WorldWideScience

Sample records for superconducting supercollider ssc

  1. 1st International Industrial Symposium on the Supercollider

    CERN Document Server

    IISSC; Supercollider 1

    1989-01-01

    IISSC '89 was a tremendous success. A total of 635 people attended this educational forum which was dedicated to further the understanding of the design, construction and operation of the Superconducting Supercollider (SSC). A total of 110 presentations and addresses were given. The topics discussed covered .all aspects of the SSC including: Magnet Technology Cryogenics Conventional Facilities Technical Systems Detectors Related Accelerator Technology Superconducting Wire/Cable ApproXimately 38% of the presentations addressed superconducting magnet technology, 16% were devoted to detector technology, 10% addressed superconducting wire/ cable, and the balance was equally split between the remaining topics. A special award was presented to Professor M. Tigner for his meritorious contribution to the Superconducting Supercollider (SSC). The award was presented on behalf of the IISSC Board of Directors. Keynote speakers included: Gerald 'Bachy, CERN Joe Barton, Representative from Texas, 6th Disctrict Ed...

  2. Technology and materials for the Superconducting Super Collider (SSC) project

    Energy Technology Data Exchange (ETDEWEB)

    Shintomi, Takakazu; Ishimaru, Hajime; Unno, Yoshinobu; Arai, Yasuo; Watase, Yoshiyuki; Amako, Katsuya; Kondo, Takahiko (National Lab. for High Energy Physics, Tsukuba, Ibaraki (Japan))

    1992-08-01

    The Superconducting Super Collider (SSC) is the accelerator for the research on elementary particle physics, of which the construction was already begun in Texas, USA. Two proton rings comprising about 10,000 superconducting magnets are installed in an underground tunnel with the circumferential length of 87 km, and the proton-proton collision of superhigh energy is realized. This accelerator becomes the largest machine that mankind makes. In this report, among the high-tech and materials used for the SSC, superconducting magnets, super-high vacuum beam pipes, silicon semiconductor detector, the use of VLSI and superhigh density mounting and high speed, large quantity data processing system are taken up, and the outline of those is described. The SSC was planned for the elucidation of Higg's theory. The incidence accelerator group is composed of a linear accelerator and three booster synchrotrons. The particles generated by proton-proton collision are measured, and the discovery of new particles and the study on high energy physical phenomena are carried out. The construction of the accelerator and experimental equipment is carried out by international cooperation. (K.I.).

  3. SSC (Superconducting Super Collider) dipole coil production tooling

    Energy Technology Data Exchange (ETDEWEB)

    Carson, J.A.; Barczak, E.J.; Bossert, R.C.; Brandt, J.S.; Smith, G.A.

    1989-03-01

    Superconducting Super Collider dipole coils must be produced to high precision to ensure uniform prestress and even conductor distribution within the collared coil assembly. Tooling is being prepared at Fermilab for the production of high precision 1M and 16.6M SSC dipole coils suitable for mass production. The design and construction methods builds on the Tevatron tooling and production experience. Details of the design and construction methods and measured coil uniformity of 1M coils will be presented. 4 refs., 10 figs.

  4. Strain energy minimization in SSC (Superconducting Super Collider) magnet winding

    Energy Technology Data Exchange (ETDEWEB)

    Cook, J.M.

    1990-09-24

    Differential geometry provides a natural family of coordinate systems, the Frenet frame, in which to specify the geometric properties of magnet winding. By a modification of the Euler-Bernoulli thin rod model, the strain energy is defined with respect to this frame. Then it is minimized by a direct method from the calculus of variations. The mathematics, its implementation in a computer program, and some analysis of an SSC dipole by the program will be described. 16 refs.

  5. Calibration beams at the SSC (Superconducting Super Collider)

    Energy Technology Data Exchange (ETDEWEB)

    Autin, A.; Edwards, H. (Superconducting Super Collider Lab., Dallas, TX (USA)); Bensinger, J.R. (Superconducting Super Collider Lab., Dallas, TX (USA) Brandeis Univ., Waltham, MA (USA)); Baller, B.; Browning, F.; Coleman, R.; Cooper, J.; Cossairt, D.; Kula, L.; Malensek, A.; Stefanski, R.; Stutte, L. (Fermi National Accelerator Lab., Batavia, IL (USA))

    1989-04-30

    This paper discusses the following topics on the Superconducting Super Collider: beam specification at calibration halls; high energy booster options with tunnels to surface; switchyard; six beams with high and low power options; switchyard optics for both high and low energy transport; secondary beams; wide band beams; radiation shielding; tagging system; and test and calibration halls.

  6. Electron lenses for super-colliders

    CERN Document Server

    Shiltsev, Vladimir D

    2016-01-01

    This book provides a comprehensive overview of the operating principles and technology of electron lenses in supercolliders.  Electron lenses are a novel instrument for high energy particle accelerators, particularly for the energy-frontier superconducting hadron colliders, including the Tevatron, RHIC, LHC and future very large hadron colliders.  After reviewing the issues surrounding beam dynamics in supercolliders, the book offers an introduction to the electron lens method and its application.  Further chapters describe the technology behind the electron lenses which have recently been proposed, built and employed for compensation of beam-beam effects and for collimation of high-energy high-intensity beams, for compensation of space-charge effects and several other applications in accelerators. The book will be an invaluable resource for those involved in the design, construction and operation of the next generation of hadron colliders.

  7. 3D calculations of the Superconducting Super Collider (SSC) 3 Tesla magnet

    Energy Technology Data Exchange (ETDEWEB)

    Lari, R.J.

    1984-01-01

    A 20 TeV Superconducting Super Collider (SSC) proton accelerator is being proposed by the High Energy Physics Community. One proposal would consist of a ring of magnets 164 km in circumference with a field strength of 3 Tesla and would cost 2.7 billion dollars. The magnet consists of stacked steel laminations with superconducting coils. The desired field uniformity is obtained for all fields from 0.2 to 3 Tesla by using three (or more) different pole shapes. These three different laminations are stacked in the order 1-2-3-1-2-3-... creating a truly three dimensional geometry. A three laminated stack 1-2-3 with periodic boundary conditions at 1 and 3 was assigned about 5000 finite elements per lamination and solved using the computer program TOSCA. To check the TOSCA results, the field of each of the three different shaped laminations was calculated separately using periodic boundary conditions and compared to the two dimensional field calculations using TRIM. This was done for a constant permeability of 2000 and using the B-H table for fully annealed 1010 steel. The difference of the field calculations in the region of interest was always less than +-.2%

  8. 2nd International Industrial Symposium on the Supercollider

    CERN Document Server

    IISSC; Supercollider 2

    1990-01-01

    The Second International Industrialization Symposium on the Supercollider, IISSC, was held in Miami Beach Florida on March 14-16, 1990. It was an even bigger and more successful meeting than our ftrst in New Orleans in 1989. There were 691 attendees and 75 exhibitors. The enthusiasm shown by both the speakers and the audience was exhilarating for all attendees. The symposium again brought together the physicists and engineers designing the machine, the industrial organizations supporting the design and construction, the education community, and the governmental groups responsible for the funding and management of the SSC project. We believe it is this unique rnix which makes this particular meeting so valuable. The theme of this symposium was "The SSC-Americas Research Partnership" and the varied presentations throughout the meeting high-lighted that theme. The keynote speakers were: Dr. Roy Schwitters, Director of the SSC Mr. Paul F. Orefftce, Chairman of the Board of Dow Chemical Company Honorable W. Hinson...

  9. A model for correlating 4. 2-K performance with room-temperature mechanical characteristics in superconducting test dipole magnets for the Superconducting Super Collider (SSC)

    Energy Technology Data Exchange (ETDEWEB)

    Ige, O.O.; Lyon, R.H.; Iwasa, Y. (Francis Bitter National Magnet Laboratory Plasma Fusion Center, Massachusetts Institute of Technology, Cambridge, Massachusetts 02139 (United States))

    1992-03-15

    The longitudinal attenuation of impact-generated pulses in ten superconducting dipole magnets was measured at room temperature. A lumped-parameter model was constructed for the collared dipole. Using the method of nonlinear least-squares, the model was used to estimate the internal damping in the main components of the dipoles and the coupling resistances between the components: collars, inner, and outer coils. A positive correlation was found between the collar-inner coil coupling resistance and the 4.2-K performance of the magnets: the higher the coupling resistance, the fewer the number of quenches required to reach design operating current. There was virtually no correlation between any of the other internal or coupling resistances and 4.2-K performance. These observations are explained in terms of frictional slip of the inner coil against the collars causing premature quenches. The magnets are more susceptible to quenches at the collar-inner coil interface than at the collar-outer coil interface because the inner coil is subject to higher fields and forces. The experiment is potentially useful as a technique for screening high-performance superconducting magnets such as Superconducting Super Collider (SSC) dipoles at room temperature.

