration-reference configuration interaction method, J.Chem. Phys., 1988, 89: 5803-5814.[4]Dobbyn, A. J., Knowles, P. J., Harrison, R. J., Parallel internally contracted multireference configuration interaction, J. Comput.Chem., 1998, 19: 1215-1228.[5]Siegbahn, P. S. M., The externally contracted CI method applied to N2, Int. J. Quantum Chem., 1983, 23: 1869-1889.[6]Lee, T. J., Theory for externally contracted configuration interaction energy gradients, J. Chem. Phys., 1987, 87: 2825-2831.[7]Wang Yubin, Gan Zhengting, Su Kehe et al., An adjustable contracted CI method, Science in China, Series B, 1999, 42: 649-655.[8]Wenzel, W., Steiner, M. M., Wilson, K. G., Multireference Basis-Set Reduction, Int. J. Quantum Chemistry, 1996, S30: 113-118.[9]Walter, D., Carter, E. A., Multi-reference weak pairs local configuration interaction: efficient calculations of bond breaking,Chem. Phys. Letters, 2001, 346: 177-185.[10]Wang Yubin, Hong Xingji, Liu Jun, et al., Structures and potential energy surfaces of lithium isocyanide and its isomers, Theochem,1996, 369: 173-182.[11]Bian Wensheng, Werner J, Global ab initio potential energy surface for the ClH2 reactive system, J. Chem. Phys., 2000, 112:220-229.[12]Yang Minghui, Zhang, D. H., Collins, M. A. et al., Ab initio potential-energy surfaces for the reactions OH+H2 ←→H2O+H, J.Chem. Phys., 2001, 115: 174-178.[13]Zhai Gaohong, Wang Yubin, Shi Ting et al., Global many-body potential energy surface of ground state H2O+, Chemical Journal of Chinese Universities, 2003, 24: 2039-2043.[14]Paldus, J., Boyle, M. J., Unitary group approach to the many-electron correlation problem via graphical methods of spin

  19. Filosofia da ciência e ensino da ciência: uma analogia

    Directory of Open Access Journals (Sweden)

    Alberto Villani

    2001-01-01

    Full Text Available Neste trabalho, inicialmente explicitaremos nossa compreensão do debate entre Kuhn, Popper, Lakatos e Feyerabend na Conferencia Internacional sobre Filosofia da Ciência (1965, delineando as diferenças nas posições de nossos filósofos. Em seguida apresentaremos um quadro das posições sobre o ensino de ciências, assim como nos parecem caracterizar os último 30 anos de pesquisas na área. Finalmente tentaremos uma aproximação dos dois campos, procurando salientar as implicações que a problemática filosófica teve e tem para uma maior compreensão do ensino de ciências e matemática.

  20. Formas de autonomia da ciência

    Directory of Open Access Journals (Sweden)

    Marcos Barbosa de Oliveira

    2011-01-01

    Full Text Available Na primeira parte deste ensaio, distinguimos três formas que a autonomia da ciência assume ao longo de sua história: a galileana, a vannevariana e a neoliberal. A galileana foi reivindicada por Galileu em seu conflito com a Igreja Católica. O termo "vannevariana" vem de Vannevar Bush, responsável pelo relatório Science, the endless frontier, que teve um papel fundamental na conformação das práticas científicas no período pós Segunda Guerra. A autonomia vannevariana diz respeito aos rumos da pesquisa científica. A autonomia neoliberal consiste na liberdade de cada cientista procurar financiamento para as pesquisas que deseja realizar em qualquer fonte, pública ou privada, tendo em vista apenas seu auto-interesse (intelectual e/ou econômico. Na segunda parte do ensaio, utilizamos o arcabouço conceitual e histórico proporcionado por essas distinções para discutir a questão: que forma de autonomia deve ser reivindicada pela ciência nos dias de hoje? O procedimento consiste em determinar, para cada uma das três formas, o que deve ser mantido e o que deve ser abandonado. A conclusão a que se chega é a de que a autonomia neoliberal deve ser descartada, a vannevariana restringida, e a galileana preservada.In the first part of this article, three forms that the autonomy of science has assumed in the course of its history are distinguished: the Galilean one, the Vannevarian one, and the neoliberal one. The Galilean form was claimed by Galileo in his conflict with the Catholic Church. The term "Vannevarian" comes from Vannevar Bush, responsible for the report, Science, the endless frontier, which played a crucial role in the configuration of scientific practices in the post World War II period. Vannevarian autonomy has to do with the directions of scientific research. Neoliberal autonomy consists in each scientist's freedom to search for funds for the research he intends to carry out from any source, public or private, in view only

  1. Static Code Analysis with Gitlab-CI

    CERN Document Server

    Datko, Szymon Tomasz

    2016-01-01

    Static Code Analysis is a simple but efficient way to ensure that application’s source code is free from known flaws and security vulnerabilities. Although such analysis tools are often coming with more advanced code editors, there are a lot of people who prefer less complicated environments. The easiest solution would involve education – where to get and how to use the aforementioned tools. However, counting on the manual usage of such tools still does not guarantee their actual usage. On the other hand, reducing the required effort, according to the idea “setup once, use anytime without sweat” seems like a more promising approach. In this paper, the approach to automate code scanning, within the existing CERN’s Gitlab installation, is described. For realization of that project, the Gitlab-CI service (the “CI” stands for "Continuous Integration"), with Docker assistance, was employed to provide a variety of static code analysers for different programming languages. This document covers the gene...

  2. Wrap it in rap! - Music Making with Adolescent CI Users

    DEFF Research Database (Denmark)

    Petersen, Bjørn; Sørensen, Stine Derdau; Pedersen, Ellen Raben

    2015-01-01

    participated in a short intensive training program involving group-based music making activities (e.g. rapping and singing) and self-administered computer based listening exercises. Testing of music and speech discrimination was carried out before and after the program for the CI users and in two sessions......The purpose of this study was to examine 1) the potential effects of an intensive musical ear training program on the perception of music and speech in prelingually hearing impaired adolescent cochlear implant (CI) users and 2) these adolescents’ music engagement. Eleven adolescent CI users...... participants significantly outperformed the CI users in all music and speech discrimination tests except melodic contour. Despite their poor music discrimination abilities, the CI users reported levels of music engagement and enjoyment that were comparable to the NH group. The CI participants showed high...

  3. Nowe zasady działalności firm audytorskich

    Directory of Open Access Journals (Sweden)

    Kazimierz Sawicki

    2009-03-01

    Full Text Available W artykule przedstawiono zmiany, stanowiące implementację Dyrektywy 2006/43/WE Unii Europejskiej w części dotyczącej funkcjonowania firm audytorskich w Polsce. Zgłoszono uwagi popierające nowe rozwiązania, jak też zawierające wątpliwości dotyczące skuteczności ich stosowania w praktyce.

  4. CI og det døvblinde barn

    DEFF Research Database (Denmark)

    Dammeyer, Jesper Herup

    2005-01-01

    I den følgende artikel præsenterer jeg en diskussion af temaer omkring CI til døve og døvblinde børn og et treårigt psykologisk forskningsprojekt omkring CI.......I den følgende artikel præsenterer jeg en diskussion af temaer omkring CI til døve og døvblinde børn og et treårigt psykologisk forskningsprojekt omkring CI....

  5. Do estilo em ciência e em história das ciências

    Directory of Open Access Journals (Sweden)

    Michel Paty

    2012-08-01

    Full Text Available Ao considerar o conhecimento científico como uma forma de pensamento simbólico, entende-se com isso não simples sistemas de signos, mas conteúdos de pensamento (expressos por conceitos ligados entre si e que fazem sentido, que são, no espaço das representações mentais, os substitutos do "dado objetivo" que se supõe subjazer à experiência que fazemos do "mundo" pelos sentidos e, nesse nível indissociavelmente, pelo entendimento. Esse pensamento simbólico adquire densidade e consistência pela "tecelagem" realizada graças ao trabalho dos pensamentos individuais que se comunicam, social e culturalmente, inscritos no tempo da história. Da tensão dinâmica entre o sujeito do conhecimento, que busca a inteligibilidade (pela operação de sua razão, e a objetividade dos conteúdos que ele se propõe (inicialmente dados, depois modificados ou produzidos, resulta o movimento do pensamento científico e a transformação dos conhecimentos. Esse trabalho do pensamento simbólico é marcado por um estilo próprio a cada um, mas que em parte pode ser comum em contextos, escolas ou tradições. Em ciência e em história das ciências, o estilo intervém em dois níveis: o da abordagem "objetal" da produção das obras pelos cientistas e o da abordagem "reflexiva" da história epistemológica e da filosofia, que se interrogam sobre a significação tanto dos próprios conteúdos de conhecimento quanto do pensamento racional, simbólico, cuja função é manifestá-los.By considering scientific knowledge as a form of symbolic thought, we do not mean by the latter simply systems of signs, but thought contents (expressed by concepts related between them and providing meaning ; they are, in the space of mental representations, the substitutes of the «objectively given» that one supposes to underly the experience of the «world» done through the senses and the understanding, both being indissociable at this level. This symbolic thought gets

  6. The magnetic structures of double tungstates, NaM(WO{sub 4}){sub 2}, M=Fe, Cr: Examples for superexchange couplings mediated by [NaO{sub 6}]-octahedra

    Energy Technology Data Exchange (ETDEWEB)

    Nyam-Ochir, L. [School of Physics and Electronics, National University of Mongolia, 210646 Ulaanbaatar (Mongolia); Institute for Materials Science, Darmstadt University of Technology, D-64287 Darmstadt (Germany); Ehrenberg, H. [Institute for Materials Science, Darmstadt University of Technology, D-64287 Darmstadt (Germany); Institute for Complex Materials, IFW Dresden, Helmholtzstr. 20, D-01069 Dresden (Germany)], E-mail: h.ehrenberg@ifw-dresden.de; Buchsteiner, A. [Hahn Meitner Institute Berlin, D-14092 Berlin (Germany); Senyshyn, A.; Fuess, H. [Institute for Materials Science, Darmstadt University of Technology, D-64287 Darmstadt (Germany); Sangaa, D. [School of Physics and Electronics, National University of Mongolia, 210646 Ulaanbaatar (Mongolia)

    2008-12-15

    The crystal structures of the double tungstates NaM(WO{sub 4}){sub 2} with M=Fe, Cr and their solid solution are similar to the wolframite-type structure in the space group P2/c, but with doubled a lattice parameter. Magnetization and neutron-diffraction data reveal that NaFe(WO{sub 4}){sub 2} orders antiferromagnetically below 5 K with a commensurate propagation vector k=(1/2 ,1/2 ,1/2 ) and magnetic moments of Fe{sup 3+} ions oriented along the a-axis. NaCr(WO{sub 4}){sub 2} is antiferromagnetic below 10 K. Its magnetic structure is based on the propagation vector k=(1/2 ,1/2 ,0), and the magnetic moments of Cr{sup 3+} ions are aligned along the b-axis. The magnetic structure in the bc-plane is explained by a supersuperexchange mechanism. Long-range magnetic superexchange interactions along paths including [NaO{sub 6}]-octahedra are necessary to explain the observed magnetic structures. Mixed NaFe{sub x}Cr{sub 1-x}(WO{sub 4}){sub 2}, with x=0.25, 0.5, 0.75, do not indicate magnetic order, neither in magnetization nor neutron-diffraction data.

  7. On {P2,Ci| i≥3 -covered Graphs%关于{P2, Ci| i≥3}-覆盖图

    Institute of Scientific and Technical Information of China (English)

    马润年

    2000-01-01

    Let G be a graph. If each edge of G belongs to a P2,Ci | i≥3 -factor, then graph G is called P2, Ci | i≥3-covered graph. In this paper, it is proved that a connected nonbipartitegraph G is a P2, Ci | i≥3 -covered graph if and only if i(G-S) |S|-1 for all S V(G), = S = V(G).%设G是一个图,若对于G的任意一边G都有P2, Ci | i≥3 -因子含有这条边,则称G是 P2, Ci| i≥3 -覆盖图.本文给出连通非二分图G是P2, Ci | i≥3 -覆盖图的充要条件为任给S V(G), V(G) = S = 有 i (G-S) |S|-1成立.

  8. Role of apolipoprotein CI in lipid metabolism and bacterial sepsis

    NARCIS (Netherlands)

    Berbée, Jimmy Fransiscus Paulus

    2007-01-01

    The research described in this thesis focussed on the role of apolipoproteins in lipid metabolism, inflammation and bacterial sepsis, with specific emphasis on apoCI. From studies in human APOC1¬-transgenic and apoc1-/- mice, we were able to identify apoCI as a potent inhibitor of triglyceride hydro

  9. Ciência das Redes: Aspectos Epistemológicos

    OpenAIRE

    Cavalcante, Gustavo Vaconcelos

    2011-01-01

    Na época da escrita deste documento observa-se o alvorecer de uma nova ciência - A “Ciência das Redes”. Esta ciência, que por sua própria natureza já nasce com característica transdisciplinar, vem procurar buscar respostas aos desafios do novo milênio. A Ciência das Redes encontra-se ainda em sua infância e necessita demonstrar a sua robustez como ciência e para isso a busca de seus fundamentos epistemológicos é condição fundamental. O objetivo central deste trabalho é o de buscar bases epis...

  10. Ciência das Redes: Aspectos Epistemológicos

    Directory of Open Access Journals (Sweden)

    Gustavo Vaconcelos Cavalcante

    2011-04-01

    Full Text Available Na época da escrita deste documento observa-se o alvorecer de uma nova ciência - A “Ciência das Redes”. Esta ciência, que por sua própria natureza já nasce com característica transdisciplinar, vem procurar buscar respostas aos desafios do novo milênio. A Ciência das Redes encontra-se ainda em sua infância e necessita demonstrar a sua robustez como ciência e para isso a busca de seus fundamentos epistemológicos é condição fundamental. O objetivo central deste trabalho é o de buscar bases epistemológicas e transdisciplinares para a Ciência das Redes. Para alcançar este objetivo foi utilizado como fundamentação para a construção de um modelo epistemológico: o conceito de “Rizoma” oriundo dos trabalhos filosóficos de Gilles Deleuze e Felix Guattari, o “Pensamento Complexo” baseado na obra de Edgar Morin e as propriedades oriundas da Ciência das Redes

  11.  Dylematy harmonizacji rachunkowości

    Directory of Open Access Journals (Sweden)

    Jerzy Gierusz

    2015-06-01

    Full Text Available Harmonizacja rachunkowości finansowej jest procesem przynoszącym wiele korzyści, ale także generującym poważne zagrożenia. Wśród pozytywnych stron harmonizacji wymienić należy: wzmocnienie funkcji alokacyjnej rynków kapitałowych, wzrost zaufania inwestorów do sprawozdań finansowych, rozszerzenie możliwości pozyskiwania kapitału pożyczkowego, obniżenie kosztów funkcjonowania korporacji międzynarodowych. Towarzyszące harmonizacji zjawiska niepożądane to: wyeliminowanie porównywalności sprawozdań finansowych na poziomie krajowym, przekreślenie znacznej części dorobku szkoły kontynentalnej rachunkowości, ustanowienie monopolu w tworzeniu standardów, zanik normatywnego nurtu badań w rachunkowości.

  12. Filosofia das ciências sociais: temas atuais

    Directory of Open Access Journals (Sweden)

    Harold Kincaid

    2014-12-01

    Full Text Available A filosofia das ciências sociais, concebida da maneira adequada, tem algo a oferecer aos que praticam as ciências sociais. Os cientistas sociais adotam em suas pesquisas, ainda que de forma implícita, alguma filosofia de sua ciência. Para evitar impasses, é melhor explicitar essa filosofia e ser criticamente consciente dos seus méritos. A filosofia das ciências sociais, por sua vez, não pode ser praticada sem um envolvimento íntimo com a pesquisa social. O artigo esboça alguns desenvolvimentos da filosofia da ciência pós-positivista e suas implicações para a filosofia das ciências sociais. Essa perspectiva geral é então aplicada a alguns debates das ciências sociais: a natureza da causalidade; o lugar dos mecanismos na pesquisa social e da legitimidade de explicações puramente macrossociológicas; a distinção entre pesquisa qualitativa e quantitativa; a distinção entre evidência observacional e evidência experimental; a polêmica entre o individualismo e o holismo metodológicos na explicação sociológica.

  13. Psicanálise e ciência

    Directory of Open Access Journals (Sweden)

    Regina Coeli Aguiar Castelo Prudente

    Full Text Available Embora Freud tenha sido um cientista, formado no espírito científico de sua época, as relações da psicanálise com a ciência nunca foram fáceis. Desde o “Projeto”, de 1895, até seus últimos textos, Freud nunca abandonou seu propósito de fazer com que a psicanálise fosse reconhecida como ciência. Jacques Lacan, a partir de sua teoria dos discursos, afirma que a psicanálise é um novo campo do saber que mantém conexões com o campo de saber da ciência, mas com ele se confunde. O sujeito da psicanálise é o mesmo sujeito da ciência - o sujeito do desejo - mas Freud subverte o cogito cartesiano ao descobrir o inconsciente.

  14. Para quê serve a ciência?

    OpenAIRE

    Novelli, Pedro Geraldo Aparecido [UNESP

    2010-01-01

    A ciência é uma forma de conhecimento e é também uma forma do conhecimento. Contudo, a ciência parece se apresentar como a forma de conhecer e do conhecer. Essa postura faz com que a ciência se afirme no mundo como algo singular obtendo inclusive força de instituição com reconhecimento oficial e sustentação em instâncias informais. A ciência sobreviveu a uma história de perseguição, rejeição e condenação colocando-se nos tempos modernos como o referencial por excelência para o estabelecimento...

  15. Magnetism in Ca2CoOsO6 and Ca2NiOsO6: Unraveling the mystery of superexchange interactions between 3d and 5d ions

    Energy Technology Data Exchange (ETDEWEB)

    Morrow, Ryan C.; Samanta, Kartik; Dasgupta, Tanusri Saha; Xiong, Jie; Freeland, John W.; Haskel, Daniel; Woodward, Patrick

    2016-06-14

    In order to rationalize and predict the behavior of compounds containing 5d transition metal ions, an understanding of the local moments and superexchange interactions from which their magnetic properties are derived is necessary. The magnetic and electrical properties of the ferrimagnetic double perovskites Ca2CoOsO6 and Ca2NiOsO6 studied here provide critical insight toward that goal. First-principles density functional theory (DFT) calculations indicate, and experimental measurements confirm, that the Os(VI) moments are directed antiparallel to the Co/Ni moments. X-ray magnetic circular dichroism (XMCD) measurements reveal that the orbital moment on osmium has a magnitude that is approximately 30% of the spin moment, and the two contributions oppose each other. Both the size and direction of the orbital moment are confirmed by the DFT calculations. The size of the Os(VI) total moment is predicted to be 0.6-0.7 μB by DFT calculations. The ferrimagnetic ground state is stabilized by strong antiferromagnetic coupling between the d2 Os(VI) ion and the d8/d7 Ni(II)/Co(II) ion. Not only does the observation of antiferromagnetic coupling violate the Goodenough-Kanamori rules, but also it is unusual in that it becomes stronger as the Os-O-Co/Ni bond angle decreases. This unusual behavior is shown to arise predominantly from coupling between Os t2g orbitals and Ni/Co eg orbitals, mediated by the intervening oxide ion. We further find that both compounds are spin-orbit assisted Mott insulators.

  16. La ciència ficció : un pont entre les ciències i les Humanidades

    OpenAIRE

    2006-01-01

    La hipòtesi vol contestar la pregunta següent: pot la ciència-ficció ajudar a construir un nexe d'unió afavorint una lectura ètica de la ciència i la tecnologia? Esbrinant els motius dels distanciament entre ciències i Humanidades, veient en particular com és tractada l'ètica en la literatura de ciència-ficció i cercant punts de connexió entre ambdós mons. La hipótesis pretende contestar la siguiente pregunta: ¿puede la ciencia-ficción ayudar a construir un nexo de unión favoreciendo una l...

  17. Implications of CI therapy for Visual Deficit Training

    Directory of Open Access Journals (Sweden)

    Edward eTaub

    2014-10-01

    Full Text Available We address here the question of whether the techniques of CI therapy, a family of treatments that has been employed in the rehabilitation of movement and language after brain damage might apply to the rehabilitation of such visual deficits as unilateral spatial neglect and visual field deficits. CI therapy has been used successfully for the upper and lower extremities after chronic stroke, cerebral palsy (CP, multiple sclerosis (MS, other CNS degenerative conditions, resection of motor areas of the brain, focal hand dystonia, and aphasia. Treatments making use of similar methods have proven efficacious for amblyopia.The CI therapy approach consists of four major components: intensive training, training by shaping, a transfer package to facilitate the transfer of gains from the treatment setting to everyday activities, and strong discouragement of compensatory strategies.CI therapy is said to be effective because it overcomes learned nonuse, a learned inhibition of movement that follows injury to the CNS. In addition, CI therapy produces substantial increases in the grey matter of motor areas on both sides of the brain. We propose here that these mechanisms are examples of more general processes: learned nonuse being considered parallel to sensory nonuse following damage to sensory areas of the brain, with both having in common diminished neural connections (DNC in the nervous system as an underlying mechanism. CI therapy would achieve its therapeutic effect by strengthening the diminished neural connections. Use-dependent cortical reorganization is considered to be an example of the more general neuroplastic mechanism of brain structure repurposing (BSR. If the mechanisms involved in these broader categories are involved in each of the deficits being considered, then it may be the principles underlying efficacious treatment in each case may be similar. The lessons learned during CI therapy research might then prove useful for the treatment of

  18. CI-990 (PD 131112): A new quinolone prodrug.

    Science.gov (United States)

    Qadri, S M; Ueno, Y; Saldin, H; Burdette, J M; Lee, G C

    1993-03-01

    In vitro susceptibility of 1021 strains of recent clinical isolates was determined against the new fluoroquinolone CI-990 (PD 131112) and compared with CI-960, ciprofloxacin, fleroxacin, lomefloxacin, norfloxacin, perfloxacin, sparfloxacin, and temafloxacin. The minimum inhibitory concentrations (MIC) of CI-990 in mg/L required for >90% isolates were 0.03-0.5 for members of Enterobacteriaceae, 0.12-2.0 for Pseudomonas aeruginosa, 0.03-1.0 for Aeromonas hydrophilia, 1.0-2.0 for Acinetobacter calcoaceticus, 0.5-2.0 for Brucella melitensis, 0.06-1.0 for staphylococci, and 1.0-2.0 for enterococci. Its antibacterial activity was comparable or superior to other fluroquinolones tested against most gram-negative and gram-positive bacteria, including enterococci.

  19. Using the Web for Competitive Intelligence (CI) Gathering

    Science.gov (United States)

    Rocker, JoAnne; Roncaglia, George

    2002-01-01

    Businesses use the Internet as a way to communicate company information as a way of engaging their customers. As the use of the Web for business transactions and advertising grows, so too, does the amount of useful information for practitioners of competitive intelligence (CI). CI is the legal and ethical practice of information gathering about competitors and the marketplace. Information sources like company webpages, online newspapers and news organizations, electronic journal articles and reports, and Internet search engines allow CI practitioners analyze company strengths and weaknesses for their customers. More company and marketplace information than ever is available on the Internet and a lot of it is free. Companies should view the Web not only as a business tool but also as a source of competitive intelligence. In a highly competitive marketplace can any organization afford to ignore information about the other players and customers in that same marketplace?

  20. Em torno do conceito de ciência

    OpenAIRE

    Fonseca,Maria de Jesus

    1996-01-01

    A comunicação que ora se apresenta surge no âmbito da iniciativa "VIVA A CIÊNCIA" - 1994, promovida pela Secretaria de Estado da Ciência e Tecnologia e já em 2º edição. São objectivos deste projecto a divulgação da ciência e da tecnologia tornando "visível a importância da ciência e da tecnologia numa sociedade que já se habituou aos seus benefícios, mas que ainda teme e se interroga sobre os seus efeitos futuros."1 Nesse sentido, pretende-se que esta semana constitua, a nível nacional, u...

  1. Cinema, ciência e percepção.

    Directory of Open Access Journals (Sweden)

    Márcio Barreto

    Full Text Available Resumo O cinema invoca a questão dos limites da percepção humana, pois modula o tempo em imagens tão reais quanto artificiais, revelando algo mais próximo de uma nova dimensão da realidade do que de sua representação. No início do século XX, a ciência modifica o real percebido através das lentes dos microscópios e das teorias da física moderna; o parentesco entre cinema e ciência está principalmente naquilo que excede o campo perceptivo e é explorado neste artigo para mostrar como a tensão entre o caráter estático da fotografia e a fluidez fugitiva do tempo revela a ciência sem seus estereótipos habituais.

  2. Ocena Przydatności Testerów Szorstkości w Procesie Eksploatacji Nawierzchni Lotniskowych

    Directory of Open Access Journals (Sweden)

    Wesołowski Mariusz

    2016-12-01

    Full Text Available Poprawność oceny szorstkości nawierzchni lotniskowych jest ważnym elementem bezpieczeństwa wykonywania operacji lotniczych. Zagraniczne oraz krajowe dokumenty normatywne określają wymagane wartości współczynników tarcia dla: projektowanych (nowych nawierzchni lotniskowych, użytkowanych i/lub będących przedmiotem planowania prac remontowych oraz minimalne (graniczne dla eksploatowanych nawierzchni lotniskowych. Ponadto, dokumenty te definiują ogólne wymagania dotyczące urządzeń pomiarowych stosowanych do określania szorstkości nawierzchni lotniskowych. Akceptowalny poziom powtarzalności pomiaru współczynnika tarcia nie jest warunkiem wystarczającym do zaakceptowania urządzenia do wykonywania pomiarów szorstkości nawierzchni elementów funkcjonalnych lotnisk. Dlatego warunkiem dopuszczenia urządzenia do wykonywania pomiarów współczynnika tarcia powinno być przeprowadzenie badań w celu określenia jego przydatności do tego typu pomiarów. Badania te powinny obejmować m.in. ocenę urządzenia w odniesieniu do urządzeń dopuszczonych do wykonywania pomiarów, z wykorzystaniem aparatu statystycznego. Na końcową ocenę przydatności urządzenia składa się ponadto całokształt problemów technicznych związanych z procesem eksploatacji poprzez przygotowanie urządzenia do pomiarów, jego kalibrację (sprawdzenie przed pomiarami, a skończywszy na samych pomiarach.

  3. Persistência da veia ciática

    OpenAIRE

    Cardoso,Bárbara Borges; Alvarenga,Camila Oliveira; Miyahara,Maíra de Souza; Burihan,Marcelo Calil; Lima,Maria Raphaella Queiroz Alves de; Kuwahara,Mariana Cardoso; Silva,Rafael Capobianco Maia e

    2010-01-01

    CONTEXTO: Durante um período da vida embrionária, a veia ciática é a principal coletora do membro inferior. Na embriogênese vascular, há diferenciação dos angioblastos em um plexo vascular primitivo, com posterior remodelagem e expansão. Consequentemente, durante esse processo, podem ocorrer anomalias. Quando ocorre persistência da veia ciática, esta pode se comunicar com a veia safena parva ou com a veia poplítea durante seu percurso, anastomosando-se com a veia perfurante superior e com a v...

  4. Ceux-ci ne sont pas : [luuletused] / Kalju Kruusa

    Index Scriptorium Estoniae

    Kruusa, Kalju, pseud., 1973-

    2003-01-01

    Sisu: Ceux-ci ne sont pas ; Köögivahet ; "Taara..." ; "Pakane pistab pisikesi ..." ; "Meri on kaet mattklaasiga ; Pydemise päivil ; "Toas muusika mängib ..." ; "Jäin juustu imetlema ; "Mu elu on mustikas ..." ; Hingepidetus ; ŁNo me gusta la cocina

  5. Ceux-ci ne sont pas : [luuletused] / Kalju Kruusa

    Index Scriptorium Estoniae

    Kruusa, Kalju, pseud., 1973-

    2003-01-01

    Sisu: Ceux-ci ne sont pas ; Köögivahet ; "Taara..." ; "Pakane pistab pisikesi ..." ; "Meri on kaet mattklaasiga ; Pydemise päivil ; "Toas muusika mängib ..." ; "Jäin juustu imetlema ; "Mu elu on mustikas ..." ; Hingepidetus ; ŁNo me gusta la cocina

  6. Por uma ciência do riso e da sabedoria

    Directory of Open Access Journals (Sweden)

    Paula Corrêa Henning

    2010-06-01

    Full Text Available

    O artigo busca problematizar a história das ciências, especialmente o ethos da Modernidade e Pós-modernidade. Para isso, utiliza autores que se anteciparam à Pós-modernidade como Friedrich Nietzsche e Michel Foucault. Na esteira dessa discussão busca uma problematização acerca da Ciência nos rastros da Modernidade e algumas fissuras e fragilidades produzidas na ciência num cenário contemporâneo. Apresenta ainda alguns discursos midiáticos acerca de propagandas televisivas que trazem o discurso científico como legítimo e inabalável. Traz para o campo de discussão uma ciência alegre, como aprendemos com Nietzsche ou prosaica por vezes, anunciando o riso e a sabedoria na produção do conhecimento científico.

     

  7. Surviving High-temperature Components in CI Chondrites

    Science.gov (United States)

    Zolensky, M.; Frank, D.

    2014-01-01

    The CI1 chondrites, while having the most solar-like compo-sition of any astromaterial available for laboratory analysis, have also been considerably altered by asteroidal processes including aqueous alteration. It is of fundamental importance to determine their pre-alteration mineralogy, so that the state of matter in the early Solar System can be better determined. In the course of a re-examination of the compositional range of olivine and low-Ca pyroxene in CI chondrites Orgueil, Ivuna and Alais [1] we found the first reported complete CAI, as already reported [2], with at-tached rock consisting mainly of olivine and low-Ca pyroxene. The range of residual olivine major element compositions we have determined in the CIs (Fig. 1) may now be directly com-pared with those of other astromaterials, including Wild 2 grains. The abundance of olivine and low-Ca pyroxene in CIs is higher than is generally appreciated, and in fact much higher than for some CMs [1]. We also noted numerous rounded objects varying in shape from spheres to oblate spheroids, and ranging up to 100µm in size (Fig. 2), which have been previously noted [3] but have not been well documented or appreciated. We characterized the mineralogy by transmission electron microscopy and found that they consist mainly of rather fine-grained, flaky single phase to intergrown serpentine and saponite. These two materials in fact dominate the bulk of the host CI1 chondrites. With the exception of sparse spinels, the rounded phyllosilicate objects are remarka-bly free of other minerals, suggesting that the precursor from which the phyllosilicates were derived was a homogeneous mate-rial. We suggest that these round phyllosilicates aggregates in CI1 chondrites were cryptocrystalline to glassy microchondrules. If so then CI chondrites cannot be considered chondrule-free. Small though they are, the abundance of these putative microchondrules is the same as that of chondrules in the Tagish Lake meteorite.

  8. Sociologia da ciência: realismo, idealismo e construtivismo

    Directory of Open Access Journals (Sweden)

    Vicente de Paula Gomes

    2013-12-01

    Full Text Available A virada neopragmática, crítica avassaladora da função fundante dos saberes autodefendida pela filosofia, radical ao ponto de incluir a própria vertente analítica de onde se originou, é, inexoravelmente, a fronteira atual do conhecimento filosófico, o golpe do movimento neopragmático à filosofia e à razão; contudo, deve ser avaliado como positivo. Ele possibilitou o retorno à consciência das matrizes conceituais genuínas desse saber ao apontar as propostas de superação do impasse: naturalismo estrito (QUINE, 1969, naturalismo fraco (HABERMAS, 2004, idealismo objetivo (HÖSLE, 1987, contextualismo (RORTY, 1994. Contribuíram, inquestionavelmente, para esse desfecho, os estudos históricos e sociológicos da ciência pós-kuhnianos, inspirados em sua filosofia da ciência. Inserindo-se tangencialmente nesse debate, o objeto de reflexão deste estudo é contrapor o ponto de vista da sociologia da ciência ao realismo e ao idealismo. Nosso intuito é demonstrar que o construtivismo que caracteriza seu modelo de inquirição não nega, como ingênua ou maliciosamente entendem seus críticos, a função determinante da natureza na construção da ciência. A força do nosso argumento emergirá da análise realizada pelos expoentes do strong programme em sociologia da ciência, Barry Barnes, David Bloor e John Henry (1996, no livro “Scientific Knowledge: a sociological analysis”, de um estudo de caso controverso da história da física: os experimentos que o físico norte-americano Robert Millikan realizou para estabelecer a carga do elétron.

  9. Double spin-glass-like behavior and antiferromagnetic superexchange interaction between Fe3+ ions in α-Ga2-xFexO3 (0 ≤ x ≤ 0.4)

    Science.gov (United States)

    Lv, Yi-Fei; Xiang, Jian-Yong; Wen, Fu-Sheng; Lv, Wei-Ming; Hu, Wen-Tao; Liu, Zhong-Yuan

    2015-03-01

    Single phase of Fe3+-doped α-Ga2-xFexO3 (α-GFxO, x = 0.1, 0.2, 0.3, 0.4) is synthesized by treating the β-Ga2-xFexO3 (β-GFxO) precursors at high temperatures and high pressures. Rietveld refinements of the X-ray diffraction data show that the lattice constants increase monotonically with the increase of Fe3+ content. Calorimetric measurements show that the temperature of the phase transition from α-GFxO to β-GFxO increases, while the associated enthalpy change decreases upon increasing Fe3+ content. The optical energy gap deduced from the reflectance measurement is found to decrease monotonically with the increase in Fe3+ content. From the measurements of magnetic field-dependent magnetization and temperature-dependent inverse molar susceptibility, we find that the superexchange interaction between Fe3+ ions is antiferromagnetic. Remnant magnetization is observed in the Fe3+-doped α-GFxO and is attributed to the spin glass in the magnetic sublattice. At high Fe3+ doping level (x = 0.4), two evident peaks are observed in the image part of the AC susceptibility . The frequency dependence in intensity of these two peaks as well as two spin freezing temperatures observed in the DC magnetization measurements of α-GF0.4O is suggested to be the behavior of two spin glasses. Project supported by the National Basic Research Program of China (Grant No. 2010CB731605), the National Science Fund for Distinguished Young Scholars of China (Grant No. 51025103), the National Natural Science Foundation of China (Grant Nos. 51172198 and 51102206), the Natural Science Foundation of Hebei Province, China (Grant No. E2014203144), the Science Foundation for the Excellent Youth Scholars from Universities and Colleges of Hebei Province, China (Grant No. YQ2014009), and the Research Program of the College Science & Technology of Hebei Province, China (Grant No. QN2014047).

  10. Validity and limitations of the superexchange model for the magnetic properties of Sr2IrO4 and Ba2IrO4 mediated by the strong spin-orbit coupling

    Science.gov (United States)

    Solovyev, I. V.; Mazurenko, V. V.; Katanin, A. A.

    2015-12-01

    Layered perovskites Sr2IrO4 and Ba2IrO4 are regarded as the key materials for understanding the properties of magnetic relativistic insulators, mediated by the strong spin-orbit (SO) coupling. One of the most fundamental issues is to which extent these properties can be described by the superexchange (SE) model, formulated in the limit of the large Coulomb repulsion for some appropriately selected pseudospin states, and whether these materials themselves can be classified as Mott insulators. In this work, we address these issues by deriving the relevant models and extracting parameters of these models from the electronic-structure calculations with the SO coupling, based on the density functional theory. First, we construct the effective Hubbard-type model for the magnetically active t2 g bands, by recasting the problem in the language of localized Wannier orbitals. Then, we map the obtained electron model onto the pseudospin model by applying the theory of SE interactions, which is based on the second-order perturbation theory with respect to the transfer integrals. We discuss the microscopic origin of anisotropic SE interactions, inherent to the compass Heisenberg model, and the appearance of the antisymmetric Dzyaloshinskii-Moriya term, associated with the additional rotation of the IrO6 octahedra in Sr2IrO4 . In order to solve the pseudospin Hamiltonian problem and evaluate the Néel temperature (TN), we employ the nonlinear sigma model. We have found that, while for Sr2IrO4 our value of TN agrees with the experimental data, for Ba2IrO4 it is overestimated by a factor of 2. We argue that this discrepancy is related to limitations of the SE model: while for more localized t2 g states in Sr2IrO4 it works reasonably well, the higher-order terms in the perturbation theory expansion play a more important role in the more "itinerant" Ba2IrO4 , giving rise to the new type of isotropic and anisotropic exchange interactions, which are not captured by the SE model. This

  11. Spectroscopic demonstration of a large antisymmetric exchange contribution to the spin-frustrated ground state of a D3 symmetric hydroxy-bridged trinuclear Cu(II) complex: ground-to-excited state superexchange pathways.

    Science.gov (United States)

    Yoon, Jungjoo; Mirica, Liviu M; Stack, T Daniel P; Solomon, Edward I

    2004-10-06

    The magnetic and electronic properties of a spin-frustrated ground state of an antiferromagnetically coupled 3-fold symmetric trinuclear copper complex (TrisOH) is investigated using a combination of variable-temperature variable-field magnetic circular dichroism (VTVH MCD) and powder/single-crystal EPR. Direct evidence for a low-lying excited S = (1)/(2) state from the zero-field split ground (2)E state is provided by the nonlinear dependence of the MCD intensity on 1/T and the nesting of the VTVH MCD isotherms. A consistent zero-field splitting (Delta) value of approximately 65 cm(-1) is obtained from both approaches. In addition, the strong angular dependence of the single-crystal EPR spectrum, with effective g-values from 2.32 down to an unprecedented 1.2, requires in-state spin-orbit coupling of the (2)E state via antisymmetric exchange. The observable EPR intensities also require lowering of the symmetry of the trimer structure, likely reflecting a magnetic Jahn-Teller effect. Thus, the Delta of the ground (2)E state is shown to be governed by the competing effects of antisymmetric exchange (G = 36.0 +/- 0.8 cm(-1)) and symmetry lowering (delta = 17.5 +/- 5.0 cm(-1)). G and delta have opposite effects on the spin distribution over the three metal sites where the former tends to delocalize and the latter tends to localize the spin of the S(tot) = (1)/(2) ground state on one metal center. The combined effects lead to partial delocalization, reflected by the observed EPR parallel hyperfine splitting of 74 x 10(-4) cm(-1). The origin of the large G value derives from the efficient superexchange pathway available between the ground d(x2-y2) and excited d(xy) orbitals of adjacent Cu sites, via strong sigma-type bonds with the in-plane p-orbitals of the bridging hydroxy ligands. This study provides significant insight into the orbital origin of the spin Hamiltonian parameters of a spin-frustrated ground state of a trigonal copper cluster.

  12. A ciência no espaço educacional da criança: do fazer ciência à ciência do fazer

    Directory of Open Access Journals (Sweden)

    Carolina Rodrigues de Souza

    2016-05-01

    Full Text Available This article aims to reflect on the possible articulations of the development of science in the education of children and their respective childhoods. While in Kindergarten and Elementary School students are, above all, children, and as such, subjects endowed with intelligence, emotions, and feelings. They are able to make observations, retain information, propose arguments, participate in discussions, and make choices that allow them to exercise free expression of theirs thoughts in many different languages. However, to ensure the effective participation of the child as a subject of today, not an intented being, it is necessary to reconsider the actions and relationships in the school environment. In this sense, this study highlights contributions on how the educational process of science can/should be thought in the process of children education. Also, we hope to provide access to scientific culture without detracting the childhoods. We highlight the possibility of using some powerful elements of science in the school environment to sharpen curiosity and improve new worldviews. Often different from the adult perspective, science in children education should emphasize issues such as the specificity of child logic, which encompasses creativity, imagination, fantasy, and desire. This article, in its theoretical nature, discusses notions such as childhood, children, and science in order to consider a type of early childhood education in which an educational routine with elements of scientific culture would enable the occurrence of childhood practice. Este artigo objetiva refletir sobre as possíveis articulações do desenvolvimento das ciências na educação das crianças e suas respectivas infâncias e parte da compreensão de que na Educação Infantil e nos primeiros anos do Ensino Fundamental, os estudantes antes de alunos são crianças, e como tais, são sujeitos completos, dotados de inteligência, emoções e sentimentos; capazes de

  13. Observations and modelling of CO and [CI] in disks. First detections of [CI] and constraints on the carbon abundance

    CERN Document Server

    Kama, M; Carney, M; Hogerheijde, M; van Dishoeck, E F; Fedele, D; Baryshev, A; Boland, W; Güsten, R; Aikutalp, A; Choi, Y; Endo, A; Frieswijk, W; Karska, A; Klaassen, P; Koumpia, E; Kristensen, L; Leurini, S; Nagy, Z; Beaupuits, J -P Perez; Risacher, C; van der Marel, N; van Kempen, T A; van Weeren, R J; Wyrowski, F; Yıldız, U A

    2016-01-01

    The gas-solid budget of carbon in protoplanetary disks is related to the composition of the cores and atmospheres of the planets forming in them. The key gas-phase carbon carriers CO, C$^{0}$ and C$^{+}$ can now be observed in disks. The gas-phase carbon abundance in disks has not yet been well characterized, we aim to obtain new constraints on the [C]/[H] ratio in a sample of disks, and to get an overview of the strength of [CI] and warm CO emission. We carried out a survey of the CO$\\,6$--$5$ and [CI]$\\,1$--$0$ and $2$--$1$ lines towards $37$ disks with APEX, and supplemented it with [CII] data from the literature. The data are interpreted using a grid of models produced with the DALI code. We also investigate how well the gas-phase carbon abundance can be determined in light of parameter uncertainties. The CO$\\,6$--$5$ line is detected in $13$ out of $33$ sources, the [CI]$\\,1$--$0$ in $6$ out of $12$, and the [CI]$\\,2$--$1$ in $1$ out of $33$. With deep integrations, the first unambiguous detections of [C...

  14. A CAI in the Ivuna CI1 Chondrite

    Science.gov (United States)

    Frank, David R.; Zolensky, M.; Martinez, J.; Mikouchi, T.; Ohsumi, K.; Hagiya, K.; Satake, W.; Le, L.; Ross, D.; Peslier, A.

    2011-01-01

    We have recently discovered the first well-preserved calcium aluminum-rich inclusion (CAI) in a CI1 chondrite (Ivuna). Previously, all CI1 chondrites were thought to be devoid of preserved CAI and chondrules due to the near total aqueous alteration to which their parent body (bodies) have been subjected. The CAI is roughly spherical, but with a slight teardrop geometry and a maximum diameter of 170 microns (fig. 1). It lacks any Wark-Lovering Rim. Incipient aqueous alteration, and probably shock, have rendered large portions of the CAI poorly crystalline. It is extremely fine-grained, with only a few grains exceeding 10 microns. We have performed electron microprobe analyses (EPMA), FEG-SEM imaging and element mapping, as well as electron back-scattered diffraction (EBSD) and synchrotron X-ray diffraction (SXRD) in order to determine the fundamental characteristics of this apparently unique object.

  15. Zdrowie i medycyna - wyzwania przyszłości

    OpenAIRE

    Pasowicz, Mieczysław

    2013-01-01

    Praca recenzowana / peer-reviewed paper Monografia „Zdrowie i medycyna – wyzwania przyszłości” składa się z czterech części. Podstawowym przesłaniem książki jest omówienie demograficznych i ekonomicznych wyzwań przyszłości, ich przewidywanego wpływu na zdrowie i systemy ochrony zdrowia oraz rozwój medycyny. Monografia stanowi kompleksowy przegląd zjawisk wpływających na kształt przyszłej ochrony zdrowia wraz z omówieniem różnorodnych mechanizmów, które można wykorzystać do z...

  16. Characteristics of CI children with complicated middle ear infections

    DEFF Research Database (Denmark)

    Hoberg, Søren; Danstrup, Christian; Laursen, Bjarke

    2017-01-01

    OBJECTIVE: To describe cases of complicated middle ear infections in children with cochlear implants (CI), i.e., episodes of acute otitis media (AOM) and acute mastoiditis (AM), resulting in hospitalization. METHODS: A total of 206 children under 16 years (300 implantations) were implanted between...... months, respectively. Children younger than 2 years were at highest risk of AOM and/or AM. All had antibiotics prescribed before admittance, and two- thirds of infected ears had already ventilation tubes inserted. Bacteria could not be detected in more than half of cases. The most frequently isolated...... of ventilation tubes is still much debated and more research in this field is needed. CONCLUSION: AOM and/or AM were seen in Danish children with CI as often as in other western countries. Treatment of complicated middle ear infections was sufficient with IV cephalosporin and ventilation tube insertion. Special...

  17. Notas sobre o autotelismo discursivo em ciências humanas

    Directory of Open Access Journals (Sweden)

    Paulo Eduardo Lopes

    1994-12-01

    Full Text Available O Ateliê de Semiótica Discursiva, coordenado por Denis Bertrand, propôs focalizar, no ano letivo 1991-1992, a " Estética do Discurso Erudito", no quadro da temática "Estética da Ética" do Seminário de Semântica Geral, de A.J . Greimas, na Escola de Altos Estudos em Ciências Sociais de Paris (E. H. E. S. S.. Bertrand distribuiu cópias de trechos de textos célebres em ciências humanas (Lévi-Strauss, Deleuze e Guattari, Greimas, Barthes, Foucault e outros, sobre os quais os participantes deveriam realizar análises que tomassem como modelo, por exemplo, aquelas praticadas por Greimas e Landowski em lntroduction à L 'Analyse du Discours en Sciences Sociales ( 1979.

  18. História da ciência

    OpenAIRE

    2007-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Programa de Pós-Graduação em Educação Científica e Tecnológica. No presente trabalho apresento os resultados obtidos na investigação da História da Ciência veiculada nas duas coleções de livros didáticos de ciência do ensino fundamental de 5ª a 8ª série, mais usadas nas escolas que compõem a 16ª Gerência de Educação do Estado de Santa Catarina. Para realização da investigação utilizei uma ficha composta por sete tópicos, subd...

  19. Combustion and Performance Characteristics of CI Engine Running with Biodiesel

    OpenAIRE

    Tesfa, Belachew; Mishra, Rakesh; Gu, Fengshou; Ball, Andrew

    2013-01-01

    Biodiesel is one of the alternative fuels which is renewable and environmentally friendly and can be used in diesel engines with little or no modifications. In the present study, experimental investigations were carried out on the effects of biodiesel types, biodiesel fraction and physical properties on the combustion and performance characteristics of a compression ignition (CI) engine. The experimental work was conducted on a four-cylinder, four -stroke, direct injection (DI) and turbocharg...

  20. Excited states of Ne isoelectronic ions: SAC-CI study

    Energy Technology Data Exchange (ETDEWEB)

    Das, A.K.; Ehara, M.; Nakatsuji, H. [Kyoto Univ. (Japan). Faculty of Engineering

    2001-02-01

    Excited states of the s, p, and d symmetries up to principal quantum number n = 4 are studied for the first eight members of Ne isoelectronic sequence (Ne to Cl{sup 7+}) by the SAC-CI (symmetry-adapted-cluster configuration-interaction) method. The valence STO basis sets of Clementi et al. and the optimized excited STO are used by the STO-6G expansion method. The calculated transition energies agree well with the experimental values wherever available. (orig.)

  1. A busca da transdisciplinaridade nas ciências humanas

    Directory of Open Access Journals (Sweden)

    Aloísio Krohling

    2007-08-01

    Full Text Available Este artigo busca elaborar uma retrospectiva histórica das raízes epistemológicas do pensamento moderno, passando pelo Iluminismo e todas as correntes teóricas, seguidoras da mesma fonte metodológica e epistemológica do SABER INSTRUMENTAL, o que se refletiu nas várias áreas do saber do campo das Ciências Humanas, com o objetivo de mostrar a importância da busca da transdisciplinaridade e da interdisciplinaridade nas Ciências Humanas, com o resgate do paradigma do Múltiplo. A busca da transdisciplinaridade será o fio da meada no sentido de voltar ao MÚLTIPLO heraclitiano e resgatar o “Pantha Rei” das mudanças e contradições da História e da cultura ocidentais. Questiona o atomismo e a fragmentação disciplinar da maioria dos cursos de graduação na área de Ciências Humanas, mormente na Educação, e de modo exacerbado no curso de Direito, com as suas dezenas de disciplinas atomizadas e fragmentadas e sem um fio condutor. É proposta a busca da transdisciplinaridade para o resgate da Metodologia Dialética e da Filosofia da Educação e Filosofia do Direito como as duas grandes alavancas para uma visão e prática holísticas nos Cursos de Educação e Direito bem como na área das Ciências Humanas.

  2. Skinner: sobre ciência e comportamento humano

    Directory of Open Access Journals (Sweden)

    Angelo Augusto Silva Sampaio

    Full Text Available Atualmente, não se pode pensar no estudo do comportamento humano sem considerar a abordagem científica a este objeto: o campo da Psicologia científica. Esse campo é disputado por diversos enfoques teóricos que divergem quanto ao modo como definem ciência e comportamento humano. A abordagem de B. F. Skinner foi bastante proeminente no século XX, mas ainda continua a ser mal-entendida. Partindo do desenvolvimento histórico de sua obra, o presente texto visa a iluminar alguns aspectos relacionados às noções de ciência e comportamento humano desse autor e ressaltar as transformações por que passaram. Analisam-se três tópicos da obra de Skinner: seu período inicial (de 1930 a cerca de 1938, a obra "Ciência e Comportamento Humano" de 1953, e as influências da Biologia. São enfatizados aspectos relevantes da sua teorização sobre o tema: busca por relações funcionais, ênfase nos dados empíricos, operacionismo, externalismo, multideterminação do comportamento, experimentalismo, previsão e controle, ética.

  3. O Alienista: loucura, poder e ciência

    Directory of Open Access Journals (Sweden)

    ROBERTO GOMES

    1993-12-01

    Full Text Available Este artigo analisa o conto de Machado de Assis, O Alienista. Ficção centrada nos delírios de Simão Bacamarte, médico-psiquiatra, nela estão referidas as pretensões e impasses das concepções científicas do século XIX, em particular do Positivismo, que tem vínculos profundos com o nascimento das Ciências Humanas. De um lado, a sede de explicação rigorosa de seu objeto, no caso, a Loucura, e, de outro, o direito que se arroga de dizer a verdade a respeito da Loucura e do Louco e de agir sobre ele com plenos e legítimos direitos. A obra de Machado denuncia o vínculo entre ciência e poder bem como a usurpação, pelo homem de ciência, do direito que cada um tem de dizer a sua própria verdade. O que conduz à ironia final: parece haver mais loucura na pretensão de estabelecer com nitidez a linha divisória entre Razão e Loucura do que em perder-se entre seus supostos limites.

  4. Causas e leis nas ciências do homem

    Directory of Open Access Journals (Sweden)

    Sara Albieri

    2011-12-01

    Full Text Available A proposta humeana acerca do método e da investigação na ciência do homem tornou-o um precursor do conhecido modelo covering-law de explicação científica, tal como defendido por Hempel, Nagel e outros filósofos contemporâneos da ciência. A interpretação da teoria da ciência de Hume como precursora desse modelo costuma ser majoritária entre os comentadores de sua filosofia. Apenas Donald Livingston travou uma discussão singular contra essa quase unanimidade, propondo-se a defender a existência de dois modelos de explicação na epistemologia de Hume, um adequado às ciências naturais, outro às morais. O autor apóia-se em certas passagens em que Hume parece reconhecer que, em ciências morais, predominariam as explicações recorrendo a causas morais, as quais consistiriam nas razões do agente ou conjunto de agentes envolvidos no evento a ser explicado. Defendemos que a diversidade das explicações causais naturais e morais em Hume pode ser discutida, não a partir de uma distinção radical de natureza, como aquela que Livingston quer estabelecer, mas a partir de uma distinção de grau: os graus de certeza que distinguem entre provas e probabilidades, entre explicações pela via dedutiva a partir de leis ou por generalizações estatísticas. Isto é, mais de acordo com a assimetria que Nagel reconhece entre ciências do particular e generalizadoras, quanto ao objetivo de estabelecer leis, no segundo caso, ou de apenas aplicá-las, no primeiro. Uma distinção compatível com aquela que Hume já adotara, atribuindo graus diferentes de generalidade de modo análogo a ciências naturais ou morais.Hume's proposal of a science of man is often taken as a precursor of the now well-known covering-law model of scientific explanation, sustained by Hempel, Nagel and other contemporary philosophers of science. Among Hume's commentators D. Livingston is an exception, defending the existence of two models of explanation in Hume

  5. A psicanálise freudiana e a dualidade entre ciências naturais e ciências humanas

    Directory of Open Access Journals (Sweden)

    Richard Theisen Simanke

    2009-06-01

    Full Text Available Este artigo discute a tomada de posição freudiana em favor de uma epistemologia naturalista. Ele procura circunscrever a especificidade do naturalismo psicológico que Freud reivindica e, a seguir, avaliar em que medida a epistemologia freudiana pode fornecer um modelo para o questionamento da dualidade que opõe as ciências naturais às ciências humanas.This paper discusses Freud's standing in favor of a naturalist epistemology. It seeks to circumscribe the specificity of the psychological naturalism claimed by him and, next, to evaluate the extent of Freudian epistemology as a model for challenging the duality which opposes natural and human sciences.

  6. DNA damage in isolated rat hepatocytes exposed to C.I. pigment orange 5 and C.I. pigment yellow 12 by the alkaline comet assay

    DEFF Research Database (Denmark)

    Møller, P; Wallin, Håkan; Grunnet, N

    1998-01-01

    The induction of DNA damage by commonly used printing ink pigments, C.I. pigment orange 5 (C.I. 12075) and C.I. pigment yellow 12 (C.I. 21090), was investigated in freshly isolated rat hepatocytes with the comet assay. C.I. pigment yellow 12 is a 3,3'-dichlorobenzidine-based diarylide pigment, an......]quinoxaline. Our data indicate that both C.I. pigment orange 5 and C.I. pigment yellow 12 are genotoxic in hepatocytes with metabolizing capacities. However, further investigation of the metabolism and disposition are required for the evaluation of the safety of these pigments....

  7. Guerra (in)justa, ciência (im)pura

    OpenAIRE

    Cascais, António Fernando

    2003-01-01

    Se há conjunção fatal, é entre guerra e ciência, em nome dos imperativos da defesa nacional. É hoje um dado adquirido que a Segunda Guerra Mundial foi tão extraordinariamente produtiva no campo científico, quanto inumana, da biomedicina criminosa nazi à física atômica norte-americana. Muitas das aplicações técnicas com que actualmente convivemos de forma pacífica, na maior candura e na maior inocência, tiveram origem em investigação fundamental e aplicada desenvolvida no dec...

  8. Editorial - Por uma nova ciência (nova?)

    OpenAIRE

    Roncalli, Angelo Giuseppe

    2015-01-01

    Os fractais fazem parte da identidade visual da revista que ora debuta no campo da divulgação científica, a “Ciência Plural”. Para além de mais um rótulo dentre tantos outros (ou mesmo um aparente pleonasmo) o adjetivo se coloca como aquilo que é composto, diversificado, múltiplo. Não se propõe como novo paradigma (nem poderia), mais que isso, admite a perspectiva crítica de qualquer um deles.3Pluralidade no seu sentido dialético, de realidades contraditórias. Enfim, trata-se de entender que ...

  9. Combustion Stratification for Naphtha from CI Combustion to PPC

    KAUST Repository

    Vallinayagam, R.

    2017-03-28

    This study demonstrates the combustion stratification from conventional compression ignition (CI) combustion to partially premixed combustion (PPC). Experiments are performed in an optical CI engine at a speed of 1200 rpm for diesel and naphtha (RON = 46). The motored pressure at TDC is maintained at 35 bar and fuelMEP is kept constant at 5.1 bar to account for the difference in fuel properties between naphtha and diesel. Single injection strategy is employed and the fuel is injected at a pressure of 800 bar. Photron FASTCAM SA4 that captures in-cylinder combustion at the rate of 10000 frames per second is employed. The captured high speed video is processed to study the combustion homogeneity based on an algorithm reported in previous studies. Starting from late fuel injection timings, combustion stratification is investigated by advancing the fuel injection timings. For late start of injection (SOI), a direct link between SOI and combustion phasing is noticed. At early SOI, combustion phasing depends on both intake air temperature and SOI. In order to match the combustion phasing (CA50) of diesel, the intake air temperature is increased to 90°C for naphtha. The combustion stratification from CI to PPC is also investigated for various level of dilution by displacing oxygen with nitrogen in the intake. The start of combustion (SOC) was delayed with the increase in dilution and to compensate for this, the intake air temperature is increased. The mixture homogeneity is enhanced for higher dilution due to longer ignition delay. The results show that high speed image is initially blue and then turned yellow, indicating soot formation and oxidation. The luminosity of combustion images decreases with early SOI and increased dilution. The images are processed to generate the level of stratification based on the image intensity. The level of stratification is same for diesel and naphtha at various SOI. When O concentration in the intake is decreased to 17.7% and 14

  10. Diversidade sexual e ensino de ciências: buscando sentidos

    Directory of Open Access Journals (Sweden)

    Leandro Jorge Coelho

    2015-12-01

    Full Text Available ResumoO objetivo desse estudo foi analisar os sentidos atribuídos por professores de Ciências e alunos à diversidade sexual. Foram utilizados: questionário, entrevista, produção de textos, análise documental e a técnica de grupo focal para a coleta de dados. De modo geral, os alunos possuem sentidos que reconhecem Lésbicas, Gays, Bissexuais e Transgêneros (LGBT como "estranhos", mesmo assim, acreditam que têm o dever de respeitar as escolhas de cada um. As travestis foram declaradamente apresentadas com repúdio por eles, sendo a homossexualidade e bissexualidade aparentemente mais aceitas. Os professores parecem manter aulas que não abordam estas questões, mesmo o Ensino de Ciências, sendo um momento privilegiado para problematizações sobre diversidade sexual e gênero. É necessário investir em discussões sobre esses temas na formação inicial e continuada de professores, buscando a construção de novos sentidos e práticas que se preocupem com o desvelamento de significados preconceituosos sobre gênero e diversidade sexual.

  11. The radiation shielding potential of CI and CM chondrites

    Science.gov (United States)

    Pohl, Leos; Britt, Daniel T.

    2017-03-01

    Galactic Cosmic Rays (GCRs) and Solar Energetic Particles (SEPs) pose a serious limit on the duration of deep space human missions. A shield composed of a bulk mass of material in which the incident particles deposit their energy is the simplest way to attenuate the radiation. The cost of bringing the sufficient mass from the Earth's surface is prohibitive. The shielding properties of asteroidal material, which is readily available in space, are investigated. Solution of Bethe's equation is implemented for incident protons and the application in composite materials and the significance of various correction terms are discussed; the density correction is implemented. The solution is benchmarked and shows good agreement with the results in literature which implement more correction terms within the energy ranges considered. The shielding properties of CI and CM asteroidal taxonomy groups and major asteroidal minerals are presented in terms of stopping force. The results show that CI and CM chondrites have better stopping properties than Aluminium. Beneficiation is discussed and is shown to have a significant effect on the stopping power.

  12. Estudos de Comunidade e ciências sociais no Brasil

    Directory of Open Access Journals (Sweden)

    Nemuel da Silva Oliveira

    2011-12-01

    Full Text Available O objetivo deste artigo é fazer um balanço da literatura sobre os Estudos de Comunidade (EC no Brasil, destacando o contexto intelectual em que foram produzidos e os debates que suscitaram, especialmente entre as décadas de 1940 e 1960. Método de pesquisa em comunidades, oriundo da Antropologia, em investigações sobre o processo de mudança social, os EC estiveram em voga nos Estados Unidos entre os anos 1920 e 1950, tendo papel fundamental na institucionalização das Ciências Sociais no Brasil. Destacamos três aspectos na produção desses estudos no país, iniciando com uma abordagem conceitual: definições, origem e sua relação com temáticas marcantes nos anos 1950. Em seguida, privilegiamos os aspectos relacionados ao papel dos EC na história das Ciências Sociais no Brasil, com destaque para o processo de institucionalização das Ciências Sociais. Por fim, revisitamos os debates que tais estudos geraram entre os cientistas sociais quanto ao padrão de trabalho sociológico a ser desenvolvido naquele momento.The purpose of this article is to examine the literature about Community Studies(CS in Brazil, highlighting their intellectual context of production and the debates evoked by them, especially between the 1940's and 1960's. As a research method arising from Anthropology on communities in social change process, CS was used in United States between 1920's and 1950's, and played a fundamental role in the institutionalization of Social Sciences in Brazil. Three aspects are highlighted on CS production: first, in a conceptual approach, we discuss their definitions, origins and relation to main topics in the 1950's. The second aspect is related to the role of CS in the history of Social Sciences, especially their institutionalization process. By the end, we revisit the debates between social scientists about the sociological work standard to be developed at that time.

  13. Ciénega de Chapala, Jalisco, México

    Directory of Open Access Journals (Sweden)

    J. L. Martínez

    2005-01-01

    Full Text Available En la Ciénega de Chapala se llevaron a cabo una serie de experimentos de laboratorio y campo para determinar la interacción biológica entre la alimentación de la chinche apestosa y la severidad de tizón de la panoja del sorgo, causado por el hongo Fusarium moniliforme. La chinche Oebalus mexicanus es el insecto que predomina sobre las panojas de sorgo en esa región. F. moniliforme fue aislado del interior del insecto. Las pruebas de transmisión del patógeno resultaron positivas. Pruebas de regresión realizadas para los datos de 1996 y 1997 indican que del 70% al 85% del daño por tizón de la panoja se explica por la abundancia de la chinche apestosa.