  10. Development of Superconducting Strang and Cable with Improved Properties for Use in SSC Magnets

    Energy Technology Data Exchange (ETDEWEB)

    Scanlan, R.M.

    1989-02-01

    The critical current requirement for the NbTi superconductor strand was set at 2750 A/mm{sup 2} (5 T, 4.2 K) in the SSC Conceptual Design, compared with a value of 1800 A/mm{sup 2} which was specified for the strand used in the Tevatron dipoles. In addition, a filament diameter of 5 {micro}m, instead of the 9 {micro}m diameter used in the Tevatron. was chosen to reduce field distonion at injection. In order to meet the requirements for field homogeneity, the dimensional requirements for both strand and cable were also tightened. The technical solutions employed to achieve these improved properties and the resulting specifications will be discussed.

  11. Cryogenic instrumentation of an SSC (superconducting super collider) magnet test stand

    Energy Technology Data Exchange (ETDEWEB)

    McGuire, K.; Strait, J.; Kuchnir, M.; McInturff, A.

    1987-09-01

    This paper describes the system used to acquire cryogenic data for the testing of SSC magnets at the Fermilab Magnet Test Facility. An array of pressure transducers, resistance thermometers, vapor pressure thermometers, and signal conditioning circuits are used. Readings with time resolution appropriate for quench recording are obtained with a waveform digitizer and steady-state measurements are obtained with higher accuracy using a digital voltmeter. The waveform digitizer is clocked at a 400 Hz sampling rate and these readings are stored in local ring buffers. The system is modular and can be expanded to add more channels. The software for the acquisition, control, logging, and display of cryogenic data consist of two programs which run as separate tasks. These programs (as well as a third program which acquires quench and magnetic data) communicate and pass data using shared global resources. The acquired data are available for analysis via a nationwide DECnet network.

  12. The feasibility of low-mass conductors for toroidal superconducting magnets for SSC (Superconducting Super Collider) detectors

    Energy Technology Data Exchange (ETDEWEB)

    Luton, J.N.

    1990-01-01

    An earlier study by Luton and Bonanos concluded that the design and fabrication of superconducting toroidal bending magnets would require a major effort but would be feasible. This study is an extension to examine the feasibility of low-mass conductors for such use. It included a literature search, consultations, with conductor manufacturers, and design calculations, but no experimental work. An unoptimized sample design that used a residual resistivity ratio for aluminum of 1360 and a current density of 3.5 kA/cm{sup 2} over the uninsulated conductor for a 4.5-T toroid with 1 GJ of stored energy obtained a hot-spot temperature of 120 K with a maximum dump voltage of 3.6 kV and 24% of the initial current inductively transferred into the shorted aluminum structure. The stability margin was 200 mJ/cm{sup 3} of cable space. Limiting the quench pressure to 360 atm to give conservative stresses in the sheath and assuming that the whole flow path quenched immediately resulted in helium taps that could be a kilometer apart if the flow friction factor were the same as that experienced in the Westinghouse (W) Large Coil Task (LCT) coil. This indicates that the 520-m conductor length of each of the 72 individual coil segments of a toroid would be a single flow path. If some practical uncertainties can be favorably resolved by producing and testing sample conductors, the use of a conductor with clad-aluminum stabilizer and extruded aluminum-alloy sheath should be feasible and economical. 9 refs., 3 figs.

  13. SSC Safety Review Document

    Energy Technology Data Exchange (ETDEWEB)

    Toohig, T.E. [ed.

    1988-11-01

    The safety strategy of the Superconducting Super Collider (SSC) Central Design Group (CDG) is to mitigate potential hazards to personnel, as far as possible, through appropriate measures in the design and engineering of the facility. The Safety Review Document identifies, on the basis of the Conceptual Design Report (CDR) and related studies, potential hazards inherent in the SSC project independent of its site. Mitigative measures in the design of facilities and in the structuring of laboratory operations are described for each of the hazards identified.

  14. Fabrication of Rutherford-type superconducting cables for construction of dipole magnets

    Energy Technology Data Exchange (ETDEWEB)

    Scanlan, R.M.; Royet, J.; Hannaford, R.

    1988-05-01

    An experimental cabling machine has been constructed and used to investigate the fabrication of a variety of superconducting cables. These include the 23-strand and 30-strand NbTi alloy cables for the Superconducting Supercollider (SSC) and a number of experimental cables. The experimental cables include 24-strands and 36-strands as well as two-level cables with a 6 or 7-strand first level and 23 or 30-strand second level. These results were used to aid in selecting the optimum cable for the SSC dipole and quadrupole magnets. As a result of these studies, cable can now be fabricated to exacting mechanical tolerances (+/- .006 mm) and with low critical current degradation (2-5%). In addition, tooling design studies have been performed and a Prototype SSC Production Cabling Machine has been designed. The results of the cable optimization studies and the tooling design studies will be discussed. SSC cable production experience on the experimental cabling machine and the production cabling machine will be reported.

  15. US seeks major Japanese role in supercollider

    CERN Multimedia

    Cross, M

    1990-01-01

    Japan is considering an offer to join the team building the SSC in Texas. The USA is hoping to raise 8 billion dollars, approximately a third of the money it needs to build the accelerator (1/2 page).

  16. Neutral technicolor pseudo Goldstone bosons production and QCD (quantum chromodynamics) background at the SSC (Superconducting Super Collider)

    Energy Technology Data Exchange (ETDEWEB)

    Kuo, Wang-Chuang.

    1990-09-21

    The production of the neutral technicolor pseudo Goldstone bosons, P{sup 0}{prime}and P{sub 8}{sup 0}{prime}, at large transverse momentum in pp collisions, pp {yields} g(q)P{sup 0}{prime} (P{sub 8}{sup 0}{prime})X has been investigated in reactions at a high energy collider such as the SSC. The major two-body and three-body decay modes in tree diagrams are investigated in detail. The t{bar t} decay channel would dominate both the decays of P{sup 0}{prime} and P{sub 8}{sup 0}{prime} if it is allowed. Otherwise, gg and 3g will be the dominant decay modes unless the mass of the P{sup 0}{prime} and P{sub 8}{sup 0}{prime} are below 40 GeV, where b{bar b} becomes dominant. According to the QCD backgrounds, which we have also investigated in detail in this work, the signal for t{bar t} is much larger than the background and will be the ideal signal for detecting these bosons. However, in the absence of the t{bar t} channel, the {tau}{bar {tau}} mode can be used to identify P{sup 0}{prime} up to m{sub P} = 300 GeV in the transverse momentum range P{sub {perpendicular}} {approx lt} 100 GeV. Similarly, the b{bar b} decay mode can serve us a signal to identify P{sub 8}{sup 0}{prime} up to m{sub P} = 300 GeV for P{sub {perpendicular}} between 500 and 700 GeV. Our results show that these high transverse momentum production processes are useful for the searching for the P{sub 8}{sup 0}{prime} at the SSC. 63 refs.

  17. Higher costs confirmed for US supercollider

    CERN Multimedia

    Vaughan, C

    1990-01-01

    American Secratary of Energy, James Watkins told Congress that the SSC will cost at least one to two billion dollars more than its estimated cost. He admitted that the final cost may be so high that the collider is not worth building (3 paragraphs).

  18. Triggering requirements for SSC physics

    Energy Technology Data Exchange (ETDEWEB)

    Gilchriese, M.G.D. [Lawrence Berkeley Lab., CA (United States)

    1989-04-01

    Some aspects of triggering requirements for high P{sub T} physics processes at the Superconducting Super Collider (SSC) are described. A very wide range of trigger types will be required to enable detection of the large number of potential physics signatures possible at the SSC. Although in many cases trigger rates are not now well understood, it is possible to conclude that the ability to trigger on transverse energy, number and energy of jets, number and energy of leptons (electrons and muons), missing energy and combinations of these will be required. An SSC trigger system must be both highly flexible and redundant to ensure reliable detection of many new physics processes at the SSC.

  19. Development of scaling rules for Rutherford type superconducting cables

    Energy Technology Data Exchange (ETDEWEB)

    Royet, J.M.; Scanlan, R.M.

    1990-09-01

    During the R D phase of the Superconducting Supercollider (SSC) program, LBL was responsible for establishing the parameters for cables used in SSC dipole and quadrupole magnets. In addition, the design and fabrication of a new cable for use in the Low Beta Quadrupoles. As a result of the development work on these and other cables, we have arrived a set of scaling rules which provide guidelines for choosing the parameters for a wide range of superconducting cables. These parameters include strand size, strand number, keystone angle, percent compaction, cable pitch and compacted cable dimensions. In addition, we have defined the tolerance ranges for the key cable manufacturing parameters such as mandrel size and shape, stand tension, and Turkshead temperature control. In this paper, we present the results on cables ranging from 8 strands to 36 strands of 0.65mm wire and from 8 strands to 30 strands of 0.8mm wire. We use these results to demonstrate the application of the scaling rules for Rutherford-type cable.