  14. Autonomia ou dependência da ciência

    OpenAIRE

    Morin, Edgar; Centre National de la Recherche Scientifique

    2008-01-01

    Em consequência do “caso Sokal”1 , a questão de saber em que condições se pode falar de autonomia ou de dependência da ciência retomou toda a sua virulência e, cabe afirmar, toda a sua pertinência. Muitos viram na mistificação de Sokal um teste de falsificação científica: falsificar o enunciado de um discurso para testar os critérios de reconhecimento da sua validade. Mas parece mais divertido de ver nisso, antes de tudo, um jogo de cena entre dois poderes bastante distintos: os “científicos”...

  15. Ciência da Computação

    Directory of Open Access Journals (Sweden)

    André Felipe Henriques Librantz

    2006-01-01

    Full Text Available Este trabalho apresenta um sistema de navegação autônoma de robôs construídos com kits Lego Mindstorms, para cálculo de trajetórias. Esse sistema pode ser utilizado como instrumento pedagógico multidisciplinar no curso de Ciência da Computação, uma vez que, para o seu desenvolvimento são necessários conhecimentos de algoritmos, linguagem de programação, lógica computacional, estrutura de dados, inteligência artificial (IA, redes de computadores, computação gráfica e robótica.

  16. Fazer ciência: o lugar do conceito

    Directory of Open Access Journals (Sweden)

    Wilton Garcia

    2007-06-01

    Full Text Available Este texto visa abrir uma discussão acerca da pesquisa contemporânea, investindo o enfoque no discurso científico para uma abordagem dinâmica de estratégias discursivas. Tento realizar uma reflexão crítica sobre a produção do saber em alguns procedimentos conceituais. Neste caso, remeto o olhar a uma consideração teórico-metodológica que pretende contribuir à atualização do discurso da ciência, hoje, e permita propor maior flexibilidade e deslocamento diante das diferentes produções de conhecimento. Este trabalho, portanto, não pretende expor, diretamente, idéias sobre ciência, mas sobre o discurso dito científico. Nesta investigação crítica, apresento sucintamente a noção de pós-(desconstrução. Utilizo os estudos contemporâneos como eixo teórico-metodológico para este desenvolvimento argumentativo. Os estudos contemporâneos pesquisam as atualizações de conceitos, que se organizam mediante a produção de atualidades e vasculham uma (redimensão teórica e política, associada ao sistema flexível da linguagem. Essas atualizações esboçam a área dos estudos contemporâneos em sua intensidade descritiva, quando aciona um olhar investigativo sobre as inovações no discurso científico, hoje.

  17. A Biblioteconomia e a Ciência da Informação na taxionomia das ciências de Charles Sanders Peirce

    Directory of Open Access Journals (Sweden)

    Carlos Cândido de Almeida

    2005-07-01

    Full Text Available Mostra a taxionomia das ciências desenvolvida por Charles Sanders Peirce (1839-1914 que divide as ciências em três ramos: ciências teóricas, ciências da revisão e ciências aplicadas. Detalha principalmente as ciências teóricas: a Matemática, a Filosofia e a Idioscopia. Discute também o conceito de Biblioteconomia e de Ciência da Informação e que segundo as definições e características, encontradas na literatura consultada, estão na condição de ciências aplicadas, direcionadas a problemas práticos da sociedade, ou seja, o problema de controle e disseminação da informação.

  18. Trophic analysis of the fish community in the Ciénega Churince, Cuatro Ciénegas, Coahuila

    Directory of Open Access Journals (Sweden)

    Ariana Hernández

    2017-09-01

    Full Text Available Fish diets were analyzed to evaluate the dynamic trophs of the fish community in the Churince wetland system of the Cuatro Ciénegas, where the fauna consists of nine species: endemic, native and introduced. In nine sampling events (between February 2011 and May 2014 556 specimens of all nine species were collected. Stomach contents were analyzed and the Relative Importance Index (IRI was calculated. The feed coefficient (Q of the diets and the accumulated trophic diversity (Hk, as well as the amplitude of the trophic niche were evaluated. Feeding strategies in the fish community were found to be eurifagic. The main foods in general were insects, crustaceans, gastropods, plants and teleosts. According to the average linkage method, four functional trophic groups were defined, with no higher consumption species; nevertheless all were regulators, mainly invertebrates. Therefore, the chain reaction in food control was higher from top to bottom, meaning a downwards dietary control.

  19. Trophic analysis of the fish community in the Ciénega Churince, Cuatro Ciénegas, Coahuila.

    Science.gov (United States)

    Hernández, Ariana; Espinosa-Pérez, Hector S; Souza, Valeria

    2017-01-01

    Fish diets were analyzed to evaluate the dynamic trophs of the fish community in the Churince wetland system of the Cuatro Ciénegas, where the fauna consists of nine species: endemic, native and introduced. In nine sampling events (between February 2011 and May 2014) 556 specimens of all nine species were collected. Stomach contents were analyzed and the Relative Importance Index (IRI) was calculated. The feed coefficient (Q) of the diets and the accumulated trophic diversity (Hk), as well as the amplitude of the trophic niche were evaluated. Feeding strategies in the fish community were found to be eurifagic. The main foods in general were insects, crustaceans, gastropods, plants and teleosts. According to the average linkage method, four functional trophic groups were defined, with no higher consumption species; nevertheless all were regulators, mainly invertebrates. Therefore, the chain reaction in food control was higher from top to bottom, meaning a downwards dietary control.

  20. Ciência e linguagem: Fleck e o estilo de pensamento como rede de significados na ciência

    OpenAIRE

    Fernanda Schiavo Nogueira

    2012-01-01

    Na investigação conduzida, pretendemos somar esforços a outras iniciativas ainda incipientes voltadas para a (re)descoberta das contribuições pioneiras dadas pela teoria da ciência de Ludwik Fleck, pensador polonês precursor, condenado a mais de três décadas de ostracismo. Para tanto, concentraremos as atenções sobre questão de fundamental importância no processo de elaboração das ideias originais de Fleck: a contraposição do pensador polonês ao Círculo de Viena, no geral, e a Carnap, no part...

  1. Ciência e consciência, conhecimento e liberdade

    Directory of Open Access Journals (Sweden)

    Luiz Roberto Alves

    2012-08-01

    Full Text Available No tempo de novas tramas tecnológicas e riscos globais, o pensamento científico elaborado na experiência brasileira celebra um texto memorável de pouco mais de 40 anos: Ciência e libertação, do físico nuclear J. Leite Lopes. O presente ensaio perscruta esse pensamento, que se comunica com a crítica científica horrorizada com os escombros do pós-guerra e se projeta numa visão de ruptura epistemológica em vista da realidade social. Tal movimento de política científica se converte em proposta de gestão do conhecimento. A atitude metodológica deste ensaio busca textos que testemunham o entre e o pós-guerra do século XX e em contribuições das ciências da natureza e da cultura dirigidos à construção da sociedade democrática. A obra de Leite Lopes reside aí, como um feixe de linguagens a serviço da mudança social e do efetivo desenvolvimento do Brasil e da América Latina.At the time of new technological schemes and global risks, scientific thinking developed in the Brazilian experience celebrates a memorable text of little more than 40 years: Science and Liberation, written by the nuclear physicist J. Leite Lopes. This paper investigates this thought, which communicates with the critical scientific horrified by the rubble of postwar and design a vision of epistemological rupture in view of social reality. This movement becomes a proposal for a management of knowledge. The methodological approach of this essay seeks texts that bear witness to and from post-war twentieth century, and contributions from the natural sciences and culture aimed at building a democratic society. The work of Leite Lopes lies there like a bunch of languages in the service of social change and the effective development of Brazil and Latin America.

  2. Variações sobre arte e ciência

    Directory of Open Access Journals (Sweden)

    Octavio Ianni

    2004-06-01

    Full Text Available O texto propõe aproximações entre ciência e arte por meio de contrastes e semelhanças reconhecíveis nessas modalidades discursivas de conhecimento, como linguagens e narrativas singulares, dotadas de características próprias, mas que freqüentemente se valem de procedimentos e recursos alheios. Busca salientar tanto os usos de recursos ficcionais pelos textos científicos, como o contrário, as valências cognitivas e mesmo a reconstrução complexa de experiências sociais pelos textos literários, articulados por uma ambição estética.The text establishes connections between science and art through the contrasts and similarities traceables in those discourses of knowledge, while languages and peculiar narratives endowed with its own traits, but that quite often appeal to alien proce-dures and resources. It seeks to point out the uses of fiction resources in scientific texts, as the opposite, the cognitives assets and even the complex reconstruction of social experiences found out literary texts, moved by an aesthetic ambition.

  3. Cientometria: a métrica da ciência

    Directory of Open Access Journals (Sweden)

    José Aparecido da Silva

    2001-01-01

    Full Text Available Cientometria é definida como o estudo da mensuração e quantificação do progresso científico, estando a pesquisa baseada em indicadores bibliométricos. A cientometria tem um grande potencial de aplicação, havendo interesse de Governos e instituições de pesquisas em utilizar este conhecimento com o objetivo de implementar diferentes formas de apoio ao desenvolvimento científico e tecnológico. Nos últimos tempos, também, ela tem sido usada para ajudar nações a tomarem decisões sobre quais áreas do saber necessitam de fundos especiais; além disso, a análise das citações ou dos fatores de impacto de periódicos e artigos vem se tornando uma fonte importante de informação para historiadores, sociólogos e outros pesquisadores interessados na evolução da ciência. Este artigo focaliza como diferentes indicadores de citação tornam possível verificar tanto a evolução das descobertas quanto o impacto do trabalho publicado. Esta análise quantitativa complementa as opiniões e os julgamentos realizados por especialistas (avaliação pelos pares, fornecendo instrumentos úteis e objetivos para avaliar os resultados da atividade científica.

  4. de La Ciénega, costa sur de Jalisco

    Directory of Open Access Journals (Sweden)

    Peter R. W. Gerritsen

    2008-01-01

    Full Text Available Hoy día la producción agroindustrial de alimentos es una actividad que está causando gran impacto tanto en los recursos naturales como en las culturas y los tejidos sociales; mientras que el modo campesino, opuesto al agroindustrial, propone una agricultura justa con base en las prácticas y experiencias campesinas generando así alternativas sustentables de producción.En este artículo se analizan cuatro estudios de caso de agricultores en el ejido de La Ciénega en la costa sur de Jalisco, los cuales se ubican en estos dos sistemas de producción. Los resultados exponen las técnicas de producción y estrategias campesinas que se desarrollan, así como la relación de los sistemas de producción ante las políticas agropecuarias. Terminamos resaltando la importancia de las prácticas y experiencias endógenas para el fortalecimiento de un desarrollo rural sustentable

  5. Por uma nova abordagem da interface ciência/sociedade: a tarefa da filosofia da ciência no contexto dos science studies

    OpenAIRE

    André Luís De Oliveira Mendonça

    2008-01-01

    Com esta tese, eu examino a relação entre ciência e sociedade a partir das novas discussões no interior da filosofia da ciência, suscitadas, em grande parte, pelos trabalhos empíricos produzidos pelos science studies. Trata-se de uma abordagem temática, na qual eu discorro sobre as principais teses dos profissionais mais renomados e autorizados de escrita inglesa nas áreas de história da ciência, sociologia da ciência e filosofia da ciência, tais como Thomas Kuhn, Paul Feyerabend, David Bloor...

  6. Outburst-related period changes of recurrent nova CI aquilae

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, R. E.; Honeycutt, R. K., E-mail: honey@astro.indiana.edu, E-mail: rewilson@ufl.edu [Astronomy Department, Indiana University, Swain Hall West, Bloomington, IN 47405 (United States)

    2014-11-01

    Pre-outburst and post-outburst light curves and post-outburst eclipse timings are analyzed to measure any period (P) change related to nova CI Aql's outburst of early 2000 and a mean post-outburst dP/dt, which then lead to estimates of the accreting component's rate of mass (M) change and its overall outburst-related change of mass over roughly a decade of observations. We apply a recently developed procedure for unified analysis of three timing-related data types (light curves, radial velocities, and eclipse timings), although with only light curves and timings in this case. Fits to the data are reasonably good without need for a disk in the light-curve model, although the disk certainly exists and has an important role in our post-outburst mass flow computations. Initial experiments showed that, although there seems to be an accretion hot spot, it has essentially no effect on derived outburst-related ΔP or on post-outburst dP/dt. Use of atomic time (HJED) in place of HJD also has essentially nil effect on ΔP and dP/dt. We find ΔP consistently negative in various types of solutions, although at best only marginally significant statistically in any one experiment. Pre-outburst HJD {sub 0} and P results are given, as are post-outburst HJD {sub 0}, P, and dP/dt, with light curves and eclipse times as joint input, and also with only eclipse time input. Post-outburst dP/dt is negative at about 2.4σ. Explicit formulae for mass transfer rates and epoch-to-epoch mass change are developed and applied. A known offset in the magnitude zero point for 1991-1994 is corrected.

  7. Ciência em Cuba: uma aposta pela soberania

    Directory of Open Access Journals (Sweden)

    Orfilio Peláez Mendoza

    2011-01-01

    Full Text Available No dia 15 de janeiro de 1960, o então primeiro-ministro do Governo Revolucionário, Fidel Castro Ruz, disse que o futuro de Cuba teria que ser necessariamente um futuro de homens de ciência, um futuro de homens de pensamento. Meio século depois de pronunciada tão profética frase, a ilha caribenha é um país de pesquisadores, especialistas e operários altamente qualificados, que dispõe de uma das indústrias biotecnológicas mais importantes do mundo, com resultados comparáveis aos atingidos pelas nações líderes nessa área do conhecimento, e na qual a atividade científica está a caminho de se converter numa potente força produtiva, geradora de significativo ingresso de divisas e de um bem-estar maior para a sociedade.El 15 de enero de 1960 el entonces primer ministro del Gobierno Revolucionario, Fidel Castro Ruz, dijo que el futuro de Cuba tendría que ser necesariamente un futuro de hombres de ciencia, un futuro de hombres de pensamiento. Medio siglo después de pronunciada tan profética frase, la Isla caribeña es un país de investigadores, especialistas y obreros altamente calificados, que dispone de una de las industrias biotecnológicas más pujantes del mundo, con resultados comparables a los alcanzados por las naciones líderes en esta esfera del conocimiento, y donde la actividad científica va en camino de convertirse en una potente fuerza productiva, generadora de significativos ingresos en divisas y de un mayor bienestar para la sociedad.On January 15, 1960, Fidel Castro Ruz, then prime minister of the Revolutionary Government, said that Cuba's future would necessarily have to be a future of men of science, a future of men of thought. Half a century after this prophetic announcement, the Caribbean island is a country of researchers, specialists and highly skilled workers, boasting one of the world's most important biotechnological industries, with achievements comparable to those of leading nations in this field of

  8. As ciências naturais e as ciências do espírito na era da globalização

    Directory of Open Access Journals (Sweden)

    Jaeschke, Walter

    2006-01-01

    Full Text Available Este artigo, o autor apresenta, primeiramente, reflexões de cunho histórico sobre a relação entre as Ciências Naturais e as Ciências do Espírito, seguidas de observações, de caráter mais sistemático, sobre o conceito das próprias Ciências do Espírito. Com fundamento nessas observações, tece algumas reflexões sobre até que ponto podemos esperar da globalização efeitos sobre as Ciências Naturais e as Ciências do Espírito

  9. CI in the work place: does involving the HRM function make any difference?

    DEFF Research Database (Denmark)

    Hyland, Paul; Becker, Karen; Sload, Terry

    2008-01-01

    People are central to successful Continuous Improvement (CI), and in larger organisations a Human Resource Management (HRM) function is responsible for people related issues. Central to CI is learning and a culture that supports CI. Learning needs to be both individual and organisational, and must...... benefit the organisation's performance. The HRM function is often given the task of championing cultural change and managing aspects of training and learning, and it would appear that involvement of HRM professionals would enhance CI efforts and assist in the timely solution of issues within the CI...... process. This paper aims to determine the influence of involving HRM professionals in CI, and if their involvement has any impact on support and tools used in CI and the contribution of CI to business performance....

  10. Contribuições da ciência da informação para a ciência das redes

    Directory of Open Access Journals (Sweden)

    Gustavo Vasconcellos Cavalcante

    2011-04-01

    Full Text Available Se pudéssemos escolher uma palavra para resumir a sociedade do século XXI, esta palavra deveria ser "conectada". Nós crescemos sem perceber a imensa interligação de redes necessária para nosso moderno estilo de vida. Somente quando existem problemas no fornecimento de algumas destas facilidades é que começamos a perceber a existência de redes para: eletricidade, água, gás, TV à cabo, telefone, comunicação de dados, etc. Estas redes também nos permitem contatar praticamente qualquer pessoa no planeta. Durante a última década, diversas pesquisas foram feitas por pesquisadores de diversas áreas: Física, Ciência da Computação, Sociologia, Matemática, Ciência da Informação. Na época da escrita deste documento estamos participando do alvorecer de uma nova ciência - A "Ciência das Redes". Esta ciência, que por sua própria natureza já nasce com características transdisciplinares, vem procurar buscar respostas aos desafios do novo milênio. Neste artigo apresentaremos algumas contribuições oriundas da Ciência da Informação que estão sendo redescobertas para a consolidação da ainda nascente Ciência das Redes.

  11. As tendências atuais dos paradigmas: ciência, tecnologia e sociedade e ensino de ciências indígena no VII ENPEC

    Directory of Open Access Journals (Sweden)

    Maria Delourdes Maciel

    2014-01-01

    Full Text Available O Encontro Nacional de Pesquisas em Educação em Ciências é um evento bianual organizada pelos pesquisadores do ensino de Ciências. O objetivo principal desse encontro é reunir os professores e pesquisadores da área, para socializarem os relatos de experiência e pesquisas no ensino de Ciências. Nesse presente trabalho, foi realizado um mapeamento dos artigos apresentados nas seções de comunicação oral do VII ENPEC, somando um total de 425 artigos selecionados, procurou-se identificar os relacionados com a abordagem Ciências, Tecnologia e Sociedade (CTS no ensino de Ciências sua estrutura de organização e o numero de pesquisadores dessa área do Ensino de Ciências. Para esse estudo foi realizado uma pesquisa qualitativa de caráter bibliográfico, e para a análise dos dados buscou-se subsídios teóricos em Fiorentini (2002 e Bardin (2006 porque assim seria possível comparar minuciosamente os diferentes resultados obtidos. Conclui-se que a linha de pesquisa com a temática CTS apresentou 28 trabalhos cerca de 7% de trabalhos apresentados, confirmando uma sinalização nessa área de pesquisa pelos pesquisadores do ensino de Ciências e a temática sobre ensino de ciências indígena representou cerca de 1% dos trabalhos apresentados.

  12. Development of effective combined kinetic hydrate inhibitor/corrosion inhibitor (KHI/CI) products

    Energy Technology Data Exchange (ETDEWEB)

    Clark, Len. W.; Anderson, Joh.

    2006-03-15

    Low Dosage Hydrate Inhibitors (LDHIs) are gaining worldwide acceptance as a viable alternative to the more conventional methods of hydrate flow assurance control. Use of this LDHI technology in combination with Corrosion Inhibitors (CI) in production systems such as sub sea developments enables operating companies to further significantly reduce capital costs. CI can have a significant impact of the efficacy of Kinetic Hydrate Inhibitors (KHI). This paper will review the experience of developing combined KHI and CI products (KHI/CI) with the aim of producing effective products whilst also incorporating the goal of the use of more environmentally friendly CI. Relevant KHI/CI product case histories will be considered. The development of KHI to be used in the presence of CI will also be considered in different production scenarios. This relates to the typical situation of continuous CI usage with the seasonal application of KHI. Experience is also shown of how the incorporation of Thermodynamic Hydrate Inhibitors (THI) to KHI/CI products, in order to enable the combined product to control hydrates in higher subcooling systems, can also have a role to play in the influence that the CI has on the efficiency of the KHI. (author) (tk)

  13. CI2 for creating and comparing confidence-intervals for time-series bivariate plots.

    Science.gov (United States)

    Mullineaux, David R

    2017-02-01

    Currently no method exists for calculating and comparing the confidence-intervals (CI) for the time-series of a bivariate plot. The study's aim was to develop 'CI2' as a method to calculate the CI on time-series bivariate plots, and to identify if the CI between two bivariate time-series overlap. The test data were the knee and ankle angles from 10 healthy participants running on a motorised standard-treadmill and non-motorised curved-treadmill. For a recommended 10+ trials, CI2 involved calculating 95% confidence-ellipses at each time-point, then taking as the CI the points on the ellipses that were perpendicular to the direction vector between the means of two adjacent time-points. Consecutive pairs of CI created convex quadrilaterals, and any overlap of these quadrilaterals at the same time or ±1 frame as a time-lag calculated using cross-correlations, indicated where the two time-series differed. CI2 showed no group differences between left and right legs on both treadmills, but the same legs between treadmills for all participants showed differences of less knee extension on the curved-treadmill before heel-strike. To improve and standardise the use of CI2 it is recommended to remove outlier time-series, use 95% confidence-ellipses, and scale the ellipse by the fixed Chi-square value as opposed to the sample-size dependent F-value. For practical use, and to aid in standardisation or future development of CI2, Matlab code is provided. CI2 provides an effective method to quantify the CI of bivariate plots, and to explore the differences in CI between two bivariate time-series. Copyright © 2016 Elsevier B.V. All rights reserved.

  14. Reflexões sobre a importância da História e Filosofia da Ciência no Ensino de Ciências

    Directory of Open Access Journals (Sweden)

    Ana Paula de Melo

    2017-05-01

    Full Text Available A história e filosofia da ciência tem um papel fundamental no ensino de ciências, pois problematiza o conhecimento científico e o torna contextualizado.  Contudo há uma preocupação referente à existência e a maneira como é trabalhada essa temática nas licenciaturas. Entendemos que seja necessária nos cursos de formação inicial e continuada de professores, a reflexão sobre como, porque e por quem é construída a ciência e quais suas implicações para a sociedade, para que essa reflexão também possa ser feita com os alunos na rede básica de ensino. O objetivo desse trabalho teórico é evidenciar a importância da história e filosofia da ciência no ensino de ciências, bem como provocar a reflexão acerca dessa temática, a fim de questionar a validade de um ensino baseado na mera transmissão de conhecimentos científicos o qual ignora o processo de construção destes conhecimentos, entre outras reflexões. Pode-se inferir que ensinar ciências sem trabalhar história e filosofia da ciência, é apenas informar termos, conceitos, e teorias, ou seja, é permanecer no tradicionalismo metodológico, sem a preocupação em formar um cidadão crítico, que entenda o que está estudando, como foram construídos os conhecimentos que ele estuda e suas implicações históricas e sociais.

  15. Max Weber e a objetividade do conhecimento nas ciências da cultura: um breve guia para o texto A ‘Objetividade’ do Conhecimento na Ciência Social e na Ciência Política (1904

    Directory of Open Access Journals (Sweden)

    Jean Henrique Costa

    2011-05-01

    Full Text Available

    O presente artigo objetiva discutir o sentido da objetividade do conhecimento empírico-social na obra de Max Weber, especificamente no texto “A ‘Objetividade’ do Conhecimento na Ciência Social e na Ciência Política”, de 1904. Discute-se, no primeiro momento, a distinção entre conhecimento empírico e juízo de valor; no segundo momento, faz-se uma rápida crítica às idéias de “lei” e “conexão regular” nas ciências sociais para, em seguida, na terceira parte, discutir a estrutura da formação dos conceitos típico-ideais como recursos metodológicos, nos quais, para Weber, expressam a possibilidade da validade objetiva do conhecimento nas ciências da cultura.

  16. Hearing Preservation CI Surgery and Hybrid Hearing : From Anatomical Aspects to Patient Satisfaction

    OpenAIRE

    Erixon, Elsa

    2014-01-01

    A common cause of profound deafness is hair cell dysfunction in the cochlea. Cochlear implants (CI) bypass the hair cells via an electrode and stimulate the cochlear nerve directly. Nowadays, it is possible to preserve residual hair cell function and hearing through flexible electrodes and a-traumatic CI surgery techniques; called hearing preservation CI surgery. This may suit partially deaf patients who can use natural low frequency hearing in combination with electric high frequency hearing...

  17. Application of the graphical unitary group approach to the energy second derivative for CI wave functions via the coupled perturbed CI equations

    Energy Technology Data Exchange (ETDEWEB)

    Fox, D.J.

    1983-10-01

    Analytic derivatives of the potential energy for Self-Consistent-Field (SCF) wave functions have been developed in recent years and found to be useful tools. The first derivative for configuration interaction (CI) wave functions is also available. This work details the extension of analytic methods to energy second derivatives for CI wave functions. The principal extension required for second derivatives is evaluation of the first order change in the CI wave function with respect to a nuclear perturbation. The shape driven graphical unitary group approach (SDGUGA) direct CI program was adapted to evaluate this term via the coupled-perturbed CI equations. Several iterative schemes are compared for use in solving these equations. The pilot program makes no use of molecular symmetry but the timing results show that utilization of molecular symmetry is desirable. The principles for defining and solving a set of symmetry adapted equations are discussed. Evaluation of the second derivative also requires the solution of the second order coupled-perturbed Hartree-Fock equations to obtain the correction to the molecular orbitals due to the nuclear perturbation. This process takes a consistently higher percentage of the computation time than for the first order equations alone and a strategy for its reduction is discussed.

  18. Ciências Humanas e Sociais: ciências moles? A propósito do trabalho científico nesta contemporaneidade

    OpenAIRE

    Maria Adélia Aparecida de Souza

    2011-01-01

    Este ensaio busca atender uma velha e interminável discussão sobre uma questão que longe de ser científica é, sobretudo, política, qual seja a classificação das ciências. A Geografia tem oscilado nessas classificações: ora é uma ciência humana, social, ora é uma ciência da natureza. Este estímulo é o motivo principal da realização deste ensaio que, inspirado em uma interessante reflexão de Abraham Moles, prêmio Nobel de Matemática, quando sugere que reflitamos com seriedade científica e acadê...

  19. A method to fast determine the coupling coefficients in CI calculation

    Institute of Scientific and Technical Information of China (English)

    甘正汀; 苏克和; 王育邠; 文振翼

    1999-01-01

    A new algorithm for evaluating the coupling coefficients and the addresses of molecular integrals in configuration interaction (CI) calculations is presented, which leads to an improved CI calculation program CGUGA. The validity and efficiency of the new code are compared with other programs, such as MELD and GAUSSIAN-94.

  20. Da Psicanálise como uma ciência particular do singular

    Directory of Open Access Journals (Sweden)

    Wanderley Magno de Carvalho

    2014-12-01

    Full Text Available O artigo propõe considerarmos a psicanálise como uma ciência do singular; diferencia ciência do cientificismo contemporâneo, e define os termos “particular”, “ciência”, e “singular”. Em seguida, discute a concepção dominante de ciência e aplica, em oposição ao termo, assim unívoco, parte da teoria matemática dos conjuntos, apresentada pelo filósofo Alain Badiou. Propõe o reconhecimento da pluralidade das ciências, da qual infere que a psicanálise é uma ciência particular. Em seguida, aponta algumas passagens das obras de S. Freud e de J. Lacan que nos autorizam o entendimento da Psicanálise como uma ciência. Discute o tema da verdade na Psicanálise e em Badiou, e finaliza com a proposta de que o dispositivo do “passe” seja um procedimento de formalização da ciência psicanalítica.

  1. SLA: A Time for New Initiatives-- CI Division Formed, Fundraising Goal Set, Certification Coming

    Science.gov (United States)

    DiMattia, Susan; Blumenstein, Lynn

    2004-01-01

    Several initiatives were announced at the Special Libraries Association (d.b.a. SLA) conference, June 4-9, at the Gaylord Opryland Hotel in Nashville. A petition drive resulted in formation of a Competitive Intelligence (CI) Division from the former CI Section of the Leadership and Management Division. The board encouraged the member-driven…

  2. Dyskusja wokół celu sprawozdawczości finansowej opartej na MSSF

    Directory of Open Access Journals (Sweden)

    Edyta Łazarowicz

    2016-07-01

    Full Text Available Celem artykułu jest analiza i ocena propozycji zmian odnośnie do celu sprawozdawczości finansowej opartej na Międzynarodowych Standardach Sprawozdawczości Finansowej (MSSF przedstawionych w komentarzach do projektu Założeń koncepcyjnych sprawozdawczości finansowej (2015. Większość respondentów uważa, że w celu sprawozdawczości finansowej należy zwiększyć znaczenie dostarczania informacji o wypełnieniu funkcji powierniczej przez kierownictwo (stewardship. Ponadto proponują oni przedstawienie definicji stewardship w Założeniach koncepcyjnych oraz wskazanie konsekwencji zmiany celu sprawozdawczości finansowej dla przyszłego tworzenia standardów i dla sporządzania sprawozdań finansowych. Z analizy komentarzy i przeglądu literatury wynika, że cel sprawozdawczości finansowej powinien być zmieniony. Sprawą dyskusyjną pozostaje jednak, czy stewardship powinien być odrębnym celem. Niestety, jest za mało badań dotyczących relacji pomiędzy stewardship i użytecznością decyzyjną. Ich wyniki mogłyby wskazać twórcom standardów rachunkowości potencjalne kompromisy i konflikty między nimi.

  3. Objective assessment of stream segregation abilities of CI users as a function of electrode separation

    DEFF Research Database (Denmark)

    Paredes Gallardo, Andreu; Madsen, Sara Miay Kim; Dau, Torsten

    for cochlear implant (CI) users. Despite its high relevance in many daily situations, the number of studies investigating segregation abilities of CI listeners is limited and their findings are contradictory (e.g. Cooper and Roberts, 2009; Marozeau et al, 2013). Moreover, while most of the previous research...

  4. The MMN as a viable and objective marker of auditory development in CI users

    DEFF Research Database (Denmark)

    Näätänen, Risto; Petersen, Bjørn; Torppa, Ritva

    2017-01-01

    In the present article, we review the studies on the use of the mismatch negativity (MMN) as a tool for an objective assessment of cochlear-implant (CI) functioning after its implantation and as a function of time of CI use. The MMN indexes discrimination of different sound stimuli with a precision...... reporting their perception such as infants and different clinical patient groups. In infants and small children with CI, the MMN provides the only means for assessing the adequacy of the CI functioning, its improvement as a function of time of CI use, and the efficiency of different rehabilitation...... as frequency, intensity, and duration) in a short recording time of about 30 min. Most recently, such stimulus paradigms have been successfully developed for an objective assessment of music perception, too....

  5. Music-Based Training for Pediatric CI Recipients: A Systematic Analysis of Published Studies

    Science.gov (United States)

    Gfeller, Kate

    2016-01-01

    In recent years, there has been growing interest in the use of music-based training to enhance speech and language development in children with normal hearing and some forms of communication disorders, including pediatric CI users. The use of music training for CI users may initially seem incongruous given that signal processing for CIs presents a degraded version of pitch and timbre, both key elements in music. Furthermore, empirical data of systematic studies of music training, particularly in relation to transfer to speech skills are limited. This study describes the rationale for music training of CI users, describes key features of published studies of music training with CI users, and highlights some developmental and logistical issues that should be taken into account when interpreting or planning studies of music training and speech outcomes with pediatric CI recipients. PMID:27246744

  6. Manipulating the ferromagnetism in narrow-bandwidth Pr{sub 1-x}Ca{sub x}MnO{sub 3} (0 ≤ x ≤ 0.6) by means of the Mn-Ru t{sub 2g} ferromagnetic super-exchanges

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Y. L.; Liu, M. F.; Xie, Y. L.; Yan, Z. B. [Laboratory of Solid State Microstructures and Innovation Center of Advanced Microstructures, Nanjing University, Nanjing 210093 (China); Dong, S. [Department of Physics, Southeast University, Nanjing 211189 (China); Liu, J.-M. [Laboratory of Solid State Microstructures and Innovation Center of Advanced Microstructures, Nanjing University, Nanjing 210093 (China); Institute for Advanced Materials and Laboratory of Quantum Engineering and Materials, South China Normal University, Guangzhou 510006 (China)

    2015-09-28

    The concurrent ferromagnetic and metal-insulator transitions via the double-exchange route and electronic phase separation scenario represent the core ingredients of the physics of manganites. In this work, a Ca{sup 2+} and Ru{sup 4+} co-substitution of Pr{sup 3+} and Mn{sup 3+} in narrow-bandwidth and insulating PrMnO{sub 3}, namely, Pr{sub 1-x}Ca{sub x}Mn{sub 1-x}Ru{sub x}O{sub 3} (PCMRO, x ≤ 0.6), is carried out in order to investigate an alternative approach to effectively manipulate the ferromagnetism of PrMnO{sub 3}-based manganites. It is revealed that PCMRO over the whole substitution range is homogeneous solid solution with increased lattice distortion. The preference of Ru{sup 4+} valence state and the absence of Mn{sup 4+} valence state disable the Mn{sup 3+}-Mn{sup 4+} e{sub g}-orbital double-exchange, and the random occupation of Ru{sup 4+} in the lattice excludes the charge ordering and electronic phase separation. While all these consequences should favor antiferromagnetic insulating states, nevertheless, a high-temperature ferromagnetic transition is triggered by the co-substitution and the magnetization can reach up to ∼1.0 μ{sub B}/f.u. at x ∼ 0.2–0.3, much bigger than the moment (<0.1 μ{sub B}/f.u.) of Pr{sub 1−x}Ca{sub x}MnO{sub 3} in the weak ferromagnetic insulator state. It is suggested that this strong ferromagnetism is substantially ascribed to the Mn{sup 3+}-Ru{sup 4+} t{sub 2g}-orbital ferromagnetic super-exchange, and a simple geometric network illustration of the magnetism and electrical transport is presented.

  7. Dylematy standaryzacjisprawozdawczości finansowej,wyceny i pomiaru ryzyka

    Directory of Open Access Journals (Sweden)

    Dorota Dobija

    2010-09-01

    Full Text Available W artykule zostały poruszone zagadnienia związane z istotą przejrzystości fi-nansowej organizacji. Przejrzystość ta jest jednym z elementów efektywnego systemu ładu korporacyjnego, dlatego tempo zmian w tym obszarze jest narzucone przez refor-my w systemach ładu korporacyjnego. W pierwszej części opracowania jest dyskuto-wana rola menedżerów w zapewnieniu przejrzystości finansowej organizacji. Kolejna część opracowania obejmuje krytyczną dyskusję trzech istotnych wątków teore-tycznych wpływających na jakość sprawozdawczości: postępującej standaryzacji w rachunkowości, problemów wyceny w rachunkowości oraz zagadnień pomiaru i sprawozdawczości ryzyka w organizacji.

  8.  Neurorachunkowość jako potencjalny, ale trudny kierunek rozwoju rachunkowości

    Directory of Open Access Journals (Sweden)

    Nelli Artienwicz

    2015-06-01

    Full Text Available Artykuł stanowi wprowadzenie w zagadnienia i wyniki nowego interdyscyplinarnego nurtu badawczego, jakim jest neurorachunkowość. Jej zaistnienie wiąże się z faktem wzrostu popularności badań nad procesami zachodzącymi w mózgu człowieka, czym zajmuje się szeroko pojęta neuronauka. Celem tego artykułu jest przedstawienie neurorachunkowości (neuroaccounting jako interdyscyplinarnego podejścia badawczego bazującego na neurobiologii i neurochemii, ale wyrastającego z eksperymentalnych nurtów rachunkowości behawioralnej. W pierwszej części opisano neuronaukę oraz jej odniesienia do nauk ekonomicznych. Następnie zaprezentowano neurorachunkowość jako nowy trend w ramach rachunkowości behawioralnej oparty na badaniach neuronalnych. W końcu dokonano przeglądu nielicznych badań w rachunkowości, w których wykorzystano odniesienia do procesów zachodzących w mózgu człowieka oraz oceniono perspektywy rozwoju podejścia neuronalnego w rachunkowości

  9. Scyntygrafia kości w diagnostyce reumatoidalnego zapalenia stawów

    Directory of Open Access Journals (Sweden)

    Witold Tłustochowicz

    2010-04-01

    Full Text Available Celem pracy była ocena przydatności trójfazowej dynamicznejscyntygrafii kości w diagnostyce reumatoidalnego zapalenia stawów.Badaniem objęto 39 chorych hospitalizowanych i diagnozowanychz powodu dolegliwości stawowych. Przeprowadzono diagnostykęobejmującą: badanie podmiotowe, przedmiotowe, badania laboratoryjneoraz obrazowe, w tym trójfazową scyntygrafię kości z użyciemtechnetu 99m. Scyntygraficzne cechy zapalenia stawówstwierdzano, gdy obserwowano wzmożone gromadzenie znacznikawe wszystkich trzech fazach badania.Po ukończeniu diagnostyki rozpoznano u 13 chorych wczesne reumatoidalnezapalenie stawów, u 4 reumatoidalne zapalenie stawów(łącznie 17 pacjentów, a u 1 niezróżnicowane zapalenie stawów.Scyntygrafia kości wykazała cechy zapalenia stawów u 13spośród nich (72,2%, u 4 osób (22,2% wzmożone gromadzeniestwierdzono tylko w fazie statycznej, a u 1 pacjenta (5,6% uzyskanoprawidłowy wynik badania. U 21 chorych wykluczono chorobęzapalną stawów (u 19 rozpoznano fibromialgię, u 2 chorobęzwyrodnieniową. W grupie bez zapalenia stawów u 14 pacjentów(66,6% nie stwierdzono istotnych nieprawidłowości w obraziescyntygraficznym, u 6 (28,6% występowało wzmożone gromadzenieznacznika w badaniu statycznym, a u 1 chorego (4,8% opisanoscyntygraficzne cechy zapalenia stawów.Wbadanej grupie czułość scyntygrafii dynamicznej kości w wykrywaniuzapalenia stawów wynosiła 72,2% (95% CI: 57,5–76,8, a swoistość 95,2% (95% CI: 82,8–99,1. Dodatni wynik badaniadynamicznego wskazuje z dużym prawdopodobieństwem naobecność zapalenia stawów [PPV 92,9% (95% CI: 74,2–98,7].Mniej wiarygodny był ujemny wynik badania [NPV 80% (95% CI:69,5–83,3]. Wyniki niniejszej pracy wskazują, że trójfazowa scyntygrafia dynamicznakości może mieć zastosowanie w diagnostyce reumatoidalnegozapalenia stawów.

  10. Física e epistemologia heterodoxas: David Bohm e o ensino de ciências

    OpenAIRE

    Angotti, José André Pérez; UFSC - Santa Catarina

    2002-01-01

    Apresentamos proposições e convicções de David Bohm (1917–1992) bastante sugestivas para os professores de física/ciências preocupados com a melhoria dos processos e dos resultados de suas atividades, principalmente na perspectiva de ruptura com os pressupostos profissionais fundados nos fundamentos da Ciência Clássica e mesmo da Ciência Moderna e Contemporânea, bem como nos pressupostos da transmissão (ou troca) destes conhecimentos em sala de aula. Tais pressupostos, ad...

  11. PROBLEMY OCENY WŁASNOŚCI MIESZANEK MINERALNO-CEMENTOWO-EMULSYJNYCH (MCE

    Directory of Open Access Journals (Sweden)

    Piotr ZIELIŃSKI

    2016-07-01

    Full Text Available Podbudowy z mieszanek MCE są podstawowym rodzajem technologii recyklingu nawierzchni w Polsce, wykonywanym już od około 20 lat. Dotychczas stosowany sposób oceny własności tych mieszanek jest zdaniem autora niewystarczający gdyż wykonywany jest na próbkach przygotowywanych w sposób ściśle kontrolowany. Cechy ich są w tym przypadku znacznie korzystniejsze od rzeczywistych, określonych na próbkach pobranych z wykonanej na budowie warstwy. W niniejszej publikacji przedstawiono wyniki badań  wpływu metody zagęszczenia oraz wielkości próbek na podstawowe własności mieszanek MCE takie jak: zawartość wolnych przestrzeni w warstwie, moduł sztywności sprężystej (ITSM i wytrzymałość na rozciąganie pośrednie (ITS. Analiza wyników pozwoliła na stwierdzenie, że własności próbek wykonywanych w ramach recepty laboratoryjnej są bardziej korzystne niż tych przygotowanych z mieszanki wymieszanej na budowie i zagęszczonej w laboratorium, natomiast najmniej korzystne właściwości posiadają próbki pobrane metodą odwiertów ze stwardniałej warstwy: charakteryzują się one największą porowatością, najmniejszą wytrzymałością na rozciąganie pośrednie i najmniejszym modułem sztywności sprężystej oraz dodatkowo wykazują największe rozrzuty wyników. Dla poprawnej oceny trwałości konstrukcji nawierzchni z podbudową z MCE, powinniśmy oceniać własności tej mieszanki określane na próbkach z odwiertów lub ewentualnie zmienić metodę laboratoryjnego przygotowywania próbek w taki sposób aby lepiej oddawała stan rzeczywisty.

  12. Polityka rachunkowości polskich fundacjiw świetle badań empirycznych

    Directory of Open Access Journals (Sweden)

    Anna Kamińska-Stańczak

    2010-04-01

    Full Text Available Fundacja, jak każdy podmiot rachunkowości, ma obowiązek posiadania własnego, indywidualnego systemu rachunkowości, podporządkowanego koncepcji wiernego i rzetelnego obrazu. W ramach organizacji tego systemu kierownik fundacji (zarząd ma obowiązek zatwierdzenia na piśmie stosownej dokumentacji, której rodzaje określa art. 10 ustawy o rachunkowości. W niniejszym artykule wskazano na konieczność posiadania przez fundację polityki rachunkowości i jej opisu zatwierdzonego na piśmie. Przedstawiono wyniki przepro-wadzonego badania ankietowego na temat kompletności dokumentacji przyjętych przez polskie fundacje zasad (polityki rachunkowości oraz stopnia trudności w jej sporządzeniu. Badanie wykazało, że 80% fundacji ma problemy z opracowaniem takiej dokumentacji i nie dostrzega się tu wyraźnego powiązania z jakąkolwiek cechą funda-cji (np. wiek, wielkość, rodzaj działalności. Braki w dokumentacji polityki rachunko-wości występują w 60% fundacji i najczęściej dotyczą opisu systemu ochrony danych (44% fundacji i przetwarzania danych (42% fundacji. Najbardziej niepokoi jednak brak opisu przyjętych metod wyceny aktywów i pasywów (29% fundacji oraz brak zakładowego planu kont (18% fundacji. Przeprowadzone badania ankietowe oraz analiza raportów pokontrolnych Najwyższej Izby Kontroli dowodzą, że nieprawidłowości w zakresie formułowania, dokumentowania i aktualizowania polityki rachunkowości istnieją w fundacjach od wielu lat. Rodzi to szereg obaw o stan rachunkowości w fundacjach, a także o jasność i rzetelność ich sprawozdań finansowych.

  13. Curr\\'iculo interdisciplinar para licenciatura em ci\\^encias da natureza

    OpenAIRE

    Santos, Carlos Alberto dos; Valeiras, Nora

    2014-01-01

    Descreve-se neste trabalho uma proposta de curr\\'iculo interdisciplinar para a forma\\c{c}\\~ao de professores de ci\\^encias da natureza. O curso permite a obten\\c{c}\\~ao de quatro diplomas: professor de ci\\^encias para o ensino fundamental (nomenclatura brasileira), professor de biologia, f\\'isica e qu\\'imica para o ensino m\\'edio. O diploma de professor de ci\\^encias \\'e obtido com a integraliza\\c{c}\\~ao de cr\\'editos oferecidos ao longo dos tr\\^es primeiros anos do curso. Para cada ano subse...

  14. Níveis da ciência, níveis da realidade: evitando o dilema holismo/reducionismo no ensino de ciências e biologia

    OpenAIRE

    Charbel Niño El-Hani

    2000-01-01

    Um dos debates mais importantes na Filosofia da Ciência é aquele sobre as relações entre os níveis de explicação dos fenômenos e, portanto, os níveis da ciência. Esta controvérsia, intimamente relacionada ao problema metafísico dos níveis da realidade, tem sido marcada por uma polarização entre os reducionistas e seus críticos, geralmente caracterizados como holistas. O primeiro capítulo deste trabalho tem como objetivo a proposição de uma tipologia das posições metodológicas sobre a explicaç...

  15. An Improved Maximum C/I Scheduling Algorithm Combined with HARQ

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    It is well known that traffic in downlink will be much greater than that in uplink in 3 G and that beyond. High Speed Downlink Packet Access(HSDPA) is the solution to transmission for high-speed downlink packet service in UMTS, of which Maximum C/I scheduling is one of the important algorithms related to performance enhancement. An improved scheme, Thorough Maximum C/I scheduling algorithm, is presented in this article, in which every transmitted frame has the maximum C/I. The simulation results show that the new Maximum C/I scheme outperforms the conventional scheme in throughput performance and delay performance, and that the FER decreases faster as the maximum number of the retransmission increases.

  16. PAT: From Western solid dosage forms to Chinese materia medica preparations using NIR-CI.

    Science.gov (United States)

    Zhou, Luwei; Xu, Manfei; Wu, Zhisheng; Shi, Xinyuan; Qiao, Yanjiang

    2016-01-01

    Near-infrared chemical imaging (NIR-CI) is an emerging technology that combines traditional near-infrared spectroscopy with chemical imaging. Therefore, NIR-CI can extract spectral information from pharmaceutical products and simultaneously visualize the spatial distribution of chemical components. The rapid and non-destructive features of NIR-CI make it an attractive process analytical technology (PAT) for identifying and monitoring critical control parameters during the pharmaceutical manufacturing process. This review mainly focuses on the pharmaceutical applications of NIR-CI in each unit operation during the manufacturing processes, from the Western solid dosage forms to the Chinese materia medica preparations. Finally, future applications of chemical imaging in the pharmaceutical industry are discussed.

  17. Interactions of Biogeochemical Cycles in Oncoid Microbialites from Cuatro Ciénegas, Mexico

    Science.gov (United States)

    Corman, J. R.; Souza, V.; Elser, J. J.

    2010-04-01

    Modern microbialite systems may provide unique opportunities to study the feedbacks that couple or uncouple multiple biogeochemical cycles. Here we present results from a two-week manipulative ecosystem experiment using oncoid microbialites from Cuatro Ciénegas, Mexico.

  18. Communication: CDFT-CI couplings can be unreliable when there is fractional charge transfer.

    Science.gov (United States)

    Mavros, Michael G; Van Voorhis, Troy

    2015-12-21

    Constrained density functional theory with configuration interaction (CDFT-CI) is a useful, low-cost tool for the computational prediction of electronic couplings between pseudo-diabatic constrained electronic states. Such couplings are of paramount importance in electron transfer theory and transition state theory, among other areas of chemistry. Unfortunately, CDFT-CI occasionally fails significantly, predicting a coupling that does not decay exponentially with distance and/or overestimating the expected coupling by an order of magnitude or more. In this communication, we show that the eigenvalues of the difference density matrix between the two constrained states can be used as an a priori metric to determine when CDFT-CI are likely to be reliable: when the eigenvalues are near 0 or ±1, transfer of a whole electron is occurring, and CDFT-CI can be trusted. We demonstrate the utility of this metric with several illustrative examples.

  19. Efficient Algorithm for Asymptotics-Based CI and Electronic Structure of Transition Metal Atoms

    CERN Document Server

    Mendl, Christian

    2010-01-01

    Asymptotics-based CI methods are a class of Configuration-Interaction (CI) methods for atoms which reproduce, at fixed finite subspace dimension, the exact Schr\\"odinger eigenstates in the limit of fixed electron number and large nuclear charge. Here we develop, implement, and apply to 3d transition metal atoms an efficient and accurate algorithm for asymptotics-based CI. Efficiency gains come from exact (symbolic) decomposition of the CI space into irreducible symmetry subspaces at essentially linear computational cost, use of reduced density matrices in order to avoid having to store wavefunctions, and use of Slater-type orbitals (STO's). The required Coulomb integrals for STO's are evaluated in closed form, with the help of Hankel matrices, Fourier analysis, and residue calculus. Applications to 3d transition metal atoms are in good agreement with experimental data. In particular we reproduce the anomalous magnetic moment and orbital filling of Chromium in the otherwise regular series Ca, Sc, Ti, V, Cr.

  20. The Contradiction Index (CI): A New Metric Combining System Complexity and Robustness for Early Design Stages

    DEFF Research Database (Denmark)

    Göhler, Simon Moritz; Howard, Thomas J.

    2015-01-01

    For complex and integrated products, companies experience difficulties in achieving a satisfactory and consistent functional performance. When a design has “contradicting” parameter/property requirements it often requires fine tuning with numerous design iterations and complex optimizations to find...... of the different parts are with respect to the different functions. This article provides a step-by-step guide for how to estimate the CI for a design. The method is applied to a case study - the FlexTouch®, a Novo Nordisk insulin injection device. When analyzing the CI for each part, against the number of part...... design iterations, a positive correlation was found. Furthermore, when correlating the CI against the number of challenging tolerances statistical significance was found (p=0.01). It is envisaged that the CI will be a powerful approach to estimate and compare development difficulty and to guide...

  1. Estadística descriptiva per a ciències de la salut

    OpenAIRE

    Sanjuan i Nebot, Lluís Francesc

    2016-01-01

    Aquests materials han rebut un incentiu del Servei de Política Lingüística Apunts d'estadística descriptiva per a estudients de l'àrea de les ciències de la salut Apunts d'estadística descriptiva orientats a graus de l'àrea de les ciències de la salut

  2. Luz, arte, ciência... ação! Lights, art, science - action!

    Directory of Open Access Journals (Sweden)

    Thelma Lopes

    2005-01-01

    Full Text Available O principal objetivo do presente artigo é refletir sobre as principais interações entre teatro, ciência e tecnologia, ao longo da história do teatro, e discutir, a partir de nossa experiência no Ciência em Cena, espaço integrante do Museu da Vida, de que modos essas interações podem estar presentes no cotidiano de um museu de ciências. A palavra 'ciência' deve ser compreendida aqui em sentido amplo, englobando não apenas as ciências naturais, mas também as ciências humanas, assim como a palavra 'tecnologia' deve ser associada à ciência aplicada. Arte e ciência serão entendidas como processos criativos, como formas de representação do mundo e expressão do conhecimento humano.The article offers some reflections on the main interactions between theater, science, and technology down through the history of theater. Based on our experience at "Science in the Spotlight", part of the Casa de Oswaldo Cruz's Museum of Life, we discuss how these interactions can be part of a science museum's daily activities. We use the word 'science' in its broad sense, encompassing not only the natural but human sciences as well; likewise, we use the word 'technology' as it relates to applied science. Art and science are understood here as creative processes, as ways of representing the world and expressing human knowledge.

  3. Estadística descriptiva per a ciències de la salut

    OpenAIRE

    Sanjuan i Nebot, Lluís Francesc

    2016-01-01

    Aquests materials han rebut un incentiu del Servei de Política Lingüística Apunts d'estadística descriptiva per a estudients de l'àrea de les ciències de la salut Apunts d'estadística descriptiva orientats a graus de l'àrea de les ciències de la salut

  4. Semiempirical UNO-CAS and UNO-CI: method and applications in nanoelectronics.

    Science.gov (United States)

    Dral, Pavlo O; Clark, Timothy

    2011-10-20

    Unrestricted Natural Orbital-Complete Active Space Configuration Interaction, abbreviated as UNO-CAS, has been implemented for NDDO-based semiempirical molecular-orbital (MO) theory. A computationally more economic technique, UNO-CIS, in which we use a configuration interaction (CI) calculation with only single excitations (CIS) to calculate excited states, has also been implemented and tested. The class of techniques in which unrestricted natural orbitals (UNOs) are used as the reference for CI calculations is denoted UNO-CI. Semiempirical UNO-CI gives good results for the optical band gaps of organic semiconductors such as polyynes and polyacenes, which are promising materials for nanoelectronics. The results of these semiempirical UNO-CI techniques are generally in better agreement with experiment than those obtained with the corresponding conventional semiempirical CI methods and comparable to or better than those obtained with far more computationally expensive methods such as time-dependent density-functional theory. We also show that symmetry breaking in semiempirical UHF calculations is very useful for predicting the diradical character of organic compounds in the singlet spin state.

  5. Interpreting Tang Ci and Song Ci from a Cultural Perspective:Reading the New Work of Professor Deng Qiaobin the Developing History of Tang Ci and Song Ci%在文化视野中诠释唐宋词——读邓乔彬新作《唐宋词艺术发展史》

    Institute of Scientific and Technical Information of China (English)

    李剑亮; 李寒晴

    2011-01-01

    The Developing History of Tang Ci and Song Ci is a new work of professor Deng Qiaobin, and it is also a new work of the latest Song Ci study. The book makes the theory of the development and conversion of culture as its clue. It reviews the main changing of the thought, content, art form, creation style and poets genre. This book is an original creation; and it has a very distinct science trait. The author described and judged the developing history of Tang Ci and Song Ci by the theory of culture transition, which makes the reader both understand the development of Tang Ci and Song Ci and the cultural background of the forming of the artistc traits.%邓乔彬的《唐宋词艺术发展史》是其近年来词史研究的一部新作。全书以文化的发展与转换理论为枢纽,考察唐宋词的思想内容、艺术形式、创作风格以及词人流派的主要变化。具有鲜明的学术个性和独创性,具体表现在,运用文化转换理论,描述与评价唐宋词的发展历程,使读者在系统了解唐宋词艺术发展的同时,也能了解这些艺术特点形成的文化背景。

  6. PENURUNAN CONTAINER INDEX (CI MELALUI PENERAPAN OVITRAP DI SEKOLAH DASAR KOTA SEMARANG

    Directory of Open Access Journals (Sweden)

    Widya Hary Cahyati

    2016-10-01

    Full Text Available Abstrak Penggunaan ovitrap terbuat dari botol plastik bekas dan diisi atraktan merupakan salah satu upaya sederhana serta mampu menurunkan populasi nyamuk. Angka Bebas Jentik (ABJ merupakan salah satu indikator untuk mengetahui tingginya atau rendahnya populasi nyamuk pada suatu lingkungan. ABJ Kota Semarang tahun 2015 yaitu 59%, masih di bawah target (<95%. Tujuan penelitian yaitu untuk mengetahui kemampuan penerapan ovitrap berbasis sekolah dalam menurunkan container index (CI. Jenis penelitian yaitu eksperimen semu, dengan populasi seluruh sekolah dasar di Kota Semarang dan sampelnya yaitu 4 sekolah dasar : SDN Sekaran 01, SDN Pedurungan Tengah 02, SDN Petompon 01, dan SD Tugurejo. Hasil penelitian menunjukkan bahwa penerapan ovitrap mampu menurunkan CI. CI sebelum dan setelah penerapan ovitrap di sekolah menunjukkan penurunan sebesar 40% untuk SDN Sekaran 01, 43% untuk SD Pedurungan Tengah, 57% untuk SDN Petompon 01, dan 25% untuk SDN Tugurejo. Simpulan dalam penelitian ini penerapan ovitrap berbasis sekolah mampu menurunkan CI.   Abstract Aplication of ovitrap made from plastic bottle and filled attractan is one of the ways to reduce mosquitoes population. LFI Semarang in 2015 is 59 %, still under the target (<95%. The purpose of research to determine the effectiveness of  implementation of school-based ovitrap to reduce the population of Aedes. Design research was a quasi experiment, and the population are elementary schools in Semarang City also the sample are SDN Sekaran 01, SDN Pedurungan Tengah 02, SDN Petompon 01, and SDN Tugurejo. The results showed that the application of ovitrap effective to reduce the container index (CI. Before and after the application of ovitrap in schools, the CI showed a decrease :  40% in SDN Sekaran 01, 43% in SD Central Pedurungan, 57% in SDN Petompon 01, and 25% in SDN Tugurejo. The conclusion in this study is ovitrap school-based application is capable to reduce the CI.

  7. Isenção da ciência, neutralidade da análise

    Directory of Open Access Journals (Sweden)

    Daniel Menezes Coelho

    2012-01-01

    Full Text Available O artigo discute as relações entre a psicanálise e a ciência, especialmente no que tange aos seus métodos de investigação e trabalho. Para isso, tomamos como objeto a noção de neutralidade, tal como podemos apreendê-la na clínica da psicanálise, para confrontá-la com o que chamamos de isenção no campo da ciência, que não quer dizer outra coisa que a neutralidade proposta lá. Veremos que, apesar da clara filiação da noção psicanalítica para com a noção vinda da ciência, a neutralidade clínica da psicanálise toma outro rumo, que se pode mesmo opor ao sentido do termo na ciência. Enquanto em ciência o termo quer significar um processo de purificação e de seleção, em psicanálise ele surge como a exigência de nada selecionar.

  8. SNP Analysis and Haplotype Identification in Chymotrypsin Inhibitor-2 (CI-2) Gene of Barley

    Institute of Scientific and Technical Information of China (English)

    ZENG Xiang-hui; WEI Yu-ming; JIANG Qian-tao; QI Peng-fei; ZHENG You-liang

    2009-01-01

    Barley chymotrypsin inhibitor-2 (CI-2) was considered to be a promising candidate for enhancing the nutritional value of other cereals by increasing its concentration as it is rich in lysine than any other storage protein. Also, it was proposed that CI-2 might play an important role in the inhibition of proteolytic enzymes from pests or pathogens as CI-2 can strongly inhibit chymotrypsin and subtilisin. In this study, a total of 93 CI-2 gene sequences were isolated from wild and cultivated barley. 48 SNPs and 4 indels were detected across the entire sequences. The frequency of SNPs in the non-coding region (1 out of 9 bases) was slightly higher than that in the coding region (1 out of 10.7 bases). In all, 33.3% of the candidate cSNPs resulted in amino acid changes. As a total, the 24 cSNPs resulted in 15 amino acid changes. Ten distinguishable haplotypes were detected, among which 3 haplotypes were shared in the most barley accessions, whereas the rest of the haplotypes appeared at a lower frequency. In addition, three haplotypes (haplotype 4, 8, and 9) were unique for single accessions. These results suggested that low diversity at the CI-2 locus was detected among the cultivated and wild barley.

  9. The Relation between Nonverbal IQ and Postoperative CI Outcomes in Cochlear Implant Users: Preliminary Result

    Directory of Open Access Journals (Sweden)

    Mina Park

    2015-01-01

    Full Text Available Objectives. This study assessed the correlation between performance intelligence and the postoperative cochlear implant (CI outcome in Korean-speaking children. In addition, the relationship between the performance intelligence subscales and the post-CI speech outcome was evaluated. Materials and Methods. Thirteen pediatric CI users (five males, eight females; median age at implantation 6.2 (range 1.3–14.2 years; median age at intelligence test 9.3 (range 5–16 years who were tested using the Korean Educational Development Institute-Wechsler Intelligence Scale for children were studied. The correlations between the intelligence scores and 1-2 years postoperative Categories of Auditory Performance (CAP scores and between subscales of performance and 1-2 years postoperative CAP scores were analyzed. Results. There was no correlation between the categories of verbal intelligence quotient (IQ and performance IQ for “mentally retarded” and “average,” respectively (Spearman’s rho = 0.42, P=0.15. There was a strong correlation between performance IQ and the postoperative CAP scale (Spearman’s rho = 0.8977, P=0.0008. “Picture arrangement” and “picture completion,” reflecting social cognition, were strongly correlated with the postoperative CAP scales. Conclusion. Performance intelligence, especially social cognition, was strongly related to the postoperative CI outcome of cochlear implant users. Therefore, auditory rehabilitation, including social rehabilitation, should maximize the postoperative CI outcomes.

  10. Ci vediamo mercoledì. Gli altri giorni ci immaginiamo. A new female image in the searches of several Italian artists and photographers in the 1970s.

    Directory of Open Access Journals (Sweden)

    Cristina Casero

    2015-12-01

    Full Text Available A partire dai primi anni degli anni Settanta, si diffonde la consapevolezza che l’immagine femminile proposta dai mezzi di comunicazione visivi deriva da un dominio visuale patriarcale e sciovinista. Questa consapevolezza è in linea con molte proposte teoriche sull’immagine fotografica, secondo cui non possiamo più percepire in termini di documentazione della realtà, bensì di istituzioni sociali, secondo Roland Barthes. All’interno di questo contesto culturale, le teorie femministe, che in questi anni si stanno diffondendo anche Italia, emergono all’interno dei percorsi di ricerca di alcune artiste e fotografe, le quali, attraverso le proprie immagini, propongono una nuova immagine della donna che si offre, al di là delle convenzioni, come il frutto di un sguardo sincero e genuino sulla propria femminilità. La fotografia è il mezzo più appropriato per lavorare sull’identità, permettendo alle donne di guardarsi come in uno specchio e di restituire la realtà dal proprio punto di vista, che è alternativo, antagonista, anche se spesso solamente “vero”. Riflettere sull’opera Ci vediamo mercoledì. Gli altri giorni ci immaginiamo per è una buon punto di partenza per analizzare queste dinamiche.