  20. Beam instability studies for the SSC

    Energy Technology Data Exchange (ETDEWEB)

    Chou, W.

    1994-09-01

    Beam instability studies of the Superconducting Super Collider (SSC) during the period 1989--1993 are briefly reviewed in this paper. Various topics are covered: single bunch and multi-bunch, single beam and beam-beam, parasitic heating and active feedback, etc. Although the SSC will not be built, many of the results obtained from these studies remain as useful references to the accelerator community.

  1. SSC [Superconducting Super Collider] Project: Technical Training for the Future of Texas. Navarro College/Dallas Community College District. Final Report for Year One.

    Science.gov (United States)

    Orsak, Charles; McGlohen, Patti J.

    The Superconducting Super Collider Laboratory (SSCL) is a national lab for research on the fundamental forces and constituents of the universe. A major part of the research will involve an oval ring 54 miles in circumference through which superconducting magnets will steer two beams of protons in opposite directions. In response to the…

  2. An application of differential geometry to SSC magnet end winding

    Energy Technology Data Exchange (ETDEWEB)

    Cook, J.M. (Argonne National Lab., IL (USA))

    1990-04-01

    It is expected that a large fraction of the total cost of the proposed Superconducting Supercollider will be spent on magnets, and, as Leon Lederman has remarked, most of the cost of making a magnet is in the ends.'' Among the mechanical problems to be solved there is the construction of an end-configuration for the superconducting cables which will minimize their strain energy. The purpose of this paper is to promote the use of differential geometry in this minimization. The use will be illustrated by a specific application to the winding of dipole ends. The cables are assumed to be clamped so firmly that their strain is not altered by Lorentz stresses. 15 refs.

  3. Superconductivity

    CERN Document Server

    Poole, Charles P; Farach, Horacio A

    1995-01-01

    Superconductivity covers the nature of the phenomenon of superconductivity. The book discusses the fundamental principles of superconductivity; the essential features of the superconducting state-the phenomena of zero resistance and perfect diamagnetism; and the properties of the various classes of superconductors, including the organics, the buckministerfullerenes, and the precursors to the cuprates. The text also describes superconductivity from the viewpoint of thermodynamics and provides expressions for the free energy; the Ginzburg-Landau and BCS theories; and the structures of the high

  4. SSC RESTful Web Services API

    Data.gov (United States)

    National Aeronautics and Space Administration — The Satellite Situation Center (SSC) web services allow a software developer to use portions of the SSC software in their own applications. SSC is a system to cast...

  5. Superconductivity

    CERN Document Server

    Thomas, D B

    1974-01-01

    A short general review is presented of the progress made in applied superconductivity as a result of work performed in connection with the high-energy physics program in Europe. The phenomenon of superconductivity and properties of superconductors of Types I and II are outlined. The main body of the paper deals with the development of niobium-titanium superconducting magnets and of radio-frequency superconducting cavities and accelerating structures. Examples of applications in and for high-energy physics experiments are given, including the large superconducting magnet for the Big European Bubble Chamber, prototype synchrotron magnets for the Super Proton Synchrotron, superconducting d.c. beam line magnets, and superconducting RF cavities for use in various laboratories. (0 refs).

  6. Superconductivity

    Science.gov (United States)

    1989-07-01

    SUPERCONDUCTIVITY HIGH-POWER APPLICATIONS Electric power generation/transmission Energy storage Acoustic projectors Weapon launchers Catapult Ship propulsion • • • Stabilized...temperature superconductive shields could be substantially enhanced by use of high-Tc materials. 27 28 NRAC SUPERCONDUCTIVITY SHIP PROPULSION APPLICATIONS...motor shown in the photograph. As a next step in the evolution of electric-drive ship propulsion technology, DTRC has proposed to scale up the design

  7. Superconductivity

    CERN Document Server

    Ketterson, John B

    2008-01-01

    Conceived as the definitive reference in a classic and important field of modern physics, this extensive and comprehensive handbook systematically reviews the basic physics, theory and recent advances in the field of superconductivity. Leading researchers, including Nobel laureates, describe the state-of-the-art in conventional and unconventional superconductors at a particularly opportune time, as new experimental techniques and field-theoretical methods have emerged. In addition to full-coverage of novel materials and underlying mechanisms, the handbook reflects continued intense research into electron-phone based superconductivity. Considerable attention is devoted to high-Tc superconductivity, novel superconductivity, including triplet pairing in the ruthenates, novel superconductors, such as heavy-Fermion metals and organic materials, and also granular superconductors. What’s more, several contributions address superconductors with impurities and nanostructured superconductors. Important new results on...

  8. Shielding calculations for SSC

    Energy Technology Data Exchange (ETDEWEB)

    Van Ginneken, A.

    1990-03-01

    Monte Carlo calculations of hadron and muon shielding for SSC are reviewed with emphasis on their application to radiation safety and environmental protection. Models and algorithms for simulation of hadronic and electromagnetic showers, and for production and transport of muons in the TeV regime are briefly discussed. Capabilities and limitations of these calculations are described and illustrated with a few examples. 12 refs., 3 figs.

  9. Superconductivity

    CERN Document Server

    Poole, Charles P; Creswick, Richard J; Prozorov, Ruslan

    2014-01-01

    Superconductivity, Third Edition is an encyclopedic treatment of all aspects of the subject, from classic materials to fullerenes. Emphasis is on balanced coverage, with a comprehensive reference list and significant graphics from all areas of the published literature. Widely used theoretical approaches are explained in detail. Topics of special interest include high temperature superconductors, spectroscopy, critical states, transport properties, and tunneling. This book covers the whole field of superconductivity from both the theoretical and the experimental point of view. This third edition features extensive revisions throughout, and new chapters on second critical field and iron based superconductors.

  10. Proceedings of the workshop on triggering and data acquisition for experiments at the Supercollider

    Energy Technology Data Exchange (ETDEWEB)

    Donaldson, R. [ed.

    1989-04-01

    This meeting covered the following subjects: triggering requirements for SSC physics; CDF level 3 trigger; D0 trigger design; AMY trigger systems; Zeus calorimeter first level trigger; data acquisition for the Zeus Central Tracking Detector; trigger and data acquisition aspects for SSC tracking; data acquisition systems for the SSC; validating triggers in CDF level 3; optical data transmission at SSC; time measurement system at SSC; SSC/BCD data acquisition system; microprocessors and other processors for triggering and filtering at the SSC; data acquisition, event building, and on-line processing; LAA real-time benchmarks; object-oriented system building at SSC; and software and project management. Selected papers are indexed separately for inclusion in the Energy Science and Technology Database.

  11. Dicty_cDB: SSC471 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC471 (Link to dictyBase) - - - Contig-U16339-1 SSC471E (Link to Original site) SSC...471F 448 SSC471Z 246 SSC471P 694 SSC471E 665 Show SSC471 Library SS (Link to library) Clone ID SSC...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSC4-C/SSC471Q.Seq.d/ Representative seq. ID SSC...471E (Link to Original site) Representative DNA sequence >SSC471 (SSC471Q) /CSM/SS/SSC4-C/SSC...SGFT KIDDPKFIGTVEYLEKKLRRGKYIIQSPDSVSASTTFTLYYISCIAKMGRKEEARELFEN ILNDCTPLGLISQDV

  12. Dicty_cDB: SSC418 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC418 (Link to dictyBase) - - - Contig-U01562-1 SSC418E (Link to Original site) SSC...418F 448 - - SSC418P 545 SSC418E 443 Show SSC418 Library SS (Link to library) Clone ID SSC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSC4-A/SSC418Q.Seq.d/ Representative seq. ID SSC...418E (Link to Original site) Representative DNA sequence >SSC418 (SSC418Q) /CSM/SS/SSC4-A/SSC4...fygkklvnyfqlvmn*iykknkn*nkillifx** scnitffnkkkkkkkkkkkkkkkkkkk Frame B: fke**y*se

  13. Dicty_cDB: SSC172 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC172 (Link to dictyBase) - - - Contig-U15618-1 SSC172P (Link to Original site) SSC...172F 288 SSC172Z 529 SSC172P 817 - - Show SSC172 Library SS (Link to library) Clone ID SSC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSC1-C/SSC172Q.Seq.d/ Representative seq. ID SSC...172P (Link to Original site) Representative DNA sequence >SSC172 (SSC172Q) /CSM/SS/SSC1-C/SSC1...HIEENLNSTQISYRRNFYVFDCKTL CPRNETINFEIEVCKVNGMDMYGIKFKRLSGDAWSYSSSCIKIVESLKL*lkkkk

  14. Dicty_cDB: SSC190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC190 (Link to dictyBase) - - - Contig-U01589-1 SSC190P (Link to Original site) SSC...190F 599 SSC190Z 469 SSC190P 1068 - - Show SSC190 Library SS (Link to library) Clone ID SSC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSC1-D/SSC190Q.Seq.d/ Representative seq. ID SSC...190P (Link to Original site) Representative DNA sequence >SSC190 (SSC190Q) /CSM/SS/SSC1-D/SSC...fwfknpw*p**fyfqinrfrkn*ksqryfvwkgnq*sscng*n* ket*kl*skvflys*prynhiiihgy*sl*cfnylc

  15. Dicty_cDB: SSC252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC252 (Link to dictyBase) - - - Contig-U16560-1 SSC252Z (Link... to Original site) - - SSC252Z 516 - - - - Show SSC252 Library SS (Link to library) Clone ID SSC252 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC2-C/SSC252Q.Seq.d/ Representative seq. ID SSC25...2Z (Link to Original site) Representative DNA sequence >SSC252 (SSC252Q) /CSM/SS/SSC2-C/SSC252Q.Seq.d/ XXXXX...5-B/SSE525Q.Seq.d/ 898 0.0 SSC252 (SSC252Q) /CSM/SS/SSC2-C/SSC252Q.Seq.d/ 898 0.0 SSC150 (SSC150Q) /CSM/SS/SSC1-C/SSC

  16. SSC OCIO, IT SUMMIT 2011

    Science.gov (United States)

    Cottrell, Dinna L.

    2011-01-01

    The Stennis Space Center (SSC) Records Retention Facility is a centralized location for all SSC records, Records Management staff, and the SSC History Office. The building is a storm resistant facility and provides a secure environment for records housing. The Records Retention Facility was constructed in accordance with The National Archives and Records Administration (NARA) requirements for records storage, making it the first NARA compliant facility in the agency. Stennis Space Center's Records Retention Facility became operational in May 2010. The SSC Records Retention Facility ensures that the required federal records are preserved, managed and accessible to all interested personnel. The facility provides 20,000 cubic feet of records storage capacity for the purpose of managing the centers consolidated records within a central, protected environment. Records housed in the facility are in the form of paper, optical, film and magnetic media. Located within the SSC Records Retention Facility, the Records Management Office provides comprehensive records management services in the form of: a) Storage and life-cycle management of inactive records of all media types; b) Digitizing/scanning of records and documents; c) Non-textual/digital electronic records media storage, migration and transfer; d) Records Remediation.

  17. Summer Science Camps Program (SSC).

    Science.gov (United States)

    National Science Foundation, Washington, DC. Directorate for Education and Human Resources.

    The Summer Science Camps (SSC) Program supports residential and commuter enrichment projects for seventh through ninth grade minority students who are underrepresented in science, engineering, and mathematics. Eligible organizations include school districts, museums, colleges, universities, and nonprofit youth-centered and/or community-based…

  18. Dicty_cDB: SSC733 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC733 (Link to dictyBase) - G02125 DDB0216410 Contig-U04767-1 SSC...733E (Link to Original site) - - - - - - SSC733E 564 Show SSC733 Library SS (Link to library) Clone ID SSC...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSC7-B/SSC733Q.Seq.d/ ...Representative seq. ID SSC733E (Link to Original site) Representative DNA sequence >SSC733 (SSC733Q) /CSM/SS/SSC7-B/SSC...niikeng*nkmeisrs*ic*kgrsqt*ktrrr*rs*rrs*rrrwck*rkwwre kescskki*ntnyiiiiiiiivihq**

  19. Dicty_cDB: SSC707 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC707 (Link to dictyBase) - G23635 DDB0189725 Contig-U16533-1 SSC...707F (Link to Original site) SSC707F 721 - - - - - - Show SSC707 Library SS (Link to library) Clone ID SSC...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSC7-A/SSC707Q.Seq.d/ ...Representative seq. ID SSC707F (Link to Original site) Representative DNA sequence >SSC707 (SSC707Q) /CSM/SS/SSC7-A/SSC... Frames) Frame A: kkkkkkkkkknlfiy*ftyi**ylliyxxiyththallvifsnniflfiiyiiyphflyi hnfqik*realhf*vysc

  20. Dicty_cDB: SSC446 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC446 (Link to dictyBase) - - - Contig-U14332-1 SSC446F (Link to Original site) SSC...446F 303 - - - - - - Show SSC446 Library SS (Link to library) Clone ID SSC446 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC4-B/SSC446Q.Seq.d/ Representative seq. ID SSC44...6F (Link to Original site) Representative DNA sequence >SSC446 (SSC446Q) /CSM/SS/SSC4-B/SSC446Q.Seq.d/ TAAAA...d Amino Acid sequence (All Frames) Frame A: *kh*kktivf*kiiyyiiylnknfhcqifkilk*nviqiiksiiqlfiiinefiisckfi ini

  1. Dicty_cDB: SSC336 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC336 (Link to dictyBase) - - - Contig-U14396-1 SSC336E (Link... to Original site) - - - - - - SSC336E 521 Show SSC336 Library SS (Link to library) Clone ID SSC336 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC3-B/SSC336Q.Seq.d/ Representative seq. ID SSC33...6E (Link to Original site) Representative DNA sequence >SSC336 (SSC336Q) /CSM/SS/SSC3-B/SSC336Q.Seq.d/ AATTA...it*iikfkneiiisfiissfnifsigti*rslfcfknlsrq*fyfqin*frkntksqr yfvwkgn*rsscng*n*kvk*rl*skvflsy*pryshifqygh*sl*cy

  2. Dicty_cDB: SSC193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC193 (Link to dictyBase) - - - Contig-U10256-1 SSC193F (Link to Original site) SSC...193F 589 - - - - - - Show SSC193 Library SS (Link to library) Clone ID SSC193 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC1-D/SSC193Q.Seq.d/ Representative seq. ID SSC19...3F (Link to Original site) Representative DNA sequence >SSC193 (SSC193Q) /CSM/SS/SSC1-D/SSC193Q.Seq.d/ GTTGT...nce (All Frames) Frame A: vvlldnlllffkflqffvlnitqt*nknglnqkkikqrriicsfr*rtsc*ikrsf*tl* *rknwfh*kgclknhl*tiwc

  3. Dicty_cDB: SSC302 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC302 (Link to dictyBase) - - - Contig-U16354-1 SSC302Z (Link... to Original site) - - SSC302Z 640 - - - - Show SSC302 Library SS (Link to library) Clone ID SSC302 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC3-A/SSC302Q.Seq.d/ Representative seq. ID SSC30...2Z (Link to Original site) Representative DNA sequence >SSC302 (SSC302Q) /CSM/SS/SSC3-A/SSC302Q.Seq.d/ XXXXX...lxixlfkffxk*nl*mxinnygiwnnklfivlgdfgi**rtpevhtw lrichylypih*rnfqqs*veqlhldcfylpncilhpmrsfhpyqchslsrscyrcc*lp

  4. Dicty_cDB: SSC494 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC494 (Link to dictyBase) - - - Contig-U13836-1 SSC494Z (Link... to Original site) - - SSC494Z 580 - - - - Show SSC494 Library SS (Link to library) Clone ID SSC494 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC4-D/SSC494Q.Seq.d/ Representative seq. ID SSC49...4Z (Link to Original site) Representative DNA sequence >SSC494 (SSC494Q) /CSM/SS/SSC4-D/SSC494Q.Seq.d/ XXXXX...SLCYLSLGRNG NALQNLPPTLETLKYYGEVQTDLNIKSIPHVKNLLIPFNNHSIIIDTIPPTVKYLAWGKL KDLEAIETLKNLPPSVNDLTFSCPPDVFDKIQRKH

  5. Dicty_cDB: SSC343 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC343 (Link to dictyBase) - - - Contig-U16259-1 SSC343Z (Link... to Original site) - - SSC343Z 671 - - - - Show SSC343 Library SS (Link to library) Clone ID SSC343 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC3-B/SSC343Q.Seq.d/ Representative seq. ID SSC34...3Z (Link to Original site) Representative DNA sequence >SSC343 (SSC343Q) /CSM/SS/SSC3-B/SSC343Q.Seq.d/ XXXXX...e 1997.11.25 Translated Amino Acid sequence ---tlv*KXWLEIHSCDSLTIVDTQTLTCSAPPGSGIKNAVSFMVKDAESKLSPPLFLDY SPP

  6. Dicty_cDB: SSC388 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC388 (Link to dictyBase) - G20828 DDB0168913 Contig-U04577-1 SSC...388Z (Link to Original site) - - SSC388Z 721 - - - - Show SSC388 Library SS (Link to library) Clone ID SSC...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSC3-D/SSC388Q.Seq.d/ ...Representative seq. ID SSC388Z (Link to Original site) Representative DNA sequence >SSC388 (SSC388Q) /CSM/SS/SSC3-D/SSC...*k*lvfqmli* cmlii*v*clvqic*rrhqilk*mqfqcwmlvik*sly*lkiiiyfmiini**lid*k** *ie Frame B: ---ixsllghskevdqlvttsc