  11. Seria a Metafísica Essencial à Ciência e ao Senso Comum?

    Directory of Open Access Journals (Sweden)

    Rafael Sandoval

    2017-02-01

    Full Text Available Uma das declarações mais consensuais da História da Filosofia é a que diz que a Metafísica não é ciência, mas pensamento. Neste artigo, procurar-se-á defender a tese que a Metafísica é condição para o senso comum e a ciência. Primeiro, é mostrado que os termos ao qual nós utilizamos diariamente refletem nossa imagem de mundo. Quando pensamos e fazemos previsões, fazemos o uso espontâneo de termos com significado universal. Depois, é procurado evidenciar que a ciência naturalmente faz uso de termos com significado universal quando faz previsões. Finalmente, buscará apresentar que a Metafísica é anterior às nossas hipóteses e especulações.

  12. An SCF-CI method for determining the potential energy surface of a triatomic molecule

    Institute of Scientific and Technical Information of China (English)

    谢代前; 鄢国森

    1996-01-01

    A self-consistent-field (SCF)-configuration interaction (CI) (SCF-CI) method for determining the potential energy surface of a triatomic molecule from the observed vibrational band origins has been suggested. By this method, the SCF-CI procedure in the internal coordinates is used to calculate the vibrational bond origins and their first derivatives with respect to parameters in the potential energy function using the exact vibrational Hamiltonian, and the optimizer LMF in the nonlinear-squares problem is employed to optimize parameters in the potential energy function. This approach is used to optimize the potential energy function of the water molecule. The standard deviation of this fitting to the 70 observed band origins is 1.154cm-1.

  13. Exponentially more precise quantum simulation of fermions II: Quantum chemistry in the CI matrix representation

    CERN Document Server

    Babbush, Ryan; Kivlichan, Ian D; Wei, Annie Y; Love, Peter J; Aspuru-Guzik, Alán

    2015-01-01

    We present a quantum algorithm for the simulation of molecular systems that is asymptotically more efficient than all previous algorithms in the literature. As in the first paper of this series \\cite{BabbushSparse1}, we employ a recently developed technique for simulating Hamiltonian evolution using a truncated Taylor series to obtain logarithmic scaling with the inverse of the desired precision, which is an exponential improvement over methods based on the Trotter-Suzuki decomposition. The algorithm of this paper involves simulation under an oracle for the sparse, first quantized representation of the Hamiltonian known as the configuration interaction (CI) matrix. We construct and query the CI matrix oracle to allow for on-the-fly computation of molecular integrals in a way that is exponentially more efficient than classical numerical methods. Whereas second quantized representations of the wavefunction require $\\widetilde{\\cal O}(N)$ qubits, where $N$ is the number of single-particle spin-orbitals, the CI m...

  14. APPLICATION OF ACROBATIC EXEerCI SES IN A HANDBALL TRAINING PROCESS

    Directory of Open Access Journals (Sweden)

    Radojica Marušić

    2007-05-01

    Full Text Available Ac ro bat exer ci ses re pre sent a ba se for ac qu i ring com plex hand ball exer ci sing techni qu es. Hand ball players get to know dif fe rent types of mo ving and put ting in mo tion dif fe rent parts of body. They ma ster the ba sic com po nents – di rec tion, speed, am pli tu de, in ten sity of ne u ro mu scu lar ten sion, and at the sa me ti me they le arn how to di rect the ir mo tion pre ci sely and how to co or di na te the ir mo ves in spa ce and ti me.

  15. Arquivo e testemunho da Psicologia como Ciência e Profissão

    Directory of Open Access Journals (Sweden)

    Tania Mara Galli Fonseca

    Full Text Available Neste texto, abordamos a Mostra Nacional de Práticas em Psicologia a partir dos conceitos de arquivo e testemunho. Considerando-a como arquivo coletivo, a Mostra pode ser vista como o plano comum de uma multidão enunciadora que, como testemunha, enuncia aquilo que tem sido e em que está se tornando a Psicologia como ciência e profissão. A questão dos diálogos da Psicologia com outros saberes é mostrada como relevante aos devires de nossa ciência, uma vez considerarmos que dialogar com outros domínios das ciências, das artes e da filosofia refere-se a um modo de produzir aberturas no atual arquivo de saberes que produzimos em direção a outros e novos futuros possíveis.

  16. Badania jakości regeneratu ze zużytych mas ze spoiwem organicznym

    Directory of Open Access Journals (Sweden)

    R. Dańko

    2012-12-01

    Full Text Available W publikacji przedstawiono uzupełniające metody badań oraz aparaturę do oceny jakości regeneratu i tych właściwości masformierskich ze spoiwami utwardzanymi chemicznie, przygotowywanych z regeneratem, które są istotne dla kompleksowej oceny procesurecyklingu osnowy. Nowoczesne systemy oceny mas formierskich wymagają bardziej wnikliwego podejścia do czynników decydującychzarówno o ich przydatności technologicznej jak również o wpływie na otaczające środowisko naturalne. W tym kontekście pełna ocenajakości zregenerowanej osnowy wykracza poza zwyczajowo stosowane metody instrumentalne i wymaga ich uzupełnienia o bardziejzaawansowane aparaturowo metody badawcze. Pozwala to szerzej spojrzeć na ocenę zregenerowanej osnowy, zarówno w aspekcie jejużycia do sporządzania mas formierskich, jako substytutu świeżego piasku, ale także pod kątem ochrony środowiska. Do takichnowoczesnych metod można zaliczyć między innymi analizę ziarnową regeneratu za pomocą dyfrakcji laserowej, a także ocenęgazotwórczości masy formierskiej oraz identyfikację rodzaju emitowanych gazów i zawartości w nich gazów z grupy BTEX, które sąszczególnie niebezpieczne z punktu widzenia BHP.

  17. A inclusão na perspectiva do novo paradigma da ciência

    Directory of Open Access Journals (Sweden)

    Reinoldo Marqueza

    2011-12-01

    Full Text Available O estudo aborda o processo de transição paradigmática da ciência moderna para a ciência pós-moderna. Salienta as características do paradigma atual, a crise desse paradigma e aponta os contornos do paradigma emergente na perspectiva do sociólogo Boaventura Sousa Santos. Refere a Educação Inclusiva como um novo processo de produção e de apropriação do conhecimento e como uma nova forma de estar na relação.Palavras-chave: Paradigma. Conhecimento. Educação Inclusiva.

  18. Polskie miejsca pamięci w północnej Bośni

    Directory of Open Access Journals (Sweden)

    Paulina Anna Wichniewicz

    2014-11-01

    Full Text Available Polish realms of memory in northern Bosnia This article presents the transformation in Bosnia and Herzegovina which began after the war during the years 1991-1995. The most important objective was the liberation and emancipation of the forgotten memory of minorities. These processes are also expressed in relation to the Polish minority which came into existence in the territories of Bosnia and Herzegovina in the late nineteenth and early twentieth century with the government takeover by Austria-Hungary and the announcement of the program of colonization. The changes described were significantly apparent in the reconstruction of Polish realms of memory: Polish shrines in Celinovac, Polish church in Cerovljani, Polish cemeteries: in Devetina and Novi Martinac and also in the Yugoslav-Polish partisan cemetery in Srbac. Of interest, the ‘time of memory’ which took place involved all social actors: the government of the Republic of Srpska and the municipalities of Srbac and Nowogrodziec, the Embassy of the Polish Republic in Sarajevo, representatives of local communities - Serbs and the Polish minority from Ćelinovac.   Polskie miejsca pamięci w północnej Bośni Artykuł prezentuje przemiany, które od czasu zakończenia wojny 1991–1995 roku dokonują się w granicach Bośni i Hercegowiny. Ich głównym celem jest wyzwalanie i emancypacja pamięci zapomnianych mniejszości narodowych. Procesy te dotyczą również polskiej mniejszości narodowej, która na terytorium Bośni i Hercegowiny pojawiła się pod koniec XIX i na początku XX wieku wraz z przejęciem administracji przez Austro-Węgry oraz ogłoszeniem programowej kolonizacji. Najsilniej ujawniają się w rekonstruowaniu polskich miejsc pamięci: polskiej kapliczki w Ćelinovacu, polskiego kościoła w Cerovljanach, cmentarzy polskich w Devetinie i Nowym Martyńcu oraz partyzanckiego jugosłowiańsko-polskiego w Srbacu. Co ciekawe, „czas pamięci“, który nastał, odcisn

  19. Compêndio de Ciências Físicas e Químicas

    OpenAIRE

    Tavares, Frederico

    2008-01-01

    O começo de todas as ciências é o espanto de as coisas serem o que são! Aristóteles in Metafísica Conhecer o mundo que nos rodeia e compreender os fenómenos que nele acontecem sempre foi um dos grandes objectivos da Humanidade. Num mundo cada vez mais tecnológico, o papel da ciência é cada vez mais importante, pois permite descobrir novas soluções, novas tecnologias e novos materiais, que permitem não só melhorar a qualidade de vida das pessoas, mas também proporcionar um...

  20. Motor Imagery EEG Classification Based on CI-HMM%基于CI-HMM的运动想象脑电信号分类

    Institute of Scientific and Technical Information of China (English)

    孟明; 满海涛; 佘青山

    2013-01-01

    针对隐马尔科夫模型在运动想象脑电信号分类应用中,其独立性假设与脑电信号间相关性的不一致问题,提出一种基于Choquet模糊积分隐马尔科夫模型的脑电信号分类方法。该模型应用模糊积分的单调性取代了概率测度的可加性,放宽了隐马尔科夫模型的独立性假设。利用重叠滑动窗对脑电信号分段,然后对每段数据提取绝对均值、波长和小波包相对能量特征,构成特征序列用于CI-HMM的训练和分类。选取2008年BCI竞赛Datasets 1的两类运动想象数据进行分类实验,结果表明,该方法有效提高了隐马尔科夫模型方法对运动想象脑电信号分类的性能。%In the applications of hidden Markov model( HMM) in motor imagery electroencephalogram( EEG) classi-fication,the independence assumption of HMM is inconsistent with the inherent correlation of EEG signals. In order to resolve the problem,an EEG classification method based on Choquet fuzzy integral HMM( CI-HMM) is proposed. The independence assumption of HMM is relaxed by substituting the monotonicity of fuzzy integrals for the additivity of probability measures. Each signal was segmented using overlapping sliding window. Then from each segment,the absolute mean,wavelength and wavelet packet based relative energy features were extracted to constitute observation sequence for the CI-HMM training and classification. The BCI Competition 2008 Datasets 1 with two classes of motor imagery were selected for classification experiments. The experimental results show that this method can effectively improve the performance of the HMM method used in motor imagery EEG classification.

  1. Dzieło sztuki na granicy przeszłości i przyszłości. Historia i patriotyzm w sztuce nieprofesjonalnej

    Directory of Open Access Journals (Sweden)

    Aleksandra Weronika Jarysz

    2016-01-01

    Full Text Available A work of art – a link between the present and the past. History and patriotism in non-professional art In her article, the author discusses art of non-professional artists who shape the national identity in an original way. In the former professional art, the works which illustrated and uplifted history were very popular. This phenomenon is still present among folk, naive, intuitive artists, generally speaking – non-professionals. The work of their hands and imagination is a tool serving the purpose of national values and ideas, and is sometimes the basis for broader considerations on the human condition. They balance between historical facts and ahistorical generalities. The martyrdom of the Polish nation with emphasis on the events of WWII has been inspiring artists, stimulating their imagination and artistic creation. Therefore numerous ‘monuments of patriotic art’ can be found in the wood sculpture, ceramics, painting, and glass painting works from the art collection of the Toruń Maria Znamierowska-Prüfferowa Ethnographic Museum.   Dzieło sztuki na granicy przeszłości i przyszłości. Historia i patriotyzm w sztuce nieprofesjonalnej W swoim artykule autorka prezentuje sztukę twórców nieprofesjonalnych, którzy w sposób oryginalny kształtują tożsamość narodową. W dawnej sztuce profesjonalnej dzieła, które ilustrowały i uwznioślały historię były bardzo popularne. To zjawisko jest nadal aktualne wśród twórców ludowych, naiwnych, intuicyjnych, ogólnie nazywając – nieprofesjonalnych. Dzieło ich rąk i wyobraźni jest narzędziem w służbie wartości i idei narodowych, a niekiedy stanowi podstawę do szerszych rozważań nad kondycją człowieka. Balansują oni między konkretem historycznym a ahistoryczną ogólnością. Martyrologia narodu polskiego z naciskiem na wydarzenia II wojny światowej inspirowała i inspiruje twórców, pobudza ich wyobraźnię i zmusza do twórczej kreacji. Stąd też zar

  2. Development and Analysis of Original UNIFAC-CI and Modified UNIFAC-CI Models for Prediction of VLE and SLE Systems

    DEFF Research Database (Denmark)

    Mustaffa, Azizul Azri; Kontogeorgis, Georgios; Kang, Jeong Won

    parameter table due to lack of data. Alternative to performing measurements, values of the missing GIPs, can be predicted through the GCPlus approach. The predicted values for the GIPs are then used in the UNIFAC model to calculate activity coefficients. In this work, the model parametersfor using...... properties, the molecular interactions with the molecular structures. One established GC method is the UNIFAC model to predict liquid phase activity coefficients. The needed values of the group interaction parameters (GIPs) are obtained by fitting phase equilibrium data. There are many gaps in the UNIFAC...... obtained for each dataset indicate the quality of each datasets and can then be used as weighting factors, in the objective function for the parameter regression with VLE data (and with SLE data). The performance of the CI-models using parameters regressed against VLE data and simultaneously against VLE...

  3. Projeto Caminhão da Ciência: Popularização da Ciência no Oeste da Bahia

    Directory of Open Access Journals (Sweden)

    E. C. V. de Magalhães

    2014-11-01

    Full Text Available O Projeto Caminhão da Ciência tem por objetivo promover a divulgação científica em Escolas e espaços públicos da Região Oeste da Bahia. O projeto teve início no ano de 2009, com apoio do CNPq, ocorrendo a sua primeira apresentação no ano de 2010, na feira libre de Barreiras. Várias áreas do conhecimento são contempladas entre eles: Biologia, Física, Química, Matemática, Geologia e Engenharias. O projeto se fundamenta por apresentações de temáticas desenvolvidas por alunos de graduação, sob a orientação de professores da Universidade Federal do Oeste da Bahia-UFOB, envolvidos no projeto. Diversas temáticas são desenvolvidas na forma trabalhos interdisciplinares entre eles: elaboração de maquetes, experimentos com uso de materiais alternativos, vídeos, jogos e ainda informativos em websites e webblogs. Para as apresentações do projeto, são realizadas visitas nas escolas ou outros espaçoes e os materiais trasportados no Caminhão são montados no espaço físico disponibilizado, criando um cenário similar ao de uma feira de ciências. Neste trabalho são apresentados relatos de apresentações realizadas em Escolas, enfatizando os resultados obtidos que demonstram a socialização do conhecimento científico entre os monitores e a comunidade assistida, além da interação entre a Universidade e a sociedade.

  4. Estimation of CI-based soil compaction status from soil apparent electrical conductivity

    Science.gov (United States)

    Regionalization of soil properties is very important for successful site-specific field management. Soil compaction is a critical issue to be detected and managed due to its effects on crop growth. Soil compaction has been conventionally quantified as cone index (CI) measured by an ASABE-standard co...

  5. Age scope of high-risk population for esophageal cancer in Ci county

    Institute of Scientific and Technical Information of China (English)

    Zhi-Feng Chen; Jun Hou; Zhen-Wei Ding; Cui-Lan Guo; Cui-Yun Qiao; Guo-Hui Song; Shao-Sen Li; Jian-Hui Zhang; Yu-Tong He

    2005-01-01

    AIM: To define the age scope of high-risk population for esophageal cancer (EC) in Ci county.METHODS: The results of endoscopic examination of 2013 subjects, cytological screening of 16 763 persons and records of 9 265 patients with EC were analyzed by Ridit methods, the standard age group was 45-49 year group.RESULTS: The average age of patients with moderate esophageal epithelium dysplasia by endoscopic examination was 53.5 years, of severe esophageal epithelium dysplasia,51.4 years, early EC, 55.6 years. The average age of stage one severe epithelium dysplasia (SEEDI) by cytological screening was 51.2 years, of stage two severe epithelium esophageal dysplasia (SEED Ⅱ) 51.6 years, of advanced EC 61.7 years. In the group of 40-year olds,the value of Ridit by pathological diagnosis was 0.46, 95%CI, 0.45-0.47, that by cytological diagnosis was 0.45, 95%CI, 0.43-0.47. As the age increased at five-year intervals,the value of Ridit increased significantly.CONCLUSION: In Ci county of a high incidence area of EC, the age definition of high-risk population should be above 45 years.

  6. As diferentes faces da razão (II. Risco, ciência e peritos

    Directory of Open Access Journals (Sweden)

    C. M. Novais Madureira

    2012-10-01

    Full Text Available Em texto anterior argumentou-se contra os excessos do cientismo com que, na linha de Sokal e Bricmont, António Manuel Baptista ataca as análises sociológicas dos processos e produtos da ciência, nomeadamente as posições de Boaventura de Sousa Santos. Neste outro texto, pretende-se contestar AMB e os sokalistas no seu próprio campo, o da ciência pura e dura, mostrando que eles próprios não compreendem o estatuto das suas ciências, e tentando ponderar afirmações menos precisas, frequentes na análise da sociogénese da ciência. Trazendo a discussão para o nosso tempo, abordaremos também uma problemática não tratada no texto anterior, a do estatuto dos cientistas e tecnólogos enquanto peritos nas instâncias de decisão. Por último, tratará de analisar-se como as controvérsias entre peritos, hoje tão frequentes, são vividas no seio da comunidade científica e qual a evolução que geram na própria prática pericial.

  7. AEROBIC AND ANAEROBIC TREATMENT OF C.I. DISPERSE BLUE 79 - VOLUME II, APPENDICES

    Science.gov (United States)

    This study was conducted to determine the fate of C.I. Disperse Blue 79, one of the largest production volume dyes, and select biodegradation products in a conventionally operated activated sludge process and an anaerobic sludge digestion system. To achieve this objective, a pilo...

  8. AEROBIC AND ANAEROBIC TREATMENT OF C.I. DISPERSE BLUE 79 - VOLUME I

    Science.gov (United States)

    This study was conducted to determine the fate of C.I. Disperse Blue 79, one of the largest production volume dyes, and select biodegradation products in a conventionally operated activated sludge process and an anaerobic sludge digestion system. To achieve this objective, a pilo...

  9. The Size, Scale, and Structure Concept Inventory (S3CI) for Astronomy

    Science.gov (United States)

    Gingrich, E. C.; Ladd, E. F.; Nottis, K. E. K.; Udomprasert, P.; Goodman, A. A.

    2015-11-01

    We present a concept inventory to evaluate student understanding of size, scale, and structure concepts in the astronomical context. Students harbor misconceptions regarding these concepts, and these misconceptions often persist even after instruction. Evaluation of these concepts prior to as well as after instruction can ensure misconceptions are addressed. Currently, no concept inventories focus exclusively on these geometrical ideas, so we have developed the Size, Scale and Structure Concept Inventory (S3CI). In fall 2013, we piloted a 24-item version of the S3CI in an introductory astronomy course at a small private university. We performed an item analysis and estimated the internal consistency reliability for the instrument. Based on these analyses, problematic questions were revised for a second version. We discuss the results from the pilot phase and preview our updated test in this work. A valid and reliable concept inventory has the potential to accurately evaluate undergraduates' understanding of size, scale, and structure concepts in the astronomical context, as well as assess conceptual change after targeted instruction. Lessons learned in the evaluation of the initial version of the S3CI can guide future development of this and other astronomical concept inventories. Instructors interested in participating in the ongoing development of the S3CI should contact the authors.

  10. Molecular analysis of the replication origin of the Lactococcus lactis plasmid pCI305

    NARCIS (Netherlands)

    Foley, S; Bron, S; Venema, G; Daly, C; Fitzgerald, GF

    1996-01-01

    The replication origin region, ori, of the Lactococcus lactis subsp. lactis plasmid pCI305 contains three-and-one-half directly repeated 22-bp sequences and two inverted repeat sequences, IR1 and IR2. These inverted repeat sequences overlap the promoter of the repB gene, which encodes a protein (Rep

  11. Configuration interaction in the second quantization representation: basics with applications up to full CI

    Directory of Open Access Journals (Sweden)

    Yuriy Kruglyak

    2014-11-01

    Full Text Available Mathematical formalism of the second quantization is applied to the configuration interaction (CI method in quantum chemistry. Application of the Wick’s theorems for calculation of the matrix elements over configurations leads to a simple logical scheme which is valid for configurations of an arbitrary complexity and can be easily programmed.

  12. Human apolipoprotein C-I expression in mice impairs learning and memory functions

    NARCIS (Netherlands)

    Abildayeva, K.; Berbée, J.F.P.; Blokland, A.; Jansen, P.J.; Hoek, F.J.; Meijer, O.; Lütjohann, D.; Gautier, T.; Pillot, T.; Vente, J.de; Havekes, L.M.; Ramaekers, F.C.S.; Kuipers, F.; Rensen, P.C.N.; Mulder, M.

    2008-01-01

    The H2 allele of APOC1, giving rise to increased gene expression of apolipoprotein C-I (apoC-I), is in genetic disequilibrium with the APOE4 allele and may provide a major risk factor for Alzheimer's disease (AD). We found that apoC-I protein is present in astrocytes and endothelial cells within hip

  13. Towards a European research agenda for CIIP: Results from the CI ² RCO project

    NARCIS (Netherlands)

    Bendisch, U.; Bologna, S.; Le Grand, G.; Luiijf, H.A.M.

    2008-01-01

    This paper discusses the European Research Agenda for Critical In formation Infrastructure Protection (CIIP) which has been developed by the EU IST CI 2RCO project. The Agenda identifies research challenges and analyses existing R&D gaps in CIIP. It integrates the insights and ideas of a

  14. Cuatro Ciénegas, a Desert Oasis with Active Stromatolites: An Astrobiological Project

    Science.gov (United States)

    Souza, V.; Breitbart, M.; Hollander, D.; Elser, J.; Meadows, V.; Siefert, J.

    2010-04-01

    Cuatro Ciénegas Bolson is a desert valley, ringed by mountains, fed by a deep underground aquifer. The resultant pozas support active stromatolitic growth. We report on the field site as a proxy for earlier earth dominated microbial systems.

  15. Zebrafish CiA interneurons are late-born primary neurons.

    Science.gov (United States)

    Yeo, Sang-Yeob

    2009-12-11

    Pax2 is a neural-related transcription factor downstream of Notch signaling and is expressed in the developing spinal cord of zebrafish, including in CiA interneurons. However, the characteristics of pax2-positive neurons are largely unknown. The goal of this study was to characterize Pax2-positive neurons by examining their expression in embryos in which Notch function had been knocked down by mutation or injection of a morpholino or mRNA. I found that Pax2-positive CiA interneurons were late-differentiating primary neurons. pax2.1 was expressed in CoPA commissural neurons and CiA interneurons at 26 hpf. The number of pax2.1-positive cells increased in mind bomb mutant embryos or embryos injected with Su(H)1-MO, but not in cells injected with Xenopus Delta or Delta(stu) mRNA. These observations imply that Notch signaling plays a role in regulating the number of CiA neurons by preventing uncommitted precursors from acquiring a neuronal fate during vertebrate development.

  16. Curr\\'iculo interdisciplinar para licenciatura em ci\\^encias da natureza

    CERN Document Server

    Santos, Carlos Alberto dos

    2014-01-01

    Descreve-se neste trabalho uma proposta de curr\\'iculo interdisciplinar para a forma\\c{c}\\~ao de professores de ci\\^encias da natureza. O curso permite a obten\\c{c}\\~ao de quatro diplomas: professor de ci\\^encias para o ensino fundamental (nomenclatura brasileira), professor de biologia, f\\'isica e qu\\'imica para o ensino m\\'edio. O diploma de professor de ci\\^encias \\'e obtido com a integraliza\\c{c}\\~ao de cr\\'editos oferecidos ao longo dos tr\\^es primeiros anos do curso. Para cada ano subsequente \\'e poss\\'ivel obter os diplomas de professor do ensino m\\'edio. Os componentes curriculares pertinentes \\`as ci\\^encias da natureza s\\~ao inteiramente interdisciplinares nos tr\\^es primeiros anos. No quarto ano s\\~ao oferecidas disciplinas espec\\'ificas de biologia, f\\'isica e qu\\'imica, para a respectiva forma\\c{c}\\~ao de professor do ensino m\\'edio. An interdisciplinary curriculum for science teaching undergraduate course will be described. The curriculum allows four degrees according the Brazilian educational l...

  17. Collaborative efforts for managing Melaleuca in the Ciénega de Zapata, Cuba

    Science.gov (United States)

    The Ciénega de Zapata Biosphere Reserve is the largest protected area not only in Cuba but also throughout the Caribbean. This swamp ecosystem is characterized by a high biodiversity that comprises several endemic birds, reptiles and invertebrates and is visited by 65 species of birds during their a...

  18. Magnetite in CI carbonaceous meteorites - Origin by aqueous activity on a planetesimal surface

    Science.gov (United States)

    Kerridge, J. F.; Mackay, A. L.; Boynton, W. V.

    1979-01-01

    The composition and morphology of magnetite in CI carbonaceous meteorites appear incompatible with a nebular origin. Mineralization on the meteorite parent body is a more plausible mode of formation. The iodine-xenon age of this material therefore dates an episode of secondary mineralization on a planetesimal rather than the epoch of condensation in the primitive solar nebula.

  19. Ocena Nośności Konstrukcji Nawierzchni Lotniskowych Metodą Acn-Pcn

    Directory of Open Access Journals (Sweden)

    Wesołowski Mariusz

    2014-12-01

    Full Text Available Konstrukcje nawierzchni lotniskowych są projektowane na określony okres eksploatacji przy założeniu prognozowanego natężenia i struktury ruchu lotniczego. Bezpieczeństwo wykonywania operacji lotniczych przez statki powietrzne na nawierzchniach lotniskowych zależy przede wszystkim od stanu nośności ich konstrukcji. W związku z tym, kontrolne badania nośności należy przeprowadzać okresowo, gdyż informacja o aktualnym stanie eksploatacyjnym nawierzchni lotniskowej stanowi podstawę do podejmowania decyzji o rodzajach statków powietrznych dopuszczonych do ruchu, intensywności ruchu lotniczego oraz terminach rozpoczęcia prac remontowych lub modernizacyjnych. Aktualnie do oceny nośności nawierzchni lotniskowych stosuje się metodę ACN-PCN, która została wprowadzona przez Organizację Międzynarodowego Lotnictwa Cywilnego ICAO (International Civil Aviation Organization. W artykule przedstawiony został sposób wyznaczania i opisu wskaźnika PCN

  20. CCI and CI Join Hands:A Better Supply Chain with More Innovations on Cotton Fabrics

    Institute of Scientific and Technical Information of China (English)

    Tom; Xue

    2010-01-01

    Cotton Council International("CCI")and Cotton Incorporated("CI") joined forces again,from October 19-22,2010 at Intertextile Shanghai,to promote natural fiber-U.S.cotton.As global textile strategic partners,both organizations were bringing together alliances through the cotton

  1. Human apolipoprotein C-I expression in mice impairs learning and memory functions

    NARCIS (Netherlands)

    Abildayeva, Karlygash; Berbee, Jimmy F. P.; Blokland, Arjan; Jansen, Paula J.; Hoek, Frans J.; Meijer, Onno; Luetjohann, Dieter; Gautier, Thomas; Pillot, Thierry; De Vente, Jan; Havekes, Louis M.; Ramaekers, Frans C. S.; Kuipers, Folkert; Rensen, Patrick C. N.; Mulder, Monique

    2008-01-01

    The H2 allele of APOC I, giving rise to increased gene expression of apolipoprotein C-I (apoC-I), is in genetic disequilibrium with the APOE4 allele and may provide a major risk factor for Alzheimer's disease (AD). We found that apoC-I protein is present in astrocytes and endothelial cells within hi

  2. School performance and wellbeing of children with CI in different communicative-educational environments

    NARCIS (Netherlands)

    Langereis, M.C.; Vermeulen, A.M.

    2015-01-01

    OBJECTIVES: This study aimed to evaluate the long term effects of CI on auditory, language, educational and social-emotional development of deaf children in different educational-communicative settings. METHODS: The outcomes of 58 children with profound hearing loss and normal non-verbal cognition,

  3. School performance and wellbeing of children with CI in different communicative-educational environments

    NARCIS (Netherlands)

    Langereis, M.C.; Vermeulen, A.M.

    2015-01-01

    OBJECTIVES: This study aimed to evaluate the long term effects of CI on auditory, language, educational and social-emotional development of deaf children in different educational-communicative settings. METHODS: The outcomes of 58 children with profound hearing loss and normal non-verbal cognition,

  4. IRSAC Rep. du Congo ceux-ci nous ne citons que quelques-ons ...

    African Journals Online (AJOL)

    "1.l .. • foT "-. (. J. Ifr :: :; ....:"- /l. ,Ci::\\ :v. SCUTISOREi ..... 'rJ8:~ ii'". EfT ... 't k;. II. II. •. _ ... ZA It. R ep rod u ced b y Sa b in et G a tew a. y u n d er licen ce gra n ted b.

  5. THE TREE SHREW APOLIPOPROTEIN C-I cDNA: SEQUENCE AND ITS EXPRESSION

    Institute of Scientific and Technical Information of China (English)

    王克勤; 吕新跃; 吴钢; 薛红; 陈保生

    2001-01-01

    A rabbit anti-serum to tree shrew apolipoprotein C-I (apo C-l) was used to screen an expression cDNA li-braDy constructed by us from tree shrew (TS) liver tissue. Two apo C-I cDNA clones were obtained. The longerone consists of 380 nucleotides, including 21 bp and 95 bp at the 5' and 3' end of the non-translated region srespectively, and a 2 64-bp fragment in an open reading frame encoding 88 amino acids prepropeptide which con-ta-ins 26 amino acids of signal peptide and a mature protein (62 amino acids). Comparing the amino-acid se-quence deduced from this cDNA with those of the published mammalian apo C-Is reveals that it shared some struc-tural similarity with zat, mouse and dog apo C-l, but it had 5 more amino acids than that of human and baboon.The expression of apo C-I mRNA in 8 different tissues were also assayed with Northern blot. The results demonstrat-ed that liver had the highest expression, intestine had much less expression and no expression in other tissues,which is much different from human and other species. This study has laid down a good foundation for further study-ing on the function and the stucture of tree shrew apo C-I gene.``

  6. Ciênsação: Gaining a Feeling for Sciences

    Science.gov (United States)

    de Oliveira, Marcos Henrique Abreu; Fischer, Robert

    2017-01-01

    Ciênsação, an open online repository for hands-on experiments, has been developed to convince teachers in Latin America that science is best experienced first hand. Permitting students to experiment autonomously in small groups can be a challenging endeavour for educators in these countries. We analyse the reasons that cause hesitation of teachers…

  7. Ciências da Religião numa sociedade multicultural

    Directory of Open Access Journals (Sweden)

    Wolfgang Gruen

    2009-05-01

    Full Text Available Texto originalmente apresentado como aula inaugural do Programa de Pós-graduação em Ciências da Religião da PUC Minas. Trata da epistemologia e dos desafios da investigação em Ciências da Religião. Partindo do problema de base da religiosidade na Educação, do fenômeno religioso e sua dimensão profunda, o artigo segue uma densa investigação sobre os limites e horizontes das Ciências da Religião.Palavras-chave: Ciências da Religião; Religião; Religiosidade; Educação; Ensino religioso.ABSTRACTThis text was originally presented as the opening class of the Postgraduate Programme in Sciences of Religion of PUC Minas. It concerns the epistemology and challenges of investigation in Sciences of Religion. Starting from the fundamental question of religiosity in Education, of the religious phenomenon and its deep dimension, the article embarks on a close investigation into the limits and horizons of the Sciences of Religion.Key words: Sciences of religions; Religion; Religiosity; Education; Religious teaching.

  8. Observational Approach to Molecular Cloud Evolutation with the Submillimeter-Wave CI Lines

    Science.gov (United States)

    Oka, T.; Yamamoto, S.

    Neutral carbon atoms (CI) play important roles both in chemistry and cooling processes of interstellar molecular clouds. It is thus crucial to explore its large area distribution to obtain information on formation processes and thermal balance of molecular clouds. However, observations of the submillimeter-wave CI lines have been limited to small areas around some representative objects. We have constructed a 1.2 m submillimeter-wave telescope at the summit of Mt.Fuji. The telescope was designed for the exclusive use of surveying molecular clouds in two submillimeter-wave CI lines, 3 P1 -3 P0 (492GHz) and 3 P2 -3 P1 (809 GHz), of atomic carbon. A superconductor-insulator-superconductor (SIS) mixer receiver was equipped on the Nasmyth focus of the telescope. The receiver noise temperatures [Trx(DSB)] are 300 K and 1000 K for the 492 GHz and the 809 GHz mixers, respectively. The intermediate frequency is centered at 2 GHz, having a 700 MHz bandwidth. An acousto-optical spectrometer (AOS) with 1024 channel outputs is used as a receiver backend. The telescope was installed at Nishi-yasugawara (alt. 3725 m), which is 200 m north of the highest peak, Kengamine (3776 m), in July 1998. It has b en operatede successfully during 4 observing seasons in a remote way from the Hongo campus of the University of Tokyo. We have already observed more than 40 square degrees of the sky with the CI 492 GHz line. The distribution of CI emission is found to be different from those of the 13 CO or C1 8 O emission in some clouds. These differences are discussed in relation to formation processes of molecular clouds.

  9. Observational Approach to Molecular Cloud Evolution with the Submillimeter CI Lines

    Science.gov (United States)

    Oka, T.; Yamamoto, S.; Mt. Fuji Submillimeter-Wave Telescope Group

    Neutral carbon atoms (CI) play important role both in chemistry and cooling processes of interstellar molecular clouds. It is thus crucial to explore its large area distribution to investigate formation processes and thermal balance of molecular clouds. We have constructed a 1.2 m submillimeter-wave telescope at the summit of Mt.Fuji. The telescope was designed for the exclusive use of surveying molecular clouds in two submillimeter CI lines, 3P1--3P0 (492 GHz) and 3P2--3P1 (809 GHz), of atomic carbon. It has been operated successfully during 4 observing seasons since July 1998 in a remote way from the Hongo campus of the University of Tokyo. We have already revealed large-scale CI 492 GHz distributions of many giant molecular clouds, including Orion MC, Taurus MC, DR15, DR21, NGC2264, M17, W3, W44, W51, Rosette MC, covering more than 40 square degrees of the sky. The distribution of CI 492 GHz emission is found to be different from those of the 13CO or C18O emission in some clouds. We found the spatial order of C+/CO/C from UV sources. This is the general property of the cloud illuminated by intense UV radiation, whereas it is apparently inconsistent with the standard photodissociation region (PDR) picture. We also found CI-rich areas (C/CO˜1) in several dark clouds without strong UV sources. These results are discussed in relation to formation processes of molecular clouds and dense cloud cores.

  10. A dádiva como princípio organizador da ciência

    Directory of Open Access Journals (Sweden)

    Marcos Barbosa De Oliveira

    2014-12-01

    Full Text Available Este artigo é fruto do trabalho num projeto de pesquisa mais amplo cujo tema são os processos de mercantilização pelos quais a ciência vem passando nas últimas décadas. A parte do projeto em que o artigo se insere diz respeito aos processos de empresariamento da ciência, que envolvem como componente principal a introdução de métodos quantitativos produtivistas de avaliação do trabalho científico. O objetivo do artigo é complementar a crítica a tais formas de avaliação com a sugestão de formas alternativas, inspiradas na concepção, devida a W. Hagstrom, da dádiva como o princípio organizador da ciência. A exposição divide-se em cinco seções: a primeira trata da dádiva em geral ou, em outras palavras, da dádiva como princípio organizador da sociedade; a segunda, da dádiva como princípio organizador da ciência; na terceira expõe-se um argumento a favor da concepção dadivosa, baseado em seu poder explicativo; na quarta, considerações sobre a proliferação de fraudes na ciência; e na quinta, um esquema conceitual como fundamento da transição do quantitativo para o qualitativo na avaliação acadêmica. A conclusão consiste em algumas considerações gerais, propostas como balizas para o movimento em prol de formas mais sensatas de organização das práticas científicas.

  11. Das ciências sociais para as ciências sociais em saúde: a produção científica de pós-graduação em ciências sociais

    Directory of Open Access Journals (Sweden)

    Marsiglia Regina Maria Giffoni

    2003-01-01

    Full Text Available Este artigo apresenta algumas características da produção intelectual desenvolvida em disciplinas de pós-graduação das ciências sociais e humanas tendo como objeto a saúde, durante os anos 90 e nos anos de 2000 e 2001 em São Paulo. Partimos da identificação desses trabalhos nas bibliotecas da Universidade de São Paulo, Universidade Estadual de Campinas, Pontifícia Universidade Católica de São Paulo e Escola de Administração de Empresas da Fundação Getúlio Vargas de São Paulo. As 258 dissertações de mestrado e teses de doutorado encontradas foram classificadas de acordo com: instituição de ensino, ano de conclusão, nível de pós-graduação, disciplinas, temáticas abordadas e orientadores. Os professores que orientaram o maior número desses trabalhos foram entrevistados com o intuito de conhecermos suas experiências e reflexões sobre a inserção da saúde como objeto de investigação nos programas de pós-graduação das disciplinas de antropologia, sociologia, política, geografia, história, administração, direito, economia, educação, psicologia social e serviço social.

  12. Reconnaissance isotopic and hydrochemical study of Cuatro Ciénegas groundwater, Coahuila, México

    Science.gov (United States)

    Johannesson, Karen H.; Cortés, Alejandra; Kilroy, Kathryn C.

    2004-10-01

    The springs of the Cuatro Ciénegas bolson (Four Marshes basin), Coahuila, México, support more than 70 endemic species of biota. The specifics of the groundwater flow regime, however, remain a mystery. Water samples were collected from a series of springs and pools and one canal in the Cuatro Ciénegas bolson and analyzed for field parameters (temperature, pH, conductivity, alkalinity) and stable oxygen and hydrogen isotopes in an attempt to begin a systematic study of the hydrogeology of the region. Groundwaters discharging directly along a fault-controlled spring line in Cretaceous carbonate rocks of the Cupido-Aurora aquifer are the most dilute (lowest conductivities) and warmest of those sampled. Cuatro Ciénegas waters are characterized by circumneutral pH (6.9-7.7) and reasonably low alkalinity (160-215 mg/kg as HCO 3). The δ18O values of Cuatro Ciénegas waters range from -8.2 to -5.7‰, with a mean of -6.5±0.82‰, whereas δD ranges from -52 to -43‰, with a mean of -46.6±3.2‰. The majority of the water samples plot subparallel and beneath the local meteoric water line; those samples collected farthest from the spring line exhibit the most enriched δ18O and δD values. The stable isotope data indicate that isotopic enrichment of groundwaters by evaporation following discharge and subsequent surface flow is an important process within the Cuatro Ciénegas bolson. The isotope data also suggest that a fraction of Cuatro Ciénegas groundwater originates with local recharge in mountains surrounding the bolson. Those springs that issue from the western base of the Sierra de San Marcos mountain range are recharged in part in these mountains, whereas groundwaters discharging from Laguna Anteojo in the northern part of the bolson are more likely recharged in the higher San de la Madera mountain range. An estimate of the water balance suggests that interbasin flow also may contribute to the considerable groundwater discharge.

  13. Fossils of Cyanobacteria in CI1 Carbonaceous Meteorites: Implications to Life on Comets, Europa and Enceladus

    Science.gov (United States)

    Hoover, Richard B.

    2011-10-01

    Environmental (ESEM) and Field Emission Scanning Electron Microscopy (FESEM) investigations of the internal surfaces of the CI1 Carbonaceous Meteorites have yielded images of large complex filaments. The filaments have been observed to be embedded in freshly fractured internal surfaces of the stones. They exhibit recognizable features (e.g., the size and size ranges of the internal cells and their location and arrangement within sheaths) that are diagnostic of known genera and species of filamentous trichomic cyanobacteria and other trichomic prokaryotes (such as filamentous sulfur bacteria). ESEM and FESEM studies of living and fossil cyanobacteria show features similar to the filaments found in the meteorites -- uniseriate and multiseriate, branched or unbranched, isodiametric or tapered, polarized or unpolarized filaments with trichomes encased within thin or thick external sheaths. Some of the filaments found in the CI1 meteorites also exhibit specialized cells and structures used by cyanobacteria for reproduction (baeocytes, akinetes and hormogonia), nitrogen fixation (basal, intercalary or apical heterocysts), attachment (pili or fimbriae) or indicative of oscillatoria type locomotion (escaped or coiling hormogonia and flattened and coiled empty sheaths). Energy dispersive X-ray Spectroscopy (EDS) studies indicate that the Orgueil meteorite filaments are typically carbon-rich sheaths infilled with magnesium sulfate and other minerals characteristic of the CI1 carbonaceous meteorites. However, the size, structure, detailed morphological characteristics and chemical compositions of the meteorite filaments are not consistent with known species of abiotic minerals. The nitrogen content of the meteorite filaments are almost always below the detection limit of the EDS detector. EDS analysis of living and dead biological materials (e.g., filamentous cyanobacteria; bacteria, mummy and mammoth hair and tissues, and fossils of cyanobacteria, trilobites and insects in

  14. Entre "artes" e "ciências": a noção de performance e drama no campo das ciências socias

    Directory of Open Access Journals (Sweden)

    Rubens Alves da Silva

    2005-12-01

    Full Text Available Propõe-se neste artigo desenvolver uma reflexão teórica que está relacionada com as preocupações e propostas da área de estudos antropológicos das formas expressivas, focalizando, centralmente, a noção de performance e drama no campo das ciências sociais. Nesse sentido é que se busca, no momento, dialogar com os autores considerados representantes principais da discussão teórica em torno da noção de performance, drama e ritual no campo antropológico: Victor Turner, Clifford Geertz, Michael Taussig, Richard Schechner, John Dawsey - entre outros.This article attempts to develop a theoretical reflection on the aims and proposals in the area of the anthropological studies about the expressive forms, dealing with the concept of performance and drama in the social sciences. Taking this into consideration, this work intends to discuss the ideas of the most important authors in the theoretical debate concerning the concept of performance, drama and ritual in the anthropological field: Victor Turner, Clifford Geertz, Michael Taussig, Richard Schechner, John Dawsey - and others.

  15. Vespeiros da razão: perspectivas para um diálogo entre as ciências biológicas e as ciências sociais

    Directory of Open Access Journals (Sweden)

    Ricardo Waizbort

    2008-01-01

    Full Text Available Desde pelo menos A origem das espécies, de Darwin, publicado em 1859, cientistas naturais e cientistas sociais têm discutido a possibilidade de unificar as ciências biológicas e as humanas. O presente artigo tem como objetivo trazer à luz algumas dessas tentativas de considerar a importância das bases biológicas para compreender e explicar certos aspectos do comportamento humano. Embora esse seja um tema um tanto conturbado, sobretudo quando visto de um ponto de vista político, nas últimas décadas foram desenvolvidos modelos testáveis que indicam que os sistemas genéticos dos seres humanos são necessários, mas não suficientes, para equacionarmos certos conflitos de interesse que surgem nas mais variadas formas de interação social.Ever since Darwin published The origin of species, in 1859, natural and social scientists have been arguing about the possibility of constructing a bridge between biological and social sciences. The aim of this article is to shed light on some of these approaches in order to comprehend and explain some aspects of human behavior. Although such an issue is very controversial, mainly in a political perspective, in recent decades scientists have developed assayable models demonstrating the necessity of genetic systems, to equate certain interest conflicts that appear in variable forms of social interactions.

  16. Pareto, Mosca e a metodologia de uma nova ciência política

    OpenAIRE

    Bianchi,Alvaro

    2016-01-01

    O artigo investiga os debates metodológicos existentes no processo de institucionalização a ciência política italiana, no final do século XIX e início do XX. Gaetano Mosca e Vilfredo Pareto almejavam um conhecimento científico da política que fosse construído de acordo com parâmetros inspirados nas ciências naturais. Mosca advogou fortemente em favor de um método histórico que permitiria encontrar nas instituições as forças psicológicas que garantiriam a regularidade dos fenômenos políticos. ...

  17. The origin of the eccentricity of the hot Jupiter in CI Tau

    CERN Document Server

    Rosotti, Giovanni P; Clarke, Cathie J; Teyssandier, Jean; Facchini, Stefano; Mustill, Alexander J

    2016-01-01

    Following the recent discovery of the first radial velocity planet in a star still possessing a protoplanetary disc (CI Tau), we examine the origin of the planet's eccentricity (e $\\sim 0.3$). We show through long timescale ($10^5$ orbits) simulations that the planetary eccentricity can be pumped by the disc, even when its local surface density is well below the threshold previously derived from short timescale integrations. We show that the disc may be able to excite the planet's orbital eccentricity in $<$ a Myr for the system parameters of CI Tau. We also perform two planet scattering experiments and show that alternatively the observed planet may plausibly have acquired its eccentricity through dynamical scattering of a migrating lower mass planet, which has either been ejected from the system or swallowed by the central star. In the latter case the present location and eccentricity of the observed planet can be recovered if it was previously stalled within the disc's magnetospheric cavity.

  18. Debra-mediated Ci degradation controls tissue homeostasis in Drosophila adult midgut.

    Science.gov (United States)

    Li, Zhouhua; Guo, Yueqin; Han, Lili; Zhang, Yan; Shi, Lai; Huang, Xudong; Lin, Xinhua

    2014-02-11

    Adult tissue homeostasis is maintained by resident stem cells and their progeny. However, the underlying mechanisms that control tissue homeostasis are not fully understood. Here, we demonstrate that Debra-mediated Ci degradation is important for intestinal stem cell (ISC) proliferation in Drosophila adult midgut. Debra inhibition leads to increased ISC activity and tissue homeostasis loss, phenocopying defects observed in aging flies. These defects can be suppressed by depleting Ci, suggesting that increased Hedgehog (Hh) signaling contributes to ISC proliferation and tissue homeostasis loss. Consistently, Hh signaling activation causes the same defects, whereas depletion of Hh signaling suppresses these defects. Furthermore, the Hh ligand from multiple sources is involved in ISC proliferation and tissue homeostasis. Finally, we show that the JNK pathway acts downstream of Hh signaling to regulate ISC proliferation. Together, our results provide insights into the mechanisms of stem cell proliferation and tissue homeostasis control.

  19. Österreichische Literatur in der Zeitschrift Wiadomości Literackie in der Zwischenkriegszeit

    Directory of Open Access Journals (Sweden)

    Hurnikowa Elżbieta

    2016-06-01

    Full Text Available The article is devoted to reception of Austrian literature before the Second World War in Wiadomości Literackie (Literary News. It was the most popular letter, whose aim was to educate society, and popularize foreign literature and culture. The literature that was most often promoted was French literature, but also German-speaking authors (cited in the article were discussed. Austrian literature was not treated as distinct from German literature during that time but nontheless, the articles presents artists, of Austrian origin: Joseph Roth, Stefan Zweig, Rainer Maria Rilke, Hugo von Hofmannsthal, Arthur Schnitzler, Odon von Horváth, Franz Werfel and others. The article examines interviews with these writers as well as reviews their books and other texts which appeared in Wiadomości Literackie.

  20. A Ciência da Lógica: Uma leitura Estrutural

    Directory of Open Access Journals (Sweden)

    Marco Aurélio de Medeiros Jordão

    2017-02-01

    Full Text Available O presente artigo tem como objetivo fazer uma análise introdutória da obra Ciência da Lógica de Hegel. Pretendemos prosseguir com uma leitura mais estrutural do texto, analisando os argumentos e expondo a sua tecedura. Portanto, não problematizaremos o texto de Hegel a partir de outros autores ou tentaremos atualizar seu pensamento, nos prenderemos ao texto e a ele nos remeteremos. Para tal propósito nos debruçaremos na introdução da Ciência da Lógica, de tradução do professor Marco Aurélio Werle

  1. Ci4SeR--curation interface for semantic resources--evaluation with adverse drug reactions.

    Science.gov (United States)

    Souvignet, Julien; Asfari, Hadyl; Declerck, Gunnar; Lardon, Jérémy; Trombert-Paviot, Béatrice; Jaulent, Marie-Christine; Bousquet, Cédric

    2014-01-01

    Evaluation and validation have become a crucial problem for the development of semantic resources. We developed Ci4SeR, a Graphical User Interface to optimize the curation work (not taking into account structural aspects), suitable for any type of resource with lightweight description logic. We tested it on OntoADR, an ontology of adverse drug reactions. A single curator has reviewed 326 terms (1020 axioms) in an estimated time of 120 hours (2.71 concepts and 8.5 axioms reviewed per hour) and added 1874 new axioms (15.6 axioms per hour). Compared with previous manual endeavours, the interface allows increasing the speed-rate of reviewed concepts by 68% and axiom addition by 486%. A wider use of Ci4SeR would help semantic resources curation and improve completeness of knowledge modelling.

  2. Visualization and prediction of porosity in roller compacted ribbonswith near infrared chemical imaging (NIR-CI)

    DEFF Research Database (Denmark)

    Khorasani, Milad Rouhi; Amigo Rubio, Jose Manuel; Sonnergaard, Jørn

    2015-01-01

    The porosity of roller compacted ribbon is recognized as an important critical quality attribute which has a huge impact on the final product quality. The purpose of this study was to investigate the use of near-infrared chemical imaging (NIR-CI) for porosity estimation of ribbons produced...... at different roll pressures. Two off-line methods were utilized as reference methods. The relatively fast method (oil absorption) was comparable with the more time-consuming mercury intrusion method (R2 = 0.98). Therefore, the oil method was selected as the reference off line method. It was confirmed by both...... reference methods that ribbons compressed at a higher pressure resulted in a lower mean porosity. Using NIR-CI in combination with multivariate data analysis it was possible to visualize and predict the porosity distribution of the ribbons. This approach is considered important for process monitoring...

  3. Entre a Filosofia e a Ciência: Merleau-Ponty e a Psicologia

    Directory of Open Access Journals (Sweden)

    Danilo Saretta Verissimo

    2007-12-01

    Full Text Available Merleau-Ponty abordou um problema da tradição filosófica que se agudizou após o desenvolvimento das ciências humanas: a discordância entre a visão que o homem pode ter de si mesmo pela reflexão ou consciência e aquela que se obtém relacionando suas condutas às condições externas das quais elas dependem. Merleau-Ponty procurou resolver essa discordância à luz das próprias experiências das ciências, particularmente, da psicologia. Segundo ele, essas experiências demandam uma revisão da ontologia moderna. Neste contexto, no presente artigo, abordamos algumas facetas do diálogo estabelecido por Merleau-Ponty com a psicologia. Apresentamos uma leitura de questões tratadas, sobretudo em seus trabalhos iniciais.

  4. Propozycja systemowej analizy wydajnościi dochodowości pracy w rolnictwie

    Directory of Open Access Journals (Sweden)

    Zbigniew Gołaś

    2010-10-01

    Full Text Available W artykule przedstawiono propozycję systemowej analizy wydajności i dochodowo-ści pracy w rolnictwie na podstawie obowiązującego w UE znormalizowanego spra-wozdania finansowego, tzw. Rachunku Ekonomicznego dla Rolnictwa. Zapropono-wana procedura stanowi spójną i logiczną koncepcję przyczynowo-skutkowego po-wiązania czynników determinujących wydajność pracy i dochody przedsiębiorców rolnych. Zaletami skonstruowanego systemu wskaźników jest spójny i wszech-stronny obraz powiązań tych czynników oraz możliwość zmierzenia ich wpływu na wydajność pracy i poziom dochodów rolniczych za pomocą metod ilościowych.

  5. Popper, o historicismo, e o mÃtodo das ciÃncias sociais

    OpenAIRE

    Paulo Alberto Viana da Costa

    2011-01-01

    A partir da crÃtica do historicismo e do holismo, busca apresentar o mÃtodo das ciÃncias sociais como proposto por Karl Popper. ApÃs uma breve exposiÃÃo do mÃtodo das ciÃncias naturais e discussÃo sobre alguns de seus componentes, a saber os conceitos de mÃtodo dedutivo, falseabilidade, e corroboraÃÃo, o historicismo à definido e criticado. Por meio do uso de certos exemplos baseados na fÃsica do sÃculo XX, mostra como à possÃvel refutar o historicismo por provar que uma teoria em prima facie...

  6. Pesquisas com os cotidianos: devir-filosofia e devir-arte na ciência

    OpenAIRE

    Soares,Maria da Conceição Silva

    2013-01-01

    Com este texto, proponho que a tendência em pesquisas que vêm se afirmando no Brasil como pesquisas nos/dos/com os cotidianos configura o atravessamento do devir-filosofia e do devir-arte na ciência da Educação. Com esse propósito, traço um caminho de pensamento que consiste em uma articulação entre ideias defendidas por Deleuze e Guattari sobre filosofia, ciência e arte e os pressupostos epistemológicos, teóricos e metodológicos defendidos por pesquisadores que se filiam a essa tendência. Po...

  7. A PO-CI/MC-CDMA scheme for high modulation styles

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Through analyzing the theoretical spreading principle,it has been proved in this paper that the benefit of pseudo-orthogonal carrier interferometry(PO-CI)spreading code is not supported when complex signal modulation(e.g.,quadrature phase-shift keying(QPSK)and quadrature amplitude modulation(QAM))types are employed.On this basis,a novel and feasible structure for this problem is brought forward.Within the structure mentioned,instead of complex modulation patterns,pulse amplitude modulation(PAM)combined with PO-CI spreading code is utilized.This allows us to maintain the throughput increase of a multi-carrier code division multiple access(MC-CDMA)system with minimal loss in performance and no bandwidth expansion.

  8. Ciênsação: gaining a feeling for sciences

    Science.gov (United States)

    Abreu de Oliveira, Marcos Henrique; Fischer, Robert

    2017-03-01

    Ciênsação, an open online repository for hands-on experiments, has been developed to convince teachers in Latin America that science is best experienced first hand. Permitting students to experiment autonomously in small groups can be a challenging endeavour for educators in these countries. We analyse the reasons that cause hesitation of teachers appling hands-on experiments in class, and discuss how Ciênsação was implemented to overcome these obstacles. The resulting student research activities are specifically designed to be easily integrated in formal science education at school, to foster research skills and, most importantly, to let young people get to know science as an engaging creative activity.

  9. A História das Ciências e seus públicos

    OpenAIRE

    2015-01-01

    Neste artigo, apresento alguns tópicos que a historiografia das ciências tem debatido nos últimos 30 anos. Circunscrevo-me a um conjunto de problemas relacionados à revisão das representações clássicas da ciência e de sua relação com outras esferas da atividade humana, como a filosofia, a religião, a política e a economia nos distintos processos de modernização social e na formação do mundo contemporâneo. Destaco, em especial, o problema da periodização, e de que forma a recente redefinição d...

  10. Sr isotopes in the Orgueil CI meteorite: Chronology of early solar system hydrothermal activity

    Indian Academy of Sciences (India)

    J D Macdougall

    2000-03-01

    New Sr isotopic analyses and calculated formation ages of carbonates from the Orgueil CI meteorite are reported. Among the samples analyzed in this work, dolomites give the youngest formation ages and may have been deposited intermittently starting near the time of parent body formation and continuing for at least 30 Ma. The Sr isotope data also suggest that breunnerites (Fe-Mn-Mg carbonates) crystallized after dolomite formation. Leaching experiments on bulk meteorite samples provide evidence for a very mobile, water soluble Sr reservoir in Orgueil that is characterized by extremely radiogenic Sr (87Sr/86Sr ≈ 0.81- 0.82). This unsupported Sr reflects recent element redistribution, possibly at the time of parent body breakup recorded by the ∼10 Ma exposure age of Orgueil. The carbonate data in particular corroborate earlier indications that hydrothermal processes were among the earliest events to affect the CI parent body.

  11. A moderna ciência da riqueza e o neopatrimonialismo contábil

    OpenAIRE

    Lopes de Sá, Antônio

    2003-01-01

    Se brindan algunos conocimientos científicos de la contabilidad, a través de una nueva doctrina, del neopatrimonialismo contable, que ofrece una metodología que amplía las teorías tradicionales y aporta innovaciones, sin abandonar las conquistas realizadas por otras escuelas de pensamientos. Fil: Lopes de Sá, Antônio. Universidade do Brasil. Faculdade Nacional de Ciências Econômicas. Rio de Janeiro. Brasil

  12. PERFEKCJONIZM JAKO DĄŻENIE DO DOSKONAŁOŚCI: DEFINICJE, TYPOLOGIE, MODELE

    Directory of Open Access Journals (Sweden)

    Olena Loza

    2015-03-01

    Full Text Available Artykuł zawiera analizę pojęcia „perfekcjonizm” jako właściwości psychicznej. Rozpatrzono definicje per- fekcjonizmu, wskazano na jego związki z osobowością, przedstawiono odpowiednie modele: Frost, Marten, Lahart i Rosenblate (1990, Hewitt i Flett (1991, Slaney, Mobley, Tripp i Ashby (2001, Garanian (Гаранян 2009. Na podstawie tej analizy zaproponowano autorski model perfekcjonizmu.

  13. History of Met Lab Section C-I, May 1943 to April 1944

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1978-05-01

    This is part of a history of the research work of Seaborg and associates in the University of Chicago Metallurgical Laboratory, Chemistry Section C-I. The work was concerned with the development of chemical procedures for the extraction of plutonium, for the purification of plutonium, and for research on the isotopes of other heavy elements including other transuranium elements. The style of the history is that of a diary with footnotes giving additional information. (DLC)

  14. CI therapy is beneficial to patients which chronic low-functioning hemiparesis after stroke

    Directory of Open Access Journals (Sweden)

    Annette eSterr

    2014-10-01

    Full Text Available CI therapy is effective in patients with relatively good levels of residual arm function but its applicability to patients with low functioning hemiparesis is not entirely clear. In the present study we examined the feasibility and efficacy of the CI therapy concept in patients with very limited upper arm function prior to treatment, and further tested how the length of daily shaping training and constraining the good arm affects treatment outcome. In a baseline-controlled design, 65 chronic patients were treated with 2 weeks of modified CI therapy. Patients were randomly allocated to four treatment groups receiving 90 or 180 minutes of daily shaping training applied with or without constraint respectively. Outcome was measured through the Reliable Change Index, which was calculated for parameters of motor function, health and psychological wellbeing. Follow-up data were collected at 6 and 12 months. Two analyses were conducted, a whole-group analysis across all 65 participants and a subgroup analysis contrasting the four treatment variants.The whole-group analysis showed a significant treatment effect, which was largely sustained after one year. The subgroup analysis revealed a mixed picture: while improvements against the baseline period were observed in all four subgroups, 180 minutes of daily shaping training coupled with the constraint yielded better outcome on the MAL but not the WMFT, while for 90 minutes of training the level of improvement was similar for those who wore the constraint and those who did not. Together these results suggest that, at least in those patients available for follow up measures, modified CI therapy induces sustained improvements in motor function in patients with chronic low-functioning hemiparesis. The absence of clear differences between the four treatment variants points to a complex relationship between the length of daily shaping training and the constraint in this patient group which is likely to be

  15. Solvent effects on photodegradation of CI Reactive Orange 16 by simulated solar light

    OpenAIRE

    Mijin Dušan Ž.; Zlatić Dragana Z.; Ušćumlić Gordana S.; Jovančić Petar M.

    2008-01-01

    Organic solvents may appear in wastewaters and other industrial waste streams containing dyes, therefore, their photodegradation catalyzed by TiO2 should be investigated. Solvent effect on photodegradation of CI Reactive Orange 16 has been studied using simulated solar light and P-25 TiO2. Methyl, ethyl and isopropyl alcohol as well as acetone were used as solvents. Photodegradation reaction was faster in methyl than in ethyl alcohol while in water was the slowest. RO16 photodegradation effic...

  16. New records of bee flies (Diptera, Bombyliidae) from Cuatro Ciénegas, Coahuila, Mexico.

    Science.gov (United States)

    Avalos-Hernández, Omar; Kits, Joel; Trujano-Ortega, Marysol; García-Vázquez, Uri Omar; Cano-Santana, Zenón

    2014-01-01

    Forty one new records of species of Bombyliidae are reported for Coahuila in northeastern Mexico. Nine of these species are reported for the first time for the country. The specimens were collected in the Cuatro Ciénegas Basin and Sierra La Madera mountains during 2007-2013. The modified distributions of species are discussed. The gaps in the distribution of many species suggest an undersampling of this group of insects in the north of Mexico.

  17. Doutrinas, escolas novas razões de entendimentos na Ciência Contábil

    Directory of Open Access Journals (Sweden)

    Antonio Lopes de Sá

    2005-03-01

    Full Text Available Longo foi o curso do pensamento de intelectuais para conduzir a Contabilidade a uma condição superior do conhecimento humano. Hoje, como ciência, rica em doutrinas, segue o saber contábil o seu destino, valorizado pelos esforços de grandes escolas do pensamento científico, dentre as quais se destaca o Neopatrimonialismo.