  7. Dicty_cDB: SSC760 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC760 (Link to dictyBase) - - - Contig-U16310-1 SSC760Z (Link... to Original site) - - SSC760Z 608 - - - - Show SSC760 Library SS (Link to library) Clone ID SSC760 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC7-C/SSC760Q.Seq.d/ Representative seq. ID SSC76...0Z (Link to Original site) Representative DNA sequence >SSC760 (SSC760Q) /CSM/SS/SSC7-C/SSC760Q.Seq.d/ XXXXX...Translated Amino Acid sequence (All Frames) Frame A: ---tikryqrisfccqri*hpi*n*rcpkyfiirslknstnlikqsc*yrscftr

  8. Dicty_cDB: SSC144 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC144 (Link to dictyBase) - - - Contig-U15118-1 SSC144F (Link to Original site) SSC...144F 703 - - - - - - Show SSC144 Library SS (Link to library) Clone ID SSC144 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC1-B/SSC144Q.Seq.d/ Representative seq. ID SSC14...4F (Link to Original site) Representative DNA sequence >SSC144 (SSC144Q) /CSM/SS/SSC1-B/SSC144Q.Seq.d/ ATTAG...thc*rkpnqifhw*fiiwwccwcnlitlclpirfcpys fsc*cwywfsssihwfr*lylfnlqerrfnrfipwfwcicrrylclqscflwwlryc*rn fir*kqqesfilgfmgyrtsc

  9. Dicty_cDB: SSC228 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC228 (Link to dictyBase) - - - Contig-U01537-1 SSC228Z (Link... to Original site) - - SSC228Z 516 - - - - Show SSC228 Library SS (Link to library) Clone ID SSC228 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC2-B/SSC228Q.Seq.d/ Representative seq. ID SSC22...8Z (Link to Original site) Representative DNA sequence >SSC228 (SSC228Q) /CSM/SS/SSC2-B/SSC228Q.Seq.d/ XXXXX...s producing significant alignments: (bits) Value SSC228 (SSC228Q) /CSM/SS/SSC2-B/SSC2

  10. Dicty_cDB: SSC819 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC819 (Link to dictyBase) - - - Contig-U12197-1 SSC819F (Link to Original site) SSC...819F 341 - - - - - - Show SSC819 Library SS (Link to library) Clone ID SSC819 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC8-A/SSC819Q.Seq.d/ Representative seq. ID SSC81...9F (Link to Original site) Representative DNA sequence >SSC819 (SSC819Q) /CSM/SS/SSC8-A/SSC819Q.Seq.d/ CAAAA...g significant alignments: (bits) Value SSC819 (SSC819Q) /CSM/SS/SSC8-A/SSC819Q.Seq.d/ 331 4e-90 VHP762 (VHP7

  11. Dicty_cDB: SSC523 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC523 (Link to dictyBase) - - - Contig-U11366-1 SSC523F (Link to Original site) SSC...523F 570 - - - - - - Show SSC523 Library SS (Link to library) Clone ID SSC523 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC5-A/SSC523Q.Seq.d/ Representative seq. ID SSC52...3F (Link to Original site) Representative DNA sequence >SSC523 (SSC523Q) /CSM/SS/SSC5-A/SSC523Q.Seq.d/ ATTAT...*rylghnkv--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSC523 (SSC523Q) /CSM/SS/SSC

  12. Dicty_cDB: SSC317 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available oideum slug cDNA, clone SSC561. 971 0.0 2 ( BJ375299 ) Dictyostelium disc...SS (Link to library) SSC317 (Link to dictyBase) - - - Contig-U15332-1 SSC317P (Link to Original site) SSC...317F 554 SSC317Z 162 SSC317P 716 - - Show SSC317 Library SS (Link to library) Clone ID SSC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSC3-A/SSC317Q.Seq.d/ Representative seq. ID SSC...317P (Link to Original site) Representative DNA sequence >SSC317 (SSC317Q) /CSM/SS/SSC3-A/SSC3

  13. Dicty_cDB: SSC770 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ene for emp24/gp25... 307 2e-84 2 ( AU071934 ) Dictyostelium discoideum slug cDNA, clone SSC...770. 307 2e-84 2 ( AU071932 ) Dictyostelium discoideum slug cDNA, clone SSC765. 307 4e-83 2 ( AU2...SS (Link to library) SSC770 (Link to dictyBase) - - - Contig-U04772-1 SSC770F (Link to Original site) SSC...770F 195 - - - - - - Show SSC770 Library SS (Link to library) Clone ID SSC770 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC7-C/SSC770Q.Seq.d/ Representative seq. ID SSC77

  14. Dicty_cDB: SSC470 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C84194 ) Dictyostelium discoideum slug cDNA, clone SSC470. 930 0.0 1 ( C84184 ) Dictyostelium disc...oideum slug cDNA, clone SSC453. 930 0.0 1 ( AY171066 ) Dictyostelium discoideum extrachromo...SS (Link to library) SSC470 (Link to dictyBase) - - - Contig-U16581-1 SSC470E (Link... to Original site) - - - - - - SSC470E 523 Show SSC470 Library SS (Link to library) Clone ID SSC470 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC4-C/SSC470Q.Seq.d/ Representative seq. ID SSC47

  15. Dicty_cDB: SSC290 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC290 (Link to dictyBase) ssc290 G20821 DDB0230026 Contig-U09317-1 SSC2...90P (Link to Original site) SSC290F 464 SSC290Z 194 SSC290P 658 - - Show SSC290 Library SS (Link to library) Clone ID SSC2...90 (Link to dictyBase) Atlas ID ssc290 NBRP ID G20821 dictyBase ID DDB0230026 Link t...o Contig Contig-U09317-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSC2-D/SSC2...90Q.Seq.d/ Representative seq. ID SSC290P (Link to Original site) Representative DNA sequence >SSC290 (SSC2

  16. Dicty_cDB: SSC307 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC307 (Link to dictyBase) - G20822 DDB0191445 Contig-U09318-1 SSC...307P (Link to Original site) SSC307F 533 SSC307Z 179 SSC307P 712 - - Show SSC307 Library SS (Link to library) Clone ID SSC...ontig-U09318-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSC3-A/SSC...307Q.Seq.d/ Representative seq. ID SSC307P (Link to Original site) Representative DNA sequence >SSC307 (SSC307Q) /CSM/SS/SSC...3-A/SSC307Q.Seq.d/ GGATATTCAAAAATTTTAAAAAAAGATCCACAATCATGGATGTGGATAATTGCACCATTC ATTTTATA

  17. Dicty_cDB: SSC451 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC451 (Link to dictyBase) - G00637 DDB0205938 Contig-U13400-1 SSC...451P (Link to Original site) SSC451F 480 SSC451Z 149 SSC451P 629 - - Show SSC451 Library SS (Link to library) Clone ID SSC...ontig-U13400-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSC4-C/SSC...451Q.Seq.d/ Representative seq. ID SSC451P (Link to Original site) Representative DNA sequence >SSC451 (SSC451Q) /CSM/SS/SSC...4-C/SSC451Q.Seq.d/ CAACAAACAAAAAAAAAAAAAATTTAAATTTTTTACAAAAAAATGGCAGCATTAGAAAAT TTTTTAAT

  18. Dicty_cDB: SSC665 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC665 (Link to dictyBase) - - - Contig-U16581-1 SSC665F (Link to Original site) SSC...665F 381 - - - - - - Show SSC665 Library SS (Link to library) Clone ID SSC665 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC6-C/SSC665Q.Seq.d/ Representative seq. ID SSC66...5F (Link to Original site) Representative DNA sequence >SSC665 (SSC665Q) /CSM/SS/SSC6-C/SSC665Q.Seq.d/ ATATA...e-78 SSG321 (SSG321Q) /CSM/SS/SSG3-A/SSG321Q.Seq.d/ 291 4e-78 SSF109 (SSF109Q) /CSM/SS/SSF1-A/SSF109Q.Seq.d/ 291 4e-78 SSC665 (SSC

  19. Dicty_cDB: SSC166 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC166 (Link to dictyBase) - - - Contig-U10142-1 SSC166P (Link to Original site) SSC...166F 609 SSC166Z 531 SSC166P 1140 - - Show SSC166 Library SS (Link to library) Clone ID SSC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSC1-C/SSC166Q.Seq.d/ Representative seq. ID SSC...166P (Link to Original site) Representative DNA sequence >SSC166 (SSC166Q) /CSM/SS/SSC1-C/SSC...sf*nk*k***lvsfn*iik* ********nn*yy**kcsinnwc*tinnfk*k*ttttttttkrinys*tscksrrikksl *kg*cccslw*fsycnhciv*y---

  20. The Future SSC Pacific Civil Service Workforce

    Science.gov (United States)

    2008-08-01

    TECHNICAL REPORT 1971 August 2008 The Future SSC Pacific Civil Service Workforce P. Shigley G. Pennoyer J. Carreño Approved for... Shigley G. Pennoyer J. Carreño Approved for public release; distribution is unlimited. SSC San Diego San Diego, CA 92152-5001 SB...Prescribed by ANSI Std. Z39.18 08–2008 Final THE FUTURE SSC PACIFIC CIVIL SERVICE WORKFORCE P. Shigley G. Pennoyer J

  1. SSC 40 mm short model construction experience

    Energy Technology Data Exchange (ETDEWEB)

    Bossert, R.C.; Brandt, J.S.; Carson, J.A.; Dickey, C.E.; Gonczy, I.; Koska, W.A.; Strait, J.B.