  18. Experimental evaluation of C.I. engine performance using diesel blended with Jatropha biodiesel

    Directory of Open Access Journals (Sweden)

    Sunil Kumar, Alok Chaube, Shashi Kumar Jain

    2012-01-01

    Full Text Available Costlier and depleting fossil fuels are prompting researchers to use edible as well as non-edible vegetable oils as promising alternative to petro-diesel. The higher viscosity of vegetable oils leads to problem in pumping, atomization and spray characteristics. The improper mixing of vegetable oils with air leads to incomplete combustion. The best way to use vegetable oils as fuel in compression ignition (CI engines is to convert it into biodiesel. Biodiesel is a methyl or ethyl ester of fatty acids made from vegetable oils (both edible and non-edible and animal fat. The main feedstock for biodiesel production can be non-edible oil obtained from Jatropha curcas plant. Jatropha curcas plant can be cultivated on different terrains in India under extreme climatic conditions. Biodiesel can be used in its pure form or as a blend with petro-diesel in different proportions. It is being used in CI engines because it has properties similar to petro-diesel. The aim of this paper is to analyze suitability of petro-diesel blended with biodiesel in varying proportions in CI engines. For this purpose, a stationary single-cylinder four-stroke CI engine was tested with diesel blended with Jatropha biodiesel in 0%, 5%, 20%, 50%, 80% and 100%. Comparative measures of specific fuel consumption (SFC, brake thermal efficiency, smoke opacity, HC, CO2, CO, O2, NOX have been presented and discussed. Engine performance in terms of comparable brake thermal efficiency and SFC with lower emissions (HC, CO2, CO was observed with B20 fuel compared to petro-diesel. Volumetric efficiency showed almost no variation for all the blends. Important observations related to noise and vibrations during testing have also been discussed.

  19. Klozapina: między skutecznością a bezpieczeństwem

    Directory of Open Access Journals (Sweden)

    Tomasz Sobów

    2015-07-01

    Full Text Available Klozapina, choć uważana za bardzo skuteczny lek przeciwpsychotyczny, jest stosowana rzadziej, niż wynikałoby z przesłanek klinicznych wspierających jej stosowanie. Co najmniej 1/3 chorych ze schizofrenią spełnia kliniczne kryteria lekooporności, charakteryzuje się wysokim ryzykiem samobójstwa lub reaguje nasilonymi objawami pozapiramidowymi na inne leki przeciwpsychotyczne. Możliwym powodem relatywnie rzadkiego sięgania po klozapinę w praktyce klinicznej jest postrzeganie leku jako obarczonego poważnymi objawami niepożądanymi. Agranulocytoza i inne dyskrazje krwi są dobrze znane, a zasady prewencji – uporządkowane zaleceniami. O innych objawach niepożądanych, również tych potencjalnie niebezpiecznych (kardiomiopatia, zapalenia mięśnia sercowego, niedrożność jelit czy drgawki wiadomo mniej. Ryzyko wystąpienia groźnych powikłań kuracji klozapiną można jednak zminimalizować, a same powikłania – wykrywać i leczyć, pod warunkiem zachowania czujności diagnostycznej. Świadomość ryzyka i korzyści związanych ze stosowaniem klozapiny to warunek konieczny skutecznego i bezpiecznego użycia tego leku oraz pełnego wykorzystania jego niezwykłych właściwości.

  20. Time course of auditory streaming: Do CI users differ from normal-hearing listeners?

    Directory of Open Access Journals (Sweden)

    Martin eBöckmann-Barthel

    2014-07-01

    Full Text Available In a complex acoustical environment with multiple sound sources the auditory system uses streaming as a tool to organize the incoming sounds in one or more streams depending on the stimulus parameters. Streaming is commonly studied by alternating sequences of signals. These are often tones with different frequencies. The present study investigates stream segregation in cochlear implant (CI users, where hearing is restored by electrical stimulation of the auditory nerve. CI users listened to 30-s long sequences of alternating A and B harmonic complexes at four different fundamental frequency separations, ranging from 2 to 14 semitones. They had to indicate as promptly as possible after sequence onset, if they perceived one stream or two streams and, in addition, any changes of the percept throughout the rest of the sequence. The conventional view is that the initial percept is always that of a single stream which may after some time change to a percept of two streams. This general build-up hypothesis has recently been challenged on the basis of a new analysis of data of normal-hearing listeners which showed a build-up response only for an intermediate frequency separation. Using the same experimental paradigm and analysis, the present study found that the results of CI users agree with those of the normal-hearing listeners: (i the probability of the first decision to be a one-stream percept decreased and that of a two-stream percept increased as Δf increased, and (ii a build-up was only found for 6 semitones. Only the time elapsed before the listeners made their first decision of the percept was prolonged as compared to normal-hearing listeners. The similarity in the data of the CI user and the normal-hearing listeners indicates that the quality of stream formation is similar in these groups of listeners.

  1. Emission Characteristics of a CI Engine Running with a Range of Biodiesel Feedstocks

    Directory of Open Access Journals (Sweden)

    Belachew Tesfa

    2014-01-01

    Full Text Available Currently, alternative fuels are being investigated in detail for application in compression ignition (CI engines resulting in exciting potential opportunities to increase energy security and reduce gas emissions. Biodiesel is one of the alternative fuels which is renewable and environmentally friendly and can be used in diesel engines with little or no modifications. The objective of this study is to investigate the effects of biodiesel types and biodiesel fraction on the emission characteristics of a CI engine. The experimental work was carried out on a four-cylinder, four-stroke, direct injection (DI and turbocharged diesel engine by using biodiesel made from waste oil, rapeseed oil, corn oil and comparing them to normal diesel. The fuels used in the analyses are B10, B20, B50, B100 and neat diesel. The engine was operated over a range of engine speeds. Based on the measured parameters, detailed analyses were carried out on major regulated emissions such as NOx, CO, CO2, and THC. It has been seen that the biodiesel types (sources do not result in any significant differences in emissions. The results also clearly indicate that the engine running with biodiesel and blends have higher NOx emission by up to 20%. However, the emissions of the CI engine running on neat biodiesel (B100 were reduced by up to 15%, 40% and 30% for CO, CO2 and THC emissions respectively, as compared to diesel fuel at various operating conditions.

  2. Trajetórias de mulheres na ciência: "ser cientista" e "ser mulher"

    Directory of Open Access Journals (Sweden)

    Fabiane Ferreira da Silva

    2014-04-01

    Full Text Available O artigo aborda a trajetória acadêmica e profissional de mulheres na ciência. A produção de entrevistas com mulheres cientistas atuantes em universidades públicas e numa instituição de pesquisa do Rio Grande do Sul constitui o corpus de análise deste estudo. Na análise, chamamos a atenção para o poder que atravessa as relações sociais constituindo identidades e diferenças que geram preconceitos de gênero. Nas narrativas, emergiu a negação do preconceito, o reconhecimento de "brincadeiras" sexistas que não são percebidas como preconceito, e situações explícitas de preconceito de gênero. Outro aspecto evidenciado refere-se à necessidade de conciliar a profissão com as responsabilidades familiares, que implicou jornadas parciais de trabalho, o adiamento ou recusa da maternidade. No artigo, argumentamos que a trajetória das entrevistadas na ciência foi e é construída em um ambiente baseado em valores e padrões masculinos, que restringem, dificultam e direcionam a participação das mulheres na ciência.

  3. A ciência da vulnerabilidade: modelos, métodos e indicadores

    Directory of Open Access Journals (Sweden)

    Susan L. Cutter

    2012-10-01

    Full Text Available A ciência da vulnerabilidade consiste na integração multidisciplinar das ciências sociais, das ciências naturais e da engenharia na compreensão das circunstâncias que colocam as populações e os locais em risco devido aos perigos, e dos factores que aumentam ou reduzem a capacidade de resposta e de recuperação das populações, dos sistemas físicos ou das infraestruturas em relação a ameaças ambientais. A integração das diversas perspectivas requer análises baseadas nos locais com recurso a ferramentas e tecnologias geoespaciais. Este artigo descreve os instrumentos e os métodos para medir e cartografar a exposição ao risco (chamada vulnerabilidade física, a medição e a cartografia da propensão das populações para os riscos (designada vulnerabilidade social e a intersecção dos dois para criar as análises baseadas nos locais. A intersecção da vulnerabilidade física e da vulnerabilidade social cria a paisagem dos riscos (hazardscape que, por sua vez, ajuda os investigadores a compreender os impactos diferenciados dos riscos e dos desastres nos locais e nos respectivos habitantes.

  4. Charles Sanders Peirce: ciência enquanto semiótica

    Directory of Open Access Journals (Sweden)

    Lauro Frederico Barbosa da Silveira

    1989-01-01

    Full Text Available O diagrama do signo, quando aplicado no entendimento da ciência, dá lugar a uma correlação original entre abdução, dedução e indução. A união da abdução e da dedução consiste numa Forma geral de possibilidade lógica. Enquanto que a indução estabelece, no decorrer da experiência, a razão de freqüência no universo dos fatos das conseqüências previstas na representação geral. Como uma construção formal, a ciência enquanto semiótica sustenta-se, mesmo tendo por objeto um universo do puro acaso. Todavia, no interior do conjunto total do sistema filosófico de Peirce, a ciência só adquire significado se corresponder à realidade da Natureza. A garantia desta correspondência estatisticamente relevante seria o fato de o instinto humano pertencer ao mesmo estágio de evolução do universo todo.

  5. Identification of Apolipoprotein C-I as a Potential Wilms’ Tumor Marker after Excluding Inflammatory Factors

    Directory of Open Access Journals (Sweden)

    Junjie Zhang

    2014-09-01

    Full Text Available Wilms’ tumor is one of the most common malignant tumors observed in children, and its early diagnosis is important for late-stage treatment and prognosis. We previously screened and identified protein markers for Wilms’ tumor; however, these markers lacked specificity, and some were associated with inflammation. In the current study, serum samples from children with Wilms’ tumors were compared with those of healthy controls and patients with systemic inflammatory response syndrome (SIRS. After exclusion of factors associated with inflammation, specific protein markers for Wilms’ tumors were identified. After comparing the protein peak values obtained from all three groups, a protein with a m/z of 6438 Da was specified. Purification and identification of the target protein using high-pressure liquid chromatography (HPLC and two-dimensional liquid chromatography-linearion trap mass spectrometry(2D-LC-LTQ-MS mass spectrometry, respectively, revealed that it was apolipoprotein C-I (APO C-I. Thus, APO C-I is a specific protein marker for Wilms’ tumor.

  6. Indicadores da participação feminina em Ciência e Tecnologia

    Directory of Open Access Journals (Sweden)

    Maria Cristina Piumbato Innocentini Hayashi

    Full Text Available Este trabalho tem por objetivo analisar a questão do gênero no setor de ciência e tecnologia nacional e examinar a situação das docentes que pertencem à comunidade científica da Universidade Federal de São Carlos (UFSCar. O estudo baseou-se em teorias sobre as questões do gênero na ciência e da participação feminina. Para a coleta de dados, utilizou-se o Diretório de Grupos de Pesquisa no Brasil/CNPq. Para aprofundamento da realidade das mulheres na UFSCar, realizou-se um levantamento adicional nos sites da instituição e do Instituto Brasileiro de Informação em Ciência e Tecnologia (IBICT. Conforme revelam os dados do Diretório, em 1995, a participação feminina alcançou 39% dos cientistas e, em 2004, passou para 47%. Na UFSCar, as mulheres representam 39,3% dos docentes, ocupam 1/3 dos postos de comando e entre os discentes superam 55% dos estudantes. Destaca-se que ainda falta um caminho a percorrer para igualarem-se aos pesquisadores nos postos acadêmicos e áreas do conhecimento mais prestigiadas. Utilizar o potencial feminino é estratégico para avançar cientificamente.

  7. Persistência da veia ciática Persistent sciatic vein

    Directory of Open Access Journals (Sweden)

    Bárbara Borges Cardoso

    2010-09-01

    Full Text Available CONTEXTO: Durante um período da vida embrionária, a veia ciática é a principal coletora do membro inferior. Na embriogênese vascular, há diferenciação dos angioblastos em um plexo vascular primitivo, com posterior remodelagem e expansão. Consequentemente, durante esse processo, podem ocorrer anomalias. Quando ocorre persistência da veia ciática, esta pode se comunicar com a veia safena parva ou com a veia poplítea durante seu percurso, anastomosando-se com a veia perfurante superior e com a veia circunflexa medial do fêmur. OBJETIVO: Relatar o caso da persistência bilateral de veia ciática nos membros inferiores, comparando à literatura. MÉTODOS: Foram dissecados 32 membros inferiores de 16 cadáveres formolizados no Laboratório de Anatomia pela Disciplina de Anatomia Topográfica da Faculdade de Medicina da Universidade de Santo Amaro (Unisa, durante 2006 e 2007, observando-se em 2 membros inferiores de um único cadáver, a presença de veia ciática. RESULTADOS: No membro inferior esquerdo de um cadáver que apresentou a anomalia bilateralmente, a veia media 37 cm, tinha origem na região da veia poplítea, acompanhava o nervo ciático, perfurava o músculo adutor magno e desembocava na veia femoral profunda. No membro inferior direito, ela media 36 cm, originava-se recebendo as veias do compartimento tibial anterior, acompanhava o nervo ciático, perfurava o músculo adutor magno e desembocava na veia ilíaca interna. CONCLUSÃO: As variações anatômicas do sistema venoso do membro inferior são as mais prevalentes. A persistência da veia ciática pode causar insuficiência venosa crônica no membro inferior e, dessa forma, deve ser investigada para uma melhor conduta clínica ou cirúrgica.BACKGROUND: During a period of the embryonic life, the sciatic vein is the main lower limb collector. In vascular embryogenesis, there is a differentiation of the angioblasts in a primitive vascular plexus, with posterior remodeling

  8. GC-CI-MS-SIM方法诊断新生儿苯丙酮尿症%Newborn Screening of Phenylketonuria by GC-CI-MS-SIM

    Institute of Scientific and Technical Information of China (English)

    邓春晖; 胡耀铭; 胡克季; 张雅芬; 顾学范

    2001-01-01

    The application of MS in newborn screening is one of the most important branches of MS′s current clinical application.In this paper we first reported a new method of newborn screening for Phenylketonuria (PKU) by GC-CI-MS-SIM,which was relatively cheap,fast,sensitive and accurate.In this method Phenylalanine (Phe) and Tyrosine (Tyr) were extracted from dry blood spots with 0.1% mol/L HCl-methanol.The protein in the extraction was gotten rid of by centrifugor.Phe and Tyr were reacted with 3.0 mol/L HCl-butanol,then the products Phe and Tyr butyl esters were reacted with trifluoroacetic anhydride.The final derivations from Phe and Tyr,alanine,3-phenyl-N(trifluoroacetyl)-,butyl este and L-tyrosine,N(trifluoroacetyl)-,butyl ester,trifl were analyzed by GCCI-MS-SIM.The contents of the two amino acids in blood samples were determined by calculating the areas of their final derivations with exterior standard.Finally,the molar ratios of Phe to Tyr in blood sample were calculated as the basis of PKU diagnosis.Because chemical ionization and selective ion measurement were used in this method,the limits of detection for Phe and Tyr were low and the sensitivity was excellent.About 30 blood samples were analyzed by this method,and the results prove that this method could successfully discriminate between normal infants and PKU positive ones.The price of instrument GC-MS is cheaper than that of MS-MS.Therefore it was capable for large-scale screening in developing countries.

  9. A unidade entre o ser e o pensar na Ciência da Lógica

    Directory of Open Access Journals (Sweden)

    Tomás Farcic Menk

    2017-02-01

    Full Text Available Este artigo tem como objetivo analisar uma relação básica sobre a qual a Ciência da Lógica está fundamentada, a saber, a unidade entre o ser e o pensar. Hegel afirma, ainda na introdução a obra, que a filosofia deve ter início sem nenhuma pressuposição prévia e, portanto, partir do puro ser totalmente indeterminado. Porém, sendo a lógica a ciência do pensar sobre o pensar, este ser inicial nada mais é do que a primeira posição do pensar e, assim sendo, este puro ser também é um puro pensar, totalmente indeterminado. Desta forma, se tem uma unidade entre ser e pensar, e esta unidade é que será desenvolvida através dos momentos da Ciência da Lógica. Porém, ela não permanece imutável ou inalterada, como Hegel acusa a antiga metafísica, identificada na figura de Descartes, Leibniz e Wolff. Muito antes, ela é mediatizada pelo entendimento, que separa estas duas instâncias e as relaciona. Ao se relacionarem, elas se descobrem como idênticas e surge novamente uma identidade, mas agora não indiferenciada, mas que se conhece e que se sabe como unidade, pois se elevou da certeza à verdade. Por fim, utilizaremos esta leitura de Hegel para contrapor a interpretação de Pippin, tal como expressa na obra Hegels Idealism.

  10. Experimental and Numerical Investigation of Ethanol/Diethyl Ether Mixtures in a CI Engine

    KAUST Repository

    Sivasankaralingam, Vedharaj

    2016-10-17

    The auto-ignition characteristics of diethyl ether (DEE)/ethanol mixtures are investigated in compression ignition (CI) engines both numerically and experimentally. While DEE has a higher derived cetane number (DCN) of 139, ethanol exhibits poor ignition characteristics with a DCN of 8. DEE was used as an ignition promoter for the operation of ethanol in a CI engine. Mixtures of DEE and ethanol (DE), i.e., DE75 (75% DEE + 25% ethanol), DE50 (50% DEE + 50% ethanol) and DE25 (25% DEE + 75% ethanol), were tested in a CI engine. While DE75 and DE50 auto-ignited at an inlet air pressure of 1.5 bar, DE25 failed to auto-ignite even at boosted pressure of 2 bar. The peak in-cylinder pressure for diesel and DE75 were comparable, while DE50 showed reduced peak in-cylinder pressure with delayed start of combustion (SOC). Numerical simulations were conducted to study the engine combustion characteristics of DE mixture. A comprehensive detailed chemical kinetic model was created to represent the combustion of DE mixtures. The detailed mechanism was then reduced using standard direct relation graph (DRG-X) method and coupled with 3D CFD code, CONVERGE, to simulate the experimental data. The simulation results showed that the effects of physical properties on DE50 combustion are negligible. Simulations of DE50 mixture revealed that the combustion is nearly homogenous, while diesel (n-heptane used as a surrogate) and DE75 showed similar combustion behavior with flame liftoff and diffusion controlled combustion. Diesel exhibited auto-ignition at an equivalence ratio of 2, while DE75 and DE50 showed auto-ignition in the equivalence ratio range of 1-1.5 and 0-1, respectively. The experiments and numerical simulations demonstrate how the high reactivity of DEE supports the auto-ignition of ethanol, while ethanol acts as a radical scavenger.

  11. Spacecraft COst REduction Team (SCORE): TQM/CI on a massive scale

    Science.gov (United States)

    Bullard, Jerry D.

    The business of building satellites and space systems has matured. Few missions require, or can afford, excellent performance at any price. The new paradigm is doing more with less, providing quality systems at lower cost--in other words, doing our job 'Faster-Better-Cheaper.' The TRW Spacecraft COst REduction (SCORE) initiative was launched in 1990 by Daniel S. Goldin, then general manager of TRW's Space & Technology Group. The SCORE mission is to apply continuous improvement (CI) techniques to effect major reductions in the cost (our primary goal) and span time (as a corollary) required for the production of spacecraft. SCORE is a multi-year initiative that is having a profound effect on both the procedural and the cultural aspects of how we do business. The objectives of this initiative are being realized. The focus of this paper is not on the results of SCORE per se, but rather on the things we have leaned about how to do continuous improvement on a massive scale, with multilevel (hierarchical) CI teams. The following sections summarize the chronology of the SCORE initiative, from team formation to development of the year-end report for 1991. Lessons learned, the core of this presentation, are discussed--with particular focus on the unique aspects of SCORE. The SCORE initiative is continuing and, as a part of our evolving culture, will never end. It has resulted in profound insights into the way we do work and (the topic at hand) how to do CI for large and complex multidisciplinary development activities.

  12. Problem wolności w Internecie / The problem of freedom in Internet

    Directory of Open Access Journals (Sweden)

    Iwona Gleisner

    2013-07-01

    Full Text Available Artykuł jest próbą odpowiedzi na pytanie o granice wolności w Internecie. Dyskusje ten temat, toczące się na całym świecie od dawna, nie dały dotąd zadowalającej odpowiedzi. W ostatnich latach przybiera na sile spór pomiędzy zwolennikami pełnej swobody, a stronnikami prawnego ograniczania korzystania z zasobów globalnej sieci. Autorka przytacza argumenty obu stron konfliktu, zwracając uwagę na potrzebę znalezienia równowagi prawnej pomiędzy interesami twórców, a potrzebami odbiorców. Porusza ponadto istotne zagadnienie moralnej odpowiedzialności autorów za zamieszczane w Internecie treści.English abstractThis paper attempts to find an answer to the question about freedom in Internet. This issue has been discussed all over the world for long, however no satisfactory answer has yet been found. Recently, the dispute between the supporters of the full freedom and the ones voting for limiting the resources of the global network with legal means has been becoming more fierce. The author quotes arguments of both parties to the conflict, drawing attention to the need of finding a legal balance between the interests of the artists and the needs of the consumers. She also tackles with an important issue of moral responsibility of the authors for the contents placed in Internet. Normal 0 21 false false false PL X-NONE X-NONE

  13. Używki w ciąży – kofeina = Stimulants in pregnancy – caffeine

    OpenAIRE

    Pawłowska-Muc, Agnieszka Konstancja; Łepecka-Klusek, Celina; Stadnicka, Grażyna; Pilewska-Kozak, Anna Bogusława

    2015-01-01

    Pawłowska-Muc Agnieszka Konstancja, Łepecka-Klusek Celina, Stadnicka Grażyna, Pilewska-Kozak Anna Bogusława. Używki w ciąży – kofeina = Stimulants in pregnancy – caffeine. Journal of Education, Health and Sport. 2015;5(6):395-406. ISSN 2391-8306. DOI 10.5281/zenodo.18817 http://ojs.ukw.edu.pl/index.php/johs/article/view/2015%3B5%286%29%3A395-406 https://pbn.nauka.gov.pl/works/568565 http://dx.doi.org/10.5281/zenodo.18817 Formerly Journal of Health Sciences. ISSN 14...

  14. A ciência nas utopias de Campanella, Bacon, Comenius, e Glanvill

    Directory of Open Access Journals (Sweden)

    Bernardo Jefferson de Oliveira

    2002-12-01

    Full Text Available Este artigo analisa comparativamente o papel que a ciência e a técnica ocupam nas sociedades descritas em A cidade do Sol de Tommasio Campanella, a Nova Atlântida de Francis Bacon, Panorthosia de Jan Amós Comenius e o Complemento à Nova Atlântida de Joseph Glanvill.This article evaluates the role that science and technology plays in the societies described by early modern utopias, making a comparative analysis of Tommasio Campanella's City of Sun, Francis Bacon's New Atlantis, Jan Amós Comenius' Panorthosia, and Joseph Glanvill's The summe of my lord Bacon's New Atlantis.

  15. Ordenação multivariada na ecologia e seu uso em ciências ambientais

    OpenAIRE

    2002-01-01

    Análises multivariadas rotineiras em ecologia podem ser facilmente aplicadas em outras ciências ambientais, oferecendo novas possibilidades de exploração analítica e quantitativa de padrões complexos. Demonstramos isto com um estudo das relações entre variáveis demográficas e de qualidade ambiental nas Bacias dos Rios Piracicaba e Capivari. Vetores demográficos foram identificados com uma análise de coordenadas principais e, em seguida, correlacionados com variáveis de saneamento e de cobertu...

  16. Kriegsbeute-Ausstellung Posen 1917. Propagandowa wystawa dla szerokiej publiczności

    Directory of Open Access Journals (Sweden)

    Jakub Skutecki

    2014-01-01

    Full Text Available W zbiorach ikonograficznych Biblioteki Uniwersyteckiej w Poznaniu znajduje się seria widokówek dokumentujących zorganizowaną w 1917 roku Wystawę Zdobyczy Wojennych (Kriegsbeute-Ausstellung Posen 1917, jedną z serii propagandowych ekspozycji prezentujących sukcesy armii niemieckich na wszystkich frontach wielkiej wojny. W czasie trwania wystawy w pobliżu belgijskiego Passchendaele toczyła się jedna z najkrwawszych bitew, a w Poznaniu – codzienne życie w wojennej rzeczywistości.

  17. A biotechnological project with a gamma radiation source of 100,000 Ci

    Energy Technology Data Exchange (ETDEWEB)

    Lombardo, J.H.; Smolko, E.E. (Comision Nacional de Energia Atomica, Buenos Aires (Argentina))

    1990-01-01

    A project for the production of radiovaccines and other bio-medical products is presented which includes a radiation facility provided with a gamma ray source equivalent to 100,000 Ci of Co-60. The whole process incorporates novel basic features in virus production and inactivation steps. The former is carried out in animals previously subjected to immunodepression through electromagnetic radiation. The latter is obtained at low temperatures by using either electromagnetic or particle radiations. A vaccine manufacture process is shown to illustrate the utilization of ionizing radiations to obtain a foot and mouth disease virus (FMDV) vaccine with good antigenic quality and low cost. (author).

  18. Performance of 20 Ci 137Cs -ray Compton spectrometer for the study of momentum densities

    Indian Academy of Sciences (India)

    B L Ahuja; M Sharma

    2005-07-01

    In this paper, we present the design and construction of a 20 Ci -ray Compton spectrometer that employs a 137Cs source with a strong line at 661.65 keV. The total resolution of the spectrometer in momentum scale is 0.40 a.u., which is much better than the conventional 241Am Compton spectrometers. The in-house 137Cs spectrometer is very useful for the measurement of momentum densities of heavy materials. The performance of the machine is assessed using aluminum, terbium and mercury samples and the experimental data from comparable apparatus.

  19. "Objetos intangíveis" : Ufologia, ciência e segredo

    OpenAIRE

    Almeida, Rafael Antunes

    2016-01-01

    A presente tese consiste em um estudo etnográfico junto a um coletivo de ufólogos brasileiros. A etnografia acompanha os seus processos de construção de conhecimento, as relações destes pesquisadores com os seres extraterrestres e a luta pela desclassificação de documentos em posse do Estado. Os eixos mais significativos deste trabalho são a descrição dos processos de conhecimento forjados em relação a uma imagem particular de Ciência, a temática do segredo e o problema da desinformação. Argu...

  20. Georges Canguilhem: combates pela história das ciências

    OpenAIRE

    Tiago Santos Almeida

    2016-01-01

    Propomos uma investigação simultaneamente histórica e epistemológica dos trabalhos de Georges Canguilhem, buscando alargar e aprofundar nossa compreensão dos critérios que determinam tanto a escolha dos objetos, quanto os métodos de investigação e regras para a escrita da história das ciências. Essa investigação é reforçada por uma reconstrução dos debates intelectuais nos quais Canguilhem esteve envolvido ao longo da sua carreira acadêmica, debates que conduziram a verdadeiras reviravoltas n...

  1. Kobieta zakodowana. Przedsiębiorczości kobiet a nowe technologie

    OpenAIRE

    Niedzielska, Ewelina

    2015-01-01

    W obecnych warunkach intensywnego rozwoju nowoczesnych technologii funkcjonowanie przedsiębiorstw zyskało nowe cechy i możliwości. Technologie obliczeniowe i elektronicznej wymiany informacji wielorako wpływają na sposoby działania firm. Z jednej strony stanowią narzędzia pomocne do usprawniania pracy przedsiębiorstw, z drugiej zaś mogą być podstawą do tworzenia nowych przedsięwzięć biznesowych. Wnioski zawarte w monografii ukazują konieczność pogłębiania wiedzy na temat zastosowania ...

  2. A ciência nas utopias de Campanella, Bacon, Comenius, e Glanvill

    OpenAIRE

    2002-01-01

    Este artigo analisa comparativamente o papel que a ciência e a técnica ocupam nas sociedades descritas em A cidade do Sol de Tommasio Campanella, a Nova Atlântida de Francis Bacon, Panorthosia de Jan Amós Comenius e o Complemento à Nova Atlântida de Joseph Glanvill.This article evaluates the role that science and technology plays in the societies described by early modern utopias, making a comparative analysis of Tommasio Campanella's City of Sun, Francis Bacon's New Atlantis, Jan Amós Comeni...

  3. Numerical investigation on the effects of EGR on CI engine characteristics using soyabean biodiesel

    Science.gov (United States)

    Datta, Ambarish; Mandal, Bijan Kumar

    2016-07-01

    In this work an attempt has been made to numerically investigate the effect of soyabean biodiesels on an unmodified CI engine and then to study and reduce the NOx emission by the introduction of exhaust gas recirculation (EGR) technique at the rates of 10% and 20%. Compared to no EGR condition for the neat biodiesel, the NOx emission is reduced by 44% and 70% with 10% and 20% EGR respectively. But the increase in the EGR rate deteriorates the engine performance and increases the emissions, other than NOx. Thus, EGR helps in reducing NOx emission but its rate of introduction has to be bounded by a limit.

  4. Late-onset-Hörstörungen bei CI-Kindern

    OpenAIRE

    Nickisch, A.; Horn, U; Massinger, C

    2010-01-01

    Hintergrund: Nach jüngsten Mitteilungen des Deutschen Zentralregisters für kindliche Hörstörungen konnte durch das Neugeborenen-Hörscreening das mittlere Erfassungsalter permanenter frühkindlicher Hörstörungen erfreulicherweise in das erste Lebenshalbjahr verschoben werden. Wie hoch der Anteil von late-onset-Hörstörungen ist, ist derzeit jedoch unklar.Material und Methoden: Aus der Datei der von uns betreuten CI-Kinder wurden retrospektiv diejenigen ausgewählt, bei denen ein Neugeborenenhör...

  5. Filosofia da ciência como ferramenta microeconômica

    OpenAIRE

    Fabio Barbieri

    2006-01-01

    A teoria neoclássica pressupõe conhecimento perfeito. A crítica hayekiana a essa teoria, por sua vez, afirma que esse conhecimento é resultado do processo competitivo e, portanto, não pode ser considerado como dado. O “Problema de Hayek” investiga sob que condições o conhecimento do agente se aproxima dos reais fundamentos de uma economia. A fim de solucionar o “Problema de Hayek”, o nosso artigo utiliza algumas idéias da literatura de metodologia da Ciência, conhecida como teoria do “crescim...

  6. Filosofia da ciência como ferramenta microeconômica

    OpenAIRE

    Fabio Barbieri

    2006-01-01

    A teoria neoclássica pressupõe conhecimento perfeito. A crítica hayekiana a essa teoria, por sua vez, afirma que esse conhecimento é resultado do processo competitivo e, portanto, não pode ser considerado como dado. O “Problema de Hayek” investiga sob que condições o conhecimento do agente se aproxima dos reais fundamentos de uma economia. A fim de solucionar o “Problema de Hayek”, o nosso artigo utiliza algumas idéias da literatura de metodologia da Ciência, conhecida como teoria do “crescim...

  7. Microfossils of filamentous prokaryotes in CI1 and CM2 meteorites

    Science.gov (United States)

    Hoover, Richard B.

    2008-08-01

    Field Emission Scanning Electron Microscopy (FESEM) studies of recently obtained samples of Orgueil, Ivuna and Murchison meteorites have provided further evidence for the existence of indigenous filamentous microfossils embedded in the mineral matrix of CI1 and CM2 carbonaceous meteorites. Energy Dispersive X-ray Spectroscopy (EDS) spot data and 2-D elemental X-ray maps establish that the nitrogen and sulphur content of the forms found in the meteorites are dramatically different from modern prokaryotic and eukaryotic cells. These results are interpreted as providing additional evidence for the existence of a complex suite of indigenous microfossils in carbonaceous meteorites.

  8. Assessing precision, bias and sigma-metrics of 53 measurands of the Alinity ci system.

    Science.gov (United States)

    Westgard, Sten; Petrides, Victoria; Schneider, Sharon; Berman, Marvin; Herzogenrath, Jörg; Orzechowski, Anthony

    2017-09-14

    Assay performance is dependent on the accuracy and precision of a given method. These attributes can be combined into an analytical Sigma-metric, providing a simple value for laboratorians to use in evaluating a test method's capability to meet its analytical quality requirements. Sigma-metrics were determined for 37 clinical chemistry assays, 13 immunoassays, and 3 ICT methods on the Alinity ci system. Analytical Performance Specifications were defined for the assays, following a rationale of using CLIA goals first, then Ricos Desirable goals when CLIA did not regulate the method, and then other sources if the Ricos Desirable goal was unrealistic. A precision study was conducted at Abbott on each assay using the Alinity ci system following the CLSI EP05-A2 protocol. Bias was estimated following the CLSI EP09-A3 protocol using samples with concentrations spanning the assay's measuring interval tested in duplicate on the Alinity ci system and ARCHITECT c8000 and i2000SR systems, where testing was also performed at Abbott. Using the regression model, the %bias was estimated at an important medical decisions point. Then the Sigma-metric was estimated for each assay and was plotted on a method decision chart. The Sigma-metric was calculated using the equation: Sigma-metric=(%TEa-|%bias|)/%CV. The Sigma-metrics and Normalized Method Decision charts demonstrate that a majority of the Alinity assays perform at least at five Sigma or higher, at or near critical medical decision levels. More than 90% of the assays performed at Five and Six Sigma. None performed below Three Sigma. Sigma-metrics plotted on Normalized Method Decision charts provide useful evaluations of performance. The majority of Alinity ci system assays had sigma values >5 and thus laboratories can expect excellent or world class performance. Laboratorians can use these tools as aids in choosing high-quality products, further contributing to the delivery of excellent quality healthcare for patients

  9. Oxidative Dehydrogenation of Ethane to Ethylene over LiCI/MnOx/PC Catalysts

    Institute of Scientific and Technical Information of China (English)

    葛庆杰; 李文钊; 于春英; 徐恒泳

    2001-01-01

    The caalytic stability of LiCl/MnOx/PC catalyst have been investigated, the deactivation mechanism was discussed. Tne experimental results show that ethane conversion decreases and etihylene selectivotu keeps about 90% as reaction time increases. The main deactivation reasons LiCI/MnOx/PCcatalyst for oxidative dehydrogenation of ethane (ODHE) to ethylene are the transiton of active species Mn2O3 TO MnOspecies and the loss of active component Cl in catalyst. Instead of ethane with FCC tailed-gas, the stability of LiCl/MnOx/PC catalyst has been largely improved.

  10. 40 CFR 721.9662 - Thieno[3,4-b]-1,4-dioxin, 2,3-dihydro- (9CI).

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Thieno -1,4-dioxin, 2,3-dihydro- (9CI... Substances § 721.9662 Thieno -1,4-dioxin, 2,3-dihydro- (9CI). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as thieno -1,4-dioxin, 2,3-dihydro- (9CI) (PMN...

  11. Wykorzystanie informacji prospektywnychw sprawozdawczości finansowej zorientowanejna wartość na przykładzie MSR 36„Utrata wartości aktywów”

    Directory of Open Access Journals (Sweden)

    Irena Sobańska

    2009-12-01

    Full Text Available Autorzy artykułu wskazują na istotę i rosnące znaczenie informacji prospektywnych we współczesnych systemach sprawozdawczości finansowej opartej na MSSF. Ewolucja dokonująca się w sprawozdawczości finansowej, pod wpływem harmonizacji zasad rachunkowości wskutek ciągle zmieniających się MSSF, została przedstawiona na tle zmian dokonujących się w otoczeniu, w celach i w systemach zarządzania (orientacja strategiczna, wartość przedsiębiorstwa, jak również w systemach strategicznej rachunkowości zarządczej. Na podstawie szerokiego kontekstu analizy autorzy stawiają wniosek, że koncepcja wartości (przedsiębiorstwa stanowi istotny element systemu pomiaru i wyceny w systemie sprawozdawczości finansowej. Tworzy ona także spójną podstawę dla integracji rachunkowości zarządczej i rachunkowości finansowej w jeden system zapewniający użyteczne informacje zarówno dla użytkowników zewnętrznych, jak i wewnętrznych, których łączy wspólny cel – maksymalizacja wartości. Uwarunkowania tworzenia systemu sprawozdawczości opartego na informacjach prospektywnych, zorientowanego na wartość, jak również stopień dostosowania przedsiębiorstw do jego wdrożenia pokazano na przykładzie praktycznej realizacji postanowień MSR 36.

  12. The origin of the eccentricity of the hot Jupiter in CI Tau

    Science.gov (United States)

    Rosotti, G. P.; Booth, R. A.; Clarke, C. J.; Teyssandier, J.; Facchini, S.; Mustill, A. J.

    2017-01-01

    Following the recent discovery of the first radial velocity planet in a star still possessing a protoplanetary disc (CI Tau), we examine the origin of the planet's eccentricity (e ˜0.3). We show through long time-scale (105 orbits) simulations that the planetary eccentricity can be pumped by the disc, even when its local surface density is well below the threshold previously derived from short time-scale integrations. We show that the disc may be able to excite the planet's orbital eccentricity in <1 Myr for the system parameters of CI Tau. We also perform two-planet scattering experiments and show that alternatively the observed planet may plausibly have acquired its eccentricity through dynamical scattering of a migrating lower mass planet, which has either been ejected from the system or swallowed by the central star. In the latter case the present location and eccentricity of the observed planet can be recovered if it was previously stalled within the disc's magnetospheric cavity.

  13. Atmospheric sulphuric acid and neutral cluster measurements using CI-APi-TOF

    Directory of Open Access Journals (Sweden)

    T. Jokinen

    2011-12-01

    Full Text Available The first ambient measurements using nitrate ion based Chemical Ionization with the Atmospheric Pressure interface Time-Of-Flight mass spectrometer (CI-APi-TOF for sulphuric acid and neutral cluster detection are presented. We have found CI-APi-TOF a highly stable and sensitive tool for molecular sulphuric acid detection. The lowest limit of detection for sulphuric acid was determined to be 3 × 104 molecules cm−3 for two hour averaging. Signals from sulphuric acid clusters up to tetramer accompanied by ammonia were also obtained but these were found to result from naturally charged clusters formed by ion induced clustering in the atmosphere during nucleation. Opposite to earlier studies with cluster mass spectrometers, we had no indication of neutral clusters. The reason is either less efficient charging of clusters in comparison to molecular sulphuric acid, or in low concentration of neutral clusters at our measurement site during these particular nucleation events. We show that utilizing high resolution mass spectrometry is crucial in separating the weak sulfuric acid cluster signal from the other compounds.

  14. A Candidate Young Massive Planet in Orbit around the Classical T Tauri Star CI Tau

    CERN Document Server

    Johns-Krull, Christopher M; Prato, L; Crockett, Christopher J; Jaffe, Daniel T; Hartigan, Patrick M; Beichman, Charles A; Mahmud, Naved I; Chen, Wei; Skiff, B A; Cauley, P Wilson; Jones, Joshua A; Mace, G N

    2016-01-01

    The ~2 Myr old classical T Tauri star CI Tau shows periodic variability in its radial velocity (RV) variations measured at infrared (IR) and optical wavelengths. We find that these observations are consistent with a massive planet in a ~9-day period orbit. These results are based on 71 IR RV measurements of this system obtained over 5 years, and on 26 optical RV measurements obtained over 9 years. CI Tau was also observed photometrically in the optical on 34 nights over ~one month in 2012. The optical RV data alone are inadequate to identify an orbital period, likely the result of star spot and activity induced noise for this relatively small dataset. The infrared RV measurements reveal significant periodicity at ~9 days. In addition, the full set of optical and IR RV measurements taken together phase coherently and with equal amplitudes to the ~9 day period. Periodic radial velocity signals can in principle be produced by cool spots, hot spots, and reflection of the stellar spectrum off the inner disk, in ad...

  15. Pesquisa de métodos mistos nas ciências da saúde

    Directory of Open Access Journals (Sweden)

    Elisiane Lorenzini

    2017-05-01

    Full Text Available A pesquisa de métodos mistos oferece poderosas ferramentas para investigação de sistemas e processos complexos em saúde, educação e ciências sociais. Estas áreas vêm utilizando, de forma crescente, complexos delineamentos de pesquisa de métodos mistos1. Este método engloba o procedimento completo de pesquisa, incluindo assunções filosóficas, questões de pesquisa, desenho, coleta, análise, integração e estruturas de apresentação dos dados e resultados2.   Cómo citar este artículo: Lorenzini E. Pesquisa de métodos mistos nas ciências da saúde. Rev Cuid. 2017; 8(2: 1549-60. http://dx.doi.org/10.15649/cuidarte.v8i2.406

  16. Hydrochemical Investigation of Groundwaters of The Cuatro CiÉnegas Bolson, Coahuila, MÉxico

    Science.gov (United States)

    Cortes, Alejandra; Johannessona, Kevin H.; Kilroy, Kathryn C.; Barron, Luis E.

    Water samples were collected from a series of springs, pools, and canals within the Cuatro Ciénegas Bolson, Coahuila, México and analyzed for stable oxygen and hydrogen isotopes. The ?oxigen-18 values of these waters ranged from a low of -8.2 up to -5.7 , with a mean (+/- standard deviation) of -6.5 +/- 0.82 , whereas ?deuterium ranged from -52 to -43 , with a mean (+/- standard deviation) of - 46.6 +/- 3.2 . The majority of the water samples plot sub-parallel and beneath the local meteoric water line, with those sample collected furthest from spring-line exhibiting the most enriched ?oxigen-18 values. The stable isotope data indicate isotopic enrichment of groundwaters by evaporation following discharge and subsequent surface flow. The isotope data suggests that a considerable fraction of Cuatro Ciénegas groundwaters originate via local recharge. Those springs that issue from the western base of the Sierra de San Marcos mountain range are chiefly recharged within these mountains, whereas groundwaters discharging from Laguna Anteojo in the northern part of the bolson are more likely recharged within the higher San de la Madera mountain range. A preliminary water balance estimate, however, that interbas in flow must also contributes to the considerable groundwater discharge within the bolson.

  17. A nova convergência da ciência e da tecnologia

    Directory of Open Access Journals (Sweden)

    Esper A. Cavalheiro

    2007-07-01

    Full Text Available A ação sinérgica dos quatro campos científicos e tecnológicos que apresentaram crescimento acelerado nas últimas décadas - nanotecnologia, biotecnologia, tecnologias de comunicação e informação e ciências cognitivas (neurociência - tem sido intitulada Convergência Tecnológica. Este artigo faz uma revisão das principais discussões que vêm ocorrendo na comunidade científica internacional sobre o seu desenvolvimento e assinala a necessidade de uma abordagem mais ampla que inclua as ciências humanas e sociais e outros atores relevantes na sociedade contemporânea.The synergic combination of the scientific and technological fields that presented a rapid growth rate in the last few decades - nanotechnology, biotechnology, information and communication technologies, and cognitive science including neuroscience - is nowadays known as Convergent Technologies. This paper reviews its recent impact on the international scientific community and points out the need of amplifying the discussions to include humanities and social sciences and other important actors of contemporary society.

  18. Filosofia da ciência como ferramenta microeconômica

    Directory of Open Access Journals (Sweden)

    Fabio Barbieri

    2009-06-01

    Full Text Available A teoria neoclássica pressupõe conhecimento perfeito. A crítica hayekiana a essa teoria, por sua vez, afirma que esse conhecimento é resultado do processo competitivo e, portanto, não pode ser considerado como dado. O “Problema de Hayek” investiga sob que condições o conhecimento do agente se aproxima dos reais fundamentos de uma economia. A fim de solucionar o “Problema de Hayek”, o nosso artigo utiliza algumas idéias da literatura de metodologia da Ciência, conhecida como teoria do “crescimento do conhecimento” (Popper, Kuhn, Lakatos e outros. Essas idéias são utilizadas para se compreender como evolui o conhecimento dos agentes econômicos, em especial o dos empresários. Estes são vistos como ativos formuladores de teorias empresariais conjecturais criticadas no processo competitivo, não como agentes passivos que maximizam funções já conhecidas da teoria convencional. Utiliza-se a Filosofia da Ciência não para analisar metodologicamente a microeconomia, mas, sim, como ferramenta analítica pertencente à própria teoria econômica.

  19. Masculinidade e ciúme na perspectiva da teoria da sedução generalizada

    Directory of Open Access Journals (Sweden)

    Paulo Carvalho Ribeiro

    2012-09-01

    Full Text Available Partindo das contribuições freudianas sobre as relações do ciúme com a projeção e a homossexualidade, propõe-se no presente artigo uma retomada do papel do masoquismo primário e da identificação feminina como elementos definidores do ciúme masculino patológico. As condições originárias de constituição do psiquismo, vistas sob o ângulo da Teoria da Sedução Generalizada, proposta por Jean Laplanche, são relacionadas tanto ao masoquismo primário quanto à identificação feminina. A situação assimétrica entre o adulto, portador de uma sexualidade inconsciente, e a criança, destituída de recursos psíquicos para lidar com as mensagens sexuais do adulto, caracteriza, segundo esse autor, a situação antropológica fundamental.

  20. Electronic spectra and trans—cis isomerism of streptopolymethine cyanines. A CS INDO CI study

    Science.gov (United States)

    Momicchioli, Fabio; Baraldi, Ivan; Ponterini, Glauco; Berthier, Gaston

    The understanding of the role played by cyanine dyes in various fields of application calls for a thorough knowledge of the excited state properties of their parent chromophores, i.e. cationic streptopolymethyne cyanines. For this aim we performed a detailed CS INDO CI investigation on the electronic spectra of tri-, penta- and heptamethine cyanines, both unsubstituted (TC, PC, HC) and terminally substituted by methyl groups (BMTC, BMPC, BMHC). The study comprised S0 Sn, and S0 Tn transitions of the trans and all mono- cis isomers. CI expansions involved solely π orbitals of the polymethine chains and pseudo-π orbitals of the substituents and included all singly-excited and the most important doubly- and triply-excited configurations. The spectroscopic effects of methyl substitution are fairly well described and are shown to be especially important in the upper excited states. The identification of the photochemically formed stereoisomers is attempted in terms of mono- cis isomers. For BMPC, in particular, we report the absorption spectrum of the phototropic form and show that the photoisomer is identifiable as the 3-4 cis form.

  1. ZASADY OKREŚLANIA PRZYNALEŻNOŚCI DO INFRASTRUKTURY KRYTYCZNEJ

    Directory of Open Access Journals (Sweden)

    Janusz RAK

    2016-06-01

    Full Text Available Bezpieczeństwo i ochrona systemu są ściśle związane z różnego rodzaju zagrożeniami, które w sposób dynamiczny ewoluują. To z kolei powoduje konieczność antycypacji i kreowania nowych metod przeciwdziałania tego rodzaju zagrożeniom. W pracy poddano analizie metodologię określania przynależności do infrastruktury krytycznej. Wykaz sektorów określa ustawa o zarządzaniu kryzysowym. Krótko omówiono dwie awarie infrastruktury krytycznej. Podano kryteria kwalifikacji do infrastruktury krytycznej. Zaproponowano nowe sposoby finansowania ryzyka katastroficznego. Odniesiono się do elementów ochrony infrastruktury krytycznej. Na przykładzie systemu zbiorowego zaopatrzenia w wodę szczegółowo przedstawiono kryteria identyfikacyjne. Podsumowaniem rozważań naukowych jest określenie strategii zrównoważonego systemu wodociągowego.

  2. A história da ciência no ensino de física

    Directory of Open Access Journals (Sweden)

    Marcos Cesar Danhoni Neves

    1998-01-01

    Full Text Available Neste artigo procura-se mostrar a necessidade de um ensino de física contextualizado em sua história, frisando a sua não linearidade e as diferentes leituras que dela podemos ter. Diferentes aspectos da história da ciência e de sua aplicabilidade em sala de aula são apresentados, na forma de exemplos concretos possíveis para um ensino não-formal. Alguns resultados de pesquisas em conceituação espontânea a partir de situações específicas (especialmente sobre a Terra e sua posição no universo, são apresentados num contexto de possíveis mudanças conceituais e planejamentos de atividades em sala de aula. O uso da história da ciência e, em especial, da cosmologia, é abordado como possibilidade de definir rumos para a pesquisa básica e para mudar paradigmas vigentes.

  3. Atmospheric sulphuric acid and neutral cluster measurements using CI-APi-TOF

    Directory of Open Access Journals (Sweden)

    T. Jokinen

    2012-05-01

    Full Text Available The first ambient measurements using nitrate ion based Chemical Ionization with the Atmospheric Pressure interface Time-Of-Flight mass spectrometer (CI-APi-TOF for sulphuric acid and neutral cluster detection are presented. We have found CI-APi-TOF a highly stable and sensitive tool for molecular sulphuric acid detection. The lowest limit of detection for sulphuric acid was determined to be 3.6 × 104 molecules cm−3 for 15 min averaging. Signals from sulphuric acid clusters up to tetramer containing ammonia were also obtained but these were found to result from naturally charged clusters formed by ion induced clustering in the atmosphere during nucleation. Opposite to earlier studies with cluster mass spectrometers, we had no indication of neutral clusters. The reason is either less efficient charging of clusters in comparison to molecular sulphuric acid, or the low concentration of neutral clusters at our measurement site during these particular nucleation events. We show that utilizing high resolution mass spectrometry is crucial in separating the weak sulfuric acid cluster signal from other compounds.

  4. Psicologia Social como Ciência e Prática: O que Pensam Pesquisadores Brasileiros?

    Directory of Open Access Journals (Sweden)

    Valdiney Veloso Gouveia

    Full Text Available RESUMO O objetivo deste estudo foi conhecer como pesquisadores da Psicologia Social brasileira a concebem, considerando a dicotomia ciência-prática. Participaram 100 representantes de grupos de pesquisa dessa disciplina. Estes responderam questionário online com cinco partes: concepções da psicologia social, representantes da área, periódicos de referência, atitudes frente à disciplina como ciência aplicada e básica e informações demográficas. A psicologia social foi concebida como sócio-histórico-crítica, polarizando entre Silvia Lane e Aroldo Rodrigues. Considerou-se Psicologia & Sociedadec omo mais apropriada para publicações desta área, destacando-se internacionalmente o Journal of Personality and Social Psychology. As atitudes dos participantes a caracterizaram como mais aplicada. Concluindo, predomina a perspectiva abrapsiana no Brasil, divergindo alguns pesquisadores da psicologia social clássica.

  5. O fundamento como "fundamento ausente" nas ciências sociais: Heidegger, Derrida e Laclau

    Directory of Open Access Journals (Sweden)

    Daniel de Mendonça

    2016-04-01

    Full Text Available Neste artigo, refletimos teoricamente sobre o pós-fundacionalismo, corrente filosófica que influenciou o surgimento do pós-estruturalismo francês na segunda metade do século XX. De uma forma mais específica, nosso objetivo é discutir as implicações ontológicas, teóricas e epistemológicas da abordagem pós-fundacional para pesquisas em ciências sociais. Para tanto, cumprimos o seguinte percurso. Primeiramente, discorremos sobre o que chamamos de o Zeitgeist pós-fundacionalista, em especial a ênfase na diferença ontológica e no fundamento como Abgrund oriundos da obra de Martin Heidegger. A seguir, apresentamos a influência heideggeriana na reflexão filosófica pós-estruturalista de Jacques Derrida. Na sequência, discutimos a incorporação e a aplicação da ontologia heideggeriana na obra de Ernesto Laclau, principalmente a partir da discussão das noções de hegemonia e de populismo. Ao final, apresentamos nossas considerações acerca da importância do pós-fundacionalismo para pesquisas na área das ciências sociais.

  6. O Ensino de Antropologia na formação de Professores de Ciências Sociais

    OpenAIRE

    2015-01-01

    O presente artigo debate o lugar do ensino de Antropologia junto às licenciaturas em Ciências Sociais, o que é realizado remetendo tanto à tradição intelectual destas ciências, que articulam a Antropologia com a Sociologia e a Ciência Política, quanto ao contexto atual e aos desafios postos, principalmente com a reintrodução da Sociologia no Ensino Médio. É realizada uma análise do ensino de Antropologai a partir dos Projetos Pedagógicos de Cursos de algumas licenciaturas em Ciências Sociais,...

  7. Ustawodawstwo Unii Europejskiej wobec mniejszości narodowych i etnicznych - casus romski

    Directory of Open Access Journals (Sweden)

    Wojciech Marcin Stankiewicz

    2014-12-01

    of the Roma minority and replace it with another. That is why the European Union should develop a range of mechanisms and measures that may be accepted by the Roma.   Ustawodawstwo Unii Europejskiej wobec mniejszości narodowych i etnicznych - casus romski Unia Europejska znajduje się dopiero na etapie tworzenia systemu ochrony mniejszości narodowych i etnicznych, jednak niezbędne będzie podjęcie wielu starań, debat oraz działań, w które koniecznie zaangażowane muszą być wszystkie państwa członkowskie. Próby podejmowane przez Parlament Europejski w celu poprawy sytuacji mniejszości narodowych i etnicznych w Unii Europejskiej mogą być odpowiednim impulsem do wstępnych refleksji. Pomimo wielu starań Unii Europejskiej oraz wykorzystania funduszy unijnych sytuacja mniejszości romskiej nie uległa dużej poprawie. Głównymi przyczynami są niedostateczne działania ze strony Unii Europejskiej, korupcja urzędników, a także brak zainteresowania społecznością romską państw członkowskich. Dotychczas podjęte działania nie przyniosły zamierzonych rezultatów, dlatego konieczne jest poświęcenie większej uwagi tej kwestii. Unia Europejska potrzebuje mocnego wsparcia innych instytucji unijnych oraz społeczeństwa obywatelskiego.

  8. Pomiar wytrzymałości na zginanie jako metoda oceny jakości spoiwa na przykładzie mas ze szkłem wodnym

    Directory of Open Access Journals (Sweden)

    M. Stachowicz

    2012-12-01

    Full Text Available W pracy podjęto próbę określenia możliwości zastosowania parametru wytrzymałości na zginanie utwardzonych mas jako kryteriumoceny jakości użytego do ich sporządzenia spoiwa. W tym celu zaprezentowano wyniki badań wpływu wybranych czterech metodutwardzania spoiwa uwodnionego krzemianu sodu. Wybrane ekologiczne, nieorganiczne spoiwo stosowane jest do wytwarzania zarównoform, jak i rdzeni odlewniczych. Oceny skuteczności metod utwardzania spoiwa dokonano odnosząc otrzymane wartości wytrzymałościna zginanie do ilości użytego do sporządzenia masy formierskiej szkła wodnego. W badaniach zastosowano pięć gatunków uwodnionegokrzemianu sodu i wybrane cztery metody jego utwardzania. Stwierdzono, że możliwym jest wykorzystywanie opracowanej oceny jakości spoiw, w szczególności stosowanych do wykonywania rdzeni odlewniczych według zaproponowanego trzyklasowego podziału.

  9. Sprawozdawczość zintegrowana jako nowy obszar badań naukowych w rachunkowości

    Directory of Open Access Journals (Sweden)

    Joanna Krasodomska

    2015-06-01

    Full Text Available Celem artykułu jest przedstawienie sprawozdawczości zintegrowanej jako interesującego, nowego obszaru badań naukowych w rachunkowości. Zakłada ona publikację raportu prezentującego, jak przyjęte przez przedsiębiorstwo strategia, zasady zarządzania, wyniki działalności i perspektywy rozwoju prowadzą do tworzenia wartości. W artykule omówiono stanowiące podstawę sprawozdawczości zintegrowanej koncepcje modelu biznesu oraz sześciu kapitałów. Na podstawie dokonanego przeglądu literatury przedstawiono kierunki badań z zakresu sprawozdawczości zintegrowanej, prezentowane w artykułach naukowych indeksowanych w bazach EBSCO i Emerald oraz postulowane przez Międzynarodową Radę ds. Zintegrowanej Sprawozdawczości (International Integrated Reporting Council – IIRC we współpracy ze Stowarzyszeniem Dyplomowanych Biegłych Księgowych (Association of Chartered Certified Accountants – ACCA i Międzynarodowym Stowarzyszeniem Edukacji Rachunkowości i Badań (International Association for Accounting Education & Research – IAAER. Wskazano też tematy opracowań podejmujących ten problem, przyjętych do prezentacji na Kongresie Europejskiego Stowarzyszenia Rachunkowości (European Accounting Association – EAA w Glasgow w kwietniu 2015 r. Analizą objęto również dorobek polskich autorów podejmujących w swoich badaniach problematykę sprawozdawczości zintegrowanej. Przegląd literatury dotyczącej sprawozdawczości zintegrowanej oraz obecnie prowadzonych badań pozwolił na zidentyfikowanie luk badawczych i wskazanie problemów wartych naukowych dociekań. Zaliczono do nich m.in. zagadnienia związane z modelem biznesu, koncepcją wartości, sześcioma kapitałami, jakością i istotnością raportów zintegrowanych, zaspokajaniem przez raporty zintegrowane potrzeb informacyjnych użytkowników oraz rolą księgowych i biegłych rewidentów w opracowywaniu i weryfikacji sprawozdawczości zintegrowanej. 

  10. 刘毓盘与民国词坛%Liu Yupan and Ci Poetics Circles in Republic of China

    Institute of Scientific and Technical Information of China (English)

    李剑亮

    2014-01-01

    Liu Yupan is a professor and a Ci poetics writer. He specialized in writing Ci poetics, and his anthology of Ci poetics called Qin Jiao JI has come down to modern times. Liu also made a long-term study of Ci poetics. His work The History of Ci Poetics is a monograph of Ci poetics in the earlier academic history. Liu Yupan taught the history of Ci poetics and relevant courses in college as well, which exerted a vital influence on the promotion of college Ci poetics teaching. In addition, he did a hard job to compile Ci poetics, Tang Wu Dai Song Liao Jin Yuan Ming Jia Ci Ji Liu Shi Zhong Ji. Liu Yupan’s understanding of Ci poetics content was mostly affected by“Chang-zhou School”in the Qing dynasty.%刘毓盘作为一位民国时期的教授词人,他既擅长词创作,有词集《噙椒集》流传至今;又长期从事词学研究,其撰写的《词史》是中国学术史上较早的词史专著。同时,他又在大学讲授词史与词学课程,对推动大学词学教学产生了重要影响。此外,刘毓盘对词籍的辑录也十分用力,曾辑录《唐五代宋辽金元名家词集六十种辑》。在对词体的认识上,刘毓盘更多的是受清代常州词派的影响。

  11. Specific inhibition of the transcription factor Ci by a cobalt(III) Schiff base-DNA conjugate.

    Science.gov (United States)

    Hurtado, Ryan R; Harney, Allison S; Heffern, Marie C; Holbrook, Robert J; Holmgren, Robert A; Meade, Thomas J

    2012-02-06

    We describe the use of Co(III) Schiff base-DNA conjugates, a versatile class of research tools that target C2H2 transcription factors, to inhibit the Hedgehog (Hh) pathway. In developing mammalian embryos, Hh signaling is critical for the formation and development of many tissues and organs. Inappropriate activation of the Hedgehog (Hh) pathway has been implicated in a variety of cancers including medulloblastomas and basal cell carcinomas. It is well-known that Hh regulates the activity of the Gli family of C2H2 zinc finger transcription factors in mammals. In Drosophila the function of the Gli proteins is performed by a single transcription factor with an identical DNA binding consensus sequence, Cubitus Interruptus (Ci). We have demonstrated previously that conjugation of a specific 17 base-pair oligonucleotide to a Co(III) Schiff base complex results in a targeted inhibitor of the Snail family C2H2 zinc finger transcription factors. Modification of the oligonucleotide sequence in the Co(III) Schiff base-DNA conjugate to that of Ci's consensus sequence (Co(III)-Ci) generates an equally selective inhibitor of Ci. Co(III)-Ci irreversibly binds the Ci zinc finger domain and prevents it from binding DNA in vitro. In a Ci responsive tissue culture reporter gene assay, Co(III)-Ci reduces the transcriptional activity of Ci in a concentration dependent manner. In addition, injection of wild-type Drosophila embryos with Co(III)-Ci phenocopies a Ci loss of function phenotype, demonstrating effectiveness in vivo. This study provides evidence that Co(III) Schiff base-DNA conjugates are a versatile class of specific and potent tools for studying zinc finger domain proteins and have potential applications as customizable anticancer therapeutics.

  12. A relação de substancialidade na Ciência da Lógica

    Directory of Open Access Journals (Sweden)

    Greice Ane Barbieri

    2017-02-01

    Full Text Available O trabalho buscará apresentar a relação de substancialidade tal como exposta na Ciência da Lógica, de Hegel. Mas, antes dessa apresentação, cabem alguns comentários, de forma a enquadrá-la, grosso modo, dentro do sistema hegeliano, elucidando a sua função. Embora portadora de um título pretensamente formal, a Ciência da Lógica hegeliana não pode ser descrita como um manual de lógica: antes pelo contrário, a tal obra a classificação mais adequada é a de ser uma ontologia. Tendo tal característica, a lógica hegeliana baseia-se nos princípios que regem a realidade, tomando-os da própria realidade. Isso pode conferir à relação de substancialidade uma marcante importância dentro do encadeamento do sistema hegeliano da lógica e, mesmo, da filosofia real, uma vez que os pressupostos da lógica baseiam-se na reflexão sobre as categorias que foram, em última instância, retiradas do dado. Por outro lado, essas mesmas categorias contempladas na Ciência da Lógica colocam-se novamente na realidade, servindo para a compreensão dos engendramentos básicos dos avanços espirituais, isto é, as categorias da lógica hegeliana tornam-se essenciais para uma adequada compreensão de sua filosofia real. Desse modo, permeando o trabalho, de forma tênue, há o objetivo de deixar apontada a direção em busca do aspecto fenomenológico da substância, na Fenomenologia do Espírito, bem como o papel ético de tal conceito, enquanto unidade imediata, na Filosofia do Direito.

  13. Improving Vegetable Oil Fueled CI Engine Characteristics Through Diethyl Ether Blending

    KAUST Repository

    Vedharaj, S.

    2016-12-01

    In this research, the flow and ignition properties of vegetable oil (VO) are improved by blending it with diethyl ether (DEE). DEE, synthesized from ethanol, has lower viscosity than diesel and VO. When DEE is blended with VO, the resultant DEEVO mixtures have favorable properties for compression ignition (CI) engine operation. As such, DEEVO20 (20% DEE + 80% VO) and DEEVO40 (40% DEE + 60% VO) were initially considered in the current study. The viscosity of VO is 32.4*10−6 m2/s; the viscosity is reduced with the increase of DEE in VO. In this study, our blends were limited to a maximum of 40% DEE in VO. The viscosity of DEEVO40 is 2.1*10−6 m2/s, which is comparable to that of diesel (2.3*10−6 m2/s). The lower boiling point and flash point of DEE improves the fuel spray and evaporation for DEEVO mixtures. In addition to the improvement in physical properties, the ignition quality of DEEVO mixtures is also improved, as DEE is a high cetane fuel (DCN = 139). The ignition characteristics of DEEVO mixtures were studied in an ignition quality tester (IQT). There is an evident reduction in ignition delay time (IDT) for DEEVO mixtures compared to VO. The IDT of VO (4.5 ms), DEEVO20 (3.2 ms) and DEEVO40 (2.7 ms) was measured in IQT. Accordingly, the derived cetane number (DCN) of DEEVO mixtures increased with the increase in proportion of DEE. The reported mixtures were also tested in a single cylinder CI engine. The start of combustion (SOC) was advanced for DEEVO20 and DEEVO40 compared to diesel, which is attributed to the high DCN of DEEVO mixtures. On the other hand, the peak heat release rate decreased for DEEVO mixtures compared to diesel. Gaseous emissions such as nitrogen oxide (NOX), total hydrocarbon (THC) and smoke were reduced for DEEVO mixtures compared to diesel. The physical and ignition properties of VO are improved by the addition of DEE, and thus, the need for the trans-esterification process is averted. Furthermore, this blending strategy is simpler

  14. Escrevendo em aulas de ciências Writing in science classes

    Directory of Open Access Journals (Sweden)

    Carla Marques Alvarenga de Oliveira

    2005-12-01

    Full Text Available Neste artigo, apresentamos uma análise dos registros escritos dos alunos do 3° ano do Ensino Fundamental nas aulas de Ciências, em que a professora utilizou as atividades de conhecimento físico, criadas pelo Laboratório de Pesquisa e Ensino de Física da Faculdade de Educação da Universidade de São Paulo. Os registros analisados foram coletados na Escola de Aplicação da Feusp, no ano de 2001, durante o acompanhamento de três aulas de Ciências: o problema do submarino, o problema do barquinho e o problema da pressão. O artigo procura mostrar um panorama de como aparecem os registros realizados pelos alunos, após uma aula de Ciências em que eles são levados a resolver situações problemáticas por meio da experimentação, argumentar e escrever sobre os fenômenos físicos. Durante a análise, levou-se em consideração os tipos de textos que os alunos escrevem, o uso da primeira pessoa, o uso de verbos de ação, o respeito à ordem cronológica dos eventos e quais os tipos de explicações os alunos atribuem aos fenômenos trabalhados.This article analyzed the written records of Third Grade students of Elementary School at Escola de Aplicação, Universidade de São Paulo, gathered during the Science classes of the 2001 school year, in which activities about physical understanding were used. Created by the Laboratory of Research and Teaching of Physics - LAPEF, of the College of Education of USP, the activities "The Problem of the Submarine", "The Problem of the Little Boat" and "The Problem of the Pressure" required the students to solve problematic situations through experimentation, developing arguments and write about the phenomena. The study developed a framework of how the records are presented by the students, considering the types of texts they produce, the use of the first person, the use of verbs of action, the respect of the chronological order of events and the types of explanations the students give for the

  15. Fałszywy znak równości

    Directory of Open Access Journals (Sweden)

    Efraim Zuroff

    2012-12-01

    Full Text Available The equivalency canard Efraim Zuroff's text, originally published in Haaretz magazine, is a review of Timothy Snyder's Bloodlands. Snyder distinguishes six main mass murders commited by Nazi Germany and Soviet Union during the period of the Third Reich's existence. In Zuroff's opinion there are some significant differences between these tragedies. Dubious comparisons proposed by Snyder made the Holocaust most affected. Describing the Shoah as one of the six equally horryfying mass murders, the author ignores its ideological roots. Roots that sentenced to death all Jews  - regardless of their political views, religious practicies or the level of identification with Jewish community. Moreover Snyder takes no notice of the georaphical scope of the Holocaust. He also does not notice the fact, that the Nazis effectively managed to make so many Europeans their accomplices, who actively supported the Shoah.   Fałszywy znak równości Tekst Efraima Zuroffa, który pierwotnie ukazał się w piśmie Haaretz, to recenzja książki Skrwawione ziemie Timothy Snydera. Snyder wyróżnia sześć głównych masowych mordów popełnionych przez Niemcy i Związek Radziecki w okresie, który odpowiada istnieniu Trzeciej Rzeszy. Istnieją jednak, zdaniem Zuroffa, znaczące różnice między tymi tragediami. Na wątpliwych porównaniach, które proponuje Snyder, najbardziej „ucierpiał” Holokaust. Opisując Shoah jako jeden z sześciu równie straszliwych, masowych mordów, autor pomija jego ideologiczne korzenie, które sprawiały, że na śmierć skazany był każdy bez wyjątku Żyd, niezależnie od jego poglądów politycznych, praktyk religijnych czy stopnia identyfikacji z żydowską wspólnotą. Ponadto Snyder ignoruje ogromny zasięg geograficzny Holokaustu. Nie zauważa także skuteczności, z jaką naziści potrafili uczynić swoimi wspólnikami tak wielu Europejczyków, którzy w konsekwencji aktywnie wspomagali Shoah.

  16. Near-infrared chemical imaging (NIR-CI) of 3D printed pharmaceuticals.

    Science.gov (United States)

    Khorasani, Milad; Edinger, Magnus; Raijada, Dhara; Bøtker, Johan; Aho, Johanna; Rantanen, Jukka

    2016-12-30

    Hot-melt extrusion and 3D printing are enabling manufacturing approaches for patient-centred medicinal products. Hot-melt extrusion is a flexible and continuously operating technique which is a crucial part of a typical processing cycle of printed medicines. In this work we use hot-melt extrusion for manufacturing of medicinal films containing indomethacin (IND) and polycaprolactone (PCL), extruded strands with nitrofurantoin monohydrate (NFMH) and poly (ethylene oxide) (PEO), and feedstocks for 3D printed dosage forms with nitrofurantoin anhydrate (NFAH), hydroxyapatite (HA) and poly (lactic acid) (PLA). These feedstocks were printed into a prototype solid dosage form using a desktop 3D printer. These model formulations were characterized using near-infrared chemical imaging (NIR-CI) and, more specifically, the image analytical data were analysed using multivariate curve resolution-alternating least squares (MCR-ALS). The MCR-ALS algorithm predicted the spatial distribution of IND and PCL in the films with reasonable accuracy. In the extruded strands both the chemical mapping of the components in the formulation as well as the solid form of the active compound could be visualized. Based on the image information the total nitrofurantoin and PEO contents could be estimated., The dehydration of NFMH to NFAH, a process-induced solid form change, could be visualized as well. It was observed that the level of dehydration increased with increasing processing time (recirculation during the mixing phase of molten PEO and nitrofurantoin). Similar results were achieved in the 3D printed solid dosage forms produced from the extruded feedstocks. The results presented in this work clearly demonstrate that NIR-CI in combination with MCR-ALS can be used for chemical mapping of both active compound and excipients, as well as for visualization of solid form variation in the final product. The suggested NIR-CI approach is a promising process control tool for characterization of

  17. Branding Grenlandii formą ekspresji tożsamości narodowej?

    Directory of Open Access Journals (Sweden)

    Dominika Bartnik-Światek

    2016-01-01

    Full Text Available Branding Greenland as a form of expression of national identity? In the times of globalisation there is a tendency for countries to differentiate from others. More and more governments decide to launch professional nation branding campaigns in order to communicate to a broad public what a particular country has to offer as well as what values and images it wants to be associated with. Greenland is an example of a country that after a long period of colonisation and establishing self-government, in 2009 began to redefine its identity and reveal it to the world. A branding campaign has been implemented to communicate a newly defined image of Greenland. This campaign has been carried out using mainly social media and the tools that the Internet has to offer. The aim of this paper is to explore the concept of nation branding and to define the relation between nation branding and national identity. The purpose is also to analyse what images of Greenland as a brand are presented by “Pioneering nation” campaign.   Branding Grenlandii formą ekspresji tożsamości narodowej? W czasach globalizacji poszczególne państwa starają się wyróżnić na tle innych państw. Coraz więcej rządów decyduje się na przeprowadzenie profesjonalnych kampanii brandingowych, po to by podkreślić swoją wyjątkowość oraz to, że mają dużo do zaoferowania. Grenlandia to przykład państwa, które po długim okresie skolonizowania i po uzyskaniu autonomii w 2009 roku, zaczęło na nowo definiować swoją tożsamość i komunikować ją światu. W tym celu wdrożona została kampania, która wykorzystywała głównie media społecznościowe oraz inne narzędzia, które zapewnia internet. Celem niniejszego artykułu jest zbadanie zależności między brandingiem narodowym a tożsamością narodową, jak też analiza obrazu Grenlandii jako marki konstruowanej w kampanii „Pioneering nation”.

  18. A comunicação nas ciências da linguagem

    Directory of Open Access Journals (Sweden)

    Geraldo Carlos do Nascimento

    2002-06-01

    Full Text Available Este trabalho situa a questão da comunicação na sua vertente relacionada com as ciências da linguagem, que ganham corpo, embora suas origens remontem a Saussure, a partir do ensaio de Roman Jakobson, Linguistic and Poetics (1960, no qual é apresentado um esquema básico da comunicação. As fragilidades deste esquema, ainda vinculado às noções da sociologia funcionalista (Laswell/Scharam, logo se fizeram notar, particularmente no que se refere à sua operacionalização; mas foi a partir de sua crítica, conforme se defende aqui, que a semiótica greimasiana pôde, ao articular comunicação e sentido, estabelecer bases mais consistentes para a discussão da noção de comunicação e se seu campo presumível.

  19. Pode Realmente Haver uma Ciência Natural da Ação Humana?

    Directory of Open Access Journals (Sweden)

    Sérgio Oliveira

    2014-05-01

    Full Text Available Procura-se, neste texto, expor, de forma sucinta, a argumentação, com base na perspectiva de Clifford Geertz, segundo a qual a ação humana se torna um objeto falseado à medida que entendida pelas estratégias de investigação típicas das ciências naturais, as quais procuram fornecer alguma descrição universal da mesma. A contrapelo desta tendência, lembra-se aqui o vínculo da ação complexa com sentidos para sempre locais e a necessidade, em se observando tal ponto, de se imaginarem “descrições densas” que procurem reconstruir a riqueza e as particularidades desses mesmos sentidos, como se pertencessem a um texto literário.

  20. Ideias de L. S. Vigotski sobre a ciência do desenvolvimento infantil

    Directory of Open Access Journals (Sweden)

    Boris G. Meshcheryakov

    2010-01-01

    Full Text Available Neste artigo, analisam-se as ideias principais da quarta conferência de Vigotski, "A questão do meio na pedologia", no contexto da série de sete conferências intitulada "Fundamentos de pedologia", e outros trabalhos do autor sobre o mesmo tema. Essa série é considerada como representativa do projeto de Vigotski para uma ciência do desenvolvimento infantil. A quarta conferência enfoca principalmente as tendências específicas do desenvolvimento psicológico. Mostra-se que as ideias dessa conferência foram posteriormente desenvolvidas no trabalho "O problema da idade" e em leituras concernentes à crise da idade.

  1. Near-infrared chemical imaging (NIR-CI) of 3D printed pharmaceuticals

    DEFF Research Database (Denmark)

    Khorasani, Milad; Edinger, Magnus; Raijada, Dhara

    2016-01-01

    Hot-melt extrusion and 3D printing are enabling manufacturing approaches for patient-centred medicinal products. Hot-melt extrusion is a flexible and continuously operating technique which is a crucial part of a typical processing cycle of printed medicines. In this work we use hot-melt extrusion...... for manufacturing of medicinal films containing indomethacin (IND) and polycaprolactone (PCL), extruded strands with nitrofurantoin monohydrate (NFMH) and poly (ethylene oxide) (PEO), and feedstocks for 3D printed dosage forms with nitrofurantoin anhydrate (NFAH), hydroxyapatite (HA) and poly (lactic acid) (PLA...... and nitrofurantoin). Similar results were achieved in the 3D printed solid dosage forms produced from the extruded feedstocks. The results presented in this work clearly demonstrate that NIR-CI in combination with MCR-ALS can be used for chemical mapping of both active compound and excipients, as well...

  2. Kinetic-energy matrix elements for atomic Hylleraas-CI wave functions.

    Science.gov (United States)

    Harris, Frank E

    2016-05-28

    Hylleraas-CI is a superposition-of-configurations method in which each configuration is constructed from a Slater-type orbital (STO) product to which is appended (linearly) at most one interelectron distance rij. Computations of the kinetic energy for atoms by this method have been difficult due to the lack of formulas expressing these matrix elements for general angular momentum in terms of overlap and potential-energy integrals. It is shown here that a strategic application of angular-momentum theory, including the use of vector spherical harmonics, enables the reduction of all atomic kinetic-energy integrals to overlap and potential-energy matrix elements. The new formulas are validated by showing that they yield correct results for a large number of integrals published by other investigators.

  3. Improvement of Waste Tire Pyrolysis Oil and Performance Test with Diesel in CI Engine

    Directory of Open Access Journals (Sweden)

    M. N. Islam

    2016-01-01

    Full Text Available The standard of living, quality of life, and development of a nation depend on its per capita energy consumption. Global energy supply that mainly depends on fossil fuel is decreasing day by day. It is estimated that the energy demand will be increased five times by the year 2021 from present scenario. Due to the fossil fuel crisis, the development of alternative fuel technologies has drawn more attraction to deliver the replacement of fossil fuel. Pyrolysis is one of the promising alternative fuel technologies which produces valuable oil, char, and gas product from organic waste. Early investigations report that tire pyrolysis oil extracted from vacuum pyrolysis method seemed to have properties similar to diesel fuel. The main concern of this paper is to produce and improve the properties of crude tire pyrolysis oil by desulfurizing, distilling, and utilizing it with diesel in CI engine to analyze the efficiency for various compositions.

  4. Theoretical Study of Haloacetonitrile Anions: CH2XCN- (X=F, CI)

    Institute of Scientific and Technical Information of China (English)

    Xin-wen Zhang; Mei Li; Shan-xi Tian

    2008-01-01

    Haloacetonitrile anions CH2XCN- (X=F, CI) were studied by HF-SCF, Becke3-LYP, and MP2 meth- ods together with the Dunning's basis sot aug-cc-PVTZ. The vertical electron attachments to the neu- tral are endothermic. The geometrically optimized CH2FCN- is mainly a valence-bounded anion and CH2FCN-→CH2CN+F- is a nonadiabatic dissociation. This theoretical study in good agreement with the experimental results shows that the Becke3-LYP method is reasonable in describing the electronic structures of anions and dissociative attachment dynamics, while significant differences between MP2 and Becke3-LYP results are shown for the dissociation potential curves of CH2ClCN-→CH2CN+Cl-.

  5. Magnetic Dimer Excitations in Cs3Cr2CI9 Studied by Neutron Scattering

    DEFF Research Database (Denmark)

    Leuenberger, Bruno; Güdel, Hans U.; Kjems, Jørgen

    1985-01-01

    nearest-neighbor interactions need to be considered. From the excellent fit, three exchange parameters were obtained: J = -1.75 meV (intradimer), J = -0.032 meV (interdimer, intrasublattice) and J, = -0.031 meV (interdimer,i ntersublattice). These values indicate that Cs3Cr26I9is far from ordering......The energy dispersion of the singlet-triplet dimer excitation in Cs3Cr2CI9h as been studied by inelastic neutron scattering (INS) at temperatures down to 1.3 K. The results can be accounted for by using a completely isotropic Heisenberg Hamiltonian in the random phase approximation (RPA). Only...

  6. Udvikling af dialogisk kompetence hos børn med CI

    DEFF Research Database (Denmark)

    Dammeyer, Jesper Herup; Carstensen, Susanne; Karlshøj, Bente;

    2011-01-01

    Der er relativ god viden om børn med CI’s sproglige udvikling, hvad angår sproglyde og ord. Derimod er der i den internationale forskning kun beskrevet meget lidt om den del af den sproglige udvikling, som ligger ud over sætningsniveauet. Denne artikel beskriver nogle af de resultater, der er...... fremkommet ved et fire år langt følgestudie af tre førskolebørn med CI. Børnenes sproglige udvikling er observeret og analyseret i forhold til dialogiske kompetencer. Resultaterne peger på, at børnene udvikler gode talesproglige kompetencer i løbet af den fireårige periode, men at børnene har brug for støtte...

  7. Solvent effects on photodegradation of CI Reactive Orange 16 by simulated solar light

    Directory of Open Access Journals (Sweden)

    Mijin Dušan Ž.

    2008-01-01

    Full Text Available Organic solvents may appear in wastewaters and other industrial waste streams containing dyes, therefore, their photodegradation catalyzed by TiO2 should be investigated. Solvent effect on photodegradation of CI Reactive Orange 16 has been studied using simulated solar light and P-25 TiO2. Methyl, ethyl and isopropyl alcohol as well as acetone were used as solvents. Photodegradation reaction was faster in methyl than in ethyl alcohol while in water was the slowest. RO16 photodegradation efficiency and reaction rate decreased in the presence of small concentration of ethanol. Higher photodegradation efficiency was observed for higher ethanol concentration. For acetone, photodegradation decreased as concentration of acetone increased. It seems that protic solvents at higher concentrations promote reaction, while at low concentrations slow down reaction. Aprotic solvents slow down reaction.

  8. Environmental variation, hybridization, and phenotypic diversification in Cuatro Ciénegas pupfishes.

    Science.gov (United States)

    Tobler, M; Carson, E W

    2010-07-01

    Hybridization can generate novel phenotypes, and in combination with divergent selection along environmental gradients, can play a driving role in phenotypic diversification. This study examined the influence of introgressive hybridization and environmental variation on the phenotypic diversity of two pupfish species (Cyprinodon atrorus and Cyprinodon bifasciatus) endemic to the Cuatro Ciénegas basin, Mexico. These species occupy opposite environmental extremes and are comprised of multiple, intraspecifically isolated populations. However, interspecific hybridization occurs to various degrees within connecting, intermediate environments. Using geometric morphometric analysis, extensive variation of body shape was observed between and within species, and phenotypic variation was strongly correlated with environmental conditions. Furthermore, some introgressed populations exhibited unique phenotypes not found in either of the parents, and overall morphospace occupation was significantly higher in introgressed populations when compared to the parentals. Overall, we find environmental variation and transgressive segregation both appear to have been important in shaping phenotypic variation in this system.

  9. Understanding Artisanal Fishers’ Behaviors: The Case of Ciénaga Grande de Santa Marta, Colombia

    Directory of Open Access Journals (Sweden)

    Luz Elba Torres-Guevara

    2016-06-01

    Full Text Available We investigate the ecological impact caused by fishing grounds and the fishing gear/methods used by fishers in Ciénaga Grande de Santa Marta (CGSM, an estuarine lagoon located on the Caribbean coast of Colombia. To do so, we build individual and composite ecological sustainable indicators based on the opinions of a group of experienced fishers and a group of scientists. Additionally, we use those indicators to examine the influence of socioeconomic and perceptional factors on fishers’ fishing behaviors and how those behaviors may be affecting CGSM fishery resources. Our results suggest that fishers and scientists differ in their opinions about the impact of fishing on CGSM. Additionally, we found that having a higher level of education, sharing household expenses with other family members and spending more hours fishing lead to ecologically-sustainable fishing behavior, while the perception that the government is responsible for CGSM conservation leads to ecologically unsustainable fishing behavior.

  10. Właściwości spektralne, fotofizyczne i fotochemiczne wybranych fotochromowych zasad Schiffa

    OpenAIRE

    Filipczak, Katarzyna

    2013-01-01

    Wydział Chemii: Zakład Fotochemii i Spektroskopii Fotochromowe zasady Schiffa są bardzo intensywnie badane ze względu na zachodzący u nich proces ESIPT, ich właściwości fotochromowe oraz na liczne zastosowania. Mogą one występować w postaci tautomeru enolowego i tautomeru keto. Każdy z nich może występować w postaci dwóch izomerów, te z kolei mogą tworzyć po kilka konformerów. Ponadto, zasady Schiffa mogą tworzyć dimery, a także większe agregaty. Tak więc w próbce badanej zasady Schiffa...

  11. Convergence of CI single center calculations of positron-atom interactions

    CERN Document Server

    Mitroy, J

    2006-01-01

    The Configuration Interaction (CI) method using orbitals centered on the nucleus has recently been applied to calculate the interactions of positrons interacting with atoms. Computational investigations of the convergence properties of binding energy, phase shift and annihilation rate with respect to the maximum angular momentum of the orbital basis for the e^+Cu and PsH bound states, and the e^+-H scattering system were completed. The annihilation rates converge very slowly with angular momentum, and moreover the convergence with radial basis dimension appears to be slower for high angular momentum. A number of methods of completing the partial wave sum are compared, an approach based on a Delta X_J = a/(J + 1/2)^n + b/(J + 1/2)^(n+1) form (with n = 4 for phase shift (or energy) and n = 2 for the annihilation rate) seems to be preferred on considerations of utility and underlying physical justification.

  12. Identification by CI-mass spectrometry of an unexpected benzodiazepine degradation product

    Science.gov (United States)

    Buret, D.; Breton, D.; Clair, P.; Lafosse, M.

    2006-01-01

    The French Military Health Service (SSA) has developed an innovative drug product, as a treatment against neurotoxic organophosphate poisoning (NOP). It contains three drug substances: an anticholinergic, an anticonvulsant and a cholinesterase reactivator. Testing stability study, in normal conditions, over 18 months, for this speciality, has given unexpected results. Indeed, one of the drug substances, avizafone (pro-drug of diazepam), breaks down partially into a compound which migrates into the plastic container where this degradation product is demethylated after absorption. Mass spectrometry with negative chemical ionisation (negative CI-MS) was used, to monitor decomposition of the drug substance. This method first showed migration of the degradation product and has been used to monitor its evolution during the stability testing study. The demethylation seems to be due to an additive product present in the plastic. The degradation products remain trapped in the container holding the pharmaceutical formulation.

  13. A história da ciência no ensino de física

    OpenAIRE

    Marcos Cesar Danhoni Neves

    1998-01-01

    Neste artigo procura-se mostrar a necessidade de um ensino de física contextualizado em sua história, frisando a sua não linearidade e as diferentes leituras que dela podemos ter. Diferentes aspectos da história da ciência e de sua aplicabilidade em sala de aula são apresentados, na forma de exemplos concretos possíveis para um ensino não-formal. Alguns resultados de pesquisas em conceituação espontânea a partir de situações específicas (especialmente sobre a Terra e sua posição no universo),...

  14. Heisenberg behavior of some carbon-beryllium compounds: How well truncated-CI approaches work.

    Science.gov (United States)

    Calzado, Carmen J; Monari, A; Evangelisti, S

    2011-01-30

    This works tries to establish the performance of truncated CI calculations on the evaluation of magnetic coupling parameters with respect to available FCI estimates on a set of carbon-beryllium clusters. First-, second- and third-neighbor magnetic coupling constants have been evaluated and many body effective parameters as the cyclic terms. They result from the fitting of the low-lying states to the eigenvalues of an extended Heisenberg Hamiltonian, involving not only two-body isotropic terms but also cyclic terms. SDCI and DDCI calculations have been carried out and their performance compared with FCI ones. The impact of the basis set choice and size-consistency errors have been explored.

  15. Metabolic profiling and outer pericarp water state in Zespri, CI.GI, and Hayward kiwifruits.

    Science.gov (United States)

    Capitani, Donatella; Mannina, Luisa; Proietti, Noemi; Sobolev, Anatoly P; Tomassini, Alberta; Miccheli, Alfredo; Di Cocco, Maria E; Capuani, Giorgio; De Salvador, Flavio Roberto; Delfini, Maurizio

    2013-02-27

    The metabolic profiling of aqueous extracts of Zespri Gold ( Actinidia chinensis ) and CI.GI (a controlled crossbreed from different species of Actinidia deliciosa ) kiwifruits and the water state of the outer pericarp of entire fruits were monitored over the season by means of high-field NMR spectroscopy and T(2) relaxation time measurements, respectively, and compared with the corresponding ones of Hayward kiwifruits previously investigated. A more complete assignment of the (1)H spectrum with respect to that obtained previously was reported: histidine, phenylalanine, quercetin 3-rhamnoside, and epicatechin were identified. Metabolic profiling confirmed Zespri's earlier maturation compared with the two other varieties. The water state of entire kiwifruits was measured nondestructively on fruits attached to the plants or detached from the plants. T(2) relaxation times were found to be sensitive to the kiwifruit developmental stage.

  16. Meio ambiente e ética: entrecruzando olhares no ensino de ciências

    OpenAIRE

    BARBOSA JUNIOR, Ival Rabêlo

    2010-01-01

    Meio ambiente e Ética são temas recorrentes nas pautas de discussões sobre os desafios da educação brasileira. O mundo está imerso em uma crise ambiental e ética que nos convida ao movimento dialético da ação-reflexão-ação. O objetivo deste trabalho foi investigar as concepções e as relações entre os Temas Transversais Meio Ambiente e Ética dos professores de Ciências, técnicos educacionais e alunos de 5ª a 8ª série do Ensino Fundamental, de uma escola da rede particular de Belém. O estudo ap...

  17. Photocatalytic Membrane Reactor for the Removal of C.I. Disperse Red 73

    Directory of Open Access Journals (Sweden)

    Valentina Buscio

    2015-06-01

    Full Text Available After the dyeing process, part of the dyes used to color textile materials are not fixed into the substrate and are discharged into wastewater as residual dyes. In this study, a heterogeneous photocatalytic process combined with microfiltration has been investigated for the removal of C.I. Disperse Red 73 from synthetic textile effluents. The titanium dioxide (TiO2 Aeroxide P25 was selected as photocatalyst. The photocatalytic treatment achieved between 60% and 90% of dye degradation and up to 98% chemical oxygen demand (COD removal. The influence of different parameters on photocatalytic degradation was studied: pH, initial photocatalyst loading, and dye concentration. The best conditions for dye degradation were pH 4, an initial dye concentration of 50 mg·L−1, and a TiO2 loading of 2 g·L−1. The photocatalytic membrane treatment provided a high quality permeate, which can be reused.

  18. Uma abordagem sociológica da sociologia: a ciência como campo

    Directory of Open Access Journals (Sweden)

    Vívian Matias dos Santos

    2012-03-01

    Full Text Available O presente ensaio objetiva analisar como o conceito de campo de Pierre Bourdieu pode contribuir para uma abordagem sociológica da Sociologia. A discussão desdobra-se desde a reflexão mais geral de como se firma a ciência até as possibilidades de compreensão da Sociologia neste espaço. Para tanto, fez-se necessário abordar o “campo científico” por meio das relações entre sua estrutura e seus agentes - relações “multidimensionais” que podem representar uma exitosa tentativa de superação da dicotomia ação/estrutura; indivíduo/sociedade; micro e macroteorização.

  19. Structural and dynamics studies of a truncated variant of CI repressor from bacteriophage TP901-1

    DEFF Research Database (Denmark)

    Rasmussen, Kim Krighaar; Frandsen, Kristian E. H.; Erba, Elisabetta Boeri;

    2016-01-01

    The CI repressor from the temperate bacteriophage TP901-1 consists of two folded domains, an N-terminal helix-turn-helix DNA-binding domain (NTD) and a C-terminal oligomerization domain (CTD), which we here suggest to be further divided into CTD1 and CTD2. Full-length CI is a hexameric protein...

  20. Structural and dynamics studies of a truncated variant of CI repressor from bacteriophage TP901-1

    DEFF Research Database (Denmark)

    Rasmussen, Kim Krighaar; Frandsen, Kristian E. H.; Erba, Elisabetta Boeri

    2016-01-01

    The CI repressor from the temperate bacteriophage TP901-1 consists of two folded domains, an N-terminal helix-turn-helix DNA-binding domain (NTD) and a C-terminal oligomerization domain (CTD), which we here suggest to be further divided into CTD1 and CTD2. Full-length CI is a hexameric protein...

  1. A Science Centre as a Geoturism promoter - the Lagos Ciência Viva examples (Portugal).

    Science.gov (United States)

    Azevedo Rodrigues, Luis; Leote, Catarina

    2017-04-01

    Science outreach and engagement are crucial core objectives of the Lagos Ciência Viva Science Centre (CCVL). By engaging audiences in the real world a link is made between their science centre experience and the environment in which they live. Therefore, it has been an option of the CCVL to offer geological outdoor activities, both in the natural environment and urban context. Dinosaurs are an appealing science subject for both students and tourists. Thus, the CCVL has a long tradition in organizing and guiding field trips to two dinosaur track sites - Salema and Santa beaches (Vila do Bispo, southwest Algarve). These sites, both from the Lower Cretaceous reveal at least two types of tracks - theropod and iguanodontian footprints. Often in combination with the paleontology field trips, the CCVL also offers different geological field trips both for formal (school) and informal (tourism) education. This allows students and tourists to be introduced to dinosaur paleobiology and ichnology and to the structural geology and stratigraphy of the area. Our science outreach is being further developed by contractual agreement with a regional tour operator, in which the CCVL is responsible for the scientific content and guidance of the visits. Aiming at an urban context, the CCVL produced three Urban Geology and Paleontology Guide Books for three Algarve cities (Lagos, Faro and Tavira), which can be acquired in the three Ciência Viva Science Centres shops as well as in the tourist information offices serving this way as a basis for guided urban tours also offered by the CCVL. Based on our experience, we review and contextualise these geoscience activities and their potential for science outreach, communication and tourism. We discuss and propose a classification of different possibilities in geoscience communication and outreach based on three vertices: Science, Heritage and Geotourism. Some particularities of these visits, such as the merge between geosciences and other

  2. As mulheres na ciência brasileira: crescimento, contrastes e um perfil de sucesso

    Directory of Open Access Journals (Sweden)

    Jacqueline Leta

    2003-12-01

    Full Text Available HISTORICAMENTE, a ciência sempre foi vista como uma atividade realizada por homens e foi somente após a segunda metade no século XX que ocorreram mudanças nesse quadro. O presente estudo mostra o crescimento da participação feminina em alguns cursos de graduação da UFRJ (inclusive em cursos tradicionalmente ocupados por homens, nos grupos de pesquisas cadastrados no CNPq, como bolsistas do CNPq e no quadro de docentes da USP. O estudo também mostra que, apesar da maior participação no sistema brasileiro de C&T, as mulheres têm chances menores de sucesso e ascensão na carreira: são menos contempladas com bolsas de produtividade do CNPq, estão sub-representadas nos cargos administrativos da UFRJ e entre os acadêmicos da Academia Brasileira de Ciências.HISTORICALLY science has been pointed out as a male activity. Unfortunatelly, this portrait has changed only after 2nd World War. The present study shows data of female participation within some undergraduate courses at UFRJ (including some which are traditionally carried by males, within the research groups registered in the CNPq database and within the teacher's staff of USP. The study also shows that, although females are increasing within the Brazilian system of science & technology, they seem to have less chances to ascend in career: they are less granted with CNPq fellowship, they are underrepresented within the academic positions at UFRJ and within the members of the Brazilian Academy of Sciences.

  3. Polska prasa tabletowa – modele biznesowe dystrybucji treści

    Directory of Open Access Journals (Sweden)

    Krzysztof Flasiński

    2012-02-01

    Full Text Available Autor przeanalizował aplikacje spełniające trzy warunki: przeznaczone na tablety marki iPad, dostępne w sklepie App Store oraz powiązane z polskojęzycznymi tytułami prasowymi. Artykuł przedstawia kompletną panoramę polskiej prasy tabletowej. Ujętych zostało 38 aplikacji dostępnych 30 września 2011 r. Po zbadaniu wszystkich programów utworzono „mapę modeli biznesowych dystrybucji treści”. Czynnikiem decydującym o umieszczeniu na niej aplikacji prasowych była forma dystrybucji treści (płatna/bezpłatna oraz  rodzaj udostępnianej treści (powiązana z wydaniem drukowanym/powiązana z wydaniem online. Z analizy wynika, że 11 redakcji udostępnia płatne wydanie print, 10 – bezpłatne wydanie online, 7 – bezpłatne wydanie print, 3 – bezpłatne wydanie online oraz płatne wydanie print, jedna – oba wydania bezpłatnie, i jedna – oba wydania płatnie. Wywód uzupełniają dodatkowe dane: chronologiczna lista aplikacji prasowych według daty ukazania, wykaz kosztów korzystania z poszczególnych aplikacji, aktywność wydawców prasowych w App Store w rozbiciu na miesiące oraz kwartały.

  4. O que é Ciência da Informação?

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Ávila Araújo

    2014-12-01

    Full Text Available Introdução: Apresenta um panorama da Ciência da Informação em três momentos. Inicialmente, seu surgimento e consolidação na década de 1960, como confluência de vários fatos: a distinção em relação à Arquivologia, à Biblioteconomia e à Museologia; a relação com a Documentação; a ocupação do espaço institucional da Biblioteconomia; as atividades dos primeiros “cientistas da informação”; as tecnologias da informação; e o uso da Teoria Matemática. Objetivo: Analisar a ampliação vivida nas décadas seguintes com o desenvolvimento de subáreas, das caracterizações do campo e da evolução do conceito de informação. Metodologia: Revisão de Literatura. Resultados: São apresentadas as tendências contemporâneas: as sistematizações da área, os três modelos para o estudo da informação e o desafio recente de diálogo com a Arquivologia, a Biblioteconomia e a Museologia. Conclusões: muitos processos e eventos aconteceram no campo da Ciência da Informação nestes últimos 45 anos. Diferentes subáreas foram formadas, conceitos formulados e reformulados, caracterizações problematizadas e discutidas, relações com outros campos de conhecimento tensionadas e concretizadas.

  5. The development of a thermostable CiP (Coprinus cinereus peroxidase) through in silico design.

    Science.gov (United States)

    Kim, Su Jin; Lee, Jeong Ah; Joo, Jeong Chan; Yoo, Young Je; Kim, Yong Hwan; Song, Bong Keun

    2010-01-01

    Protein thermostability is a crucial issue in the practical application of enzymes, such as inorganic synthesis and enzymatic polymerization of phenol derivatives. Much attention has been focused on the enhancement and numerous successes have been achieved through protein engineering methods. Despite fruitful results based on random mutagenesis, it was still necessary to develop a novel strategy that can reduce the time and effort involved in this process. In this study, a rapid and effective strategy is described for increasing the thermal stability of a protein. Instead of random mutagenesis, a rational strategy was adopted to theoretically stabilize the thermo labile residues of a protein using computational methods. Protein residues with high flexibility can be thermo labile due to their large range of movement. Here, residue B factor values were used to identify putatively thermo labile residues and the RosettaDesign program was applied to search for stable sequences. Coprinus cinereus (CiP) heme peroxidase was selected as a model protein for its importance in commercial applications, such as the polymerization of phenolic compounds. Eleven CiP residues with the highest B factor values were chosen as target mutation sites for thermostabilization, and then redesigned using RosettaDesign to identify sequences. Eight mutants based on the redesigns, were produced as functional enzymes and two of these (S323Y and E328D) showed increased thermal stability over the wild-type in addition to conserved catalytic activity. Thus, this strategy can be used as a rapid and effective in silico design tool for obtaining thermostable proteins.

  6. The functional significance of cortical reorganization and the parallel development of CI therapy

    Directory of Open Access Journals (Sweden)

    Edward eTaub

    2014-06-01

    Full Text Available For the 19th and the better part of the 20th centuries two correlative beliefs were strongly held by almost all neuroscientists and practitioners in the field of neurorehabilitation. The first was that after maturity the adult CNS was hardwired and fixed, and second that in the chronic phase after CNS injury no substantial recovery of function could take place no matter what intervention was employed. However, in the last part of the 20th century evidence began to accumulate that neither belief was correct. First, in the 1960s and 1970s, in research with primates given a surgical abolition of somatic sensation from a single forelimb, which rendered the extremity useless, it was found that behavioral techniques could convert the limb into an extremity that could be used extensively. Beginning in the late 1980s, the techniques employed with deafferented monkeys were translated into a rehabilitation treatment, termed Constraint Induced Movement therapy or CI therapy, for substantially improving the motor deficit of the upper and lower extremities in the chronic phase after stroke. CI therapy has been applied successfully to other types of damage to the CNS such as traumatic brain injury, cerebral palsy, multiple sclerosis, and spinal cord injury, and it has also been used to improve function in focal hand dystonia and for aphasia after stroke. As this work was proceeding, it was being shown during the 1980s and 1990s that sustained modulation of afferent input could alter the structure of the CNS and that this topographic reorganization could have relevance to the function of the individual. The alteration in these once fundamental beliefs has given rise to important recent developments in neuroscience and neurorehabilitation and holds promise for further increasing our understanding of CNS function and extending the boundaries of what is possible in neurorehabilitation.

  7. Multicentre evaluation of the Naída CI Q70 sound processor: feedback from cochlear implant users and professionals

    Directory of Open Access Journals (Sweden)

    Jeanette Martin

    2016-12-01

    Full Text Available The aim of this survey was to gather data from both implant recipients and professionals on the ease of use of the Naída CI Q70 (Naída CI sound processor from Advanced Bionics and on the usefulness of the new functions and features available. A secondary objective was to investigate fitting practices with the new processor. A comprehensive user satisfaction survey was conducted in a total of 186 subjects from 24 centres. In parallel, 23 professional questionnaires were collected from 11 centres. Overall, there was high satisfaction with the Naída CI processor from adults, children, experienced and new CI users as well as from professionals. The Naída CI processor was shown as being easy to use by all ages of recipients and by professionals. The majority of experienced CI users rated the Naída CI processor as being similar or better than their previous processor in all areas surveyed. The Naída CI was recommended by the professionals for fitting in all populations. Features like UltraZoom, ZoomControl and DuoPhone would not be fitted to very young children in contrast to adults. Positive ratings were obtained for ease of use, comfort and usefulness of the new functions and features of the Naída CI sound processor. Seventy-seven percent of the experienced CI users rated the new processor as being better than their previous sound processor from a general point of view. The survey also showed that fitting practices were influenced by the age of the user.

  8. Problema, teoria e observação em ciência: para uma reorientação epistemológica da educação em ciência

    Directory of Open Access Journals (Sweden)

    João Felix Praia

    2002-01-01

    Full Text Available Trabalhos recentes de investigação sugerem que freqüentemente os professores de ciências constroem imagens de ciência marcadas por visões de índole empirista/indutivista. O presente artigo desenvolve-se em torno de contributos da epistemologia, numa perspectiva de transposição para o campo da Educação em Ciência, isto é, centra a nossa atenção na busca e apropriação crítica de elementos fundamentadores de uma teorização para a Educação em Ciência, por sua vez, também ela capaz de orientar práticas educacionais. É com naturais limitações, decorrentes ainda do actual estatuto epistemológico da Educação em Ciência que procuramos desenvolver um conjunto de idéias sobre aspectos tão importantes como o problema, a teoria e a observação em Ciência, capazes de contribuir para que os professores se sintam mais informados e, por via disso, sejam mais capazes de fundamentar as suas opções educacionais e didácticas em relação à ciência que ensinam.

  9. Między pamięcią a zapomnieniem Shoah. Problem estetycznej neutralizacji przeszłości w myśleniu historycznym Saula Friedländera

    Directory of Open Access Journals (Sweden)

    Sawicki, Maciej

    2015-06-01

    Full Text Available W tekstach Saula Friedländera problem indywidualnej pamięci Shoahstanowił jedną z głównych granic dla dyskursu. Punktem krytycznym jego refleksji nad pamięcią stała się kwestia społecznego myślenia zbawczego, które stanowiło reakcję obronną wobec katastrofy. Fenomen ten ujawnił się szczególnie wyraźnie w publicznej formie pamięci, która z jednej strony domagała się prostoty i jasnej interpretacji, jako że jej zadaniem było oswojenie niekoherencji, wyeliminowanie bólu oraz rozbudzenie nadziei u współczesnych; z drugiej strony indywidualna pamięć głęboka ocalałych – nie znająca zasad – nie godziła się na formę pamięci publicznej, mimo że nie była w stanie jej się oprzeć. Według Friedländera ekspansja pamięci publicznej i zanikanie pamięci indywidualnej sprawia, iż "pamięć Shoah prawdopodobnie nie ucieknie przed całkowitą rytualizacją"1. W swoich rozważaniach częstokroć zwracał on uwagę na to, że sztuka nie może przeciwdziałać oswajaniu grozy, ponieważ musi wyrażać indywidualną pamięć przeszłości w pewnych prostych formach. Oprócz tego problematyczny stał się fakt, że same kategorie sztuki po Holokauście zostały zawładnięte przez przemysł kulturowy i politykę, przez co problem pamięci stał się środkiem przetargowym dla innych celów. Nawiązując za Friedländerem do aktualnego impasu wobec różnych oswajających mechanizmów pamięci, spróbuję poddać pod rozwagę kwestię granic i możliwości w tworzeniu estetycznego pomostu między teraźniejszością a przeszłością.

  10. Perspectives on biodiversity science in Brazil Perspectivas das ciências da biodiversidade no Brasil

    Directory of Open Access Journals (Sweden)

    Fabio Rubio Scarano

    2007-08-01

    Full Text Available Biodiversity issues in Brazil have reached a critical point. On one hand, biodiversity science is increasing in quality and quantity, however on the other, habitat destruction in all major biomes still maintain alarmingly high rates. This paradox, from a scientific perspective, has two central tenets that scientists should focus on. First, although science related to biodiversity is of high standard in Brazil as compared to that of peers in the world, it is still not at the leading edge of research. Second, the wealth of information built up by strong research programmes, such as Biota/Fapesp - to which this special issue of Scientia Agricola is dedicated - is beginning to help decision-makers to improve precision and quality of their decisions concerning the environment, but still much is left to be done in this respect. Therefore, I discuss some of the biodiversity issues that remain controversial and demand fast scientific growth. Tackling them Brazil may finally reach the leading edge of biodiversity research. Finally, I discuss how communication between scientists and decision-makers and the general public may be improved, highlighting how a strong education project is urgently needed from kindergarten to graduate programmes in order to solve the two problems above mentioned and definitely crack the paradox biodiversity knowledge vs. biodiversity destruction.A temática da biodiversidade no Brasil alcançou um ponto crítico onde, por um lado, a ciência da biodiversidade aumenta em quantidade e em qualidade, enquanto que por outro, a destruição de habitats nos grandes biomas brasileiros se mantém em taxas alarmantes. Eu defendo que este paradoxo, numa perspectiva científica, tenha dois princípios centrais nos quais cientistas talvez devessem se concentrar. Primeiramente, embora as ciências relacionadas à biodiversidade no Brasil sejam de alto padrão se comparadas com o que é produzido no resto do mundo, o país ainda não detém a

  11. Oxidative addition of the C-I bond on aluminum nanoclusters

    Science.gov (United States)

    Sengupta, Turbasu; Das, Susanta; Pal, Sourav

    2015-07-01

    Energetics and the in-depth reaction mechanism of the oxidative addition step of the cross-coupling reaction are studied in the framework of density functional theory (DFT) on aluminum nanoclusters. Aluminum metal in its bulk state is totally inactive towards carbon-halogen bond dissociation but selected Al nanoclusters (size ranging from 3 to 20 atoms) have shown a significantly lower activation barrier towards the oxidative addition reaction. The calculated energy barriers are lower than the gold clusters and within a comparable range with the conventional and most versatile Pd catalyst. Further investigations reveal that the activation energies and other reaction parameters are highly sensitive to the geometrical shapes and electronic structures of the clusters rather than their size, imposing the fact that comprehensive studies on aluminum clusters can be beneficial for nanoscience and nanotechnology. To understand the possible reaction mechanism in detail, the reaction pathway is investigated with the ab initio Born Oppenheimer Molecular Dynamics (BOMD) simulation and the Natural Bond Orbital (NBO) analysis. In short, our theoretical study highlights the thermodynamic and kinetic details of C-I bond dissociation on aluminum clusters for future endeavors in cluster chemistry.Energetics and the in-depth reaction mechanism of the oxidative addition step of the cross-coupling reaction are studied in the framework of density functional theory (DFT) on aluminum nanoclusters. Aluminum metal in its bulk state is totally inactive towards carbon-halogen bond dissociation but selected Al nanoclusters (size ranging from 3 to 20 atoms) have shown a significantly lower activation barrier towards the oxidative addition reaction. The calculated energy barriers are lower than the gold clusters and within a comparable range with the conventional and most versatile Pd catalyst. Further investigations reveal that the activation energies and other reaction parameters are highly

  12. Incognito ergo sum. O wytwarzaniu obojętności

    Directory of Open Access Journals (Sweden)

    Joanna Tokarska-Bakir

    2014-06-01

    Full Text Available Incognito ergo sum: on indifference  The present article is an analysis of various types of indifference of non-Jewish inhabitants of Warsaw to the plight of Jewish Poles. The words of Krzysztof Dunin-Wąsowicz, a historian and “Żegota” activist, provide the vantage point for the analysis: Dunin-Wąsowicz claimed that around 75 per cent of the inhabitants of Warsaw “were indifferent to what was taking place behind the Ghetto wall”. Thomas Kuhne hypothesised that it was Germans’ indifference to the Jewish – not hatred – that legitimised the Nazi racial policies of the 1930s. This statement might also apply to the “75 per cent of the inhabitants of Warsaw”. The article is mainly based on articles published by ZWZ-AK, in particular Biuletyn Informacyjny.   Incognito ergo sum. O wytwarzaniu obojętności Autorka analizuje różne odcienie obojętności nieżydowskich mieszkańców Warszawy w latach czterdziestych wobec losu żydowskich Polaków. Punktem wyjścia jest zdanie Krzysztofa Dunin-Wąsowicza, historyka i działacza „Żegoty”, który stwierdził, że dla około 75 procent mieszkańców Warszawy „obojętne było to, co działo się poza murem getta”. Powołując się na tezę Thomasa Kuhnego, że to właśnie obojętność Niemców wobec Żydów – a nie nienawiść w stosunku do nich – „spowodowała masowe poparcie nazistowskiej polityki rasowej w latach trzydziestych”, autorka zastanawia się, czy „podobnej opinii nie można by sformułować pod adresem” 75 procent mieszkańców Warszawy. Materiał do analizy stanowią w znacznej mierze publikacje prasy ZWZ-AK, w tym przede wszystkim „Biuletyn Informacyjny”.

  13. Comets as Parent Bodies of CI1 Carbonaceous Meteorites and Possible Habitats of Ice-Microbiota

    Science.gov (United States)

    Wickramasinghe, N. Chandra; Wallis, Daryl H.; Rozanov, Alexei Yu.; Hoover, Richard B.

    2011-01-01

    Recent studies of comets and cometary dust have confirmed the presence of biologically relevant organic molecules along with clay minerals and water ice. It is also now well established by deuterium/hydrogen ratios that the CI1 carbonaceous meteorites contain indigenous extraterrestrial water. The evidence of extensive aqueous alteration of the minerals in these meteorites led to the hypothesis that water-bearing asteroids or comets represent the parent bodies of the CI1 (and perhaps CM2) carbonaceous meteorites. These meteorites have also been shown to possess a diverse array of complex organics and chiral and morphological biomarkers. Stable isotope studies by numerous independent investigators have conclusively established that the complex organics found in these meteorites are both indigenous and extraterrestrial in nature. Although the origin of these organics is still unknown, some researchers have suggested that they originated by unknown abiotic mechanisms and may have played a role in the delivery of chiral biomolecules and the origin of life on Early Earth. In this paper we review these results and investigate the thermal history of comets. We show that permanent as well as transient domains of liquid water can be maintained on a comet under a plausible set of assumptions. With each perihelion passage of a comet volatiles are preferentially released, and during millions of such passages the comet could shed crustal debris that may survive transit through the Earth s atmosphere as a carbonaceous meteorite. We review the current state of knowledge of comets and carbonaceous meteorites. We also present the results of recent studies on the long-term viability of terrestrial ice-microbiota encased in ancient glacial ice and permafrost. We suggest that the conditions which have been observed to prevail on many comets do not preclude either survivability (or even the active metabolism and growth) of many types of eukaryotic and prokaryotic microbial

  14. Globalização: novo paradigma das ciências sociais

    Directory of Open Access Journals (Sweden)

    Octavio Ianni

    1994-08-01

    Full Text Available As ciências sociais estão sendo desafiadas a pensar a globalização do mundo. No fim do século XX, quando se anuncia o XXI, elas se defrontam com os dilemas que se abrem com a globalização das coisas, gentes e idéias. Há processos e estruturas sociais, econômicos, políticos, culturais e outros que apenas começam a ser estudados. Além do que é local, nacional e regional, colocam-se problemas novos e fundamentais com a emergência da sociedade global. As fronteiras geográficas e históricas, culturais e civilizatórias parecem modificar-se em direções e formas surpreendentes. Indivíduo, grupo, classe, coletividade e povo são colocados diante de outros horizontes. O próprio pensamento científico é desafiado a elaborar conceitos e interpretações para dar conta de realidades pouco conhecidas. As teorias da globalização, que começam a ser esboçadas, revelam o empenho das ciências sociais em explicar o que há de novo no que vai pelo mundo.Social sciences are now being challenged to think on the world's globalization. At the end of the twentieth century and dawn of the twenty first, they are faced with the dilemas that open up with the globalization of things, people and ideas: There are social, economical, political, cultural and other processes and structures that are just begining to be studied. Besides what is local, national and regional, new and fundamental problems appear with the rising global society. The geographic, historical, cultural and civilizatorian limits seem to change in surprising ways and directions. The individual, group, class, colectivity and people are put before other horizons. The scientific thinking itself is called upon to elaborate concepts and interpretations to account for little known realities. The globalization theories that are just being sketched show the efforts of Social Sciences to explain what is new going on in the world.

  15. Gry w podmiot. Szkic o (wczesnej twórczości Mladena Stilinovicia

    Directory of Open Access Journals (Sweden)

    Magdalena Bogusławska

    2016-10-01

    Full Text Available Games of a subject: A sketch of the (early works of Mladen Stilinović The article concerns the conceptualization of the subject in the works of the contemporary Croatian visual artist Mladen Stilinović. The object of analysis are most of all works (collages, texts from the 1970s and early 1980s, when the artist formulated the basis for his creative philosophy and at the same time determined the directions of their research. His system of reference were the socialist state order and the traditionalist, academic system of artistic practice, which he criticized from the perspectives of Diogenes, philosophical Cynicism and constructive anarchism. Until this day, the attitude of resistance is the main creative principle for Stilinović’s art. He sets strong, conscious and autonomous creator’s “I” against symbolic violence of different systems (political, ideological, educational, etc.. This “I” is not so much the material and object of expression as a space of play based on concpetualism and self-irony.   Gry w podmiot. Szkic o (wczesnej twórczości Mladena Stilinovicia Artykuł dotyczy konceptualizacji podmiotu w twórczości współczesnego chorwackiego artysty wizualnego – Mladena Stilinovicia. Przedmiotem analizy są przede wszystkim prace (kolaże, teksty z lat 70. i początku 80. XX wieku, kiedy to artysta formułował podstawy filozofii twórczej i określał kierunki swych poszukiwań. Układem odniesienia były dla niego wówczas socjalistyczny porządek państwa i tradycjonalistyczny, akademicki system praktyki artystycz­nej, które poddawał konsekwentnej krytyce z pozycji rozumnego, diogenesowskiego cynizmu i konstruktywnego anarchizmu. Do dziś postawa oporu jest dla Stilinovicia podstawową zasadą twórczą. Przemocy symbolicznej wszelkich systemów (politycznych, ideologicznych, edukacyjnych itp. przeciwstawia mocne, świadome i niezależne „ja” twórcy. Jest tu ono nie tyle tworzywem i przedmiotem ekspresji

  16. W okowach etniczności? Wybrane partie etnoregionalne w Serbii i Chorwacji (1990–2012

    Directory of Open Access Journals (Sweden)

    Dominika Mikucka-Wójtowicz

    2014-12-01

    Full Text Available In the grip of ethnicity? The functioning of selected ethnoregionalist parties in Serbia and Croatia In the last twenty years we have been able to observe an increase in the significance of regional and ethnic identities (“reethnification”, and a resultant proliferation of ethnoregional and regional groupings. But although ethnoregionalist parties (ERP are widespread in both Western and Central and Eastern Europe, there remains surprisingly little literature differentiating between the various kinds of ethnoregionalist parties and dealing with the lack of common definition of this kind of political actors. Some scholars even propose using a broader term – ethnic party. Moreover, over the years many scholars have believed (and some continue to that their emergence in multicultural societies conjures up the politicisation of ethnic division and – practically inevitably – leads to “ethnic outbidding”, threatening to the stability of democracy. In the first part of the paper, the author deals with the conceptualisation of ethnoregionalist parties, examining the diversifications of their demands and strategies and showing that to gain voters they can invoke a much broader repertoire of strategies than the ethnic outbidding model suggested. The second part of the article is devoted to the problem of operation of selected ERPs in Serbia and Croatia. The analysis covers Hungarian parties in Serbia and Serbian ones in Croatia. In the concluding remarks, the author tries to point out the main reasons for the changes in their strategy (as well as demands over time.   W okowach etniczności? Wybrane partie etnoregionalne w Serbii i Chorwacji (1990–2012 Na przestrzeni ostatnich dwóch dekad możemy obserwować wyraźny wzrost znaczenia regionalnych i etnicznych tożsamości, prowadzący do powstawania coraz większej liczby ugrupowań etnoregionalnych i regionalnych. Mimo to – podobnie jak w przypadku wielu innych, istotnych i aktualnych

  17. Comets as parent bodies of CI1 carbonaceous meteorites and possible habitats of ice-microbes

    Science.gov (United States)

    Wickramasinghe, N. Chandra; Wickramasinghe, Janaki T.; Wallis, Jamie; Hoover, Richard B.; Rozanov, Alexei Y.

    2011-10-01

    Recent studies of comets and cometary dust have confirmed the presence of biologically relevant organic molecules along with clay minerals and water ice. It is also now well established by deuterium/hydrogen ratios that the CI1 carbonaceous meteorites contain indigenous extraterrestrial water. The evidence of extensive aqueous alteration of the minerals in these meteorites led to the hypothesis that water-bearing asteroids or comets represent the parent bodies of the CI1 (and perhaps CM2) carbonaceous meteorites. These meteorites have also been shown to possess a diverse array of complex organics and chiral and morphological biomarkers. Stable isotope studies by numerous independent investigators have conclusively established that the complex organics found in these meteorites are both indigenous and extraterrestrial in nature. Although the origin of these organics is still unknown, some researchers have suggested that they originated by unknown abiotic mechanisms and may have played a role in the delivery of chiral biomolecules and the origin of life on Early Earth. In this paper we review these results and investigate the thermal history of comets. We show that permanent as well as transient domains of liquid water can be maintained on a comet under a plausible set of assumptions. With each perihelion passage of a comet volatiles are preferentially released, and during millions of such passages the comet could shed crustal debris that may survive transit through the Earth's atmosphere as a carbonaceous meteorite. We review the current state of knowledge of comets and carbonaceous meteorites. We also present the results of recent studies on the long-term viability of terrestrial ice-microbiota encased in ancient glacial ice and permafrost. We suggest that the conditions which have been observed to prevail on many comets do not preclude either survivability (or even the active metabolism and growth) of many types of eukaryotic and prokaryotic microbial

  18. Bioinformatic analysis of the distribution of inorganic carbon transporters and prospective targets for bioengineering to increase Ci uptake by cyanobacteria.

    Science.gov (United States)

    Gaudana, Sandeep B; Zarzycki, Jan; Moparthi, Vamsi K; Kerfeld, Cheryl A

    2015-10-01

    Cyanobacteria have evolved a carbon-concentrating mechanism (CCM) which has enabled them to inhabit diverse environments encompassing a range of inorganic carbon (Ci: [Formula: see text] and CO2) concentrations. Several uptake systems facilitate inorganic carbon accumulation in the cell, which can in turn be fixed by ribulose 1,5-bisphosphate carboxylase/oxygenase. Here we survey the distribution of genes encoding known Ci uptake systems in cyanobacterial genomes and, using a pfam- and gene context-based approach, identify in the marine (alpha) cyanobacteria a heretofore unrecognized number of putative counterparts to the well-known Ci transporters of beta cyanobacteria. In addition, our analysis shows that there is a huge repertoire of transport systems in cyanobacteria of unknown function, many with homology to characterized Ci transporters. These can be viewed as prospective targets for conversion into ancillary Ci transporters through bioengineering. Increasing intracellular Ci concentration coupled with efforts to increase carbon fixation will be beneficial for the downstream conversion of fixed carbon into value-added products including biofuels. In addition to CCM transporter homologs, we also survey the occurrence of rhodopsin homologs in cyanobacteria, including bacteriorhodopsin, a class of retinal-binding, light-activated proton pumps. Because they are light driven and because of the apparent ease of altering their ion selectivity, we use this as an example of re-purposing an endogenous transporter for the augmentation of Ci uptake by cyanobacteria and potentially chloroplasts.

  19. Identification and Validation of Novel Hedgehog-Responsive Enhancers Predicted by Computational Analysis of Ci/Gli Binding Site Density.

    Directory of Open Access Journals (Sweden)

    Katherine Gurdziel

    Full Text Available The Hedgehog (Hh signaling pathway directs a multitude of cellular responses during embryogenesis and adult tissue homeostasis. Stimulation of the pathway results in activation of Hh target genes by the transcription factor Ci/Gli, which binds to specific motifs in genomic enhancers. In Drosophila, only a few enhancers (patched, decapentaplegic, wingless, stripe, knot, hairy, orthodenticle have been shown by in vivo functional assays to depend on direct Ci/Gli regulation. All but one (orthodenticle contain more than one Ci/Gli site, prompting us to directly test whether homotypic clustering of Ci/Gli binding sites is sufficient to define a Hh-regulated enhancer. We therefore developed a computational algorithm to identify Ci/Gli clusters that are enriched over random expectation, within a given region of the genome. Candidate genomic regions containing Ci/Gli clusters were functionally tested in chicken neural tube electroporation assays and in transgenic flies. Of the 22 Ci/Gli clusters tested, seven novel enhancers (and the previously known patched enhancer were identified as Hh-responsive and Ci/Gli-dependent in one or both of these assays, including: Cuticular protein 100A (Cpr100A; invected (inv, which encodes an engrailed-related transcription factor expressed at the anterior/posterior wing disc boundary; roadkill (rdx, the fly homolog of vertebrate Spop; the segment polarity gene gooseberry (gsb; and two previously untested regions of the Hh receptor-encoding patched (ptc gene. We conclude that homotypic Ci/Gli clustering is not sufficient information to ensure Hh-responsiveness; however, it can provide a clue for enhancer recognition within putative Hedgehog target gene loci.

  20. Verdade da Metafí­sica: Descartes na Rota da Descoberta dos Fundamentos da Ciência

    OpenAIRE

    2010-01-01

    Este artigo trata fundamentalmente de dois grandes aspectos da filosofia de Descartes: a metafísica como fundamento da Ciência e a própria concepçáo cartesiana de Ciência. Na abordagem da primeira questáo – formalmente a primeira parte deste artigo – procura-se evidenciar a metafísica como forjadora de uma concepçáo de verdade e como alicerce para o conhecimento certo e indubitável, ponto de partida para se fundar as ciências. Esta primeira parte apresenta, inicialmente, a concepçáo metafísic...

  1. Degradation of C.I. Reactive Red 2 through photocatalysis coupled with water jet cavitation.

    Science.gov (United States)

    Wang, Xiaoning; Jia, Jinping; Wang, Yalin

    2011-01-15

    The decolorization of an azo dye, C.I. Reactive Red 2 was investigated using TiO(2) photocatalysis coupled with water jet cavitation. Experiments were performed in a 4.0 L solution under ultraviolet power of 9 W. The effects of TiO(2) loading, initial dye concentration, solution pH, geometry of cavitation tube, and the addition of anions on the degradation of the dye were evaluated. Degradation of the dye followed a pseudo-first order reaction. The photocatalysis coupled with water jet cavitation elevated degradation of the dye by about 136%, showing a synergistic effect compared to the individual photocatalysis and water jet cavitation. The enhancement of photocatalysis by water jet cavitation could be due to the deagglomeration of catalyst particles as well as the better contact between the catalyst surfaces and the reactants. Venturi tube with smaller diameter and shorter length of throat tube favored the dye decolorization. The degradation efficiency was found to increase with decreasing initial concentration and pH. The presence of NO(3)(-) and SO(4)(2-) enhanced the degradation of RR2, while Cl(-), and especially HCO(3)(-) significantly reduced dye decolorization. The results of this study indicated that the coupled photocatalysis and water jet cavitation is effective in degrading dye in wastewater and provides a promising alternative for treatment of dye wastewater at a large scale. Copyright © 2010 Elsevier B.V. All rights reserved.