    1990-04-01

    Several short model SSC magnets have been built and tested at Fermilab. They establish a preliminary step toward the construction of SSC long models. Many aspects of magnet design and construction are involved. Experience includes coil winding, curing and measuring, coil end part design and fabrication, ground insulation, instrumentation, collaring and yoke assembly. Fabrication techniques are explained. Design of tooling and magnet components not previously incorporated into SSC magnets are described. 14 refs., 18 figs., 2 tabs.

  2. Dicty_cDB: SSC771 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s) Value N ( C92009 ) Dictyostelium discoideum slug cDNA, clone SSC771. 375 0.0 3...SS (Link to library) SSC771 (Link to dictyBase) - - - Contig-U12865-1 SSC771Z (Link... to Original site) - - SSC771Z 520 - - - - Show SSC771 Library SS (Link to library) Clone ID SSC771 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC7-C/SSC771Q.Seq.d/ Representative seq. ID SSC77...1Z (Link to Original site) Representative DNA sequence >SSC771 (SSC771Q) /CSM/SS/SSC7-C/SSC771Q.Seq.d/ XXXXX

  3. Dicty_cDB: SSC482 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available oideum slug cDNA, clone SSC482. 906 0.0 1 ( AU284498 ) Dictyostelium discoideum gamete cDNA clone:...SS (Link to library) SSC482 (Link to dictyBase) - - - Contig-U16310-1 SSC482Z (Link... to Original site) - - SSC482Z 585 - - - - Show SSC482 Library SS (Link to library) Clone ID SSC482 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC4-D/SSC482Q.Seq.d/ Representative seq. ID SSC48...2Z (Link to Original site) Representative DNA sequence >SSC482 (SSC482Q) /CSM/SS/SSC4-D/SSC482Q.Seq.d/ XXXXX

  4. Dicty_cDB: SSC879 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC879 (Link to dictyBase) - G00650 DDB0231447 Contig-U04510-1 SSC...879E (Link to Original site) SSC879F 634 SSC879Z 660 SSC879P 1294 SSC879E 938 Show SSC879 Library SS (Li...nk to library) Clone ID SSC879 (Link to dictyBase) Atlas ID - NBRP ID G00650 dictyBase ID DDB0231447 Link to... Contig Contig-U04510-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSC8-D/SSC...879Q.Seq.d/ Representative seq. ID SSC879E (Link to Original site) Representative DNA sequence >SSC879 (SSC

  5. Dicty_cDB: SSC604 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC604 (Link to dictyBase) - - - Contig-U16255-1 SSC604Z (Link... to Original site) - - SSC604Z 674 - - - - Show SSC604 Library SS (Link to library) Clone ID SSC604 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC6-A/SSC604Q.Seq.d/ Representative seq. ID SSC60...4Z (Link to Original site) Representative DNA sequence >SSC604 (SSC604Q) /CSM/SS/SSC6-A/SSC604Q.Seq.d/ XXXXX...klfxxxk****fnn*slssiitl*yyfnnntffnxqrlyk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSC

  6. Dicty_cDB: SSC765 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( C92861 ) Dictyostelium discoideum slug cDNA, clone SSF515. 969 0.0 1 ( AU071932 ) Dictyostelium discoideum slug cDNA, clone SSC...765. 414 e-114 2 ( AU071934 ) Dictyostelium discoideum slug cDNA, clone SSC...SS (Link to library) SSC765 (Link to dictyBase) - G20269 DDB0215345 Contig-U04772-1 SSC...765F (Link to Original site) SSC765F 655 - - - - - - Show SSC765 Library SS (Link to library) Clone ID SSC...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSC7-C/SSC765Q.Seq.d/

  7. Dicty_cDB: SSC660 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC660 (Link to dictyBase) - - - Contig-U15495-1 SSC660E (Link... to Original site) - - - - - - SSC660E 553 Show SSC660 Library SS (Link to library) Clone ID SSC660 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC6-C/SSC660Q.Seq.d/ Representative seq. ID SSC66...0E (Link to Original site) Representative DNA sequence >SSC660 (SSC660Q) /CSM/SS/SSC6-C/SSC660Q.Seq.d/ AAAAA...nwcrtfsrsnfrck*wwclg*iiry* yy*trr*wyscfiqkss*gic*gcfdwwsxiygy*g*ptkylw*kgsnwlcsc*nrpsnh cwhl***sptrisctyc*kv

  8. Detector problems at the SSC

    Energy Technology Data Exchange (ETDEWEB)

    Wojcicki, S.G.

    1985-02-01

    During the last couple of years there has been considerable concern expressed among the US high energy community as to whether detector limitations would prevent one from being able to fully exploit a luminosity of 10/sup 33/ cm/sup -2/ sec/sup -1/ at a hadron-hadron high energy collider. As a result of these concerns, a considerable amount of work has been done recently in trying to understand the nature of potential difficulties and the required R and D that needs to be performed. A lot of this work has been summarized in the 1984 DPF Summer Study at Snowmass. This paper attempts to review some of these results. This work is limited to the discussion of detector problems associated with the study of high energy hadron-hadron collisions. We shall start with the discussion of the desirable features of the detectors and of the SSC environment in which they will have to work. After a brief discussion of the model 4..pi.. detectors, we shall discuss specific detector aspects: lepton identification, tracking, calorimetry and computing and triggering. We shall end with some remarks about possible future course of events. 15 refs., 10 figs.

  9. SSC San Diego Strategic Plan. Revision 3

    Science.gov (United States)

    2001-11-01

    OMB control number. 1. REPORT DATE NOV 2001 2. REPORT TYPE 3. DATES COVERED - 4. TITLE AND SUBTITLE SSC San Diego Strategic Plan. Rev 3 5a...Business Improvement Group ( CBIG ), will be composed of the team members listed above, and will be responsible for monitoring the planning and...implementation of these objectives. The CBIG will charter sub-groups as necessary. Improve Corporate IT infrastructure Much of the SSC San Diego IT service

  10. Dicty_cDB: SSC463 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC463 (Link to dictyBase) - - - Contig-U04467-1 SSC463Z (Link... to Original site) - - SSC463Z 612 - - - - Show SSC463 Library SS (Link to library) Clone ID SSC463 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04467-1 Original site URL http://dict...IMXFXCSNNQVISSSLVSXNNCIYTVEMSGNIFCPTPTPTPTPT PTPTPNPTSNVPCKSSNGISITXSDIITCIGYGQSICTTSSGYSCEPNQTNGVLKCISPD NS...XCSNNQVISSSLVSXNNCIYTVEMSGNIFCPTPTPTPTPT PTPTPNPTSNVPCKSSNGISITXSDIITCIGYGQSICTTSSGYSCEPNQTNGVLKCISPD NSISCI

  11. SSC workshop on environmental radiation

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1986-01-09

    The Superconducting Super Collider is a 20 TeV-on-20 TeV proton beam collider where two 20-TeV proton accelerators whose beams, rotating in opposite senses, are brought into collision to provide 40 TeV in the center of mass. The scale of the project is set by the 6.6 tesla magnet guide field for the protons which results in a roughly circular machine with a circumference of 83 km (51.5 mi.). The energy scale of the proton beams and the physical scale of the machine are an order of magnitude greater than for any presently operating or contemplated proton accelerator yet the facility must be operated within the same strict radiological guidelines as existing accelerators in the US and Europe. To ensure that the facility conforms to existing and projected guidelines both in design and operation, the Workshop was charged to review the experience and practices of existing accelerator laboratories, to determine the relevant present and projected regulatory requirements, to review particle production and shielding data from accelerators and cosmic rays, to study the design and operational specifications of the Collider, to examine the parameters set forth in the Siting Parameters Document, and to evaluate the computational tools available to model the radiation patterns arising under various operational and failure scenarios. This report summarizes the extensive and intensive presentations and discussions of the Workshop. A great deal of material, much of it in the form of internal reports from the various laboratories and drafts of works in preparation, was provided by the participants for the various topics. This material, including the viewgraphs used by the presenters, forms the background and basis for the conclusions of the Workshop and, as such, is an important part of the Workshop. An introduction to the material and a catalog by topic are presented as section 6 of this report.