  2. Hydrogen Isotopes of Glassy and Phyllosilicate Spherules in Al Rais (CR) and Orgueil (CI) Chondrites

    Institute of Scientific and Technical Information of China (English)

    GUAN Yunbin; Michael E. ZOLENSKY

    2004-01-01

    The hydroxyl in phyllosilicate minerals is the most common occurrence of water in primitive meteorites.Direct hydrogen isotopic analysis of this water component using an ion microprobe has been made in some glassy or phyllosilicate spherules from the Al Rais (CR) and Orgueil (CI) chondrites. The spherules from Al Rais show large deuterium excesses (δD = +200 - +800) relative to terrestrial standards, whereas deuterium-enrichments in the spherules from Orgueil are much smaller (δD = +40 - +130‰). The phyllosilicate spherules are products of aqueous alteration of glassy precursors. In A1 Rais the phyllosilicate spherules have relatively higher δD values than the glassy ones, indicating that water introduced during aqueous alteration was deuterium-enriched. The deuterium-enrichments in the phyllosilicate spherules from Orgueil could result from isotopic exchange under thermodynamic conditions within the solar nebula. The much larger δD excesses of the Al Rais spherules, however, cannot be attributed to the similar process;instead, an interstellar origin needs to be invoked.

  3. Ciência & Saúde Coletiva: scientific production analysis and collaborative research networks.

    Science.gov (United States)

    Conner, Norma; Provedel, Attilio; Maciel, Ethel Leonor Noia

    2017-03-01

    The purpose of this metric and descriptive study was to identify the most productive authors and their collaborative research networks from articles published in Ciência & Saúde Coletiva between, 2005, and 2014. Authors meeting the cutoff criteria of at least 10 articles were considered the most productive authors. VOSviewer and Network Workbench technologies were applied for visual representations of collaborative research networks involving the most productive authors in the period. Initial analysis recovered 2511 distinct articles, with 8920 total authors with an average of 3.55 authors per article. Author analysis revealed 6288 distinct authors, 24 of these authors were identified as the most productive. These 24 authors generated 287 articles with an average of 4.31 authors per article, and represented 8 separate collaborative partnerships, the largest of which had 14 authors, indicating a significant degree of collaboration among these authors. This analysis provides a visual representation of networks of knowledge development in public health and demonstrates the usefulness of VOSviewer and Network Workbench technologies in future research.

  4. Touraine e Bourdieu nas ciências sociais brasileiras: duas recepções diferenciadas

    Directory of Open Access Journals (Sweden)

    José Sergio Leite Lopes

    2013-06-01

    Full Text Available Ao retomar o tema da recepção da obra de Pierre Bourdieu no Brasil, o presente artigo o faz a partir da comparação com a recepção de outro sociólogo francês, Alain Touraine, anteriormente implantado na circulação de ideias e redes de pesquisadores entre os dois países. A trajetória dos dois no que diz respeito a sua relação com o campo das ciências sociais brasileiras pode ser uma pista interessante para o conhecimento de aspectos deste mesmo campo no que se refere a sua inserção na circulação internacional de ideias e de pesquisadores. A bagagem acumulada de sociologia industrial de Touraine fez com que fosse procurado pela sociologia uspiana no momento em que as pesquisas sobre o fenômeno industrial de São Paulo eclodiam. Já a apropriação de Bourdieu incide sobre gerações subsequentes, e, ao ter adquirido renome nos anos 1990 nos países anglo-saxônicos, já era bem conhecido nos círculos especializados brasileiros.

  5. PERFORMANCE AND EMISSION CHARACTERISTICS OF A CI ENGINE OPERATED ON VEGETABLE OILS AS ALTERNATIVE FUELS

    Directory of Open Access Journals (Sweden)

    K. Rajagopal

    2011-12-01

    Full Text Available An experimental analysis was done using a four-stroke, single cylinder, constant speed, water-cooled diesel engine, which was interfaced with Engine software. Performance and emission characteristics were evaluated for three non-edible vegetable oils, i.e. thumba, jojoba, neem oil, as well as jojoba methyl ester, to study the effect of injection pressure at 205, 220, 240 and 260 bar with a variation in injection timing at 23°bTDC and 28°bTDC. The performance of jojoba methyl ester improved with an increase in injection pressure. A maximum brake thermal efficiency of 29.72% was obtained with lower emissions compared to the other vegetable oils; this might be explained by low viscosity and better combustion. Further investigations were carried out with a new lubricant, SAE 5W-30, which improved the performance of the CI engine by 1.59%. All of the abovementioned investigations were fruitful and these results are expected to lead to substantial contributions in the development of a viable vegetable oil engine.

  6. O pensamento representacional e sua atualização nas ciências humanas

    Directory of Open Access Journals (Sweden)

    Eduardo Maurício Bomfim

    2012-04-01

    Full Text Available As ciências humanas ocupam um lugar particular na produção do conhecimento. Surgidas em decorrência de mudanças gerais na estrutura epistemológica e político-administrativa do século XIX, elas adquirem uma configuração específica que as localiza no cruzamento de vários outros saberes, como apontado pelo historiador Michel Foucault. Além disso, elas comportam outra peculiaridade, caracterizando-se em sua atividade por uma estreita relação com o que o filósofo Gilles Deleuze denomina de modelo da representação. A partir das análises de algumas obras destes dois pensadores, veremos como esses saberes operam uma atualização da representação por meio da normalização dos indivíduos.

  7. Interaction between toxic azo dye C.I. Acid Red 88 and serum albumins

    Energy Technology Data Exchange (ETDEWEB)

    Naveenraj, Selvaraj [Nanomaterials and Solar Energy Conversion Lab, Department of Chemistry, National Institute of Technology, Tiruchirappalli 620015 (India); Solomon, Rajadurai Vijay; Venuvanalingam, Ponnambalam [School of Chemistry, Bharathidasan University, Tiruchirappalli 620024 (India); Asiri, Abdullah M. [The Center of Excellence for Advanced Materials Research, King Abdulaziz University, Jeddah 21413, P.O. Box 80203 (Saudi Arabia); Anandan, Sambandam, E-mail: sanand@nitt.edu [Nanomaterials and Solar Energy Conversion Lab, Department of Chemistry, National Institute of Technology, Tiruchirappalli 620015 (India)

    2013-11-15

    Serum albumin-toxic dye interaction studies will be of paramount importance in the field of toxicology due to its relation towards the distribution and transportation of dye in blood. In this regard, the binding between C.I. Acid Red 88 (AR88) and serum albumins (HSA and BSA) was investigated by using combination of spectroscopic and molecular modeling methods. The fluorescence results revealed that AR88 interact with serum albumins through the combination of static and dynamic quenching mechanism. The distance “r” between serum albumin and AR88 was obtained according to the Forster resonance energy transfer (FRET) theory. Synchronous fluorescence and CD spectral results showed alterations in the microenvironment and conformation of serum albumins. The molecular docking method is also employed to understand the interaction of AR88 with serum albumins. All these studies confirm that BSA has more affinity towards AR88 than that of HSA which suggests that AR88 is more easily transported in the body of bovid than human and so it is more hazardous to bovids. -- Highlights: • AR88 interacts with serum albumin through the combination of both static and dynamic quenching mechanism. • The binding site of AR88 in serum albumins is nearer to tryptophan moiety. • Circular Dichroism spectra showed that AR88 alters α-helicity of serum albumin. • This interaction study could be greatly imperative for further investigations in toxicology.

  8. Intracochlear Fluid Pressure Changes Related to the Insertional Speed of a CI Electrode

    Directory of Open Access Journals (Sweden)

    I. Todt

    2014-01-01

    Full Text Available Introduction. To preserve residual hearing the atraumaticity of the cochlea electrode insertion has become a focus of cochlear implant research. In addition to other factors, the speed of insertion is thought to be a contributing factor in the concept of atraumatic implantation. The aim of our study was to observe intracochlear fluid pressure changes due to different insertional speeds of an implant electrode in a cochlear model. Materials and Methods. The experiments were performed using an artificial cochlear model. A linear actuator was mounted on an Advanced Bionics IJ insertional tool. The intracochlear fluid pressure was recorded through a pressure sensor which was placed in the helicotrema area. Defined insertions were randomly performed with speeds of 0.1 mm/sec, 0.25 mm/sec, 0.5 mm/sec, 1 mm/sec, and 2 mm/sec. Results. A direct correlation between speed and pressure was observed. Mean maximum values of intracochlear fluid pressure varied between 0.41 mm Hg and 1.27 mm Hg. Conclusion. We provide the first results of fluid pressure changes due to insertional speeds of CI electrodes in a cochlear model. A relationship between the insertional speed and intracochlear fluid pressure was observed. Further experiments are needed to apply these results to the in vivo situation.

  9. Metagenomic and stable isotopic analyses of modern freshwater microbialites in Cuatro Ciénegas, Mexico.

    Science.gov (United States)

    Breitbart, Mya; Hoare, Ana; Nitti, Anthony; Siefert, Janet; Haynes, Matthew; Dinsdale, Elizabeth; Edwards, Robert; Souza, Valeria; Rohwer, Forest; Hollander, David

    2009-01-01

    Ancient biologically mediated sedimentary carbonate deposits, including stromatolites and other microbialites, provide insight into environmental conditions on early Earth. The primary limitation to interpreting these records is our lack of understanding regarding microbial processes and the preservation of geochemical signatures in contemporary microbialite systems. Using a combination of metagenomic sequencing and isotopic analyses, this study describes the identity, metabolic potential and chemical processes of microbial communities from living microbialites from Cuatro Ciénegas, Mexico. Metagenomic sequencing revealed a diverse, redox-dependent microbial community associated with the microbialites. The microbialite community is distinct from other marine and freshwater microbial communities, and demonstrates extensive environmental adaptation. The microbialite metagenomes contain a large number of genes involved in the production of exopolymeric substances and the formation of biofilms, creating a complex, spatially structured environment. In addition to the spatial complexity of the biofilm, microbial activity is tightly controlled by sensory and regulatory systems, which allow for coordination of autotrophic and heterotrophic processes. Isotopic measurements of the intracrystalline organic matter demonstrate the importance of heterotrophic respiration of photoautotrophic biomass in the precipitation of calcium carbonate. The genomic and stable isotopic data presented here significantly enhance our evolving knowledge of contemporary biomineralization processes, and are directly applicable to studies of ancient microbialites.

  10. Da metamatemática para a ciência cognitiva From metamathematics to Cognitive Science

    Directory of Open Access Journals (Sweden)

    Henrique de Morais Ribeiro

    1999-01-01

    Full Text Available Neste artigo, propõe-se uma configuração possível para a transição histórico-filosófica de temas investigados no domínio da metamatemática para o domínio da Ciência Cognitiva funcionalista neurocomputacional. A descrição de tal transição é feita por meio de uma breve análise das idéias de Post, Church, Gödel e Turing sobre a possibilidade de formalização do pensamento criador na matemática, enfatizando as contribuições deste último.In this article, it is suggested a possible profile for the historical and philosophical migration of several issues from the metamathematical domain to the domain of functionalist neuro-computational Cognitive Science. The description of such a transition is accomplished by an analysis of the ideas of Post, Church, Gödel, and, in particular, Turing on the possibility of formalization of creative thinking in Mathematics.

  11. Influence of operating parameters on electrocoagulation of C.I. disperse yellow 3

    Directory of Open Access Journals (Sweden)

    Djamel Ghernaout

    2014-12-01

    Full Text Available This work deals with the electrocoagulation (EC process for an organic dye removal. The chosen organic dye is C.I. disperse yellow 3 (DY which is used in textile industry. Experiments were performed in batch mode using Al electrodes and for comparison purposes Fe electrodes. The experimental set-up was composed of 1 L beaker, two identical electrodes which are separated 2 cm from each other. The main operating parameters influencing EC process were examined such as pH, supporting electrolyte concentration CNaCl, current density i, and DY concentration. High performance EC process was shown during 45 min for 200 mg/L dye concentration at i = 350 A m-2 (applied voltage 12 V and CNaCl = 1 g L-1 reaching 98 % for pHs 3 and 10 and 99 % for pH 6. After 10 min, DY was also efficiently removed (86 % showing that EC process may be conveniently applied for textile industry wastewater treatment. EC using Fe electrodes exhibited slightly lower performance comparing EC using Al electrodes.

  12. The Careful Puppet Master: Reducing risk and fortifying acceptance testing with Jenkins CI

    Science.gov (United States)

    Smith, Jason A.; Richman, Gabriel; DeStefano, John; Pryor, James; Rao, Tejas; Strecker-Kellogg, William; Wong, Tony

    2015-12-01

    Centralized configuration management, including the use of automation tools such as Puppet, can greatly increase provisioning speed and efficiency when configuring new systems or making changes to existing systems, reduce duplication of work, and improve automated processes. However, centralized management also brings with it a level of inherent risk: a single change in just one file can quickly be pushed out to thousands of computers and, if that change is not properly and thoroughly tested and contains an error, could result in catastrophic damage to many services, potentially bringing an entire computer facility offline. Change management procedures can—and should—be formalized in order to prevent such accidents. However, like the configuration management process itself, if such procedures are not automated, they can be difficult to enforce strictly. Therefore, to reduce the risk of merging potentially harmful changes into our production Puppet environment, we have created an automated testing system, which includes the Jenkins CI tool, to manage our Puppet testing process. This system includes the proposed changes and runs Puppet on a pool of dozens of RedHat Enterprise Virtualization (RHEV) virtual machines (VMs) that replicate most of our important production services for the purpose of testing. This paper describes our automated test system and how it hooks into our production approval process for automatic acceptance testing. All pending changes that have been pushed to production must pass this validation process before they can be approved and merged into production.

  13. COMBUSTION CHARACTERISTICS OF CI ENGINE USING KARANJA BIODIESEL BLENDS AS FUEL

    Directory of Open Access Journals (Sweden)

    H.A. PHADTARE

    2013-05-01

    Full Text Available Karanja based bio-diesel is a non-edible, biodegradable fuel suitable for diesel engines. Karanja biodiesel has been prepared by transesterification method. Biodiesel-diesel blends have been prepared on volume basis. Physical properties of Karanja biodiesel, diesel and its blends have been determined. An experimentalinvestigation has been carried out to analyze combustion characteristics of a single cylinder, VCR diesel engine fuelled with Karanja biodiesel and its blends (10%, 20%, 30%, 50% and 75% with neat diesel. A series of engine tests, with CR 16.5, 17.5 and 18.5 have been conducted using each of the above blends for comparativeevaluation. Combustion parameters such as ignition delay, peak pressure development, heat release rate analysis of engine have been studied. The results of the experiment in each case have been compared with baseline data of neat diesel. Ignition delays of bio-diesel blends are lower than that of diesel; peak pressure takes place definitely after TDC for safe and efficient operation. Comparable rate of pressure rise obtained is indicative of stable and noise free operation of CI engines with karanja biodiesel blends. B10 is suitable alternative fuel for diesel at slightly higher CR can be used without any engine modifications.

  14. Role of a biodiesel blend in sustaining the energy and environment as a CI engine fuel

    Directory of Open Access Journals (Sweden)

    S.Saravanan, G.Nagarajan, G.Lakshmi Narayana rao, S.Sampath

    2011-01-01

    Full Text Available In the present work, biodiesel derived from high free fatty acid (FFA crude rice bran oil, (CRBO a non-edible vegetable oil was tested as a fuel in a compression ignition engine in blended form to test its suitability and also its ability to create a sustainable environment. A 4.4 kW direct injection stationary diesel engine was used for experimentation. Biodiesel (crude rice bran oil methyl ester blend was prepared by mixing 20 % crude rice bran oil methyl ester (CRBME with 80 % diesel on volume basis. An enhanced thermal oxidation was observed for the CRBME blend which oxidizes most of the UBHC into CO and CO2. As a result of this, UBHC emission and smoke density were reduced by 28 % and 35 % respectively with a marginal increase in CO and NOx emission than diesel. It was also observed that by blending CRBME with diesel, the brake thermal efficiency of the engine decreased only marginally which ensures the suitability of CRBME blend as a CI engine fuel. Experimental results show almost similar performance in CRBME blend when compared to diesel which strengthens its ability to have a sustainable environment. This research work can be extended to improve the thermal oxidation process which may result in further reduction in CO, UBHC and particulate emission than that of the emissions reported in this paper.

  15. Synthesis of Petroleum-Based Fuel from Waste Plastics and Performance Analysis in a CI Engine

    Directory of Open Access Journals (Sweden)

    Christine Cleetus

    2013-01-01

    Full Text Available The present work involves the synthesis of a petroleum-based fuel by the catalytic pyrolysis of waste plastics. Catalytic pyrolysis involves the degradation of the polymeric materials by heating them in the absence of oxygen and in the presence of a catalyst. In the present study different oil samples are produced using different catalysts under different reaction conditions from waste plastics. The synthesized oil samples are subjected to a parametric study based on the oil yield, selectivity of the oil, fuel properties, and reaction temperature. Depending on the results from the above study, an optimization of the catalyst and reaction conditions was done. Gas chromatography-mass spectrometry of the selected optimized sample was done to find out its chemical composition. Finally, performance analysis of the selected oil sample was carried out on a compression ignition (CI engine. Polythene bags are selected as the source of waste plastics. The catalysts used for the study include silica, alumina, Y zeolite, barium carbonate, zeolite, and their combinations. The pyrolysis reaction was carried at polymer to catalyst ratio of 10 : 1. The reaction temperature ranges between 400°C and 550°C. The inert atmosphere for the pyrolysis was provided by using nitrogen as a carrier gas.

  16. O ciúme enquanto sintoma do transtorno obsessivo-compulsivo

    Directory of Open Access Journals (Sweden)

    Torres Albina Rodrigues

    1999-01-01

    Full Text Available O ciúme patológico (CP é um problema importante para a psiquiatria, que envolve riscos e muito sofrimento, podendo ocorrer em diversos transtornos mentais. Psicopatologicamente pode se apresentar de formas distintas, tais como idéias obsessivas, prevalentes ou delirantes sobre infidelidade. Entretanto, sua apresentação no transtorno obsessivo-compulsivo (TOC, como uma obsessão em geral associada a rituais de verificação, é relativamente pouco documentada. Para discutir esse aspecto específico do CP, este trabalho é ilustrado com quatro casos clínicos selecionados, em que o CP tem tais características, abordando aspectos de diagnóstico e tratamento. A compreensão de alguns casos de CP como uma manifestação do TOC, mesmo quando não claramente egodistônica, amplia as possibilidades terapêuticas e pode melhorar o prognóstico.

  17. Biodegradation of C.I. Reactive Red 195 by Enterococcus faecalis strain YZ66.

    Science.gov (United States)

    Mate, Madhuri Sahasrabudhe; Pathade, Girish

    2012-03-01

    Synthetic dyes are extensively used in textile dyeing, paper, printing, colour photography, pharmaceutics, cosmetics and other industries. Among these, azodyes represents the largest and most versatile class of synthetic dyes. As high as 50% of the dyes are released into the environment during manufacture and usage. Traditional methods of treatment are found to be expensive and have operational problems. Biological decolourization has been investigated as a method to transform, degrade or mineralize azo dyes. In the present studies bacteria from soil from dye waste area, dye waste, sewage and dung were subjected to acclimatization with C.I. Reactive Red 195 an azo dye, in the basal nutrient media. The most promising bacterial isolate was used for further dye degradation studies. The 16s rRNA gene sequencing and biochemical characteristics revealed the isolated organism as Enterococcus faecalis strain YZ66. The strain showed 99.5% decolourization of the selected dye (Reactive Red 195-50 mg/l) within one and half hour in static anoxic condition. The optimum pH and temperature for the decolourization was 5.0 and 40°C respectively. The biodegradation was monitored by UV-Vis, FTIR, TLC and HPLC. The final products were characterized by Gas chromatography and Mass Spectrophotometry. Toxicity study demonstrated no toxicity of the biodegradation product. The results suggest that the isolated organism E. faecalis strain YZ 66 can be used as a useful tool to treat waste water containing reactive dyes.

  18. Adsorption of C.I. Natural Red 4 onto Spongin Skeleton of Marine Demosponge

    Directory of Open Access Journals (Sweden)

    Małgorzata Norman

    2014-12-01

    Full Text Available C.I. Natural Red 4 dye, also known as carmine or cochineal, was adsorbed onto the surface of spongin-based fibrous skeleton of Hippospongia communis marine demosponge for the first time. The influence of the initial concentration of dye, the contact time, and the pH of the solution on the adsorption process was investigated. The results presented here confirm the effectiveness of the proposed method for developing a novel dye/biopolymer hybrid material. The kinetics of the adsorption of carmine onto a marine sponge were also determined. The experimental data correspond directly to a pseudo-second-order model for adsorption kinetics (r2 = 0.979–0.999. The hybrid product was subjected to various types of analysis (FT-IR, Raman, 13C CP/MAS NMR, XPS to investigate the nature of the interactions between the spongin (adsorbent and the dye (the adsorbate. The dominant interactions between the dye and spongin were found to be hydrogen bonds and electrostatic effects. Combining the dye with a spongin support resulted with a novel hybrid material that is potentially attractive for bioactive applications and drug delivery systems.

  19. A ontologia na ciência da informação

    Directory of Open Access Journals (Sweden)

    Geraldino Gonçalves Bastos

    2007-07-01

    Full Text Available Este artigo apresenta o uso do termo ontologia, a partir de levantamento da freqüência deste em artigos de periódicos indexados na Base LISA. Procurou-se identificar a evolução do volume de publicações em diversos idiomas, desde a primeira vez em que o termo foi utilizado, em 1977, até março de 2006; a relação do termo com outros temas e a identificação dos pesquisadores com maior contribuição acadêmica na área. Os dados encontrados sugerem que deve ser realizado um estudo qualitativo, como a análise de conteúdo dos resumos ou textos completos para estabelecer uma análise mais aprofundada do escopo em que a ontologia se vê inserida hoje no campo da Ciência da Informação.

  20. Educação física, ciência e cultura

    Directory of Open Access Journals (Sweden)

    Emerson Luís Velozo

    2010-05-01

    Full Text Available Este artigo discute algumas características da ciência moderna que têm influenciado a prática acadêmica na educação física e contribuído para que algumas de suas subáreas se tornem hegemônicas. Isso implica uma visão fragmentada, naturalizada e universalizada de ser humano e de realidade social. Alguns pressupostos defendidos pelo pensamento antropológico - a compreensão da realidade como dimensão cultural e simbólica, a noção de fato social total e a concepção sintética de homem - podem contribuir para desfragmentar, desnaturalizar e desuniversalizar o saber científico sobre a realidade social. Esses pressupostos podem fornecer subsídios para a compreensão da tradição acadêmica da educação física e para a sua discussão epistemológica

  1. Representação social da pesquisa pelos doutorandos em ciências exatas

    Directory of Open Access Journals (Sweden)

    Edna Maria Querido de Oliveira Chamon

    2014-05-01

    Full Text Available Propõe-se uma análise da representação social da atividade de pesquisa, classificada como fundamental e aplicada, pelos doutorandos que desenvolvem uma tese nas áreas de ciências exatas. Buscando identificar os processos de objetivação e ancoragem da representação social, organizou-se um questionário, que foi passado a um conjunto de 144 doutorandos. Uma análise fatorial identificou cinco eixos dominantes na representação social: 1 o projeto profissional do doutorando; 2 a definição ou modelo ideal de pesquisa; 3 a resolução de problemas; 4 a metodologia da pesquisa; e 5 a oposição entre teoria e prática ou entre conhecimento e trabalho. O conjunto dos resultados obtidos mostra uma nítida clivagem entre as atividades de pesquisa fundamental e aplicada, em termos de seus objetivos principais, problemas estudados e meios de pesquisa. A oposição entre conhecimento e trabalho sugere uma ancoragem em categorias preexistentes, disseminadas na população em geral.

  2. The slow decline of the Galactic recurrent novae T Pyxidis, IM Normae, and CI Aquilae

    CERN Document Server

    Caleo, Andrea

    2015-01-01

    A distinguishing trait of the three known Galactic recurrent novae with the shortest orbital periods, T Pyx, IM Nor, and CI Aql, is that their optical decline time-scales are significantly longer than those of the other recurrent systems. On the other hand, some estimates of the mass of the ejecta, the velocity of the ejecta, and the duration of the soft X-rays emission of these systems are of the order of those of the other recurrent systems and the fast classical novae. We put forth a tentative explanation of this phenomenon. We propose that in these systems part of the material transferred from the companion during the first few days of the eruption remains within the Roche lobe of the white dwarf, preventing the radiation from ionizing the ejecta of the system and increasing the optical decline time-scale. We explain why this phenomenon is more likely in systems with a high mass transfer rate and a short orbital period. Finally, we present a schematic model that shows that the material transferred from th...

  3. El Fons Millàs de la secció d'Història de la Ciència de la Biblioteca de Ciències i d'Enginyeries

    OpenAIRE

    2000-01-01

    El fons Millàs inclou unes 1300 monografies sobre ciència àrab, instruments científics, poesia hebrea medieval, història de l'astronomia i de les matemàtiques, i historiografia de la ciència; diverses sèries de publicacions periòdiques; i la col·lecció gairebé completa de les obres de Josep Maria Millàs

  4. On the Restoration and Construction of Qie Zhong Ci to the Object-chanting Ci Theory%《箧中词》对咏物词理论的修补和建构

    Institute of Scientific and Technical Information of China (English)

    袁美丽

    2012-01-01

    Qie Zhong Ci is an important Ci anthology in the Qing Dynasty Ci,widely admired by Ci theorists.Current studies of the anthology mainly focus on Tan Xian's theories on Ci,and the discussion of the composition of anthology.Yet few scholars have ever paid attention to the fact that a great number of object-chanting Ci are selected in Qie zhong Ci with comments.In this paper,the study mainly focuses on the Tan Xian's contribution in restoring and constructing the object-chanting Ci theory from the following four perspectives: meaning under the apparent form,representation with Bi Xing,aesthetic pursuit for naturalness and vagueness,and broad theoretical vision.%《箧中词》是清代重要的词选本,颇为词家推崇。目前对《箧中词》的研究多集中在探讨谭献的词学思想和从词选角度进行系统研究与理论阐释,而对《箧中词》编选大量咏物词并进行评点,学者们则关注较少。文章从别有怀抱的内蕴要求、比兴寄托的表现方法、幽涩自然的美学追求和广阔的理论视野四个方面来论述谭献对咏物词理论的修补和建构。

  5. Encontros possíveis: experiências com jogos teatrais no ensino de ciências

    Directory of Open Access Journals (Sweden)

    Thiago Ranniery Moreira de Oliveira

    2012-01-01

    Full Text Available O que pode acontecer entre o Teatro e o Ensino de Ciências? Quais as potencialidades da composição Ensino de Ciências com jogos teatrais? Que agenciamentos podem surgir desse encontro? Ao seguir as trilhas da filosofia da diferença em educação, inspirada em Gilles Deleuze, investiga-se, a partir de uma cartografia, a experiência da oficina de teatro Ciência inCena. Nela, alunos-atores escolheram o conteúdo de peixes a ser trabalhado a partir de jogos teatrais. O processo de montagem de Pedro e o mar ou como os peixes hão de voar indica possibilidades de se pensar outras narrativas para os sujeitos e objetos das aulas de ciências e as relações que os comportam.

  6. The role of CI and learning in an organizational change process-Experiences from a longitudinal study of organizational change

    DEFF Research Database (Denmark)

    Kofoed, Lise; Gertsen, Frank; Jørgensen, Frances

    2002-01-01

    Describes a longitudinal single-case study in which continuous improvement (CI) was implemented during a radical organisational change process. In this case, numerous organisation factors greatly hindered the full integration of certain planned radical changes. In an effort to circumvent...... these situational barriers, CI, with an emphasis on imbedded learning, was introduced through an action research methodology in the context of an experimental learning lab ("experimentarium"). Contrary to prevailing theory that suggests that CI serves primarily to support and supplement existing radical changes......, experiences from this study suggest that CI may be instrumental in facilitating the completion of the change cycle initiated by planned radical changes. Starts with a brief review of related theory, along with a discussion of the differences between radical and incremental changes. Followed by presentation...

  7. Ocena jakości obsługi klienta w procesie kształtowania jego satysfakcji

    OpenAIRE

    2012-01-01

    Celem pracy jest analiza wybranych sposobów oceny jakości obsługi klienta w procesie kształtowania jego satysfakcji. W pracy skupiono się na istocie i zastosowaniu mystery shopping. W części teoretycznej pracy zostały przedstawione wybrane zagadnienia z zakresu marketingu usług, satysfakcji klienta, standardów obsługi klienta, a także metodologia badań satysfakcji klienta. W części praktycznej pracy znajduje się opis badania jakości obsługi klientów ING Banku Śląskiego, kt...

  8. The role of CI and learning in an organizational change process-Experiences from a longitudinal study of organizational change

    DEFF Research Database (Denmark)

    Kofoed, Lise; Gertsen, Frank; Jørgensen, Frances

    2002-01-01

    these situational barriers, CI, with an emphasis on imbedded learning, was introduced through an action research methodology in the context of an experimental learning lab ("experimentarium"). Contrary to prevailing theory that suggests that CI serves primarily to support and supplement existing radical changes......, experiences from this study suggest that CI may be instrumental in facilitating the completion of the change cycle initiated by planned radical changes. Starts with a brief review of related theory, along with a discussion of the differences between radical and incremental changes. Followed by presentation......Describes a longitudinal single-case study in which continuous improvement (CI) was implemented during a radical organisational change process. In this case, numerous organisation factors greatly hindered the full integration of certain planned radical changes. In an effort to circumvent...

  9. Análise do comportamento e sociedade: implicações para uma ciência dos valores

    Directory of Open Access Journals (Sweden)

    Anne Carolynne Bogo

    Full Text Available O behaviorismo radical tem sido alvo de muitas críticas, principalmente no que se refere às questões éticas. A despeito dessas críticas, Skinner considera a análise do comportamento uma ciência dos valores, discutindo a moralidade em termos de comportamento moral. Entretanto, a afirmação de que a análise do comportamento é uma ciência dos valores pode ter consequências sociais distintas a depender do modelo de ciência adotado como pressuposto. O debate científico contemporâneo trata da crise do modelo moderno de ciência e do surgimento de outro: o modelo pós-moderno. Uma das diferenças entre essas duas propostas científicas refere-se à relação entre ciência e sociedade. Considerando esses aspectos, o objetivo deste trabalho é discutir qual modelo de ciência, moderno ou pós-moderno, norteia a assertiva skinneriana que declara a análise do comportamento uma ciência dos valores. Para tanto, serão apresentadas, inicialmente, algumas concepções tradicionais de explicação do comportamento moral e as principais críticas que Skinner dirige a elas. Em seguida, o sistema ético skinneriano será analisado, juntamente às questões sociais envolvidas na prática do analista do comportamento. E, por fim, discutir-se-á como cada modelo de ciência pode subsidiar práticas de intervenção diferentes, com consequências sociais igualmente distintas.

  10. Engineering of a Genetically Encodable Fluorescent Voltage Sensor Exploiting Fast Ci-VSP Voltage-Sensing Movements

    OpenAIRE

    Alicia Lundby; Hiroki Mutoh; Dimitar Dimitrov; Walther Akemann; Thomas Knöpfel

    2008-01-01

    Ci-VSP contains a voltage-sensing domain (VSD) homologous to that of voltage-gated potassium channels. Using charge displacement ('gating' current) measurements we show that voltage-sensing movements of this VSD can occur within 1 ms in mammalian membranes. Our analysis lead to development of a genetically encodable fluorescent protein voltage sensor (VSFP) in which the fast, voltage-dependent conformational changes of the Ci-VSP voltage sensor are transduced to similarly fast fluorescence re...

  11. Isolation of a new restriction enzyme, ApaCI, an isoschizomer of BamHI produced by Acetobacter pasteurianus.

    Science.gov (United States)

    Grones, J; Turna, J

    1992-01-01

    A new Type II restriction endonuclease ApaCI purified from Acetobacter pasteurianus is an isoschizomer of BamHI that cleaves at the nucleotide sequence 5'-G/GATCC-3' of double-stranded DNA. The single restriction activity present in this strain permits rapidly purified 30,000 units of cleavage activity from 10 g of freshly harvested cells. The resulting ApaCI preparation is free of contaminant nuclease activities that might interfere with in vitro manipulation of DNA.

  12. Possibility of a white dwarf as the accreting compact Star in ci cam (xte j0421+560

    Directory of Open Access Journals (Sweden)

    Manabu Ishida

    2004-01-01

    Full Text Available Aunque CI Cam, la cual present o una explosi on en abril de 1998, ha sido considerada como una fuente transitoria de rayos X suaves (SXT que alberga un agujero negro, posee a la vez ciertas caracter sticas que dif cilmente pueden hacerla encajar dentro del grupo de SXT. En este art culo proponemos una enana blanca como la estrella central acreciente en CI Cam.

  13. Magnetorheological properties of sodium sulphonate capped electrolytic iron based MR fluid: a comparison with CI based MR fluid

    Science.gov (United States)

    Vinod, Sithara; John, Reji; Philip, John

    2017-02-01

    Magnetorheological fluids have numerous engineering applications due to their interesting field assisted rheological behavior. Most commonly used dispersed phase in MR fluids is carbonyl iron (CI). The relatively high cost of CI warrants the need to develop cheaper alternatives to CI, without compromising rheological properties. With the above goal in mind, we have synthesized sodium sulphonate capped electrolytic iron based MR fluid and studied their magnetorheological properties. The results are compared with that of CI based MR fluid. EI and CI particles of average particle size of ∼10 μm with fumed silica particles additives are used in the present study. The dynamic yield stress for EI and CI based MR fluid were found to vary with field strength with an exponent of roughly 1.2 and 1.24, respectively. The slightly lower static and dynamic yield stress values of EI based MR fluid is attributed to the lower magnetization and polydispersity values. The dynamic yield stress showed a decrease of 18.73% and 61.8% for field strengths of 177 mT and 531 mT, respectively as the temperature was increased from 293 to 323 K. The optorheological studies showed a peak in the loss moduli, close to the crossover point of the storage and loss moduli, due to freely moving large sized aggregates along the shear direction that are dislodged from the rheometer plates at higher strains. Our results suggests that EI based MR fluids have magnetorheological behavior comparable to that of CI based MR fluids. As EI is much cheaper than CI, our findings will have important commercial implications in producing cost effective EI based MR fluids.

  14. As Ciências da Terra e a mundialização das sociedades

    Directory of Open Access Journals (Sweden)

    Umberto G. Cordani

    1995-12-01

    Full Text Available De acordo com os princípios da Agenda 21, o principal documento resultante da unced-92, a sociedade sustentável do futuro deverá mostrar um desenvolvimento econômico equilibrado, no mundo todo, em harmonia com os sistemas de suporte da vida, em nosso planeta. As Ciências da Terra têm um papel crucial, visto que elas têm a responsabilidade da busca e do gerenciamento dos recursos minerais e energéticos, da conservação, do gerenciamento dos solos e da água, do monitoramento contínuo dos processos dinâmicos do Sistema Terra e da prevenção e mitigação dos desastres naturais. Solidariedade social em nível global é necessária para o alcance futuro de uma sociedade sustentável realmente equitativa e preocupada com a justiça social. Entretanto, as tendências atuais da globalização, sob a égide dos grandes conglomerados transnacionais, são as de dar menor prioridade face a assuntos como preservação ambiental e desenvolvimento econômico do Terceiro Mundo. Tais tendências precisam ser invertidas, e os cientistas e profissionais das Ciências da Terra devem tornar-se proativos, em comunicar-se com políticos, educadores e o público em geral, no sentido de planejar adequadamente as atividades de desenvolvimento, evitando possíveis impactos desastrosos para o ambiente.Following the principles contained in the Agenda 21, the main agreement reached during the unced-92, the future sustainable society shall exhibit an equitable socio-economic development, all over the world, in harmony with the life support systems of our planet. The Earth sciences have a crucial role, because they have the responsibility of the search, provision and management of mineral and energetic resources, the conservation and management of soils and water, the continuous monitoring of the dynamic processes of the Earth system, and the prevention and mitigation of natural disasters. Solidarity among people is needed in order to achieve a truly equitable

  15. Performance of C.I Engine by Using Biodiesel-Mahua Oil.

    Directory of Open Access Journals (Sweden)

    sudheer nandi

    2013-10-01

    Full Text Available - India is looking at renewable alternative fuel sources to reduce its dependence on foreign imports of oils. As India imports 70% of the oil, the country has been hit hard by increasing cost and uncertainty. Recently the biomass resources are being used as alternative fuels and effective use of those fuels is gaining prominence as a substitute way to solve the problem of global warming and the energy crisis. Among all the alternative fuels existing mahua oil is also one. In this work, conventional laboratory equipment has been used for the transesterification of mahua oil. Various properties of esterified mahua oil have been tested for comparison with diesel fuel; further the investigations are carried out on a laboratory based diesel engine to study its performance.An attempt has been made in the present work to find out the suitability of transesterified mahua oil as a fuel in C.I. engine. Experimental work was carried out on 7B.H.P single cylinder four stroke and vertical, water cooled Kirloskar diesel engine at rated speed of 1500rpm different blends of transesterified mahua oil with diesel were tested at 200bar injection pressure.From the performance characteristics of transesterified mahua oil diesel blends the efficiencies obtained were found to be better with 75% transesterified mahua oil. The thermal efficiencies of transesterified mahua oil are higher at 25% diesel blends. The cost of transesterified mahua oil is low compared to the cost of diesel. Hence mahua oil blended with diesel is more economical and this can provide an immediate, though partial solution to the growing diesel scarcity in developing countries like ours

  16. Inedible vegetable oils and their derivatives for alternative diesel fuels in CI engines: A review

    Energy Technology Data Exchange (ETDEWEB)

    No, Soo-Young [Chungbuk National University, Department of Biosystems Engineering, Cheongju 361-763 (Korea, Republic of)

    2011-01-15

    The use of inedible vegetable oils as an alternative fuel for diesel engine is accelerated by the energy crisis due to depletion of resources and increased environmental problems including the great need for edible oil as food and the reduction of biodiesel production cost, etc. Of a lot of inedible vegetable oils which can be exploited for substitute fuel as diesel fuel, seven vegetable oils, i.e., jatropha, karanja, mahua, linseed, rubber seed, cottonseed and neem oils were selected for discussion in this review paper. The application of jatropha oil as a liquid fuel for CI engine can be classified with neat jatropha oil, engine modifications such as preheating, and dual fuelling, and fuel modifications such as jatropha oil blends with other fuels, mostly with diesel fuel, biodiesel, biodiesel blends and degumming. Therefore, jatropha oil is a leading candidate for the commercialization of non-edible vegetable oils. There exists a big difference in the fuel properties of seven inedible vegetable oils and its biodiesels considered in this review. It is clear from this review that biodiesel generally causes an increase in NOx emission and a decrease in HC, CO and PM emissions compared to diesel. It was reported that a diesel engine without any modification would run successfully on a blend of 20% vegetable oil and 80% diesel fuel without damage to engine parts. This trend can be applied to the biodiesel blends even though particular biodiesel shows 40% blend. In addition, the blends of biodiesel and diesel can replace the diesel fuel up to 10% by volume for running common rail direct injection system without any durability problems. (author)

  17. Diversity and Resource Use Patterns of Anthophile Insects in Cuatro Ciénegas, Coahuila, Mexico.

    Science.gov (United States)

    Ávalos-Hernández, Omar; Cano-Santana, Zenón; Trujano-Ortega, Marysol; García-Vázquez, Uri Omar

    2016-12-01

    Bees and flies are the main pollinators responsible for the maintenance of plant diversity and crop production. Studies of pollinator communities have focused on bees; however, community structures may vary among groups of pollinators. We describe and compare the diversity and resource use patterns of six Apoidea and two Diptera anthophile families in Cuatro Ciénegas in the northeast of Mexico. We sampled insects in two distinct geographic units (valley and mountains) and two seasons (rainy and dry). Spatial and temporal patterns in species composition and abundance of these families were identified and the diversity in each family compared. The spatial and temporal patterns in species composition, diversity, and resource use were different for each family. Overall, diversity was higher during the rainy season. Only fly families and the Andrenidae presented season-specific differences in species composition, in contrast with the other Apoidea. Two bee families visited more plant species per insect species during the rainy season, whereas flies visited the same number of plant species in both seasons. Apidae, Megachilidae, and Bombyliidae visited more plant species in the mountains, while the other families exhibited no differences between the mountains and the valley. The variation in the community structures of each group may reflect distinct life histories, resources needs during larval stages, and foraging behaviors. These differences are relevant in management and conservation programs that could benefit one group of pollinators while harming others with different characteristics. The traits of some families indicate their potential value as pollinators. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  18. Reforms of a real estate cadastre in Poland / Reformy katastru nieruchomości w Polsce

    Science.gov (United States)

    Pietrzak, Ludmiła; Hopfer, Andrzej; Cegielski, Stanisław

    2012-11-01

    On May 7, 2010 the act dated March 4, 2010 on the spatial information infrastructure was published which transposes the European Parliament and the European Council Directive No 2007/2/WE dated March 14, 2007 established the spatial information infrastructure (INSPIRE) in the European Community. This act introduced basic changes to the binding Act, i.e. the Law of Geodesy and Cartography and, as the consequence, the demand to develop various administrative decrees occurred. The authors of the paper present the analysis of the existing conditions of the cadastre, the task of governmental and public government administration, related to demands concerning the cadastral reforms, following the act on the spatial information infrastructure and they discuss possibilities to perform such reforms at the local and national scales. W dniu 7 maja 2010 r. weszła w życie ustawa a dnia 4 marca 2012 r. o infrastrukturze informacji przestrzennej dokonująca transpozycji dyrektywy Parlamentu Europejskiego i Rady nr 2007/3/WE ustanawiającej infrastrukturę informacji przestrzennej w Europie. Ustawa to wprowadziła zasadnicze zmiany do obowiązującej ustawy prawo geodezyjne i kartograficzne, i w konsekwencji powstała konieczność opracowania nowych rozporządzeń wykonawczych. W chwili obecnej większość rozporządzeń jest już opracowana, część jest jeszcze konsultowana z organizacjami zawodowymi geodetów. W artykule autorzy dokonują analizy stanu istniejącego, zadań administracji rządowej i samorządowej związanych z koniecznością modernizacji katastru oraz podają zakres koniecznych do przeprowadzenie reform w skali kraju oraz w skali lokalnej.

  19. Naród kontra lewactwo. Polityczne kategoryzacje rzeczywistości w folklorze internetowym

    Directory of Open Access Journals (Sweden)

    Michał Rauszer

    2016-01-01

    all features which exclude you from the community and your positive “national identity.”   Naród kontra lewactwo. Polityczne kategoryzacje rzeczywistości w folklorze internetowym W znanym eseju Dziecięca choroba lewicowości w komunizmie Lenin, na określenie naiwnej jego zdaniem polityki zachodnich partii komunistycznych, używa pojęcia „lievizna”. Zwykle tłumaczy się je jako „lewicowość”, termin ten jednak nie oddaje pogardy dla zachodnich partii komunistycznych, z jaką Lenin się o nich wypowiadał. W języku polskim wyraz ten był także niekiedy przekładany jako „lewactwo”, po to by służył ośmieszaniu działań niezgodnych z nomenklaturą Polskiej Zjednoczonej Partii Robotniczej (przykładem może być ruch ‘68 na Zachodzie. Współcześnie określenie „lewactwo” najczęściej jest używane w dyskursie ruchów prawicowych, aby pokazać każdy niezgodny z nimi projekt jako „dziecinny”. Wyrazem tym określa się nie tylko ruchy lewicowe, ale także wszystkie inne, które nie wpisują się w dyskurs prawicy narodowej. W swoim artykule staram się pokazać, w jaki sposób wyraz ten służy jako fantazmatyczna bariera, granica definiująca tożsamość narodową. Za materiał badawczy posłużył mi folklor internetowy taki, jak: memy, komentarze pod artykułami i zdjęciami, krótkie filmiki na portalu YouTube, a także oferta internetowych sklepów z odzieżą i gadżetami patriotycznymi (oferta tych sklepów jest ściśle oparta na takiej folklorystycznej interpretacji wydarzeń ujmowanych jako ważne. Pojęcie „lewactwa” funkcjonuje jako bariera wyznaczająca tożsamość narodową oraz jako przestrzeń fantazji. Ideologiczna praca tego pojęcia pokazuje, w jaki sposób w opozycji do tej bariery definiuje się i wyznacza pozytywny zbiór tego, co jest postrzegane jako „narodowe”, oraz tego, co „narodem” nie jest. Ponadto „lewactwo” jest także używane jako ekran fantazji, na której projektuje się cechy

  20. Prognozowanie i ujmowanie przychodóww przedsiębiorstwie postawionymw stan upadłości likwidacyjnej

    Directory of Open Access Journals (Sweden)

    Janusz Czerny

    2010-03-01

    Full Text Available W upadłości likwidacyjnej przedsiębiorstw mamy do czynienia z dwoma stru-mieniami przychodów, a mianowicie z przychodami dotyczącymi zbycia przedsię-biorstwa lub jego składników majątku oraz z przychodami związanymi z ewentual-nym kontynuowaniem działalności: Przychody ze sprzedaży przedsiębiorstwa powinny być prognozowane głównie na podstawie informacji płynących z systemu rachunkowości, co stanowi tzw. sta-tyczny aspekt upadłości, natomiast jej aspekt dynamiczny jest związany z zakre-sem i czasem kontynuowanej działalności, o czym decyduje syndyk, mając na uwa-dze naczelny cel upadłości, jakim jest optymalne zaspokojenie roszczeń wierzycieli.

  1. Jenkins-CI, an Open-Source Continuous Integration System, as a Scientific Data and Image-Processing Platform.

    Science.gov (United States)

    Moutsatsos, Ioannis K; Hossain, Imtiaz; Agarinis, Claudia; Harbinski, Fred; Abraham, Yann; Dobler, Luc; Zhang, Xian; Wilson, Christopher J; Jenkins, Jeremy L; Holway, Nicholas; Tallarico, John; Parker, Christian N

    2017-03-01

    High-throughput screening generates large volumes of heterogeneous data that require a diverse set of computational tools for management, processing, and analysis. Building integrated, scalable, and robust computational workflows for such applications is challenging but highly valuable. Scientific data integration and pipelining facilitate standardized data processing, collaboration, and reuse of best practices. We describe how Jenkins-CI, an "off-the-shelf," open-source, continuous integration system, is used to build pipelines for processing images and associated data from high-content screening (HCS). Jenkins-CI provides numerous plugins for standard compute tasks, and its design allows the quick integration of external scientific applications. Using Jenkins-CI, we integrated CellProfiler, an open-source image-processing platform, with various HCS utilities and a high-performance Linux cluster. The platform is web-accessible, facilitates access and sharing of high-performance compute resources, and automates previously cumbersome data and image-processing tasks. Imaging pipelines developed using the desktop CellProfiler client can be managed and shared through a centralized Jenkins-CI repository. Pipelines and managed data are annotated to facilitate collaboration and reuse. Limitations with Jenkins-CI (primarily around the user interface) were addressed through the selection of helper plugins from the Jenkins-CI community.

  2. Sprawozdanie z polityki rachunkowości jako odrębny składnik sprawozdania finansowego

    Directory of Open Access Journals (Sweden)

    Ewa Walińska

    2016-07-01

    Full Text Available Niniejszy artykuł poświęcono rozważaniom na temat polityki rachunkowości z perspektywy użytkownika sprawozdania finansowego. Jego celem jest prezentacja nowej formuły ujawnień informacji dotyczącej polityki rachunkowości, która zdaniem autorki podnosiłaby rangę i znaczenie tego elementu systemu rachunkowości. W artykule przedstawiono istotę i miejsce polityki rachunkowości w sprawozdaniu finansowym w świetle obowiązującego prawa bilansowego i praktyki największych spółek publicznych notowanych na Giełdzie Papierów Wartościowych w Warszawie. Podsumowaniem rozważań jest propo- zycja ujawniania polityki rachunkowości jako odrębnego składnika sprawozdania finansowego – spra- wozdania z polityki rachunkowości.

  3. Wartość firmyw świetle nadrzędnych zasad rachunkowości 

    Directory of Open Access Journals (Sweden)

    Bogna Sawicka

    2009-10-01

    Full Text Available Celem artykułu jest analiza księgowych procedur wyceny wartości firmy w odniesieniu do wymogów stawianych przez nadrzędne zasady obowiązujące w rachunkowości finansowej oraz do współczesnych rozwiązań stosowanych w procesach wyceny wartości przedsiębiorstw. Przeprowadzona analiza wykazała, że obowiązujące uregulowania w zakresie rachunkowości uwzględniły w znacznym stopniu osiągnięcia współczesnej teorii finansów przedsiębiorstw oraz złożoność procesów gospodarczych. Pomimo jednak jasno określonych zasad wyceny wartości firmy zarówno w momencie początkowego ujęcia, jak również w kolejnych latach obrotowych, ich stosowanie wymaga wielu danych szacunkowych oraz równoczesnego stosowania wielu metod wyceny wartości przedsiębiorstwa (wartość rynkowa, wartość godziwa aktywów netto, wartość dochodowa. Praktyczne zastosowanie modeli wyceny może napotykać wiele barier dotyczących doświadczenia osób sporządzających i badających sprawozdania finansowe, dostępu do odpowiednich informacji, może też stanowić pole do świadomego kreowania obrazu przedsiębiorstwa w sprawozdaniu finansowym. W artykule podjęto próbę wskazania, jak występowanie tych okoliczności może niekorzystnie wpływać na jakość informacji prezentowanej w sprawozdaniu finansowym i utrudniać weryfikację wiarygodności prezentowanej wartości firmy w świetle podstawowych zasad rachunkowości.

  4. Antioxidant properties of selected culinary spices / Antyoksydacyjne właściwości wybranych przypraw

    Directory of Open Access Journals (Sweden)

    Słowianek Marta

    2016-03-01

    Full Text Available Wstęp: Przyprawy dodawane do żywności wzbogacają jej walory smakowe i zapachowe, niektóre z nich mogą także wydłużać jej czas przechowywania dzięki obecności związków o aktywności przeciwutleniającej. Cel: Celem pracy było zbadanie 28 przypraw dostępnych na rynku pod kątem całkowitej zawartości polifenoli i aktywności przeciwutleniającej. Metody: Do oceny całkowitej zawartości związków fenolowych zastosowano metodę Folina- Ciocalteau. Aktywność antyoksydacyjną ekstraktów oznaczono metodą z użyciem rodnika DPPH. Wyniki: Otrzymane wyniki wykazują, że większość analizowanych przypraw jest bogata w związki fenolowe i posiada wysoką aktywność antyoksydacyjną. Całkowita zawartość polifenoli w przyprawach oscylowała od 0,9 do 155,1 mg GAE/g z najniższą wartością odnotowaną dla sezamu i najwyższą dla cynamonu. Zdolność do wygaszania rodnika DPPH wyrażona w procentach była zróżnicowana i wahała się w zakresie od 4,1% dla sezamu do 94,9% dla goździków. Odnotowano umiarkowaną korelację (r=0,63, p<0,05 pomiędzy aktywnością antyoksydacyjną i zawartością polifenoli ogółem, co dowodzi, że związki fenolowe są ważnymi, antyoksydacyjnymi składnikami w badanych przyprawach. Wnioski: Prowadzone badania wykazują, że wiele przypraw może służyć jako naturalne konserwanty żywności i jednocześnie ma korzystny wpływ na nasze zdrowie.

  5. Evaluation of radioiodine therapy with fixed doses of 10 and 15 mCi in patients with Graves disease; Avaliacao da radioiodoterapia com doses fixas de 10 e 15 mCi em pacientes com doenca de Graves

    Energy Technology Data Exchange (ETDEWEB)

    Canadas, Viviane; Vilar, Lucio; Moura, Eliane; Brito, Ana; Castellar, Enio [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Hospital das Clinicas. Servico de Endocrinologia]. E-mail: vivi2207@ig.com.br

    2007-10-15

    The treatment options for the hyperthyroidism of Graves' disease are antithyroid drugs, surgery and radioiodine, none of which is considered ideal, as they do not act directly on the etiopathogenesis of the disease. Radioiodine has been increasingly used as the treatment of choice because it is a safe and definitive therapy whose administration is very easy. Some authors prefer to administer higher doses in order to deliberately induce hypothyroidism, while others recommend lower doses that result in a lower incidence of hypothyroidism and a greater incidence of euthyroidism. There is no consensus for the optimal regimen of fixed doses to be used and this is the main focus of the present study, where doses of 10 and 15 mCi of {sup 131}I were compared. Among the 164 patients analyzed, 61 (37.2%) were submitted to 10 mCi and 103 (62.8%) to 15 mCi. In the longitudinal analysis it was observed that remission of the hyperthyroidism was statistically different in the sixth month (p < 0.001), being higher in the group that used the dose of 15 mCi, but similar in both groups at 12 and 24 months. It may be concluded that the administration of fixed doses of 10 and 15 mCi of {sup 131}I brought about a similar remission of the hyperthyroidism after 12 months of treatment. Moreover, the remission rate of the hyperthyroidism had no association with age, sex or previous therapy with antithyroid drugs. (author)

  6. Gabriel Tarde e as ciências sociais francesas: afinidades eletivas

    Directory of Open Access Journals (Sweden)

    Marcia Cristina Consolim

    2008-10-01

    Full Text Available Este artigo investiga os fatores que contribuíram para a ascensão intelectual de Tarde nos anos 1890, tendo-se em conta o fato de que o autor não tinha as credenciais acadêmicas necessárias para a carreira universitária. Procuro mostrar que Tarde conquistou prestígio junto a instâncias do poder intelectual e político contrárias à crescente autonomia da universidade e das ciências sociais. Os grupos pertencentes ao pólo pedagógico e ao pólo técnico-profissional ainda eram hegemônicos nos anos 1890, mas passaram a disputar com Durkheim a definição legítima das novas disciplinas. Como parte de uma estratégia estamental, esses grupos elegeram a psicologia social de Tarde como instrumento de combate, autor que correspondeu às expectativas e acumulou capital social nas mais diversas instâncias intelectuais e políticas, sendo por isso amplamente recompensado.This article investigates the factors that contributed to the intellectual ascension of Tarde during the 1890's. Taking into account the fact that the author lacked the necessary academic credentials for a university career, I seek to show that Tarde obtained prestige among circles of intellectual and political power that were contrary to the growing autonomy of the university and the social sciences. Groups affiliated to the pedagogic pole and the technical-professional pole were still hegemonic in the 1890's, but they began to contend with Durkheim for the legitimate definition of the new disciplines. As part of a strategy of maintaining hierarchy, these groups elected the social psychology of Tarde as an instrument for combat. The author lived up to expectations and accumulated social capital in diverse intellectual and political fields, being thereby amply rewarded.

  7. Anti-microbial coating innovations to prevent infectious diseases (AMiCI): Cost action ca15114.

    Science.gov (United States)

    Dunne, Colum P; Keinänen-Toivola, Minna M; Kahru, Anne; Teunissen, Birgit; Olmez, Hulya; Gouveia, Isabel; Melo, Luis; Murzyn, Kazimierz; Modic, Martina; Ahonen, Merja; Askew, Pete; Papadopoulos, Theofilos; Adlhart, Christian; Crijns, Francy R L

    2017-04-28

    Worldwide, millions of patients are affected annually by healthcare-associated infection (HCAI), impacting up to 80,000 patients in European Hospitals on any given day. This represents not only public health risk, but also an economic burden. Complementing routine hand hygiene practices, cleaning and disinfection, antimicrobial coatings hold promise based, in essence, on the application of materials and chemicals with persistent bactericidal or -static properties onto surfaces or in textiles used in healthcare environments. The focus of considerable commercial investment and academic research energies, such antimicrobial coating-based approaches are widely believed to have potential in reduction of microbial numbers on surfaces in clinical settings. This belief exists despite definitive evidence as to their efficacy and is based somewhat on positive studies involving, for example, copper, silver or gold ions, titanium or organosilane, albeit under laboratory conditions. The literature describes successful delay and/or prevention of recontamination following conventional cleaning and disinfection by problematic microbes such as methicillin-resistant Staphylococcus aureus (MRSA) and vancomycin resistant enterococci (VRE), among others. However, there is a scarcity of studies assessing antimicrobial surfaces other than copper in the clinical environment, and a complete lack of published data regarding the successful implementation of these materials on clinically significant outcomes (including HCAI). Through its Cooperation in Science and Technology program (COST), the European Commission has funded a 4-year initiative to establish a network of stakeholders involved in development, regulation and use of novel anti-microbial coatings for prevention of HCAI. The network (AMiCI) comprises participants of more than 60 universities, research institutes and companies across 29 European countries and, to-date, represents the most comprehensive consortium targeting use of

  8. OCENA WŁAŚCIWOŚCI PRZECIWPOŚLIZGOWYCH NAWIERZCHNI DROGOWYCH PRZY WYKORZYSTANIU URZĄDZEŃ TWO, CTM I DFT

    Directory of Open Access Journals (Sweden)

    Marta WASILEWSKA

    2016-07-01

    Full Text Available Kompleksowa ocena właściwości przeciwpoślizgowych powinna być wykonywana w oparciu o ciągły pomiar współczynnika tarcia oraz parametrów dotyczących tekstury nawierzchni drogowych. W artykule przedstawiono ocenę właściwości przeciwpoślizgowych nawierzchni drogowych przeprowadzoną na podstawie pomiarów wykonanych zestawem pomiarowym TWO (Traction Watcher One oraz urządzeniami CTM (Circular Track Meter i DFT (Dynamic Friction Tester. Do badań wytypowano 11 odcinków testowych, których warstwy ścieralne były zróżnicowane pod względem technologii wykonania, okresu użytkowania i obciążenia ruchem samochodowym. Przy pomocy urządzenia CTM dokonano oceny makrotekstury (parametr MPD, a przy wykorzystaniu urządzenia DFT oceniano w sposób pośredni mikroteksturę powierzchni (współczynnik tarcia DFT20. Urządzenie TWO umożliwiło ciągły pomiar współczynnika tarcia z ustalonym poślizgiem 17,8% koła pomiarowego przy trzech prędkościach 30, 60, 90 km/h. W artykule ustalono zależności funkcyjne pomiędzy współczynnikiem tarcia µ z pomiarów TWO, a współczynnikiem DFT20 i parametrem MPD. Wykazano, że na wartość µ przy prędkości 30 km/h istotny wpływ ma jedynie mikrotekstura nawierzchni, a przy prędkości 60 i 90 km/h zarówno mikrotekstura i makrotekstura.

  9. O Instituto Brasileiro de Educação, Ciência e Cultura e a institucionalização da ciência no Brasil, 1946-1966

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Souza de Abrantes

    Full Text Available O Instituto Brasileiro de Educação, Ciência e Cultura (IBECC foi criado como Comissão Nacional da Organização das Nações Unidas para a Educação, a Ciência e a Cultura (UNESCO no Brasil, logo após o fim da Segunda Guerra Mundial, com o objetivo de atuar em projetos naquelas áreas. O artigo analisa o desenvolvimento desse projeto, em particular em São Paulo, onde cientistas e educadores se engajaram em uma experiência inovadora em termos de divulgação científica e ensino de ciências, por meio de feiras, concursos, produção de material didático e kits de experimentação.

  10. 宋代词人对温庭筠词的借鉴与创新%On the Reference and Innovation of the Ci-poetry of Wen Tingyun by Ci Writers of the Song Dynasty

    Institute of Scientific and Technical Information of China (English)

    蔡慧; 钱锡生

    2015-01-01

    The Ci-poetry of Wen Tingyun was not only revered as a model in Hua Jian Ji, but it also had a pro⁃found impact in the Song Dynasty. In their creative process, Ci writers of the Song Dynasty often intentionally or unintentionally learned and imitated the Ci-poetry of Wen Tingyun. Some writers copied and imitated the words and sentences from Wen Tingyun’s Ci-poetry, while others imitated and learned from his writing style. On such a basis, many Ci writers of the Song Dynasty could also make their works exceed Wen Tingyun’s. Thus, the Ci-poet⁃ry of the Song Dynasty had its own unique features and diverse contents and styles.%温庭筠的词不仅在《花间集》中被尊为典范,在宋代也产生了深远影响。宋代词人在创作时,常常有意或无意地对温庭筠词进行借鉴与模仿,这种借鉴有的是字句的搬用和化用,有的是风格上的模仿和借鉴。在此基础上,很多宋代词人又能对温词有所超越,使宋词具有自身面貌的独特性和内容风格的多元性。

  11. Da educação em ciência às orientações para o ensino das ciências: um repensar epistemológico From Science Education to Science Teaching: an epsitemological rethinking

    Directory of Open Access Journals (Sweden)

    António Cachapuz

    2004-12-01

    Full Text Available No presente artigo, discute-se a construção epistemológica da Educação em Ciência como área interdisciplinar que integra, por apropriações e transposições educacionais, campos relevantes do saber, nomeadamente a Filosofia da Ciência, a História da Ciência, a Sociologia da Ciência e a Psicologia Educacional. Desenvolvem-se, em seguida, argumentos de natureza curricular e de política educativa4 que procuram clarificar, afinal, para quê e para quem a Educação em Ciência. Debruçamo-nos, necessariamente, por fim, sobre o ensino das Ciências e suas orientações preferenciais e que se perfilam como as mais congruentes com os referenciais teóricos enunciados. Note-se que esse percurso de pesquisa/teoria/prática exige reflexão, tempo, maturação de idéias, cumplicidade com a inovação e empenho na ação.The paper starts with a brief description of the epistemological construction of Science Education and its interdisciplinary character, in particular the contributions of the Philosophy of Science, History of Science, Sociology of Science and Educational Psychology. Secondly, arguments are developed in order to find out appropriate answers to two key educational issues, namely, the purpose of science education and who science education is for. Finally, the paper characterizes three main orientations for science teaching based on the previously developed framework.