  12. Fixed target facility at the SSC

    Energy Technology Data Exchange (ETDEWEB)

    Loken, S.C.; Morfin, J.G.

    1985-01-01

    The question of whether a facility for fixed target physics should be provided at the SSC must be answered before the final technical design of the SSC can be completed, particularly if the eventual form of extraction would influence the magnet design. To this end, an enthusiastic group of experimentalists, theoreticians and accelerator specialists have studied this point. The accelerator physics issues were addressed by a group led by E. Colton whose report is contained in these proceedings. The physics addressable by fixed target was considered by many of the Physics area working groups and in particular by the Structure Function Group. This report is the summary of the working group which considered various SSC fixed target experiments and determined which types of beams and detectors would be required. 13 references, 5 figures.

  13. SSC/BCD data acquisition system proposal

    Energy Technology Data Exchange (ETDEWEB)

    Barsotti, E.; Bowden, M.; Swoboda, C. [Fermilab, Batavia, IL (United States)

    1989-04-01

    The proposed new data acquisition system architecture takes event fragments off a detector over fiber optics and to a parallel event building switch. The parallel event building switch concept, taken from the telephone communications industry, along with expected technology improvements in fiber-optic data transmission speeds over the next few years, should allow data acquisition system rates to increase dramatically and exceed those rates needed for the SSC. This report briefly describes the switch architecture and fiber optics for a SSC data acquisition system.

  14. Time measurment system at the SSC

    Energy Technology Data Exchange (ETDEWEB)

    Arai, Yasuo [National Laboratory for High Energy Physics, Ibaraki (Japan)

    1989-04-01

    A proposal of time measurement system at the SSC experiment is described. An example of a possible scheme for central tracking chambers is shown. Designs of a preamp/shaper/discri chip and a time digitizer chip are described. A method to distribute system clock and power/cooling problems are also discussed.

  15. Change of surface critical current in the surface superconductivity and mixed states of superconducting niobium

    Science.gov (United States)

    Aburas, Muhamad; Pautrat, Alain; Bellido, Natalia

    2017-01-01

    A systematic study of irreversible magnetization was performed in bulk niobium after different surface treatments. Starting with smooth surfaces and abrading them, a strong increase of the critical current is observed up to an apparent limiting value. An impressive change of the critical current is also observed in the surface superconductivity (SSC) state, reaching values of the same order of magnitude as in the mixed state. We explain also the observation of strong SSC for magnetic fields perpendicular to large facets in terms of nucleation of superconductivity along bumps of a corrugated surface.

  16. Ship to Shore Connector Amphibious Craft (SSC)

    Science.gov (United States)

    2015-12-01

    Selected Acquisition Report (SAR) RCS: DD-A&T(Q&A)823-303 Ship to Shore Connector Amphibious Craft (SSC) As of FY 2017 President’s Budget Defense...Mission and Description 6 Executive Summary 7 Threshold Breaches 8 Schedule 9 Performance 11 Track to Budget 16 Cost and...Capability Production Document CY - Calendar Year DAB - Defense Acquisition Board DAE - Defense Acquisition Executive DAMIR - Defense Acquisition

  17. Longitudinal matching between SFC and SSC

    Energy Technology Data Exchange (ETDEWEB)

    Yin, Q.M.; Tang, J.Y.; Wang, S.L. [Institute of Modern Physics, China Academy of Science, Lanzhou (China)

    1998-11-01

    In order to increase the beam current and to enhance the beam quality, an upgrading program of HIRFL is going on at HIRFL. As a part of this program, the longitudinal matching between injector SFC and main machine SSC will be improved. It consists of beam energy measurement, compensation of energy loss due to stripper and a new rebuncher system. In this paper, the study results are presented. (author)

  18. Dicty_cDB: SSC323 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC323 (Link to dictyBase) - - - Contig-U16278-1 SSC323E (Link... to Original site) - - - - - - SSC323E 765 Show SSC323 Library SS (Link to library) Clone ID SSC323 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16278-1 Original site URL http://dict... Amino Acid sequence xxnxitnxxnrliips*ilifsqq*FFLICTMGLAFGKLFSRFFGKKDMRILMVGLDAAG... Acid sequence (All Frames) Frame A: xxnxitnxxnrliips*ilifsqq*FFLICTMGLAFGKLFSRFF

  19. Experimental Operation of SSC RF Cavities at Higher Voltage

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    For many years,SSC RF cavities were operated at about half of its designing voltages,which are from 100 kV at 6.5 MHz to 250 kV at 14.5 MHz respectively.But,with the construction of new project HIRFL-CSR,high intensity beams are required to be extracted from SSC.Therefore,in order to achieve this aim,SSC Dee voltages must be enhanced to higher operation level.

  20. SSC San Diego Command History Calendar Year 2005

    Science.gov (United States)

    2006-03-01

    SSC San Diego from Capt. Tim Flynn on 18 August 2005. Capt. Unetic joined the Center from SPAWAR Headquarters where he was Executive Assistant to...communications. Rear Adm. Tim Flynn Rear Adm. Tim Flynn served as SSC San Diego Commanding Officer beginning 2 May 2002. Before joining SSC San Diego, he was...Steven Short, Arleen Simbulan, Robert Smith, Gleason Snashall, Dow Street, Weden Teng, Deborah Tharp , Tine Thompson, Viet Tran, Thomas Tucker, Rob Turner

  1. Applied superconductivity

    CERN Document Server

    Newhouse, Vernon L

    1975-01-01

    Applied Superconductivity, Volume II, is part of a two-volume series on applied superconductivity. The first volume dealt with electronic applications and radiation detection, and contains a chapter on liquid helium refrigeration. The present volume discusses magnets, electromechanical applications, accelerators, and microwave and rf devices. The book opens with a chapter on high-field superconducting magnets, covering applications and magnet design. Subsequent chapters discuss superconductive machinery such as superconductive bearings and motors; rf superconducting devices; and future prospec

  2. Multiple photon effects in $pp$ scattering at SSC energies

    CERN Document Server

    Delaney, D B; Shio, C; Siopsis, G; Ward, B F L

    1992-01-01

    The Monte Carlo program SSCYFS2 is used in conjunction with available parton distribution functions to calculate the effects of multiple photon radiation on pp scattering at SSC energies. Effects relevant to precision SSC physics such as Higgs discovery and exploration are illustrated.

  3. Preliminary report on the design of the Superconducting Super Collider

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1986-01-01

    While a rather detailed Conceptual Design Report will be available in April, an Superconducting Super Collider (SSC) it is appropriate to give a preview, now that the primary parameters for the Conceptual Design Report have been put down. In this preview the leading two chapters give the historical and scientific-technical background for the SSC and deal at somelength with the physics issues to be explored by the SSC. A third chapter reviews briefly the engineering and accelerator physics foundations for the developing SSC design, while the fourth lists the primary design parameters and describes the overall design. The fifth chapter describes briefly the principal engineering systems that will appear in the Conceptual Design Report, including the rather extensive injector system required. A sixth and final chapter outlines the beginnings of a ``construction plan`` put together for the purposes of exploring practical schedules and defining the critical design, development and planning paths for the overall facility and its major sub-systems.

  4. Superconductor procurement and R and D for SSC

    Energy Technology Data Exchange (ETDEWEB)

    Scanlan, R.; Royet, J.; Hannaford, R.; Horler, D.

    1985-06-01

    We describe the results of superconductor procurements for SSC dipole model magnets. Most results will pertain to LBL procurements for the LBL-BNL collaboration; however, where appropriate to complete the SSC data base, reference will be made to material purchased by FNAL and TAC. Also, most of the results to be presented will relate to the conventional SSC conductors, i.e., with filament sizes in the range of 15 to 25 ..mu..m. Some information on fine filament NbTi material, such as quantities and delivery schedules, will be presented here; fine filament NbTi R and D is described in another section.

  5. Mobile Platform Development for SSC Propulsion Test Operations Project

    Data.gov (United States)

    National Aeronautics and Space Administration — A review of mobile applications (apps) and portable electronic tools/mobile platforms (that could be used by propulsion testing field users at SSC) was conducted....

  6. A simulation of data acquisition system for SSC experiments

    Energy Technology Data Exchange (ETDEWEB)

    Watase, Y.; Ikeda, H. [National Laboratory for High Energy Physics (KEK), Tsukuba, Ibaraki (Japan)

    1989-04-01

    A simulation on some parts of the data acquisition system was performed using a general purpose simulation language GPSS. Several results of the simulation are discussed for the data acquisition system for the SSC experiment.