  12. Current status of the Citrus leprosis virus (CiLV -C and its vector Brevipalpus phoenicis (Geijskes

    Directory of Open Access Journals (Sweden)

    Guillermo León M

    2012-08-01

    Full Text Available The Citrus leprosis virus CiLV-C is a quarantine disease of economic importance. Over the past 15 years, this disease has spread to several countries of Central and South America. Colombia has about 45,000 hectares of citrus planted with an annual production of 750,000 tonnes. The CiLV-C has only been detected in the departments of Meta, Casanare and recently Tolima. Meta has 4,300 hectares representing 10% of the national cultivated area, and Casanare, where CiLV-C appeared in 2004, has no more than 500 ha planted with citrus. The presence of the Citrus leprosis virus in Colombia could affect the international market for citrus, other crops and ornamental plants with the United States and other countries without the disease. The false spider mite Brevipalpus phoenicis (Geijskes (Acari: Tenuipalpidae is the main vector of the CiLV-C. Disease management is based on control programs of the vector and diminishing host plants. Chemical mite control is expensive, wasteful and generates resistance to different acaricides. This paper provides basic information on CiLV-C and its vector, advances in diagnosis and methods to control the disease and prevention of its spread

  13. „Pokłosie”, poGrossie i kibice polskości

    Directory of Open Access Journals (Sweden)

    Piotr Forecki

    2014-06-01

    Full Text Available "Aftermath", after-Gross and the fans of Polishness Aftermath was released in the late 2012. Its director, Władysław Pasikowski, had previously been famous for his violent action films with strong male protagonists. He has also written some of the most sexist dialogues in the history of Polish cinema, as well as a number of lines, often obscene, which have become catchphrases and slogans present every day in the pop culture. His latest film, however, tackles a completely different issue – this thriller-cum-western tells a story that is decidedly contemporary, but nevertheless inspired by the events that took place in Jedwabne (described by Jan Tomasz Gross in his book Neighbors. Aftermath does not attempt to provide a reconstruction of the events that took place “on the margins of the Holocaust” (including Jedwabne. However, it clearly hints at the issue of the Polish contribution to the extermination of Jews and the impact of the conspiracy of silence having been broken. The film gave rise to a heated debate, which rippled through the Polish media for as long as two months after its release. This article is an attempt to analyse and interpret the words and ideas that appeared in the debate.   „Pokłosie”, poGrossie i kibice polskości Wraz z końcem 2012 roku odbyła się premiera filmu fabularnego Pokłosie w reżyserii Władysława Pasikowskiego. Ten bardzo popularny polski reżyser znany był dotychczas przede wszystkim z mocnych filmów sensacyjnych o twardych mężczyznach. Zasłynął także jako autor bodaj najbardziej seksistowskich dialogów w polskim kinie oraz rozmaitych i częstokroć wulgarnych kwestii wypowiadanych przez bohaterów, z których wiele do dziś funkcjonuje w popkulturze na prawach popularnych cytatów. W swoim najnowszym filmie Pasikowski sięgnął jednak po zupełnie inny temat. W konwencji thrillera z elementami westernu opowiedział historię jak najbardziej współczesną, ale w zdecydowany sp

  14. A universidade corrupta: o jeitinho brasileiro de se fazer ciência

    Directory of Open Access Journals (Sweden)

    Ivan Martins Fontes Leichsenring

    2013-12-01

    Full Text Available Antes do advento do Sistema Qualis, a pesquisa enviesada sempre pareceu ser uma via fácil na obtenção de financiamento, reconhecimento e privatização da máquina universitária nas mãos de poucos grupos científicos, como há muito, por exemplo, tem nos demonstrado a área de Medicina e suas relações um tanto discutíveis com a indústria farmacêutica. Neste estudo, após um breve levantamento histórico-comparativo com a situação alemã do Entre Guerras, tecemos algumas críticas sobre a atual produção científica brasileira nas Ciências Humanas e ao atrelamento de nossas universidades públicas aos modelos internacionais e cientificistas de produtividade. E, também, tentamos debater como a corrupção científica tem se construído e fortalecido por causa da enorme pressão do “publicar ou perecer” e da adoção do Sistema Qualis, que têm induzido nossos cientistas a optar por consagrar temas já anteriormente pré-consagrados, evitando assim a crítica, anulando possíveis questionamentos, estimulando a publicação de “artigos-placebo” e impedindo, em última análise, o desenvolvimento científico e tecnológico do país. Abstract: Before the advent of the Qualis System, skewed research always seemed to be an easy way to obtain funding, recognition and privatization of the university machine in the hands of a few scientific groups, as for a long while, the area of medicine and its somewhat controversial relationships with the pharmaceutical industry has shown us. In this study, after a brief comparative-historical survey with the German situation of interwar period, some criticism have been weaved about the current Brazilian scientific production in the humanities and the bundling of our public universities to international and scientificist productivity models. A discussion has also been tried on how scientific corruption has built and strengthened because of the enormous pressure of 'publishing or perishing' and

  15. Spatial and temporal variability of spring ecosystems in Cuatro Ciénegas, MX

    Science.gov (United States)

    Corman, J. R.; Ramos, J.; Childers, D. L.; Elser, J. J.

    2013-12-01

    Springs in desert ecosystems provide vital water resources and are often hotspots of biodiversity. Indeed, the Cuatro Ciénegas (CC) Valley, México, which hosts >300 springs, lakes, streams, and ponds, has the highest rate of endemism in North America. This region of the Chihuahuan Desert and its aquatic ecosystems are thought to be supported by both precipitation events and local and regional aquifers, however, the hydrologic influence and connectivity of the springs are not well understood. We have been monitoring the physicochemical characteristics of this system since 1998 and yearly since 2011. Our basin-wide study of 15 different aquatic features provides an opportunity to (1) characterize the physicochemical and nutrient landscape of the aquatic ecosystems and (2) test the assumptions of hypothesized hydrologic dynamics. The aquatic ecosystems of CC have an impressive spatial diversity in their physicochemical properties and support a locally-connected hydrologic model of the valley. Aqueous specific conductivity spanned 1.1 - 9.6 mS/cm2, with the highest values found in the eastern lobe and lowest values in the southeastern and northern regions. Dissolved organic carbon concentrations ranged over two orders of magnitude (max: 5.3 mM), with a similar spatial variability as specific conductivity. Nutrient data also showed geographic trends, however patterns differed for nitrogen (N) and phosphorus (P). While total dissolved N and P were highest in the eastern lobe, the highest values of each were not found at the same sites. Rancho las Pozas had the highest N (>500 uM N), while Los Hundidos had the highest P concentrations (as high as 10.8 uM P). Atomic N:P ratios ranged from 7 - 997 across CC, with a mean of 139. Both the highest (>500) and lowest (27 cm of rain in some regions. A comparison of our longest record from Río Mesquites, a spring-fed stream, and Los Hundidos, a collection of spring-fed and evaporitic ponds, shows the spatial dissimilarity of CC

  16. Butanol/diesel blends as a CI engine fuel. Physico-chemical and engine performance characteristics evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Shukla, M.K.; Thakre, G.D.; Saxena, R.C.; Sharma, Y.K.; Jain, A.K.; Singal, S.K. [CSIR - Indian Institute of Petroleum, Dehradun, Uttrakhand (India)

    2013-06-01

    Recently, butanol produced by fermentation, known as bio-butanol has emerged as a new alternative fuel for CI engines. However, very little work has been carried out on its use in C.I. engine. In this context current paper deals with the characteristic properties and performance evaluation of butanol as a blending additive in diesel fuels. The butanol-diesel blends are prepared in varying concentrations of 5-l 0% and have been studied for their Corrosion, Tribology, distillation and Physico-chemical characteristics. These characteristics properties are then compared with those of diesel. The study reveals that the butanol-diesel blends offer better cetane number, improved corrosion behaviour and comparable distillation and tribological properties. The engine performance evaluation revealed comparable performance in terms of fuel economy as compared with diesel fuel. Hence, Butanol-diesel blends can be successfully used as an alternative fuel for CI engines. (orig.)

  17. Exergy efficiency applied for the performance optimization of a direct injection compression ignition (CI) engine using biofuels

    Energy Technology Data Exchange (ETDEWEB)

    Azoumah, Y. [Laboratoire Biomasse Energie Biocarburant (LBEB), Institut International d' Ingenierie de l' Eau et de l' Environnement (2iE), Rue de la Science, 01BP 594, Ouagadougou 01 (Burkina Faso); Blin, J. [Laboratoire Biomasse Energie Biocarburant (LBEB), Institut International d' Ingenierie de l' Eau et de l' Environnement (2iE), Rue de la Science, 01BP 594, Ouagadougou 01 (Burkina Faso)]|[Unite Propre de Recherche Biomasse Energie, CIRAD-PERSYST, TA B-42/16t, 73 Avenue J.-F. Breton, 34398 Montpellier Cedex 5 (France); Daho, T. [Laboratoire de Physique et de Chimie de l' Environnement (LPCE), Departement de Physique, UFR-SEA, Universite de Ouagadougou, 03 BP 7021, Ouagadougou 03 (Burkina Faso)

    2009-06-15

    The need to decrease the consumption of materials and energy and to promote the use of renewable resources, such as biofuels, stress the importance of evaluating the performance of engines based on the second law of thermodynamics. This paper suggests the use of exergy analysis (as an environmental assessment tool to account wastes and determine the exergy efficiency) combined with gas emissions analysis to optimize the performance of a compression ignition (CI) engine using biofuels such as cottonseed and palm oils, pure or blended with diesel for different engine loads. The results show that the combination of exergy and gas emissions analyses is a very effective tool for evaluating the optimal loads that can be supplied by CI engines. Taking into account technical constraints of engines, a tradeoff zone of engine loads (60% and 70% of the maximum load) was established between the gas emissions (NO and CO{sub 2}) and the exergy efficiency for optimal performance of the CI engine. (author)

  18. Neuropatía compresiva del ciático secundaria a lipoma de muslo: Caso clínico

    OpenAIRE

    A.F. Pineda-Restrepo; M.P. Casteleiro-Roca; B. López-Obregón

    2014-01-01

    La neuropatía compresiva del nervio ciático es una patología poco frecuente, atribuible a diferentes etiologías. Una causa poco habitual es la compresión extrínseca por tumores de tejidos blandos, como puede ser un lipoma. Presentamos un caso de neuropatía compresiva del nervio ciático a causa de un lipoma en la cara posterior del muslo. Ante la presencia de clínica compresiva del nervio ciático es importante realizar una adecuada evaluación clínica del paciente, así como las pruebas compleme...

  19. SKUTKI FINANSOWE DECYZJI PRZEDSIĘBIORSTWA ŚWIETLE RACHUNKOWOŚCI TRZECH SOCZEWEK (AUTORSKIE PODEJŚCIE METODOLOGICZNE)

    OpenAIRE

    Józefa Famielec

    2016-01-01

    Hipoteza badawcza artykułu zakłada, że rachunkowość jest wykorzystywana w niewielkim stopniu do wypracowywania w jednostce optymalnych decyzji. Taki rachunek jak, przepływy pieniężne netto, czy też przepływy pieniężne działalności inwestycyjnej, stanowią często tylko biurokratyczny załącznik do wniosków o finansowanie czy też o pomoc publiczną. Jednostki nie mają przekonania co do ich przydatności a często i wiedzy merytorycznej dla ich interpretacji oraz reakcji na ustalane wielkości i w...

  20. O ensino de conteúdos de História e Filosofia da Ciência

    Directory of Open Access Journals (Sweden)

    Fernando Bastos

    1998-01-01

    Full Text Available O presente trabalho de pesquisa consistiu em duas etapas: (i produção de um Guia de Estudos em que a história das pesquisas sobre a febre amarela (1881-1903 foi usada como subsídio para a discussão de alguns importantes aspectos do processo de produção de conhecimentos na ciência; (ii realização de experiência pedagógica em que o Guia de Estudos foi aplicado junto a alunos do ensino médio. Os resultados obtidos forneceram evidência da viabilidade do uso da História da Ciência no Ensino de Ciências.

  1. A Ciência de Freud: introdução ao problema da cientificidade da psicanálise

    Directory of Open Access Journals (Sweden)

    Nathalia Sisson

    2010-04-01

    Full Text Available Apresenta-se primeiramente a concepção de Freud do que seria a Ciência e em que constituiria a atividade cientifica, utilizando-se textos freudianos nos quais ele trabalha esse tema. Considera-se as noções de Naturwissenchaft e Geistwissenchaft para contextualizar a discussão sobre a cientificidade da Psicanálise à época de Freud. Confronta-se então a Ciência, como entendida por Freud, com as concepções de Popper e Bachelard, oriundos da Epistemologia. Posteriormente, apresentamos diferentes posições de psicanalistas, como Lacan e Kernberg, quanto ao mesmo tema, para mostrar como a compreensão do que seja a Ciência determina os posicionamentos quanto à relação entre esta e a Psicanálise.

  2. A ciência da informação na visão dos professores da ECI/UFMG

    OpenAIRE

    Araujo,Carlos Alberto Ávila; Sima,Aline Michelle; Guedes,Roger Miranda; Resende,Karine Souza

    2007-01-01

    Este texto apresenta os resultados de uma pesquisa realizada com os professores da Escola de Ciência da Informação da UFMG sobre os seguintes assuntos: a ciência da informação como uma ciência social; a ciência da informação como uma ciência interdisciplinar; a ciência da informação como uma ciência pós-moderna; a natureza da relação entre a ciência da informação e a biblioteconomia. A cada entrevistado solicitou-se, ainda, que indicasse dez autores e dez obras da área de ciência da informaçã...

  3. Relações entre a analise do discurso e a ciência da história

    Directory of Open Access Journals (Sweden)

    Claudiana Nair Pothin Narzetti

    2007-11-01

    Full Text Available 0 presente trabalho pretende analisar o modo como a Análise do discurso derivada de Michel Pêcheux se relacionava com uma das regiões do conhecimento que estão na sua base — o marxismo ou a ciência da história. 0 nosso ponto de partida é expor o modo como o próprio Pêcheux via essa relação da AD com a referida ciência, no período de elaboração e maturação da disciplina (anos 69 a 75. Para isso, primeiramente, mostramos o sentido amplo que Pêcheux, na linha do grupo althusseriano, atribuía expressão "ciência da história". Mostramos, em seguida, que o projeto pecheutiano de desenvolver a teoria e a análise do discurso se entroncava no projeto althusseriano de desenvolver urna teoria das ideologias. Consideramos a reconstrução do modo como Pêcheux entendia a relação entre a AD e a ciência da história importante, porque a expressão "ciência da história" tem um sentido especial que é freqüentemente ignorado e, por isso, tem conduzido à interpretação apressada que define aAD como uma "disciplina de entremeio", situada entre a ciência da história, a Lingüística e a Psicanálise, interpretação essa que Pêcheux recusava explicitamente.

  4. An improved cirrus detection algorithm MeCiDA2 for SEVIRI and its evaluation with MODIS

    Directory of Open Access Journals (Sweden)

    F. Ewald

    2013-02-01

    Full Text Available In this study, a substantially improved version of the Meteosat cirrus detection algorithm (MeCiDA2 will be presented, which now allows application to the full earth disc visible by the Meteosat satellite. As cirrus clouds have an influence on the radiation budget of the earth, their optical properties and their global coverage has to be monitored at the global scale using instruments aboard geostationary satellites. Since MeCiDA was optimised for the area of Europe only, various changes were necessary to handle the variable conditions found over the full Meteosat disc. Required changes include the consideration of the viewing angle dependency and of the sensitivity of the 9.7 μm channel to the ozone column. To this end, a correction is implemented that minimises the influence of the variability of the stratospheric ozone. The evaluation of the proposed improvements is carried out by using MeCiDA applied to MODIS (moderate resolution imaging spectrometer data to address viewing angle-dependent cirrus detection, and by additionally comparing it to the cloud optical properties MOD06 cirrus product. The new MeCiDA version detects less cirrus than the original one for latitudes larger than 40°, but almost the same amount elsewhere. MeCiDA's version for MODIS is more sensitive than that for SEVIRI (spinning enhanced visible and infrared imager with cirrus occurrences higher by 10%, and the new MeCiDA provides almost the same cirrus coverage (±0.1 as given by the cloud phase optical properties from MODIS for latitudes smaller than 50°. Finally, the influence of sub-pixel clouds on the SEVIRI cirrus detection has been examined: more than 60% of the undetected SEVIRI cirrus pixels have a cirrus coverage smaller than 0.5.

  5. Technical note: A new day- and night-time Meteosat Second Generation Cirrus Detection Algorithm MeCiDA

    Directory of Open Access Journals (Sweden)

    W. Krebs

    2007-12-01

    Full Text Available A new cirrus detection algorithm for the Spinning Enhanced Visible and Infra-Red Imager (SEVIRI aboard the geostationary Meteosat Second Generation (MSG, MeCiDA, is presented. The algorithm uses the seven infrared channels of SEVIRI and thus provides a consistent scheme for cirrus detection at day and night. MeCiDA combines morphological and multi-spectral threshold tests and detects optically thick and thin ice clouds. The thresholds were determined by a comprehensive theoretical study using radiative transfer simulations for various atmospheric situations as well as by manually evaluating actual satellite observations. The cirrus detection has been optimized for mid- and high latitudes but it could be adapted to other regions as well. The retrieved cirrus masks have been validated by comparison with the Moderate Resolution Imaging Spectroradiometer (MODIS Cirrus Reflection Flag. To study possible seasonal variations in the performance of the algorithm, one scene per month of the year 2004 was randomly selected and compared with the MODIS flag. 81% of the pixels were classified identically by both algorithms. In a comparison of monthly mean values for Europe and the North-Atlantic MeCiDA detected 29.3% cirrus coverage, while the MODIS SWIR cirrus coverage was 38.1%. A lower detection efficiency is to be expected for MeCiDA, as the spatial resolution of MODIS is considerably better and as we used only the thermal infrared channels in contrast to the MODIS algorithm which uses infrared and visible radiances. The advantage of MeCiDA compared to retrievals for polar orbiting instruments or previous geostationary satellites is that it permits the derivation of quantitative data every 15 min, 24 h a day. This high temporal resolution allows the study of diurnal variations and life cycle aspects. MeCiDA is fast enough for near real-time applications.

  6. Mengchuang’ s Ci Poetics and the Bifurcated Trend of the Ci-poetry Style---Original title:The Ci-poetics in the Late Song Dynastry and the Historical Value of Mengchuang%梦窗词学观与词风的二元走向

    Institute of Scientific and Technical Information of China (English)

    孙虹; 孙龙飞

    2014-01-01

    文章主要采用以宋论宋的方法,指出晚宋词学区分宋词为豪气词与雅词两大阵营:既摒弃不拘音律的豪气词派,又汰黜守律派词中的浮艳而归趋醇雅。守律派著名词人吴梦窗的论词四标准和创作实践与宋代特别是晚宋词学合流共趋;其词学观点与带有先锋实验性质的创作实践,是“由南追北”二元走向的词家转境,守律派词学与词风因之具有了词史的典范意义。%This article is to evaluate the Ci-poetry of the Song Dynasty from the perspective of the Ci-poetics developed in that period.In the late Song period, scholars divided Ci-poems into two categories: the heroic and the elegant.They disapproved the heroic ones that broke the rules of meter, rhythm or rhyme;for those written in regular meter or rhyme patterns, they would depreciate them as well if they were written in excessively flowery and ornate style.Wu mengchuang, a poet of the Shou-lv ( formal-rule-abiding ) group, heralded the trend of Ci-poetics in the Song, in particular the late Song dynasty.Both his statement of four criteria for Ci-poetry and his pioneering and experimental Ci-poetry creation reflected the bifurcated trend of“continuing the Southern Song style while learning from the northern style”.Thanks to his efforts, the Shou-lv group, with its Ci-poetics and its Ci-poetry style, acquired a unique position in the history of Ci-poetry.

  7. De opressora a oprimida: a ciência, seus críticos e suas críticas

    Directory of Open Access Journals (Sweden)

    Felipe Simão Pontes

    2011-06-01

    Full Text Available http://dx.doi.org/10.5007/1806-5023.2010v7n1/2p131 O livro A Cruzada Contra as Ciências do filósofo, jornalista e professor universitário Orlando Tambosi deflagra um combate contra setores da academia e da religião que atacam a validade do conhecimento científico. Lançado em 2010 pela Editora da UFSC, o livro é indicado para os interessados em ciência, tecnologia, religião e marxismo.

  8. Multicentre evaluation of the Naída CI Q70 sound processor: feedback from cochlear implant users and professionals

    OpenAIRE

    Jeanette Martin; Christine Poncet-Wallet; Angelika Illg; Sarah Perrin-Webb; Lise Henderson; Nathalie Noël-Petroff; Gennaro Auletta; Maria Grazia Barezzani; Karim Houri; Indian Research Group; Heike Bagus; Ulrich Hoppe; Jane Humphries; Wiebke van Treeck; Briaire, Jeroen J

    2016-01-01

    The aim of this survey was to gather data from both implant recipients and professionals on the ease of use of the Naída CI Q70 (Naída CI) sound processor from Advanced Bionics and on the usefulness of the new functions and features available. A secondary objective was to investigate fitting practices with the new processor. A comprehensive user satisfaction survey was conducted in a total of 186 subjects from 24 centres. In parallel, 23 professional questionnaires were collected from 11 cent...

  9. Contribuição ao debate entre psicanálise e ciência: Feyerabend

    OpenAIRE

    2010-01-01

    Trata-se de apresentar a contribuição de Paul Feyerabend ao debate entre psicanálise e ciência. A obra deste autor parece fornecer um novo horizonte de discussão, pois esvazia a pretensão de idealizar a ciência e a apresenta como atividade humana, impura, sem qualquer regra racional de funcionamento. Primeiro, faremos uma 'varredura' pelo campo atual de discussão, destacando alguns artigos que contribuem para esse debate. Seguiremos com uma crítica ao esforço de regramento epistemológico; e, ...

  10. Posições subjetivistas e objetivistas de ciência: a hermenêutica como fundamento da pesquisa qualitativa

    OpenAIRE

    2010-01-01

    Este trabalho discute aspectos relacionados à evolução recente da ciência, com ênfase no conflito entre posições objetivistas e subjetivistas, até chegar à importância da pesquisa qualitativa na construção do conhecimento científico na atualidade, com base nos variados campos de tradição e linhas de pensamento nas ciências sociais e nas formulações teóricas de Gadamer sobre hermenêutica. Nos estudos de Denzin e Lincoln, analisa-se a relevância da pesquisa qualitativa nos últimos tempos e sua ...

  11. Bioética clínica: ciência e humanidade = Clinical bioethics: science and humanity

    Directory of Open Access Journals (Sweden)

    Batista, Cristiano Corrêa

    2005-01-01

    Resultados e conclusão: Nossa conclusão é de a medicina não ser apenas uma ciência, mas também uma arte. Ela exige, em situações particulares, elaborar julgamentos de valor. A Bioética Clínica, surge para guiar caminhos combinando o conhecimento técnico- científico das ciências biomédicas com o conhecimento filosófico. Por meio da Bioética Clínica é possível resgatar os aspectos humanos da arte da medicina

  12. Concepções de professoras do ensino fundamental sobre o ensino de ciências para os anos iniciais

    OpenAIRE

    Silva, Aparecida de Fátima Andrade da; Marcondes,Maria Eunice Ribeiro; Paixão, Fátima

    2014-01-01

    Esta investigação visou compreender as conceções de duas professoras sobre o ensino de Ciências para os anos iniciais do Ensino Fundamental do Sistema educativo do Brasil, a partir de questionários, entrevistas e vídeos de reuniões. As conceções de ensino-aprendizagem estão relacionadas com a perspetiva cognitivista. O conteúdo de Ciências é fundamental para estas professoras, para favorecer o desenvolvimento de habilidades cognitivas e atitudes. Diferentes estratégias de ensino são utilizada...

  13. Engineering of a genetically encodable fluorescent voltage sensor exploiting fast Ci-VSP voltage-sensing movements

    DEFF Research Database (Denmark)

    Lundby, Alicia; Mutoh, Hiroki; Dimitrov, Dimitar

    2008-01-01

    Ci-VSP contains a voltage-sensing domain (VSD) homologous to that of voltage-gated potassium channels. Using charge displacement ('gating' current) measurements we show that voltage-sensing movements of this VSD can occur within 1 ms in mammalian membranes. Our analysis lead to development of a g...... of a genetically encodable fluorescent protein voltage sensor (VSFP) in which the fast, voltage-dependent conformational changes of the Ci-VSP voltage sensor are transduced to similarly fast fluorescence read-outs....

  14. Metodologias feministas: a reflexividade ao serviço da investigação nas ciências sociais

    OpenAIRE

    Neves, Sofia; Nogueira, Conceição

    2005-01-01

    Nos últimos anos as metodologias feministas têm influenciado fortemente a psicologia e as ciências sociais em geral, trazendo para o domínio da investigação novas possibilidades de pesquisa e de entendimento das dinâmicas sociais. A denominada crise positivista, muito marcada pelas críticas feministas à objectividade e neutralidade da ciência, legitimou a emergência de portentosas ferramentas analíticas, entre as quais a reflexividade. Este artigo explora a importância da adopção da reflexivi...

  15. Potenciais aplicações da Inteligência Artificial na Ciência da Informação.

    OpenAIRE

    Martins, Agnaldo Lopes; UFMG

    2010-01-01

    Pretende contribuir com as pesquisas em Ciência da Informação (CI), mais especificamente com aqueles profissionais e pesquisadores envolvidos em atividades que circundam o campo do tratamento digital da informação. Desmistifica, tipifica e exemplifica o uso da Inteligência Artificial em apoio ou substituição ao processamento, baseado na programação algorítmica convencional. Discute as principais técnicas de Inteligência Artificial (IA) utilizadas atualmente, por meio de embasamento conceitual...

  16. A ciência humboltiana e a gênese da Geografia física moderna

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Vitte

    2009-01-01

    Full Text Available O trabalho argumenta que a geografia física surgiu a partir das reflexões e postulados da ci-ência humboldtiana. Essa formada no contexto da naturphilosophie e no desenvolvimento de novos instrumentos e avanços das ciências exatas, permitindo a construção de um modelo de natureza e superfície da terra baseado no princípio transcendental das leis universais da natureza, materializadas em princípios regionais.

  17. SeDiCI: Servicio de Difusión de la Creación Intelectual

    Directory of Open Access Journals (Sweden)

    Marisa R. de Giusti

    2008-07-01

    Full Text Available Presenta el Servicio de Difusión de la Creación Intelectual (SeDiCI de la Universidad Nacional de La Plata (UNLP, Argentina, desde el punto de vista de los objetivos que condujeron a la UNLP a su creación. Se describen en detalle las etapas por las que se atravesó para poner en marcha este repositorio institucional y especialmente las facilidades que provee el software Celsius-DL desarrollado en la UNLP que soporta el Portal de SeDiCI.

  18. O estatuto epistemológico da teologia como ciência da fé e a sua responsabilidade pública no âmbito das ciências e da sociedade pluralista

    Directory of Open Access Journals (Sweden)

    Susin, Luiz Carlos

    2006-01-01

    Full Text Available A revolução científica operada nos últimos tempos recoloca também para a teologia e para as ciências da religião o seu estatuto epistemológico e científico. A melhor forma de a teologia esclarecer seu lugar no âmbito das ciências é esclarecer sua distinção e sua relação com as ciências da religião. Tanto teologia como ciências da religião, no entanto, precisam se situar diante de um terceiro, a sociedade pluralista e sua exigência de convivência, o que reclama a responsabilidade pública e a necessidade da existência da teologia no âmbito público e não apenas como afirmação de identidades próprias

  19. O discurso pedagógico da ciência em operação na Rede Nacional de Educação e Ciência: Novos Talentos da Rede Pública (RNEC/NT

    Directory of Open Access Journals (Sweden)

    Lavínia Schwantes

    Full Text Available Resumo Este artigo objetiva analisar como alguns grupos da Rede Nacional de Educação e Ciências: Novos Talentos da Rede Pública (RNEC/NT, da região sul do país, operam o que temos chamado discurso pedagógico da ciência em cursos para professores e estudantes da Educação Básica. Para tal, utilizamos descrições de cenas enunciativas de cursos desses grupos e os analisamos a partir da análise de discurso foucaultiana. Concluímos que existem três movimentos de pedagogização da ciência nos cursos analisados: na organização pedagógica geral do curso; no ensino, ou como denominamos na "pedagogização" do método científico; e na variação de metodologias para o ensino de ciências. É possível dizer que cursos como estes possibilitam ao professorado compreender a importância desses dois campos de saber para sua prática docente: o discurso pedagógico e o discurso científico.

  20. Por uma ciência formativa e indiciária: proposta epistemológica para a ciência da informação Formative science and indicial science: epistemological proposal for information science

    Directory of Open Access Journals (Sweden)

    Eliany Alvarenga de Araújo

    2006-01-01

    Full Text Available Reflexão epistemológica sobre a Ciência da Informação como “fazer científico” que se estrutura na Ciência Moderna, em termos teóricos e metodológicos e nas Tecnologias daInformação, em termos aplicados. Tal configuração possibilitou o surgimento desta ciência, porém consideramos que a mesma não garantirá à mesma o pleno desenvolvimento comocampo de conhecimento consistente e moderno. A Ciência Moderna, enquanto visão e prática científica encontra-se esgotada e as Tecnologias de Informação são apenas mecanismos autoregulados que funcionam segundo princípios de automatismos. A partir destas considerações propomos o conceito de ciência formativa (Bachelard, 1996 e o paradigma indiciário (Ginzburg, 1991 como bases teóricas e metodológicas para uma epistemologia da Ciência da Informação. O conceito de ciência formativa se baseia no principio dos três estados do espírito científico e nas condições psicológicas do progresso científico e o paradigma indiciário propõe a intuição (empírica e racional como base metodológica para o fazer científico.Epistemological reflections on the Information Science as scientific field that if structure in the context of modern science, in theoretical and methodological terms and technologies of the information in applied terms. Such configuration made possible the sprouting of this science; however we consider that the same one will not guarantee to this science the full development as field of consistent and modern knowledge. Modern Science, while scientific practical vision and meets depleted and the information technologies are only auto-regulated mechanisms that function according to principles of automatisms. To leave of these considerations we propols the concept of Formative Science (Bachelard, 1996 and the Indiciario Paradigm (1991 with epistemological basis for the Information Science. The concept of formative science if a base on the principles of tree

  1. 从音乐附庸到独立新诗--论词乐分离于南宋文人词%On the Separation of CI from Music--The Evolution of CI Music

    Institute of Scientific and Technical Information of China (English)

    宋秋敏

    2013-01-01

      词与乐的关系是一个不断发展和演进的过程,这个过程既影响了词体本身的性质特征,也决定了词体的演化和蜕变。南渡以后,词人们或者拓展词体的抒情言志功能,或者注重词体的合律性和艺术技巧,从各自不同的角度,为唐宋词的创作增添了色彩,但是,他们都未能圆满地解决歌词合乐的持续发展问题,而且,他们创作中的种种流弊在某种程度上还使得南宋词合乐面临新的困境,加速了文人词向格律诗的转变。%  The relationship between Ci and music is a continuously evolving process; this process not only affects Ci’s character, also decide its evolution and transformation. After the Incident of Nandu, Chi writers enriched the creation of Ci from different angles, some expanded Ci’s function of expressing feelings and ambition; some improve Ci’s metrical and artistic skills. However, they still failed to satisfactorily resolve the problem of Ci’s sustainable development. In addiction, various abuses in the Ci writing, to a certain extent, left South Song Ci in a new dilemma, accelerating Ci’s transformation from musical Ci to metrical poetry.

  2. História e epistemologia da Ciência da Informação: Abordagem social em foco

    Directory of Open Access Journals (Sweden)

    Hamilton Rodrigues Tabosa

    2016-07-01

    Full Text Available O objetivo deste artigo é refletir, principalmente com base em Moscovici e Vygotsky, acerca do desenvolvimento das teorizações sobre as relações existentes entre os estudos com abordagens cognitivas e sociais que aconteciam na Europa dos anos 60, para compreender o momento histórico em que se deu o início da abordagem social por parte da Ciência da Informação (CI enquanto ela se institucionalizava com forte tendência a influências norte-americanas na sua composição epistemológica. Suscita reflexões que partem das representações sociais oriundas da Sociologia, bem como da Psicologia Social para procurar perceber influências e/ou equivalências em relação ao surgimento da abordagem social na CI. Apresenta também, brevemente, a visão de Latour sobre a ideia de purificação e de ciência moderna com o intuito de compreender como a CI se insere nesse quadro teórico. Como resultados, percebeu-se e discutiu-se sobre o retardamento do aparecimento ou da adoção de um caráter social no campo teórico e metodológico da CI, uma ciência não-moderna, aberta a soluções interdisciplinares (fortemente ligadas à Sociologia para alguns de seus problemas de pesquisa e integrante de uma rede de relações sócio técnicas horizontais. O objetivo deste artigo é refletir, principalmente com base em Moscovici e Vygotsky, acerca do desenvolvimento das teorizações sobre as relações existentes entre os estudos com abordagens cognitivas e sociais que aconteciam na Europa dos anos 60, para compreender o momento histórico em que se deu o início da abordagem social por parte da Ciência da Informação (CI enquanto ela se institucionalizava com forte tendência a influências norte-americanas na sua composição epistemológica. Suscita reflexões que partem das representações sociais oriundas da Sociologia, bem como da Psicologia Social para procurar perceber influências e/ou equivalências em relação ao surgimento da abordagem

  3. Concepção de neutralidade e objetividade da ciência e tecnologia na formação de professores de ciências: argumentos para a inserção da história e sociologia da ciência na construção do conhecimento científico

    OpenAIRE

    2008-01-01

    A partir de algumas concepções apresentadas por 67 futuros professores de Ciências/Química e Biologia sobre a neutralidade e objetividade da Ciência e Tecnologia foram constatadas visões distorcidas e dilemas persistentes sobre estas questões. Dentre as respostas, 24% dos respondentes entenderam que os melhores cientistas são os que seguem com precisão as etapas do método científico em suas investigações e 13% ficaram indiferentes à pergunta formulada; 72% consideraram que a solução dos probl...

  4. Functional and crystallographic characterization of Salmonella typhimurium Cu,Zn superoxide dismutase coded by the sodCI virulence gene

    NARCIS (Netherlands)

    Pesce, A; Battistoni, A; Stroppolo, ME; Polizio, F; Nardini, M; Kroll, JS; Langford, PR; O'Neill, P; Sette, M; Desideri, A; Bolognesi, M

    2000-01-01

    The functional and three-dimensional structural features of Cu,Zn superoxide dismutase coded by the Salmonella typhimurium sodCI gene, have been characterized. Measurements of the catalytic rate indicate that this enzyme is the most efficient superoxide dismutase analyzed so far, a feature that may

  5. A mutation in Myo15 leads to Usher-like symptoms in LEW/Ztm-ci2 rats

    NARCIS (Netherlands)

    Held, N.; Smits, B.M.; Gockeln, R.; Schubert, S.; Nave, H.; Northrup, E.; Cuppen, E.; Hedrich, H.J.; Wedekind, D.

    2011-01-01

    The LEW/Ztm-ci2 rat is an animal model for syndromal deafness that arose from a spontaneous mutation. Homozygous animals show locomotor abnormalities like lateralized circling behavior. Additionally, an impaired vision can be observed in some animals through behavioral studies. Syndromal deafness as

  6. A crítica de Charles Taylor ao naturalismo na Ciência Política

    Directory of Open Access Journals (Sweden)

    Tiago Losso

    2011-06-01

    Full Text Available Os mais recentes esforços de revitalização do enfoque interpretativo na Ciência Política têm sua gênese na década de 1960, quando vários autores passaram a advogar a centralidade do estudo dos significados lingüístico e hermenêutico dos fenômenos políticos. Dentre tais autores, destaca-se o filósofo e politólogo Charles Taylor, cujos textos dos anos 1960 e 1970 desferem críticas contundentes ao naturalismo subjacente ao mainstream da Ciência Política da época. Meu objetivo é explorar a crítica de Taylor ao naturalismo, pensadas no contexto de uma proposta de abordagem interpretativa para a Ciência Política. Primeiramente, contextualizarei as contribuições de Taylor no âmbito mais amplo do interpretive turn nas Ciências Sociais. Em seguida, sumarizarei as reservas que Quentin Skinner e Clifford Geertz apresentam à crítica de Taylor.

  7. BADANIE MIESZANEK MINERALNO-ASFALTOWYCH W WARUNKACH ŚCINANIA PRZY KONTROLOWANEJ SZTYWNOŚCI WZDŁUŻNEJ

    Directory of Open Access Journals (Sweden)

    Adam ZOFKA

    2016-07-01

    Full Text Available W artykule przedstawiono koncepcję nowej metody badania próbek z mieszanki mineralno-asfaltowej w warunkach ścinania z ciśnieniem bocznym. Dotychczas stosowane metody badawcze ścinania z obciążeniem bocznym opierają się na ocenie właściwości mieszanki mineralno-asfaltowej przy ścinaniu w warunkach stałej siły wzdłużnej lub stałej objętości badanej próbki. Nowa metoda badawcza pozwala na badanie ścinania przy stałej sztywności wzdłużnej. Aby możliwe było badanie według tej metody, zaprojektowano i wykonano specjalną przystawkę o nazwie AST (ang. Advanced Shear Tester. W artykule przedstawiono zarówno opis procesu twórczego podczas projektowania przystawki, jak wykonane urządzenie. Zaprezentowano pierwsze wyniki badań walidacyjnych uzyskanych przy użyciu przystawki na próbkach UHMW-PE oraz z mieszanki mineralno-asfaltowej.

  8. The Music Experiences and Attitudes Of A First Cohort of Prelingually-Deaf Adolescents and Young Adults CI Recipients

    Science.gov (United States)

    Gfeller, Kate; Driscoll, Virginia; Smith, Rachel See; Scheperle, Christina

    2012-01-01

    The purpose of this study was to examine the musical engagement (participation and attitude) of pediatric CI recipients who were implanted during early childhood and who have reached age 15 or older. A questionnaire was administered to a group of 31 prelingually deaf CI users who receive annual follow up services and assessment in a clinical research center. The questionnaire was used to examine involvement in and attitudes toward music in school, the community, and in the home; social affiliation (hearing, Deaf, both) and mode of communication (oral, manual, both) were also examined. Despite the technical limitations of cochlear implants in transmitting pitch, melody, and tone quality, over two thirds of this sample described music as being important or very important in their lives. A high level of past and present familial involvement in music was associated with higher levels of current involvement and importance of music in the lives of adolescent and young adult CI users. Comparisons were noted with data from prior studies of persons with hearing loss who were non-CI users. PMID:23565029

  9. 78 FR 37792 - Mario Julian Martinez-Bernache, Inmate Number #95749-279, CI Big Spring, Corrections Institution...

    Science.gov (United States)

    2013-06-24

    ... Bureau of Industry and Security Mario Julian Martinez-Bernache, Inmate Number 95749-279, CI Big Spring, Corrections Institution, 2001 Rickabaugh Drive, Big Spring, TX 79720; Order Denying Export Privileges On March... this provision may be for a period of up to 10 years from the date of the conviction. 15 CFR...

  10. Identification of Quaternary Structure and Functional Domains of the CI Repressor from Bacteriophage TP901-1

    DEFF Research Database (Denmark)

    Pedersen, Margit; Lo Leggio, Leila; Grossmann, J. Günter;

    2008-01-01

    filtration and chemical cross-linking demonstrated that the C-terminal end of Cl was required for oligomerization and that Cl may exist as a hexamer in solution. Furthermore, expression and purification of the C-terminal part of CI (amino acids 92-180) showed that this part of the protein contained all...

  11. Możliwości wykorzystania MSSF 9 do kształtowania wyniku finansowego jednostki gospodarczej

    Directory of Open Access Journals (Sweden)

    Maciej Frendzel

    2016-09-01

    Full Text Available Artykuł podejmuje problematykę zastosowania Międzynarodowego Standardu Sprawozdawczości Finan- sowej (MSSF 9 Instrumenty finansowe w kontekście możliwości wykorzystania przewidzianych w nim rozwiązań do uzyskania pożądanych rezultatów w zakresie sprawozdawczości finansowej. Celem artykułu jest prezentacja wybranych obszarów rachunkowości instrumentów finansowych, które mogą być wyko- rzystane do kształtowania wyniku finansowego i sytuacji finansowej jednostki gospodarczej w kontek- ście pierwszego zastosowania tej regulacji. W artykule zastosowano metodę krytycznej analizy, wnio- skowania dedukcyjnego oraz studium przypadku. Na potrzeby artykułu i zastosowania studium przypad- ku przeprowadzono dwa wywiady niestrukturyzowane z osobami zajmującymi kierownicze stanowiska w instytucji finansowej w Polsce oraz przeanalizowano przeprowadzone przez nich symulacje.

  12. Development of the radical-stable Coprinus cinereus peroxidase (CiP) by blocking the radical attack.

    Science.gov (United States)

    Kim, Su Jin; Joo, Jeong Chan; Kim, Han Sang; Kwon, Inchan; Song, Bong Keun; Yoo, Young Je; Kim, Yong Hwan

    2014-11-10

    Despite the potential use of peroxidases as industrial biocatalysts, their practical application is often impeded due to suicide inactivation by radicals generated in oxidative reactions. Using a peroxidase from Coprinus cinereus (CiP) as a model enzyme, we revealed a dominant factor for peroxidase inactivation during phenol oxidation, and we engineered radical-stable mutants by site-directed mutagenesis of an amino acid residue susceptible to modification by phenoxyl radical. Mass spectrometry analysis of inactivated CiP identified an adduct between F230 and a phenoxyl radical, and subsequently, the F230 residue was mutated to amino acids that resisted radical coupling. Of the F230 mutants, the F230A mutant showed the highest stability against radical inactivation, retaining 80% of its initial activity, while the wild-type protein was almost completely inactivated. The F230A mutant also exhibited a 16-fold higher turnover of the phenol substrate compared with the wild-type enzyme. Furthermore, the F230A mutant was stable during the oxidation of other phenolic compounds, including m-cresol and 3-methoxyphenol. No structural changes were observed by UV-vis and CD spectra of CiP after radical coupling, implying that the F230-phenol radical adduct inactivated CiP by blocking substrate access to the active site. Our novel strategy can be used to improve the stability of other peroxidases inactivated by radicals.

  13. A Comprehensive Evaluation of H2SO4 formation from OH and sCI pathways in high BVOC environments

    Science.gov (United States)

    Kim, S.; Seco, R.; Park, J. H.; Guenther, A. B.; Smith, J. N.; Kuang, C.; Bustillos, J. O. V.; Tota, J.; Souza, R. A. F. D.

    2014-12-01

    The recently highlighted importance of stabilized Criegee intermediates (sCI) as an oxidant for atmospheric SO2 triggered a number of studies to assess the atmospheric implications of H2SO4 formation from the sCI reaction pathway. In addition, it has not been clear why new particle formation events are not observed in the Amazon rain forest. The mostly widely speculated reason has been a very low H2SO4 level. We will present quantitative assessments of SO2 oxidation by sCI leading to the H2SO4 production using a comprehensive observational dataset from a tropical rainforest study during the GOAmazon field campaign at the T3 site in Manacapuru, Amazonas, Brazil. To our best knowledge, this is the first observation of H2SO4 and OH in Amazon and is unique for all tropical sites due to the accompanying comprehensive gas and aerosol observations such as CO, NOX, SO2, VOCs, and physical and chemical characteristics of aerosols. We will discuss observed H2SO4 levels during the GOAmazon field campaigns to demonstrate 1) H2SO4 formation potential from OH and sCI oxidation pathways by contrasting extremely clean and relatively polluted air masses and 2) the Implications of the observed H2SO4 levels in new particle formation and particle growth events.

  14. Ensino de ciências e matemática, IV : temas de investigação

    National Research Council Canada - National Science Library

    Pirola, Nelson Antonio

    2010-01-01

    ... com a Fundação Editora da UNESP, que tem como principal objetivo a divulgação de pesquisas realizadas pelos Programas de Pós-Graduação da universidade. A série "Ensino de Ciências e Matemática" teve...

  15. The Performance skills of Nalanxingde’s Ci%论纳兰性德词的表现技巧

    Institute of Scientific and Technical Information of China (English)

    刘晓萍

    2016-01-01

    Nalanxingde is one of the the most gifted and accomplished Ci w riters in qing dynasty .His Ci as the inte‐gration on the basis of predecessors’ ci and innovate ,and in qing dynasty luxuriousness and even the history of Chinese lit‐erature has a unique value and status .His Ci has a superb performance skills in the four aspects such as subject content , image ,language ,and melody .Nalanxingde brought fresh smell and new element on this kind of style of Word ,and the development of the study is contributed .%纳兰性德是清代最富天才、最有成就的词人之一,他的词作在融合前人词作的基础上而有所创新,在清代词坛乃至中国文学史上都有着独特的价值和地位,在题材内容、意象、语言、音律等四个方面都有着高超的表现技巧。纳兰性德给词这种文体带来了新鲜的生气,加入了新的元素,对词学的发展可谓是功不可没。

  16. The cholecystokinin-B receptor antagonist CI-988 failed to affect CCK-4 induced symptoms in panic disorder patients

    NARCIS (Netherlands)

    vanMegen, HJGM; Westenberg, HGM; denBoer, JA; Slaap, B; vanEsRadhakishun, F; Pande, AC

    1997-01-01

    The effects of the cholecystokinin-B (CCK-B) receptor antagonist CI-988 on symptoms elicited by the cholecystokinin tetrapeptide (CCK4) were studied in DSM-IIIR patients with panic disorder. The study employed a double-blind, two-period incomplete block design. Patients (n = 14) received two differe

  17. Evaluation of selective NK(1) receptor antagonist CI-1021 in animal models of inflammatory and neuropathic pain.

    Science.gov (United States)

    Gonzalez, M I; Field, M J; Hughes, J; Singh, L

    2000-08-01

    CI-1021 ([(2-benzofuran)-CH(2)OCO]-(R)-alpha-MeTrp-(S)-NHCH(CH (3))Ph) is a selective and competitive neurokinin-1 (NK(1)) receptor antagonist. This study examines its activity in animal models of inflammatory and neuropathic pain. In mice, CI-1021 (1-30 mg/kg, s.c.) dose dependently blocked the development of the late phase of the formalin response with a minimum effective dose (MED) of 3 mg/kg. Two chemically unrelated NK(1) receptor antagonists, CP-99,994 (3-30 mg/kg) and SR 140333 (1-100 mg/kg), also dose dependently blocked the late phase, with respective MEDs of 3 and 10 mg/kg. PD 156982, a NK(1) receptor antagonist with poor central nervous system penetration, failed to have any effect. However, when administered i. c.v., it selectively blocked the late phase of the formalin response. Chronic constrictive injury (CCI) to a sciatic nerve in the rat induced spontaneous pain, thermal and mechanical hyperalgesia, and cold, dynamic, and static allodynia. CI-1021 (10-100 mg/kg) and morphine (3 mg/kg) blocked all the responses except dynamic allodynia. Carbamazepine (100 mg/kg) was weakly effective against all the responses. Once daily administration of morphine (3 mg/kg, s. c.) in CCI rats led to the development of tolerance within 6 days. Similar administration of CI-1021 (100 mg/kg, s.c.) for up to 10 days did not induce tolerance. Moreover, the morphine tolerance failed to cross-generalize to CI-1021. CI-1021 blocked the CCI-induced hypersensitivity in the guinea pig, with a MED of 0.1 mg/kg, p.o. CI-1021 (10-100 mg/kg, s.c.) did not show sedative/ataxic action in the rat rota-rod test. It is suggested that NK(1) receptor antagonists possess a superior side effect profile to carbamazepine and morphine and may have a therapeutic use for the treatment of inflammatory and neuropathic pain.

  18. BADANIA PRĘDKOŚCI POJAZDÓW NA WLOTACH SKRZYŻOWAŃ BEZ SYGNALIZACJI ŚWIETLNEJ

    Directory of Open Access Journals (Sweden)

    Robert ZIÓŁKOWSKI

    2016-07-01

    Full Text Available W terenach zurbanizowanych w obszarze skrzyżowań drogowych dochodzi do koncentracji zdarzeń drogowych. Mimo projektowania skrzyżowań z sygnalizacją świetlną w celu poprawy bezpieczeństwa ruchu drogowego, to zdecydowana większość skrzyżowań w miastach funkcjonuje bez sygnalizacji. Od wielu lat jako jedną z podstawowych przyczyn dla jakich dochodzi do zdarzeń drogowych pozostaje prędkość. Celem referatu jest analiza prędkości pojazdów na wlotach skrzyżowań bez sygnalizacji świetlnej z uwzględnieniem charakterystyki odcinka dojazdowego, kierunku jazdy przez skrzyżowanie oraz wielkości promienia wyokrąglającego. Dodatkowo przeanalizowano średnie prędkości pojazdów na przejściach dla pieszych zlokalizowanych na wlotach nadrzędnych. Przeanalizowano prędkości pojazdów w warunkach ruchu swobodnego na 14 skrzyżowaniach zlokalizowanych w Białymstoku. Pomiary prowadzono wykorzystując metodę pojazdu testowego z wykorzystaniem rejestratora danych GPS. W wyniku przeprowadzonych badań wykazano istotne różnice pomiędzy średnimi prędkościami w zależności od relacji skrętnej. Dodatkowo wykazano istotność wpływu przekroju poprzecznego wlotu na średnią prędkość przejazdu przy wykonywaniu relacji prawoskrętnych. Przy relacjach lewoskrętnych takiego wpływu nie stwierdzono. Przeprowadzone analizy prędkości na przejściach dla pieszych wskazały, istotny wpływ odsunięcia przejścia od skrajnego pasa ruchu poprzecznej drogi na wzrost prędkości.

  19. Ciência e arte: relações improváveis? Science and art: unlikely relations?

    Directory of Open Access Journals (Sweden)

    José Claudio Reis

    2006-10-01

    Full Text Available Este artigo discute as relações entre ciência e arte, principalmente entre física e pintura, com o objetivo de apresentar uma abordagem cultural para a ciência. Dessa forma, entendemos que a compreensão dos conteúdos da ciência torna-se mais significativa. Abordamos diferentes momentos da história desde a revolução científica até o século XX. As relações aqui salientadas não buscam uma relação causal entre ciência e arte, mas sim uma visão mais significativa do que é o processo de construção do conhecimento. Assim, a ciência se desnuda para nós como parte da cultura e pode nos ajudar a compreender melhor o processo histórico que nos trouxe até aqui.With the goal of presenting a cultural approach to science, the article discusses relations between science and art, especially between physics and painting. From this standpoint, we can see how understanding the substance of science becomes more important. Different moments in history are examined, from the scientific revolution down through the twentieth century. The relations highlighted herein are not chosen in an effort to undercover a causal relation between science and art but to arrive at a more meaningful understanding of how knowledge is constructed. Science is thus revealed to be part of culture, which can help us better understand the historical process through which we have come to this point.

  20. Gabapentin and the neurokinin(1) receptor antagonist CI-1021 act synergistically in two rat models of neuropathic pain.

    Science.gov (United States)

    Field, Mark J; Gonzalez, M Isabel; Tallarida, Ronald J; Singh, Lakhbir

    2002-11-01

    The present study examines the effect of combinations of gabapentin (Neurontin) and a selective neurokinin (NK)(1) receptor antagonist, 1-(1H-indol-3-ylmethyl)-1-methyl-2-oxo-2-[(1-phenylethyl)amino]ethyl]-2-benzofuranylmethyl ester (CI-1021), in two models of neuropathic pain. Dose responses to both gabapentin and CI-1021 were performed against static allodynia induced in the streptozocin and chronic constriction injury (CCI) models. Theoretical additive lines were calculated from these data. Dose responses to various fixed dose ratios of a gabapentin/CI-1021 combination were then examined in both models. In the streptozocin model, administration of gabapentin/CI-1021 combinations at fixed dose ratios of 1:1 and 60:1 resulted in an additive effect with dose response similar to the theoretical additive line. However, a synergistic interaction was seen after fixed dose ratios of 10:1, 20:1, and 40:1 with static allodynia completely blocked and the dose responses shifted approximately 8-, 30-, and 10-fold leftward, respectively, from the theoretical additive values. In the CCI model, after fixed dose ratios of 5:1 and 20:1, combinations of gabapentin and CI-1021 produced an additive response. At the fixed dose ratio of 10:1 static allodynia was completely blocked with an approximate 10-fold leftward shift of the dose response from the theoretical additive value, indicating synergy. The combination of gabapentin with a structurally unrelated NK(1) receptor antagonist, (2S,3S)-3-(2-methoxybenzylamino)-2-phenylpiperidine (CP-99,994), also produced synergy, at a fixed dose ratio of 20:1. This ratio completely blocked streptozocin-induced static allodynia and was approximately shifted leftward 5-fold from the theoretical additive value. These data suggest a synergistic interaction between gabapentin and NK(1) receptor antagonists in animal models of neuropathic pain.

  1. Realisation of voicing by French-speaking CI children after long-term implant use: An acoustic study.

    Science.gov (United States)

    Grandon, Bénédicte; Vilain, Anne; Lœvenbruck, Hélène; Schmerber, Sébastien; Truy, Eric

    2017-01-01

    Studies of speech production in French-speaking cochlear-implanted (CI) children are very scarce. Yet, difficulties in speech production have been shown to impact the intelligibility of these children. The goal of this study is to understand the effect of long-term use of cochlear implant on speech production, and more precisely on the coordination of laryngeal-oral gestures in stop production. The participants were all monolingual French children: 13 6;6- to 10;7-year-old CI children and 20 age-matched normally hearing (NH) children. We compared /p/, /t/, /k/, /b/, /d/ and /g/ in word-initial consonant-vowel sequences, produced in isolation in two different tasks, and we studied the effects of CI use, vowel context, task and age factors (i.e. chronological age, age at implantation and duration of implant use). Statistical analyses show a difference in voicing production between groups for voiceless consonants (shorter Voice Onset Times for CI children), with significance reached only for /k/, but no difference for voiced consonants. Our study indicates that in the long run, use of CI seems to have limited effects on the acquisition of oro-laryngeal coordination needed to produce voicing, except for specific difficulties located on velars. In a follow-up study, further acoustic analyses on vowel and fricative production by the same children reveal more difficulties, which suggest that cochlear implantation impacts frequency-based features (second formant of vowels and spectral moments of fricatives) more than durational cues (voicing).

  2. Elinor Ostrom, a premiação da visão unificada das ciências humanas

    Directory of Open Access Journals (Sweden)

    Amilcar Baiardi

    Full Text Available Sempre houve preocupações no sentido de estabelecer uma conexão histórica e paradigmática entre a sociologia, a economia e a política, sustentando a unificação dos campos científicos e trazendo de volta aquilo que para Weber era a Ciência Social como "Ciência da Realidade", voltada para a compreensão da significação cultural atual dos fenômenos e para o entendimento de sua origem histórica e que, para Marx, era a busca da totalidade, fundamental porque não seria possível compreender as partes sem uma visão do todo. Neste texto, explora-se esse "approach", focando a obra de Elinor Ostrom, vencedora do Prêmio Nobel de Economia de 2009, que sempre se recusou a ver a esfera das ciências humanas como uma "Torre de Babel", mas sim como um ambiente com amplas possibilidades de integração, sendo sua práxis um exemplo completo e eloquente de convergência e de síntese nas ciências sociais. Após o breve exame de alguns casos emblemáticos de tentativas de integração das ciências sociais, analisam-se a trajetória acadêmica de Elinor Ostrom e suas principais contribuições para as pesquisas sobre os recursos e bens de propriedade comum.

  3. On Singing Ci with the Tune of Kunqu Opera:Centered on Xue-Shaohui's Viewpoint on Singing Ci%论以昆曲唱词——以薛绍徽唱词观为中心

    Institute of Scientific and Technical Information of China (English)

    刘荣平

    2009-01-01

    薛绍徽用昆曲唱唐宋词是逼近唐音宋调的有效手段,她提出的"无词不可唱,无词不合乐"的观点,对于我们今天唱唐宋词颇具参考价值和启示意义.具体到唱词,她提出的"长音使短,短音使长"的方法即是昆唱中的"依字声行腔";她认为词之唱"不在于谱",通过分析,可知其原因实在于腔;她由词唱的角度去看待词之韵脚平仄,这是注意到了音乐对歌词的重构作用.其唱词方法和观点与当今词乐专家洛地、刘崇德主张的唱词方法和观点在学理上相通.可以说用昆曲唱唐宋词是目前最好的方法之一.%Xue Shaohui singing of ci-poem of the Tang and Song dynasties with the tune of Kunqu opera effectively approaches the original tunes. Her viewpoint that any ci can be sung and every ci is in rhyme has shedded light on today's ci singing. Her advocation of "making the long sound short and the short one long" is actually " singing the tunes according to the lyric" in Kunqu and she also said that singing ci is "not confined to music score". When she looked on the level and oblique tones and rhyme through the angle of singing, she noticed the reconstruction role of music to lyrics. Her viewpoint is in line with Luo-Di's and Liu Chongde's professioanal ideas. It may be said that that singing ci of the Tang and Song dynasties with the tune of Kunqu opera is one of the best ways today.

  4. From Reliability to Resilience: Modern Challenges of Safety and Reliability Theory and Applications / Od Nieuszkadzalności Do Odporności: Współczesne Wyzwania Teorii i Inżynierii Niezawodności i Bezpieczeństwa

    Directory of Open Access Journals (Sweden)

    Nowakowski Tomasz

    2015-09-01

    Full Text Available Można wyróżnić główne kierunki rozwoju współczesnej teorii niezawodności; niektóre z nich są przedmiotem codziennych działań inżynierskich, jak np.: kontrola jakości w produkcji masowej czy „czysta” analiza niezawodności. Ale większość tych wyzwań, takich jak: efektywność, odporność czy bezpieczeństwo są obecnie przedmiotem wielu prac koncepcyjnych, modelowania i badań. Celem artykułu jest pokazanie jak wymagania w stosunku do osiągów obiektu technicznego były poszerzane o: oczekiwania klienta (jakość, zdolność do zapobiegania utracie właściwości przez obiekt podczas eksploatacji (nieuszkadzalność i obsługiwalność, skutki niepożądanych zdarzeń i ochrona przed nimi (bezpieczeństwo oraz zdolność do odtworzenia osiągów (odporność na zagrożenia.

  5. Measurement of Small Values of Hydrostatic Pressure with the Compensation of Atmospheric Pressure Influence / Pomiar Małych Wartości Ciśnienia Hydrostatycznego Z Kompensacją Wpływu Ciśnienia Atmosferycznego

    Science.gov (United States)

    Broda, Krzysztof; Filipek, Wiktor

    2013-09-01

    structure has been simplified and the measurement accuracy has increased. Znajomość rozkładu ciśnienia (lub różnicy ciśnień) determinuje opis przepływu płynu przez ośrodek porowaty. W przypadku dużych liczb Reynoldsa nie nastręcza to większych trudności, lecz dla przepływów laminarnych (tj. dla liczb Re (Bear, 1988; Duckworth, 1983; Troskolański, 1957) z zakresu 0.01 do 3) jest to praktycznie niemożliwe w oparciu o dostępne na rynku przyrządy. Przyczyny powodujące taką sytuację zostały omówione w poprzednim opracowaniu (Broda i Filipek, 2012), w którym zwrócono uwagę na trudności pomiarów związane z napięciem powierzchniowym czy włoskowatością (Adamson, 1997). Zaproponowano (Broda i Filipek, 2012) nową, autorską metodę pomiaru bardzo małych różnic ciśnień oraz skonstruowano odpowiednie stanowisko składające się z dwóch oddzielnych zbiorników pomiarowych oraz przeprowadzono pomiary. Z przeprowadzonych badań (Broda i Filipek, 2012) wynikała konieczność zastosowania stabilizacji temperatury urządzenia oraz kompensacji wpływu ciśnienia atmosferycznego na proces pomiarowy. Niniejsza publikacja przedstawia wyniki kontynuacji badań nad metodami i aparaturą do pomiaru bardzo małych różnic ciśnień z uwzględnieniem zdobytych doświadczeń, w oparciu o nowe stanowisko pomiarowe, którego zasadę działania i budowę przedstawiono na rys. 1-5, kolejno przedstawiając koncepcję wykonania pomiaru małych wartości ciśnienia hydrodynamicznego z kompensacją wpływu ciśnienia atmosferycznego rys. 1; ilustrację obrazującą stan odpowiadający przypadkowi braku przepływu płynu przez badany obiekt rys. 2; omawiając stan odpowiadający przypadkowi przepływu płynu przez badany obiekt rys. 3. Kolejno omówiono stan odpowiadający pomiarowi spadku ciśnienia na badanym obiekcie rys. 4 oraz przedstawiono metodykę pomiaru (zależności (1) - (20)). Zdjęcie stanowiska badawczego oraz jego elementów ilustruje rys. 5. W

  6. História da química na sala de aula para ensinar sobre natureza da ciência: o exemplo da interdependência entre ciência e tecnologia

    OpenAIRE

    Paixão, Fátima; Figueiredo, Margarida

    2015-01-01

    Na senda da investigação que valoriza um ensino e aprendizagem de Química promotor de literacia científica desenvolvemos, no âmbito do Projeto EANCYT (Enseñanza y Aprendizaje sobre la Naturaleza de la Ciencia y Tecnología), uma sequência didática com o objetivo de melhorar a compreensão pelos alunos da Interdependência entre Ciência e Tecnologia através de um ensino explícito sobre a Natureza da Ciência. No desenho da sequência didática foram utilizados materiais que se enquadram no domínio d...

  7. O papel do ensino informal de ciências: uma análise sobre o impacto do show de energia sobre o interesse dos alunos para cursos de áreas de ciências exatas

    Directory of Open Access Journals (Sweden)

    Marco Aurélio Alvarenga Monteiro

    2012-10-01

    Full Text Available Nosso trabalho tem por objetivo discutir o ensino de ciências no contexto da educação informal. Assim, apresentamos e analisamos os resultados de uma iniciativa que temos realizado buscando despertar o interesse de alunos do ensino médio para o estudo das ciências exatas e tecnológicas. Os shows de Energia são atividades nas quais são apresentadas demonstrações experimentais de conceitos científicos para alunos do ensino médio. Após a realização de cada show os alunos respondem a um questionário que serviu de base para a realização desse estudo. Os resultados obtidos indicam que a realização dos shows tem tido grande impacto sobre os estudantes.

  8. Miejsce przeszłości w przestrzeni ponowoczesności. Landmarki w krajobrazie kulturowym Ustronia jako przykład „re-konstruowania” wspólnoty lokalnej

    OpenAIRE

    2014-01-01

    Artykuł stanowi studium przypadku ukazujące przeobrażenia przestrzeni symbolicznej w niewielkiej miejscowości sytuującej się na wielorako pojętym pograniczu. Autorka omawia przykład Ustronia na Śląsku Cieszyńskim, w którym przez dwa wieki współistniały rolnictwo, przemysł i uzdrowisko, a obecnie dominuje turystyka. Zachodzące zmiany nie są jednak biernie przyjmowane przez mieszkańców, gdyż krajobraz kulturowy zależy od nawarstwień historycznych i funkcjonowania w pamięci zbiorowej. W podtrzym...

  9. 40 CFR 63.6604 - What fuel requirements must I meet if I own or operate an existing stationary CI RICE?

    Science.gov (United States)

    2010-07-01

    ... that meets the requirements in 40 CFR 80.510(b) for nonroad diesel fuel. Existing non-emergency CI... I own or operate an existing stationary CI RICE? 63.6604 Section 63.6604 Protection of Environment....6604 What fuel requirements must I meet if I own or operate an existing stationary CI RICE? If you...

  10. Powikłania neurologiczne współistniejące z niewydolnością nerek

    Directory of Open Access Journals (Sweden)

    Maria Łukasik

    2010-03-01

    Full Text Available Powikłania neurologiczne w przebiegu niewydolności nerek, zarówno te spowodowane mocznicą, jak i wynikające z jej leczenia, dotyczą ośrodkowego oraz obwodowego układu nerwowego, jak również tkanki mięśniowej i stanowią przyczynę zwiększonej śmiertelności u chorych z niewydolnością nerek. Pacjenci z niewydolnością nerek są szczególnie narażeni na rozwój encefalopatii mocznicowej, encefalopatii nadciśnieniowej, chorób naczyniowych ośrodkowego układu nerwowego bądź zespołów otępiennych. W tej grupie chorych częściej niż w populacji ogólnej rozwijają się mono- i polineuropatie, a choroby nerek należą do częstszych przyczyn zespołu niespokojnych nóg. Pomimo ciągłego postępu terapeutycznego wciąż nie ma skutecznego leczenia wielu tych powikłań, m.in. encefalopatii mocznicowej, miażdżycy, neuropatii czy miopatii. Co więcej, wprowadzenie dializoterapii rozszerzyło spektrum komplikacji o otępienie dializacyjne, krwawienia śródczaszkowe, zespół nierównowagi dializacyjnej, encefalopatię Wernickego i osmotyczną mielinolizę. Leczenie immunosupresyjne stosowane zarówno w chorobach nerek, jak i u chorych po przeszczepie nerki przyczyniło się do rozwoju oportunistycznych infekcji i nowotworzenia w ośrodkowym układzie nerwowym, ponadto niekiedy powikłane jest rozwojem odwracalnej tylnej leukoencefalopatii. Znajomość tych powikłań oraz ścisła współpraca między nefrologami i neurologami mogą przyczynić się do zmniejszenia śmiertelności i poprawy jakości życia chorych z niewydolnością nerek. Należy przy tym pamiętać, że także patologie, które prowadzą do niewydolności nerek (szczególnie choroby układowe tkanki łącznej czy cukrzyca, powodują uszkodzenia ośrodkowego i obwodowego układu nerwowego, a określenie rzeczywistej przyczyny bywa niemożliwe.

  11. A "crítica forte" da ciência e implicações para a educação em ciências The "strong criticism" of science and the implication to science education

    Directory of Open Access Journals (Sweden)

    Ileana María Greca

    2004-12-01

    Full Text Available Neste trabalho discutimos alguns elementos oriundos tanto do que se pode denominar vagamente de tendências pós-modernas na filosofia, quanto do campo da história social e da sociologia das ciências, e as possíveis implicações dos mesmos para a pesquisa e a educação em ciências. Nossa avaliação é que, independentemente do problemático de alguns de seus pressupostos, estas correntes têm a contribuir para a nossa compreensão da ciência e para a formação de cidadãos mais responsáveis.In this article we discuss some issues from what can be termed vaguely postmodernists tendencies in philosophy and social history, trying to establish some implications from these positions for Science Education. Although problematic aspects exist in their assumptions, we think they may contribute to our understanding of science and help us to prepare more responsible citizens.

  12. Impact of isovalent doping on the formation of the CiOi(SiI)n defects in silicon

    Science.gov (United States)

    Christopoulos, S.-R. G.; Sgourou, E. N.; Vovk, R. V.; Chroneos, A.; Londos, C. A.

    2017-09-01

    It has been determined that carbon-oxygen-self-interstitial defects in silicon (Si) can influence the operation of devices through the concentration of intrinsic point defects. Doping with larger isovalent dopants such as germanium (Ge) and tin (Sn) can impact the formation, energetics and structure of defect clusters in Si. In the present study we use density functional theory calculations to gain insights on the formation and stability of the CiOi(SiI)n (n = 0, 1, 2) defects in Si doped with Ge or Sn. It is calculated that the CiOi(SiI)n defects will preferentially form away from the oversized dopants. This result for the interstitial clusters is opposite to what is expected for vacancy-containing clusters which strongly associate with oversized dopants.

  13. Experimental Investigation on Usage of Palm Oil as a Lubricant to Substitute Mineral Oil in CI Engines

    Directory of Open Access Journals (Sweden)

    K. S. V. Krishna Reddy

    2014-01-01

    Full Text Available Due to growing environmental concerns, vegetable oils are finding their way into lubricants for industrial and transportation applications. The substitution of mineral oil with vegetable oil as a base stock for an environment friendly lubricant in a CI engine is explored in this study without adding any additives. The experiments have been conducted with a mixture of palm oil and mineral oil, at different compositions. Blends of palm oil and mineral oil in different compositions, 0, 25, and 50 (by vol % were added to base SAE20W40 mineral oil to obtain different lubricant blends. The parameters evaluated include brake thermal efficiency, brake specific fuel consumption, volumetric efficiency, and mechanical efficiency and exhaust emissions. The engine performance and emission tests were carried out on a single cylinder, water cooled, 4-stroke CI engine. Compared to mineral oil, the palm oil-based lubricant revealed appreciable expedience on engine and emission performance.

  14. The Validity and Reliability of Turkish Version of the Chemotherapy-induced Taste Alteration Scale (CiTAS).

    Science.gov (United States)

    Sozeri, Elif; Kutluturkan, Sevinc

    2016-08-11

    The study was aimed to assess the validity and reliability of the Turkish version of the Chemotherapy-induced Taste Alteration Scale (CiTAS), and was conducted on adult patients receiving chemotherapy (N = 184) in the Chemotherapy Unit and Hematology Clinic (Outpatient) of a university hospital between December 2013 and May 2014. The results showed that the Cronbach's alpha coefficient (.869) was satisfactory. The alpha value was .89 for the Decline in Basic Taste subscale, .70 for Discomfort subscale, .82 for Phantogeusia and Parageusia subscale, and .72 for General Taste Alterations subscale. The coefficients of the relationship between test-retest reliability results were significantly high (r = .939, n = 28). The Turkish version of the CiTAS was a sufficient and suitable tool in evaluating the taste alterations associated with chemotherapy.

  15. A epistemologia de Mario Bunge e sua contribuição para o ensino de ciências

    OpenAIRE

    Westphal,Murilo; Pinheiro, Thais Cristine

    2004-01-01

    Apresenta-se parte da epistemologia de Mario Bunge, sua preocupação com a crise que se instaurou sobre a ciência e com o avanço de visões relativistas como as de Kuhn e Feyerabend. Destacam-se as divergências de opiniões e as muitas críticas que desenvolve no anseio de retorno ao realismo ontológico - seu maior interesse - razão de um progresso científico coeso e de uma aproximação consistente com a verdade. Faz-se referência, ainda, ao uso de tal epistemologia no ensino de ciências, mostrand...

  16. Różnice indywidualne w skłonności do kupowania impulsywnego. Konstrukcja i walidacja skali pomiarowej

    OpenAIRE

    Gąsiorowska, Agata

    2013-01-01

    Dotychczasowe badania nad zakupami impulsywnymi sugerują istnienie indy- widualnych różnic w zakresie skłonności do takiego sposobu kupowania. Niniejszy artykuł prezentuje wyniki badań, których celem była konstrukcja i weryfikacja wielowymiarowej skali do pomiaru skłonności do kupowania impulsywnego (SKI). Skala ta składa się z pięciu podwymiarów, reprezentujących emocje zwią- zane z zakupami, poczucie nacisku podczas zakupów, przyjemność z nich czerpaną, odczuwanie żalu pozakupowego i brak r...

  17. The Kto-Skd complex can regulate ptc expression by interacting with Cubitus interruptus (Ci) in the Hedgehog signaling pathway.

    Science.gov (United States)

    Mao, Feifei; Yang, Xiaofeng; Fu, Lin; Lv, Xiangdong; Zhang, Zhao; Wu, Wenqing; Yang, Siqi; Zhou, Zhaocai; Zhang, Lei; Zhao, Yun

    2014-08-08

    The hedgehog (Hh) signaling pathway plays a very important role in metazoan development by controlling pattern formation. Drosophila imaginal discs are subdivided into anterior and posterior compartments that derive from adjacent cell populations. The anterior/posterior (A/P) boundaries, which are critical to maintaining the position of organizers, are established by a complex mechanism involving Hh signaling. Here, we uncover the regulation of ptc in the Hh signaling pathway by two subunits of mediator complex, Kto and Skd, which can also regulate boundary location. Collectively, we provide further evidence that Kto-Skd affects the A/P-axial development of the whole wing disc. Kto can interact with Cubitus interruptus (Ci), bind to the Ci-binding region on ptc promoter, which are both regulated by Hh signals to down-regulate ptc expression. © 2014 by The American Society for Biochemistry and Molecular Biology, Inc.

  18. Uma outra visão do direito: as contribuições fornecidas pelas ciências sociais

    Directory of Open Access Journals (Sweden)

    Bárbara Baptista

    2009-02-01

    Full Text Available A proposta principal deste trabalho é tentar expor as relevantes contribuições que as ciências sociais podem fornecer à compreensão do Direito e ao desenvolvimento da pesquisa jurídica. Para fazê-lo, parto de uma experiência pessoal, vivenciada durante a elaboração da minha dissertação de mestrado, cujo resultado me permitiu olhar o Direito sob o viés antropológico e, por isso, enxergar aspectos e mecanismos do nosso sistema judiciário que eu não teria percebido se não tivesse me valido da pesquisa de campo que realizei e do diálogo produtivo que me permiti fazer com as ciências sociais.

  19. O teatro como ferramenta pedagógica nas Ciências da Nutrição

    OpenAIRE

    Padrão, Patrícia; Barros, Renata; Gregório, Maria João; Graça, Pedro

    2012-01-01

    Diferentes autores têm vindo a questionar a abrangência da formação universitária na área das ciências da saúde, nomeadamente pela incapacidade de se formarem profissionais capazes de construir alianças a vários níveis, com vista à transformação dos ambientes onde atuam.Com o objetivo de capacitar os estudantes pré-graduados da Licenciatura em Ciências da Nutrição para uma melhor interação com o seu público-alvo, foi desenvolvido um espetáculo de teatro, no âmbito da Unidade Curricular de Pro...

  20. A fundamentação da ciência da natureza humana de David Hume: uma epistemologia experimental

    OpenAIRE

    Campelo, Wendel de Holanda Pereira

    2013-01-01

    A ciência da natureza humana é o projeto de Hume que concerne à toda sua filosofia –estética, ética, política, teoria do conhecimento, história, economia, filosofia da religião, etc. – coisa de que jamais poderíamos dar conta, dado a natureza do trabalho de mestrado. Por isso, contentamo-nos em falar apenas da fundamentação da ciência da natureza humana, referente à investigação acerca da origem das ideias e operações do entendimento, ou da investigação sobre as causas e os poderes ocultos do...

  1. Sobre ciúmes e erotomania: reflexões acerca de um caso clínico

    Directory of Open Access Journals (Sweden)

    Fernanda Costa Rios

    2013-09-01

    Full Text Available Este artigo aborda os temas do ciúmes e da erotomania a partir de um caso clínico. O ciúme foi retomado partindo de sua manifestação primordial na gênese da constituição do psiquismo em direção a seus desdobramentos patológicos. A erotomania foi abordada a partir do referencial psiquiátrico clássico e não daquele encontrado nos atuais manuais diagnósticos. A articulação dos dois temas, embora não tenha visado qualquer intenção diagnóstica, apontou para uma posição subjetiva regressiva, de estruturação narcísica, delirante e com frágil conjugação do corpo.

  2. Odpowiednie stosowanie okoliczności wyłączających odpowiedzialność karna wobec przewinień dyscyplinarnych

    OpenAIRE

    Wantoła, Michał

    2016-01-01

    Autor zakłada zasadność rozróżnienia pojęć odpowiedzialności karnej sensu stricto i odpowiedzialności karnej sensu largo (odpowiedzialności represyjnej). Konstytucyjne gwarancje w zakresie prawa karnego odnoszą się do każdego rodzaju odpowiedzialności represyjnej, w tym do odpowiedzialności dyscyplinarnej. Przepisy prawa dyscyplinarnego najczęściej przewidują nakaz odpowiedniego stosowania uregulowań kodeksu postępowania karnego, nie odnosząc się do kwestii stosowania przepisów kodeksu karneg...

  3. Enrichment of the amino acid L-isovaline by aqueous alteration on CI and CM meteorite parent bodies.

    Science.gov (United States)

    Glavin, Daniel P; Dworkin, Jason P

    2009-04-07

    The distribution and enantiomeric composition of the 5-carbon (C(5)) amino acids found in CI-, CM-, and CR-type carbonaceous meteorites were investigated by using liquid chromatography fluorescence detection/TOF-MS coupled with o-phthaldialdehyde/N-acetyl-L-cysteine derivatization. A large L-enantiomeric excess (ee) of the alpha-methyl amino acid isovaline was found in the CM meteorite Murchison (L(ee) = 18.5 +/- 2.6%) and the CI meteorite Orgueil (L(ee) = 15.2 +/- 4.0%). The measured value for Murchison is the largest enantiomeric excess in any meteorite reported to date, and the Orgueil measurement of an isovaline excess has not been reported previously for this or any CI meteorite. The L-isovaline enrichments in these two carbonaceous meteorites cannot be the result of interference from other C(5) amino acid isomers present in the samples, analytical biases, or terrestrial amino acid contamination. We observed no L-isovaline enrichment for the most primitive unaltered Antarctic CR meteorites EET 92042 and QUE 99177. These results are inconsistent with UV circularly polarized light as the primary mechanism for L-isovaline enrichment and indicate that amplification of a small initial isovaline asymmetry in Murchison and Orgueil occurred during an extended aqueous alteration phase on the meteorite parent bodies. The large asymmetry in isovaline and other alpha-dialkyl amino acids found in altered CI and CM meteorites suggests that amino acids delivered by asteroids, comets, and their fragments would have biased the Earth's prebiotic organic inventory with left-handed molecules before the origin of life.

  4. The Effects of Thermal Metamorphism on the Amino Acid Content of the CI-Like Chondrite Y-86029

    Science.gov (United States)

    Burton, A. S.; Grunsfeld, S.; Glavin, D. P.; Dworkin, J. P.

    2014-01-01

    Carbonaceous chondrites con-tain a diverse suite of amino acids that varies in abundance and structural diversity depending on the degree of aqueous alteration and thermal histo-ry that the parent body experienced [1 - 3]. We recently determined the amino acid contents of several fragments of the Sutter's Mill CM2 chon-drite [4]. In contrast with most other CM2 chon-drites, the Sutter's Mill meteorites showed minimal evidence for the presence of indigenous amino acids. A notable difference between the Sutter's Mill meteorites and other CM2 chondrites are that the Sutter's Mill stones were heated to tempera-tures of 150 - 400 C [4], whereas most other CM2 chondrites do not show evidence for thermal met-amorphism [5]. Because empirical studies have shown that amino acids rapidly degrade in aqueous solutions above 150 C and the presence of miner-als accelerates this degradation [6], a plausible explanation for the lack of amino acids observed in the Sutter's Mill meteorites is that they were destroyed during metamorphic alteration. Fewer CI chondrites have been analyzed for amino acids because only a small number of these meteorites have been recovered. Nevertheless, indigenous amino acids have been reported in the CI chondrites Ivuna and Orgueil [7]. Here we report on the amino acid analysis of the CI-like chondrite, Yamato 86029 (Y-86029; sample size of 110 mg). Just as the Sutter's Mill meteorites were thermally metamporphosed CM2 chondrites, Y-86029 has experienced thermal metamorphism at higher temperatures than Orgueil and Ivuna (normal CI chondrites) experienced, possibly up to 600 C [8].

  5. On the relation of electrophysiological compound action potential (ECAP) measurements and perceptive skills in cochlear implant (CI) listeners

    OpenAIRE

    Linke, Theresa

    2017-01-01

    Background Cochlear Implants (CIs) provide near normal speech intelligibility in quiet environments to individuals suffering from sensorineural hearing loss. Perception of speech in situations with competing background noise and especially music appraisal however are still insufficient. Hence, improving speech perception in ambient noise and music intelligibility is a core challenge in CI research. Quantitatively assessing music intelligibility is a demanding task due to its inherently sub...

  6. New records of bee flies (Diptera, Bombyliidae from Cuatro Ciénegas, Coahuila, Mexico

    Directory of Open Access Journals (Sweden)

    Omar Ávalos-Hernández

    2014-07-01

    Full Text Available Forty one new records of species of Bombyliidae are reported for Coahuila in northeastern Mexico. Nine of these species are reported for the first time for the country. The specimens were collected in the Cuatro Ciénegas Basin and Sierra La Madera mountains during 2007–2013. The modified distributions of species are discussed. The gaps in the distribution of many species suggest an undersampling of this group of insects in the north of Mexico.

  7. Artigos da revista Ciência Hoje como recurso didático no ensino de química

    Directory of Open Access Journals (Sweden)

    Luciana Nobre de Abreu Ferreira

    2011-01-01

    Full Text Available This paper presents the results from the selection and analysis of Ciência Hoje articles published from 2004 to 2009 with the aim to discuss some of their features which can assist teachers in chemistry teaching. Therefore, the articles were analyzed according to their content and format based on an analytical tool proposed by Kawamura and colleagues. The results indicate that this magazine offers a reasonable collection of articles related to chemistry with a variety of contents and approaches.

  8. Timing and spectral analysis of the unusual X-ray transient XTE J0421+560/CI Camelopardalis

    NARCIS (Netherlands)

    Bartlett, E.S.; Clark, J.S.; Coe, M.J.; Garcia, M.G.; Uttley, P.

    2013-01-01

    We present a detailed X-ray study of the 2003 XMM-Newton observation of the high-mass X-ray binary XTE J0421+560/CI Camelopardalis. The continuum of the X-ray spectrum is well described by a flat power law (Γ = 1.0 ± 0.2) with a large intrinsic absorbing column (NH = (4.4 ± 0.5) × 1023 cm−2). We hav

  9. Determinants Of European Banks' Capital Adequacy / Determinanty Adekwatności Kapitałowej Banków Europejskich

    Directory of Open Access Journals (Sweden)

    Klepczarek Emilia

    2015-12-01

    Full Text Available W artykule przedstawiono analizę czynników wpływających na poziom wskaźnika CET 1 ratio, będącego miarą relacji pomiędzy kapitałem podstawowym banku a aktywami ważonymi ryzykiem. Badaniu poddano próbę losowo wybraną z grupy banków uczestniczących w tzw. stress-testach przeprowadzonych przez władze Europejskiego Banku Centralnego. EBC przeprowadził testy warunków skrajnych oceniając m.in. poziom współczynnika CET1 obliczanego według regulacji wynikających z III Reżimu Bazylejskiego. Wyniki potwierdzają hipotezę o wpływie wielkości banku i wskaźników ryzyka (aktywa ważone ryzykiem do aktywów ogółem; udział pożyczek w aktywach ogółem na poziom adekwatności kapitałowej. Potwierdzono również silny wpływ konkurencji, a także ujemną korelację między wskaźnikiem CET1 i udziałem depozytów w zobowiązaniach kapitałowych, którą można uzasadnić istnieniem systemu gwarantowania depozytów. W końcowej części artykułu przedstawiono możliwe słabości przeprowadzonych badań, wynikające z nich ograniczenia wnioskowania oraz koncepcje ewentualnych dalszych analiz przedmiotowego obszaru tematycznego.

  10. Transfer of Kv3.1 voltage sensor features to the isolated Ci-VSP voltage-sensing domain.

    Science.gov (United States)

    Mishina, Yukiko; Mutoh, Hiroki; Knöpfel, Thomas

    2012-08-22

    Membrane proteins that respond to changes in transmembrane voltage are critical in regulating the function of living cells. The voltage-sensing domains (VSDs) of voltage-gated ion channels are extensively studied to elucidate voltage-sensing mechanisms, and yet many aspects of their structure-function relationship remain elusive. Here, we transplanted homologous amino acid motifs from the tetrameric voltage-activated potassium channel Kv3.1 to the monomeric VSD of Ciona intestinalis voltage-sensitive phosphatase (Ci-VSP) to explore which portions of Kv3.1 subunits depend on the tetrameric structure of Kv channels and which properties of Kv3.1 can be transferred to the monomeric Ci-VSP scaffold. By attaching fluorescent proteins to these chimeric VSDs, we obtained an optical readout to establish membrane trafficking and kinetics of voltage-dependent structural rearrangements. We found that motifs extending from 10 to roughly 100 amino acids can be readily transplanted from Kv3.1 into Ci-VSP to form engineered VSDs that efficiently incorporate into the plasma membrane and sense voltage. Some of the functional features of these engineered VSDs are reminiscent of Kv3.1 channels, indicating that these properties do not require interactions between Kv subunits or between the voltage sensing and the pore domains of Kv channels.

  11. Science and the values of popular movements A ciência e os valores dos movimentos populares

    Directory of Open Access Journals (Sweden)

    Marcos Barbosa de Oliveira

    2004-01-01

    Full Text Available First an overall view is provided of Lacey’s ideas concerning science in its relation with the values of popular movements, and of the World Social Forum. Then, as an exercise in the building of conceptual bridges betweeen philosophical and political discourses about science, an analysis is provided of a speech delivered by Brazil’s new minister for science and technology in the occasion of his taking office.Em primeiro lugar, apresenta-se uma visão geral das idéias de Lacey sobre a ciência em sua relação com os valores dos movimentos populares, e do Fórum Social Mundial. A seguir, num exercício de construção de pontes conceituais entre o discurso filosófico e o político sobre a ciência, desenvolve-se uma análise do pronunciamento do novo titular do Ministério da Ciência e Tecnologia do Brasil, feito por ocasião de sua posse.

  12. Molecular docking study investigating the possible mode of binding of C.I. Acid Red 73 with DNA.

    Science.gov (United States)

    Guo, Yumei; Yue, Qinyan; Gao, Baoyu

    2011-07-01

    C.I. Acid Red 73 is a reactive azo dye with a variable potential carcinogenicity. The mechanism mediating interactions that occur between the dye and DNA have not been completely understood thus far. In this study, molecular docking techniques were applied to describe the most probable mode of DNA binding as well as the sequence selectivity of the C.I. Acid Red 73 dye. These docking experiments revealed that the dye is capable of interacting with the minor groove of the DNA on the basis of its curved shape, which fits well with the topology of double-stranded DNA. In addition, the dye can bind selectively to the minor groove of the DNA by applying CGT sequence selectivity. Further, the minor groove can be recognized although DNA targets present intercalation gaps. However, intercalative binding can also occur when the DNA target possesses an appropriate intercalation gap. Compared with the other eight DNA sequences that were studied, the DNA dodecamer d(CGCGATATCGCG)(2) (PDB ID: 1DNE) presents a very favorable target for the binding of C.I. Acid Red 73 to the minor groove, with the lowest binding free energy -9.19 kcal/mol. Results reported from this study are expected to provide useful information for research involving further simulations of molecular dynamics and toxicology investigations of the dye.

  13. The Change of the Orbital Periods Across Eruptions and the Ejected Mass For Recurrent Novae CI Aquilae and U Scorpii

    CERN Document Server

    Schaefer, Bradley E

    2011-01-01

    I report on the cumulative results from a program started 24 years ago designed to measure the orbital period change of recurrent novae (RNe) across an eruption. The goal is to use the orbital period change to measure the mass ejected during each eruption as the key part of trying to measure whether the RNe white dwarfs are gaining or losing mass over an entire eruption cycle, and hence whether they can be progenitors for Type Ia supernovae. This program has now been completed for two eclipsing RNe; CI Aquilae (CI Aql) across its eruption in 2000 and U Scorpii (U Sco) across its eruption in 1999. For CI Aql, I present 78 eclipse times from 1991-2009 (including four during the tail of the 2000 eruption) plus two eclipses from 1926 and 1935. For U Sco, I present 67 eclipse times, including 46 times during quiescence from 1989-2009, plus 21 eclipse times in the tails of the 1945, 1999, and 2010 eruptions. The eclipse times during the tails of eruptions are systematically and substantially shifted with respect to...

  14. O desenvolvimento de atividades práticas na escola: um desafio para os professores de ciências

    Directory of Open Access Journals (Sweden)

    Marcelo Leandro Feitosa de Andrade

    2011-01-01

    Full Text Available As atividades práticas contribuem para o interesse e a aprendizagem em Ciências, especialmente quando investigativas e problematizadoras. Assim, o objetivo foi entender como professores de Ciências do Ensino Fundamental percebem estas atividades, bem como saber se são por eles utilizadas e os motivos para o seu uso/não uso no cotidiano da escola. Para isso, entrevistamos professoras de Ciências, que indicaram raramente utilizar atividades práticas e terem dificuldades nesta utilização. Quando o fazem, é após aulas teóricas, para apenas ilustrar a teoria . Justificam raramente recorrerem a tais atividades pela insegurança, falta de apoio e infraestrutura da escola. As professoras afirmam valorizar as atividades práticas, mas as percebem apenas como complemento para as aulas teóricas. Entendem serem necessárias mais atividades práticas, porém ficam angustiadas por não conseguirem desenvolvê-las nas condições de trabalho. Considerando as dificuldades apontadas, são oferecidas sugestões para se promoverem estas atividades no sistema público de ensino brasileiro.

  15. Low-lying π∗ resonances associated with cyano groups: A CAP/SAC-CI study

    Science.gov (United States)

    Ehara, Masahiro; Kanazawa, Yuki; Sommerfeld, Thomas

    2017-01-01

    The complex absorbing potential (CAP)/symmetry-adapted cluster-configuration interaction (SAC-CI) method is applied to low-lying π∗ resonance states of molecules containing one or two cyano (CN) groups. Benchmark calculations are carried out comparing the non-variational and approximate variational approach of SAC-CI and studying the selection threshold of operators. Experimental resonance positions from electron transmission spectroscopy (ETS) are reproduced provided the anticipated deviations due to vibronic effects are taken into account. Moreover, the calculated positions and widths agree well with those obtained in previous electron scattering calculations for HCN, CH3CN and their isonitriles. Based on our results, we suggest a reassignment of the experimental ETS of fumaronitrile and malononitrile. Our present results demonstrate again that the CAP/SAC-CI method reliably predicts low-lying π∗ resonances, and regarding the total numbers of molecules and resonances investigated, it is fair to say that it is presently the most extensively used high-level method in the temporary anion field.

  16. Phylogeography and conservation genetics of a distinct lineage of sunfish in the Cuatro Ciénegas valley of Mexico.

    Science.gov (United States)

    Coghill, Lyndon M; Hulsey, C Darrin; Chaves-Campos, Johel; García de Leon, Francisco J; Johnson, Steven G

    2013-01-01

    The valley of Cuatro Ciénegas, an aquatic oasis located in the Mexican Chihuahuan Desert, exhibits the highest level of endemism in North America and is a Mexican National Protected Area. However, little is known about the evolutionary distinctiveness of several vertebrate species present in the Cuatro Ciénegas valley. We conducted a phylogeographic study using mitochondrial haplotypes from the centrarchid fish Lepomis megalotis to determine if the populations found within the valley were evolutionarily distinct from populations outside the valley. We also examined if there was evidence of unique haplotypes of this sunfish within the valley. Genetic divergence of L. megalotis suggests populations within the valley are evolutionarily unique when compared to L. megalotis outside the valley. Significant mitochondrial sequence divergence was also discovered between L. megalotis populations on either side of the Sierra de San Marcos that bisects the valley. Our results reinforce previous studies that suggest the organisms occupying aquatic habitats not only within Cuatro Ciénegas but also in each of the two lobes of the valley generally deserve independent consideration during management decisions.

  17. Posições subjetivistas e objetivistas de ciência: a hermenêutica como fundamento da pesquisa qualitativa

    Directory of Open Access Journals (Sweden)

    João Manoel Roratto

    2010-04-01

    Full Text Available Este trabalho discute aspectos relacionados à evolução recente da ciência, com ênfase no conflito entre posições objetivistas e subjetivistas, até chegar à importância da pesquisa qualitativa na construção do conhecimento científico na atualidade, com base nos variados campos de tradição e linhas de pensamento nas ciências sociais e nas formulações teóricas de Gadamer sobre hermenêutica. Nos estudos de Denzin e Lincoln, analisa-se a relevância da pesquisa qualitativa nos últimos tempos e sua forma metodológica diversificada e peculiar de representar as diferentes realidades que compõem o universo social, bem como as expectativas desse modelo de pesquisa a se afirmar como ciência. Em Gadamer, busca-se entender a construção do processo retórico e hermenêutico como método para compreender e explicar a realidade social, cujas bases ontológicas estão nas ideias originais de Platão sobre discurso e de Aristóteles sobre filosofia prática.

  18. High-Dispersion Spectroscopy of the X-Ray Transient RXTE J0421+560 (= CI Cam) during Outburst

    CERN Document Server

    Robinson, E L; Welsh, W F; Robinson, Edward L.; Ivans, Inese I.; Welsh, William F.

    2002-01-01

    We obtained high dispersion spectra of CI Cam, the optical counterpart of XTE J0421+560, two weeks after the peak of its short outburst in 1998 April. The optical counterpart is a supergiant B[e] star emitting a two-component wind. The cool wind (the source of narrow emission lines of neutral and ionized metals) has a velocity of 32 km/s and a temperature near 8000 K. Dense and roughly spherical, it fills the space around the sgB[e] star, and, based on the size of an infrared-emitting dust shell around the system, extends to a radius between 13 - 50 AU. It carries away mass at a high rate, Mdot > 10^(-6) solar masses per year. The hot wind has a velocity in excess of 2500 km/s and a temperature of 1.7 +/-0.3 x 10^4 K. From UV spectra of CI Cam obtained in 2000 March with Hubble Space Telescope, we derive a differential extinction E(B-V) = 0.85 +/- 0.05. We derive a distance to CI Cam > 5 kpc. Based on this revised distance, the X-ray luminosity at the peak of the outburst was L(2-25 keV) > 3.0 x 10^38 erg/s, ...

  19. Iron-sulfides, iron-oxides and aqueous processing of organic materials in CM and CI meteorites and IDPs

    Science.gov (United States)

    Rietmeijer, F. J.

    Why do CM meteorites have such a rich variety of organics? D/H isotope ratios prove an interstellar component of the organic matter in CM and CI carbonaceous meteorites wherein the complex ``organics'' could in part be due to Fischer-Tropsch type (FTT) processes and processing of organic precursors on Fe-sulfide, Fe-oxide or clay catalysts. ``Origin of Life'' scenarios refer to the richly varied organics in CM (Murchison) meteorites as the precursor materials delivered to the Earth 4.2-3.9 Gyrs ago. Aggregate interplanetary dust particles (IDPs) have more carbon, incl. an interstellar component, than CI and CM meteorites but their original ``organics'' and amounts are modified by pyrolysis during atmospheric entry. Here, I will assume that anhydrous aggregate IDPs formed the originally anhydrous CI and CM matrix. These IDPs contain submicron CHON, mixed and `silicate' principal components (PCs), e.g. Fe-rich serpentine dehydroxylate, (Mg,Fe)3Si2O7, PCs [Fe/(Mg+Fe)(fe) = 0.3-0.8], and micron-size Fe-sulfides, olivine and pyroxenes. In a Mg-Fe-Si diagram with an Fe-apex, these PC compositions plot on a serpentine, (Mg,Fe)/Si line. The hydrated CI matrix compositions also define a straight line that, anchored at serpentine, fe = 0.3, is rotated towards higher (Mg,Fe)/Si ratios with increasing serpentine fe-ratio when during hydration of an initially ``serpentine dehydroxylate PC'' CI matrix reacted with Fe-sulfide, Fe-oxide, or both. The straight line defining hydrated CM matrix compositions is rotated even more towards higher (Mg,Fe)/Si ratios when hydrated CI-like material continued reacting with Fe-oxide and Fe-sulfide and formed tochilinite, a mineral unique to CM meteorites. Continuous hydration of IDP-like material with an ample supply of Fe-minerals acting as catalysts for formation and processing ``organics'' would have affected the redox conditions of a buffered C-H-O-S aqueous fluid during the time ``organics' were modified to the unique mélanges of CM

  20. Micorrizas arbusculares asociadas a Júcaro de ciénaga ( Bucida palustris y Soplillo ( Lysiloma latisiliquum en la Reserva de la Biosfera Ciénaga de Zapata, Cuba.

    Directory of Open Access Journals (Sweden)

    Raquel M. Rodríguez Rodríguez

    2014-01-01

    Full Text Available Se evaluó y caracterizó el e status micorrízico arbuscular de Bucida palustris (j úcaro de ciénaga y Lysiloma latisiliquum (soplillo , especies distintivas de bosque de ciénaga y bosque semidecíduo con humedad fluctuante, respectivamente, en la Reserva de la Biosfera Ciénaga de Zapata . Se determinó además, la densidad de esporas rizosféricas de hongos micorrizógenos arbusculares y se identificó la especie predominante en cada caso. Ambas especies vegetales resultaron micótrofas arbusculares con elevados porcentajes de colonización (> 9 0 % y densidad visual ( >25 %. La densidad de esporas rizosféricas asociadas a Lysiloma latisiliquum fue casi 2,5 veces mayor que en Bucida palustris y las especies predominantes fueron Funneliformis halonatus y Racocetra alborosea , respectivamente. La m orfología Tipo - Paris se identificó en Lysiloma latisiliquum y el Tipo - Arum en Bucida palustris . Se observaron además de los enrollados hifales y arbúsculos determinantes de los tipos morfológicos anteriormente descritos, esporas y vesículas intrarradicales en ambas especies. Este trabajo constituye el primer reporte de micorrizas arbusculares asociadas a especies vegetales en humedales cubanos. Estudios acerca de su funcionamiento y diversidad, así como su relación con plantas cubanas permitirá una mejor co mprensión de esta simbiosis y facilitará la utilización de micorrizas nativas en estrategias de conservación y uso sostenible de plantas y ecosistemas.

  1. Variabilidade biológica de isolados do Citrus leprosis virus (CiLV oriundos de cultivares de laranjeira Biological variability of Citrus leprosis virus (CiLV isolates from sweet orange cultivars

    Directory of Open Access Journals (Sweden)

    Jadier de Oliveira Cunha Junior

    2007-09-01

    Full Text Available A leprose, causada pelo Citrus leprosis virus (CiLV, é uma das principais doenças presentes em pomares cítricos fluminenses. O objetivo deste trabalho foi comparar o quadro sintomatológico desenvolvido por isolados de CiLV obtidos de cultivares comerciais de laranjeira (Lima, Pêra e Seleta, inoculados mecanicamente em Chenopodium amaranticolor, em três diluições. Após cinco a sete dias da inoculação foram observadas lesões necróticas, com pequeno halo clorótico quando observadas contra a luz. O maior número de lesões, nas três diluições, foi obtido do isolado de 'Seleta', seguido por 'Pêra' e 'Lima'. A melhor diluição utilizada para a observação das lesões foi de 1:10. Os resultados demonstram uma possível variabilidade biológica entre os isolados virais e/ou uma menor ou maior replicação viral, dependendo da cultivar, indicando um possível mecanismo de resistência da planta ao vírus.Citrus leprosis, caused by Citrus leprosis virus (CiLV is one of the major diseases in citrus orchards in the State of Rio de Janeiro. The objective of this study was to compare the development of symptoms on Chenopodium amaranticolor inoculated with CiLV isolates from 'Lima', 'Pera' and 'Seleta' sweet oranges using three different dilutions. Five to seven-days after inoculation, necrotic lesions exhibiting a small chlorotic halo when exposed to the light, were observed. The highest number of lesions developed using the three dilutions was obtained from 'Seleta', an intermediate value from 'Pêra' and the lowest number from 'Lima'. The best dilution for lesions development was 1:10. The results demonstrate a possible biological variability among the virus isolates and/or a lower or higher viral replication, dependent on the cultivar. This indicates a putative mechanism of Citrus resistance to the virus.

  2. (Human) Resourcing For CI

    DEFF Research Database (Denmark)

    Jørgensen, Frances; S., Jacob; Kofoed, Lise Busk

    2005-01-01

    More and more, the ability to compete in today’s market is viewed as being dependent on human capital. One of the most challenging aspects of human resource management involves supplying the organization with the human capital necessary to fulfill its objectives. This task becomes especially...

  3. Mitos da didática das ciências acerca dos motivos para incluir a Natureza da Ciência no ensino das ciências Science Education myths about the reasons to include the Nature of Science in science teaching

    Directory of Open Access Journals (Sweden)

    J. A. Acevedo

    2005-04-01

    Full Text Available Em certas situações, a Didática das Ciências transmite como mitos algumas crenças que não estão suficientemente sustentadas pela investigação que ela própria produz. Este artigo mostra dois desses mitos relacionados com os motivos que se costumam apontar para incluir a Natureza da Ciência no ensino das ciências, como sejam a suposta relação entre a prática docente e as crenças sobre a Natureza da Ciência, e a crença de que a sua compreensão é um fator chave na hora de tomar melhores decisões cívicas em questões tecnocientíficas de interesse social. A análise que se apresenta realizou-se mediante a revisão de diversos resultados de investigações procedentes da própria Didática das Ciências e também da Psicologia das Decisões. A conclusão aponta para considerar que outros fatores influenciam mais, tornando muito menos lineares essas hipotéticas relações do que alguns especialistas pensam e mais complexa a problemática abordada.In some situations Science Education transmits as myths various beliefs as myths that are not enough sustained by the research in its own domain. This paper shows two of these myths related to the reasons usually pointed in orderfor includinge the Nature of Science in science teaching:, such as the supposed relationship between the educational practice and the beliefs about the Nature of Science, and also the belief that its understanding of the Nature of Science is a key factor in when making better civicdecisions as citizens in technical socioscientific oscientific issues. with social interest The analysis was carried out by means of athe review of several results from the own Science Education Research, and also from the Psychology of Decisions. The conclusion seems to be clear: other factors are of a greater influence, making those hypothetical relations much less linear than some experts wcould think, and making the questions much more complex. the presented question.

  4. Biografia nieobecna. Wokół życia i twórczości Ireneusza Plater-Zyberka

    Directory of Open Access Journals (Sweden)

    Robert Zawisza

    2014-12-01

    Full Text Available An Absent Biography. About the life and work of Ireneusz Plater-Zyberk Ireneusz Plater-Zyberk (1896–1946, was a writer and a film producer, adventurer and gallant. His life is an incredible story of the disabled individual who succeeded in an amazing career. Plater-Zyberk was born in a wealthy landowning family who lived at the estate of Vabole in Latvia. He was born without hands and at that time, due to his disability, was classified as "margins of society." Thanks to perseverance and commitment of his mother, he graduated as an extern student from high school in Warsaw, Poland. His career  includes Life without Hands, memories,  and two novels. He was a co-author of first movie in Poland with stunt effects Dead Node (1927, which unfortunately wasn’t preserved. Also, he was recognized as a documentary creator as well as an initiator of film production regulations.   Biografia nieobecna. Wokół życia i twórczości Ireneusza Plater-Zyberka Ireneusz Plater-Zyberk (1896 lub 1897–1946 był literatem i twórcą filmowym, nieco awanturnikiem i bawidamkiem. Jego postać to niezwykły przykład niepełnosprawnego, który osiągnął w dwudziestoleciu międzywojennym znaczącą karierę. Ireneusz Plater-Zyberk pochodził z zamożnej rodziny ziemiańskiej, zamieszkałej w majątku Wabol na Łotwie. Urodził się bez rąk i w ówczesnej rzeczywistości miał pozostać na marginesie społeczeństwa. Dzięki wytrwałości matki udało mu się ukończyć jako ekstern gimnazjum w Warszawie. W swoim dorobku ma wspomnienia Życie bez rąk oraz dwie powieści. Ważną rolę odegrał Plater jako scenarzysta i reżyser, był m.in. współtwórcą pierwszego polskiego filmu z efektami kaskaderskimi „Martwy węzeł” (1927. Miał on również ogromne zasługi jako twórca filmów dokumentalnych i jednocześnie inspirator zmian w prawodawstwie dotyczącym produkcji filmowej. Tłem jego twórczości pisarskiej jest burzliwe i pełne przygód

  5. Aulas de ciências para surdos: estudos sobre a produção do discurso de intérpretes de LIBRAS e professores de ciências

    Directory of Open Access Journals (Sweden)

    Walquíria Dutra de Oliveira

    2015-06-01

    Full Text Available O bilinguismo na educação de surdos pressupõe a língua de sinais como primeira língua do surdo e, com a inclusão escolar, os alunos surdos foram inseridos em instituições regulares de ensino, implicando uma nova estrutura da sala de aula. O ensino de ciências para surdos é um desafio, pois o aluno surdo utiliza uma língua diferente da do professor, e necessita de um intérprete de LIBRAS para ter acesso ao corpo de conhecimentos mediados por ele. A investigação objetivou analisar a produção de narrativas (um gênero do discurso de professores e intérpretes de LIBRAS sobre a aula de ciências para surdos. As narrativas foram produzidas no “diário de aula”, e foram analisadas pela técnica de análise de conteúdo. Nossos resultados apontam que o bilinguismo ainda não permeia a sala de aula inclusiva, e que a barreira linguística é a maior dificuldade encontrada no aprendizado dos conhecimentos científicos pelos alunos surdos.

  6. Adolescência: efeitos da ciência no campo do sujeito Adolescence: effects of science over the subject

    Directory of Open Access Journals (Sweden)

    Fernanda Costa Moura

    2005-01-01

    Full Text Available Este artigo apresenta a análise das manifestações da crise adolescência na correlação que estas mantêm com o funcionamento social contemporâneo como indicador privilegiado para pensar a operação da ciência e seus efeitos no campo do sujeito. A análise parte do exame da incidência da ciência sobre a linguagem como domínio a partir do qual o sujeito se constitui. Aborda questões próprias da clínica psicanalítica com adolescentes - tais como a dificuldade de elaboração de uma referência à alteridade e seus impasses diante do sexo e a morte -, refletindo sobre a vinculação destas dificuldades com o que é desencadeado pelas transformações do discurso e do laço social constitutivas da prática da ciência.The present paper focuses on the manifestations of the so called adolescence crisis related to the contemporary social order, to analyze the effects of science on the field of the subject. Starting with the exam of the transformations science imposes to language and taking language as constitutive of the subject, the paper approaches some frequent issues of the psychoanalytical clinic held with adolescents - such as the difficulties with otherness, or the subjective position of the young towards sex and death. The relationship those issues might have with the operations performed by science which transform the order of discourse is discussed.

  7. O sujeito da psicanálise e o sujeito da ciência: Descartes, Freud e Lacan

    Directory of Open Access Journals (Sweden)

    Ingrid Vorsatz

    Full Text Available Partindo da problematização proposta por Lacan acerca do sujeito da psicanálise enquanto o correlato antinômico do sujeito da ciência moderna, procura-se destacar os elementos que constituem o cerne de sua argumentação. O sujeito da ciência emerge da démarche cartesiana conhecida como o cogito no momento em que o procedimento metodológico da dúvida encontra seu ponto de basta numa asserção insofismável: "sou". O sujeito da psicanálise, suposto ao inconsciente (das Unbewusste, inferido por Freud a propósito do elemento duvidoso do sonho, é tributário do procedimento cartesiano. A certeza é o ponto para o qual convergem os encaminhamentos de Descartes e Freud. Mas, enquanto o primeiro recua e institui Deus como garante da verdade, o fundador da psicanálise avança exortando o sujeito a se responsabilizar por aquilo que advém como injunção inconsciente. Do lado do discurso da ciência o sujeito é um elemento alheio ao plano dos enunciados que visam recobrir a totalidade do real - que, de resto, resiste a uma apreensão exaustiva. Recolhido pela psicanálise, esse elemento subtraído da ordem de razões, resto fecundo, tem como dever garantir o campo em relação ao qual se encontra subsumido, numa torção causal que faz ressaltar o estatuto ético do conceito maior (Grundbegriff estabelecido por Freud.

  8. Psicologia: Ciência e Profissão: 30 anos registrando o avanço da Psicologia Brasileira

    Directory of Open Access Journals (Sweden)

    Maria Imaculada Cardoso Sampaio

    Full Text Available Psicologia: Ciência e Profissão (PCP, publicada pelo Conselho Federal de Psicologia ao longo de 30 anos, registra o avanço da Psicologia, como ciência e profissão. O objetivo deste trabalho é relatar alguns aspectos que merecem destaque, a partir de 2005, quando PCP se consolida como uma revista científica, ganha a versão digital e se insere no movimento do acesso aberto. É feita também uma breve análise dos indicadores de citações da revista. As análises foram efetuadas a partir da leitura dos editoriais dos fascículos publicados do ano 2005 até o momento. Com base nos módulos de bibliometria do PePSIC e SciELO, além dos dados das referências da revista, foram levantados indicadores de citações recebidas e fornecidas por PCP. Os dados permitem afirmar que PCP vem aumentando o número de citações recebidas. A rede de revistas que mais citam PCP está publicada no PePSIC, demonstrando que publicações eletrônicas ganham maior visibilidade na comunidade científica. Ao completar 30 anos, a proposta da revista é o comprometimento com a Psicologia voltada para aliviar o sofrimento humano, mas também dedicada ao avanço da ciência psicológica. O conhecimento documentado em revistas científicas e o impacto que tais publicações representam para o saber universal é algo que deve ser abordado, discutido e entendido, assim, estudos dessa natureza devem ser incentivados.

  9. Ética profissional: entendimento dos acadêmicos de Ciências Contábeis da Unoesc

    OpenAIRE

    Boff, Marines Lucia

    2010-01-01

    Objetiva-se avaliar o entendimento dos acadêmicos no decorrer do Curso de Ciências Contábeis na Unoesc sobre ética profissional. É uma pesquisa exploratória e descritiva, com levantamento de dados por meio de questionário, com abordagem quantitativa e qualitativa dos dados coletados. Representam a amostra 304 acadêmicos da 2ª, 4ª, 6ª e 8ª fase do Campus de São Miguel do Oeste e Campi Aproximados de Pinhalzinho e Maravilha. Constatou-se que o entendimento sobre ética profissional antes e depoi...

  10. Ciência & Saúde coletiva Journal at the national and international context of scientific communication.

    Science.gov (United States)

    Minayo, Maria Cecília de Souza; Gomes, Romeu

    2015-07-01

    The article discusses the role of the Ciência & Saúde Coletiva Journal in the dissemination of knowledge in Brazil and in the international scientific community, its new challenges and role in the consolidation of the national public health field. Its history is outlined, positioning it as a scientific journal and the themes approached in it are analyzed. Among the findings, it is emphasized that the journal features a structured space by the habitus of public health, and creates its own habitus that contributes to structure this field. In addition, the journal contributes to the development of critical mass in the area and is committed to the Brazilian Public Health System.

  11. Calidad del agua potable en la Ciénaga de Chapala, Michoacán, México

    OpenAIRE

    Martha A. Velázquez-Machuca; José Luis Pimentel Equihua

    2012-01-01

    Con el objetivo de evaluar el grado de contaminación de las fuentes de agua potable en la Ciénaga de Chapala, Michoacán, México, se seleccionaron 17 sitios (manantiales y pozos) en los municipios de Villamar, Jiquilpan, Sahuayo, Venustiano Carranza y Cojumatlán en tres fechas de muestreo durante abril y diciembre de 2008, y mayo de 2009. Los parámetros de calidad del agua analizados fueron pH , temperatura, CE, Cl - , CO 3 2- , HCO 3 - , SO 4 2- , Ca 2+ , Mg 2+ , Na + , K + , metales totales ...

  12. 12CO 4-3 and [CI] 1-0 at the centers of NGC 4945 and Circinus

    Science.gov (United States)

    Hitschfeld, M.; Aravena, M.; Kramer, C.; Bertoldi, F.; Stutzki, J.; Bensch, F.; Bronfman, L.; Cubick, M.; Fujishita, M.; Fukui, Y.; Graf, U. U.; Honingh, N.; Ito, S.; Jakob, H.; Jacobs, K.; Klein, U.; Koo, B.-C.; May, J.; Miller, M.; Miyamoto, Y.; Mizuno, N.; Onishi, T.; Park, Y.-S.; Pineda, J. L.; Rabanus, D.; Röllig, M.; Sasago, H.; Schieder, R.; Simon, R.; Sun, K.; Volgenau, N.; Yamamoto, H.; Yonekura, Y.

    2008-02-01

    Context: Studying molecular gas in the central regions of the star burst galaxies NGC 4945 and Circinus enables us to characterize the physical conditions and compare them to previous local and high-z studies. Aims: We estimate temperature, molecular density and column densities of CO and atomic carbon. Using model predictions we give a range of estimated CO/C abundance ratios. Methods: Using the new NANTEN2 4 m sub-millimeter telescope in Pampa La Bola, Chile, we observed for the first time CO 4-3 and [C I] ^3P_1{-}^3P0 at the centers of both galaxies at linear scale of 682 pc and 732 pc respectively. We compute the cooling curves of 12CO and 13CO using radiative transfer models and estimate the physical conditions of CO and [CI]. Results: The centers of NGC 4945 and Circinus are very [C I] bright objects, exhibiting [C I] ^3P_1{-}^3P0 luminosities of 91 and 67 K km s-1 kpc2, respectively. The [C I] ^3P_1{-}^3P_0/CO 4-3 ratio of integrated intensities are large at 1.2 in NGC 4945 and 2.8 in Circinus. Combining previous CO J= 1{-}0, 2-1 and 3-2 and 13CO J= 1{-}0, 2-1 studies with our new observations, the radiative transfer calculations give a range of densities, n(H2)=103{-}3 × 104 cm-3, and a wide range of kinetic temperatures, T_kin= 20{-}100 K, depending on the density. To discuss the degeneracy in density and temperature, we study two representative solutions. In both galaxies the estimated total [CI] cooling intensity is stronger by factors of 1{-}3 compared to the total CO cooling intensity. The CO/C abundance ratios are 0.2-2, similar to values found in Galactic translucent clouds. Conclusions: Our new observations enable us to further constrain the excitation conditions and estimate the line emission of higher-J CO- and the upper [CI]-lines. For the first time we give estimates for the CO/C abundance ratio in the center regions of these galaxies. Future CO J= 7{-}6 and [CI] 2-1 observations will be important to resolve the ambiguity in the physical

  13. Os 4Ps do composto de marketing na literatura de Ciência da Informação

    Directory of Open Access Journals (Sweden)

    Sueli Angelica Do Amaral

    Full Text Available Analisa 60 documentos sobre os 4Ps do composto de marketing em unidades de informação da literatura de Ciência dei Informação no período de 1975 a 1995, para conhecer quantos e quais autores escreveram sobre o tema, qual o pioneiro, quem foi o pioneiro a propor adição de Ps. Apresenta a cronologia dos documentos estudados e discute as 4Ps do composto de marketing. Propõe a adoção da mais completa proposta analisada como forma de garantir o futuro das unidades de informação.

  14. Os 4Ps do Composto de Marketing na literatura de Ciência da Informação

    OpenAIRE

    Amaral, Sueli Angélica do

    2000-01-01

    Analisa 60 documentos sobre os 4Ps do composto de marketing cm unidades de informação da literatura de Ciência da Informação no período de 1975 a 1995, para conhecer quantos e quais autores escreveram sobre o tema, qual o pioneiro, quem foi o pioneiro a propor adição de Ps. Apresenta a cronologia dos documentos estudados e discute as 4Ps do composto de marketing. Propõe a adoção da mais completa proposta analisada como forma de garantir o futuro das unidades de informação. ___________________...

  15. Los incendios forestales que tienen como causa las descargas eléctricas en Ciénaga de Zapata.

    OpenAIRE

    Arnaldo Alfonso Fernández; Nelson Medina Torres

    2010-01-01

    En este estudio se presenta la descripción de los resultados más importantes obtenidos de los incendios forestales que tienen como causa las descargas eléctricas en Ciénaga de Zapata, y, que consisten en la tipificación de la situaciòn sinóptica, definición de la época, período, mes, hora y lugar de mayor peligro: la zona de aparición potencial, así como el índice de peligrosidad. Todos ellos, de utilid...

  16. Os 4Ps do Composto de Marketing na literatura de Ciência da Informação

    OpenAIRE

    Amaral, Sueli Angélica do

    2000-01-01

    Analisa 60 documentos sobre os 4Ps do composto de marketing cm unidades de informação da literatura de Ciência da Informação no período de 1975 a 1995, para conhecer quantos e quais autores escreveram sobre o tema, qual o pioneiro, quem foi o pioneiro a propor adição de Ps. Apresenta a cronologia dos documentos estudados e discute as 4Ps do composto de marketing. Propõe a adoção da mais completa proposta analisada como forma de garantir o futuro das unidades de informação. ___________________...

  17. Os 4Ps do composto de marketing na literatura de Ciência da Informação

    OpenAIRE

    Sueli Angelica Do Amaral

    2000-01-01

    Analisa 60 documentos sobre os 4Ps do composto de marketing em unidades de informação da literatura de Ciência dei Informação no período de 1975 a 1995, para conhecer quantos e quais autores escreveram sobre o tema, qual o pioneiro, quem foi o pioneiro a propor adição de Ps. Apresenta a cronologia dos documentos estudados e discute as 4Ps do composto de marketing. Propõe a adoção da mais completa proposta analisada como forma de garantir o futuro das unidades de informação.

  18. MOSTRA ANUAL DE FÍSICA DO RN: Ciência acessível a todos

    Directory of Open Access Journals (Sweden)

    Jacques Cousteau da Silva Borges

    2008-05-01

    Full Text Available No ano de 2003, os professores de Física do CEFET-RN, tiverem a idéia de expor aos seus alunos os equipamentos e experimentos de Física presentes em seus laboratórios. O evento de apenas dois dias foi intitulado “I Mostra de Física do Rio Grande do Norte”, e teve como seu principal público os próprios alunos do CEFET-RN. Nestes dois dias, praticamente todos os servidores e alunos da instituição se deparam com experiências de mecânica, óptica, eletricidade e tantas outras, que despertaram o interesse de muitos alunos, pela ciência e tecnologia. Nos anos seguintes, a mostra cresceu e evoluiu, contanto não apenas com demonstrações de Leis Físicas por experimentos didáticos, mas também com mini-cursos, oficinas, palestras, lançamentos de livros e apresentações de filmes relacionados com a Física e com a ciência como um todo. A partir de uma abordagem lúdica e interativa, alunos e professores do CEFET e de outras instituições vêm participando ano a ano, cada vez mais. O presente trabalho irá tratar de como essa mostra evoluiu nessas quatro edições, além destacar como ela têm incentivado a inclusão de jovens no mundo científico. Por fim, avalia-se a contribuição da Mostra de Física para o curso de Licenciatura em Física do CEFET-RN, analisando a participação e envolvimento dos graduandos nas atividades desenvolvidas nessa “Feira de ciências”. Palavras-chave: Ensino de Física. Mostra de Física. Feira de Ciências.

  19. Quasidimensional simulation of CI-combustion with pilot and post injections; Quasidimensionale Simulation der Dieselverbrennung mit Vor- und Nacheinspritzungen

    Energy Technology Data Exchange (ETDEWEB)

    Rether, Dominik; Schmid, Andreas; Grill, Michael [Stuttgart Univ. (Germany). Inst. fuer Verbrennungsmotoren und Kraftfahrwesen; Bargende, Michael [Stuttgart Univ. (Germany). Inst. fuer Verbrennungsmotoren und Kraftfahrwesen; Forschungsinstitut fuer Kraftfahrwesen und Fahrzeugmotoren Stuttgart (FKFS) (Germany)

    2010-10-15

    Diesel engines have become much more complex over the last two decades. By means of simulations the number of test bench investigations can be reduced. The difficulty in modelling the conventional CI-combustion is to reproduce self-ignition, gas mixture and the combustion in such a way that predictive calculations are possible. At FKFS a phenomenological combustion model has been developed, which can simulate operating points with an arbitrary number of pilot and post injections in high quality within short computation times. (orig.)

  20. Nawrót w uzależnieniu od alkoholu jako wyraz depresyjności pacjenta

    Directory of Open Access Journals (Sweden)

    Ewa Wyrzykowska

    2012-03-01

    Full Text Available Artykuł przedstawia studium przypadku pacjentki uzależnionej od alkoholu, której uzależnienie rozumieć można jako wtórne wobec osobowościowej depresyjności. Opisano historię życia pacjentki, podejmowanego przez nią lecze‑ nia uzależnienia oraz licznych nawrotów choroby. Przedstawiono rozumienie psychopatologii pacjentki, jak również powtarzających się nawrotów picia, z perspektywy teorii psychodynamicznej. Pacjentka pięciokrotnie podejmowała leczenie odwykowe. Cztery razy przerywała abstynencję po leczeniu. Z perspektywy psychodynamicznej uzależnienie od alkoholu oraz nawroty choroby można traktować jako formę autodestruktywności (w tym tak zwanej autodestruk‑ tywności pośredniej, niszczenia siebie, własnych marzeń oraz pragnień. Pacjentka kilkakrotnie podejmowała studia, których nie kończyła z powodu nadużywania alkoholu; miała dwójkę dzieci. W artykule dokonano również analizy re‑ lacji pacjentki z bliskimi osobami. Ojciec pacjentki był uzależniony od alkoholu. W okresie adolescencji pacjentka piła razem z nim. Matka pacjentki wspominana jest przez nią jako nieobecna. Swojego partnera pacjentka poznała na le‑ czeniu odwykowym. On również po wielu leczeniach nie utrzymywał abstynencji. Wydaje się, że w relacjach interper‑ sonalnych pacjentka nieświadomie powtarzała frustrujące, niesatysfakcjonujące związki. Można przyjąć, iż znalazło to swoje odzwierciedlenie w relacjach terapeutycznych, które, poprzez kolejne nawroty, pacjentka również unieważ‑ niała. Analiza historii życia i nawrotów picia alkoholu wskazuje, że rozwój uzależnienia mógł być spowodowany głę‑ bokimi deficytami natury depresyjnej w strukturze osobowości pacjentki oraz deficytami w relacji z obiektem.