  7. SSC-K code user's manual

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Y.M.; Lee, Y.B.; Chang, W.P.; Hahn, D

    2000-07-01

    The Supper System Code of KAERI (SSC-K) is a best-estimate system code for analyzing a variety of off-normal or accidents in the heat transport system of a pool type LMR design. It is being developed at Korea Atomic Energy Research Inititution (KAERI) on the basis of SSC-L, originally developed at BNL to analyze loop-type LMR transients. SSC-K can handle both designs of loop and pool type LMRs. SSC-K contains detailed mechanistic models of transient thermal, hydraulic, neutronic, and mechanical phenomena to describe the response of the reactor core, coolant, fuel elements, and structures to accident conditions. This report provides an overview of recent model developmentsvfor the SSC-K computer code, focusing on phenomenological model descriptions for new thermal, hydraulic, neutronic, and mechnaical modules. A comprehensive description of the models for pool-type reactor is given in Chapters 2 and 3; the steady-state plant characterization, prior to the initiation of transient is described in Chapter 2 and their transient counterparts are discussed in Chapter 3. In Chapter 4, a discussion on the intermediate heat exchanger (IHX) is presented. The IHX model of SSC-K is similar to that used in the SSC-L, except for some changes required for the pool-type configuration of reactor vessel. In Chapter 5, an electromagnetic (EM) pump is modeled as a component. There are two pump choices available in SSC-K; a centrifugal pump which was originally imbedded into the SSC-L, and an EM pump which was introduced for the KALIMER design. In Chapter 6, a model of passive safety decay heat removal system(PSDRS) is discussed, which removes decay heat through the reactor and containment vessel walls to the ambient air heat sink. In Chapter 7, models for various reactivity feedback effects are discussed. Reactivity effects of importance in fast reactor include the Doppler effect, effects of sodium density changes, effects of dimensional changes in core geometry. Finally in Chapter 8

  8. Superconducting transistor

    Science.gov (United States)

    Gray, Kenneth E.

    1979-01-01

    A superconducting transistor is formed by disposing three thin films of superconducting material in a planar parallel arrangement and insulating the films from each other by layers of insulating oxides to form two tunnel junctions. One junction is biased above twice the superconducting energy gap and the other is biased at less than twice the superconducting energy gap. Injection of quasiparticles into the center film by one junction provides a current gain in the second junction.

  9. Superconductivity and superconductive electronics

    Science.gov (United States)

    Beasley, M. R.

    1990-12-01

    The Stanford Center for Research on Superconductivity and Superconductive Electronics is currently focused on developing techniques for producing increasingly improved films and multilayers of the high-temperature superconductors, studying their physical properties and using these films and multilayers in device physics studies. In general the thin film synthesis work leads the way. Once a given film or multilayer structure can be made reasonably routinely, the emphasis shifts to studying the physical properties and device physics of these structures and on to the next level of film quality or multilayer complexity. The most advanced thin films synthesis work in the past year has involved developing techniques to deposit a-axis and c-axis YBCO/PBCO superlattices and related structures. The in-situ feature is desirable because no solid state reactions with accompanying changes in volume, morphology, etc., that degrade the quality of the film involved.

  10. Three-flavor color superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Malekzadeh, H.

    2007-12-15

    I investigate some of the inert phases in three-flavor, spin-zero color-superconducting quark matter: the CFL phase (the analogue of the B phase in superfluid {sup 3}He), the A and A{sup *} phases, and the 2SC and sSC phases. I compute the pressure of these phases with and without the neutrality condition. Without the neutrality condition, after the CFL phase the sSC phase is the dominant phase. However, including the neutrality condition, the CFL phase is again the energetically favored phase except for a small region of intermediate densities where the 2SC/A{sup *} phase is favored. It is shown that the 2SC phase is identical to the A{sup *} phase up to a color rotation. In addition, I calculate the self-energies and the spectral densities of longitudinal and transverse gluons at zero temperature in color-superconducting quark matter in the CFL phase. I find a collective excitation, a plasmon, at energies smaller than two times the gap parameter and momenta smaller than about eight times the gap. The dispersion relation of this mode exhibits a minimum at some nonzero value of momentum, indicating a van Hove singularity. (orig.)

  11. Abraham Pais Prize for History of Physics Lecture: Big, Bigger, Too Big? From Los Alamos to Fermilab and the SSC

    Science.gov (United States)

    Hoddeson, Lillian

    2012-03-01

    The modern era of big science emerged during World War II. Oppenheimer's Los Alamos laboratory offered the quintessential model of a government-funded, mission-oriented facility directed by a strong charismatic leader. The postwar beneficiaries of this model included the increasingly ambitious large laboratories that participated in particle physics--in particular, Brookhaven, SLAC, and Fermilab. They carried the big science they practiced into a new realm where experiments eventually became as large and costly as entire laboratories had been. Meanwhile the available funding grew more limited causing the physics research to be concentrated into fewer and bigger experiments that appeared never to end. The next phase in American high-energy physics was the Superconducting Super Collider, the most costly pure physics project ever attempted. The SSC's termination was a tragedy for American science, but for historians it offers an opportunity to understand what made the success of earlier large high-energy physics laboratories possible, and what made the continuation of the SSC impossible. The most obvious reason for the SSC's failure was its enormous and escalating budget, which Congress would no longer support. Other factors need to be recognized however: no leader could be found with directing skills as strong as those of Wilson, Panofsky, Lederman, or Richter; the scale of the project subjected it to uncomfortable public and Congressional scrutiny; and the DOE's enforcement of management procedures of the military-industrial complex that clashed with those typical of the scientific community led to the alienation and withdrawal of many of the most creative scientists, and to the perception and the reality of poor management. These factors, exacerbated by negative pressure from scientists in other fields and a post-Cold War climate in which physicists had little of their earlier cultural prestige, discouraged efforts to gain international support. They made the SSC

  12. SSC: Gesture-based game for initial dementia examination

    Institute of Scientific and Technical Information of China (English)

    LIU Jun-fa; CHEN Yi-qiang; XIE Chen; GAO Wen

    2006-01-01

    This paper presents a novel system assisting medical dementia examination in a joyful way: the object just needs to play a popular game SSC against the computer during the examination. The SSC game's target is to detect the player's reacting capability, which is related closely with dementia. Our system reaches this target with some advantages: there are no temporal and spatial constraints at all. There is no cost, and it can even improve people's mental status. Hand talk technology and EHMM gesture recognition approach are employed to realize the human computer interface. Experiments showed that this system can evaluate people's reacting capability effectively and is helpful for initial dementia examination.

  13. High energy physics at the University of Iowa. Progress report, 1 September 1992--30 September 1993

    Energy Technology Data Exchange (ETDEWEB)

    McCliment, E.R.; Mallik, U.; Newsom, C.R.; Onel, Y.

    1993-11-01

    Efforts were devoted to three tasks: a study of electron proton physics with ZEUS at HERA (the ZEUS detector, the J/{psi} search, future upgrades), fixed-target experiments at Fermilab (Coulomb-nuclear interference measurement, inclusive {Lambda} measurements, hyperon radiative decay, charmed baryon studies at CERN and at Fermilab--detector status), and R&D related to Superconducting Supercollider (SSC) detector development with the GEM collaboration.

  14. Superconducting electronics

    NARCIS (Netherlands)

    Rogalla, Horst

    1994-01-01

    During the last decades superconducting electronics has been the most prominent area of research for small scale applications of superconductivity. It has experienced quite a stormy development, from individual low frequency devices to devices with high integration density and pico second switching

  15. The Influence of Niobium on SSC Resistance in API Steels

    Energy Technology Data Exchange (ETDEWEB)

    Malina, J.; Malina, M.; Novosel-Radovic, V. [Zagreb Univ., Faculty of Metallurgy (Croatia)

    2004-07-01

    Full text of publication follows: Oil country tubular goods are often exposed to aggressive sour environments in oil wells where H{sub 2}S promotes sulfide stress cracking, SSC. This is one of the most dangerous corrosion phenomena characterized by unpredictable and sudden cracking of steel constructions in service. SSC results in a variety of fracture features having a common relationship to the presence of hydrogen in metal and therefore it belongs to hydrogen embrittlement phenomena, HE. For the production of sulfide stress cracking resistant (SSC) tubing from steels included in Group 3 of API Specification 5CT, in this study two experimental Cr-Mo steels (without niobium and with niobium microalloyed) were tested. The influence of Nb precipitates in pipeline steels on the sensitivity to sulfide stress cracking was examined in laboratory experiments using three point bent beam tests. High mechanical properties were achieved through quenching and tempering procedures. Better corrosion resistance of Nb-containing steel is the consequence of microstructural parameters obtained through strengthening mechanism with microalloying element. Besides the usual mechanical, metallographic, SEM and TEM analyses, as complementary method the X-ray diffraction was used. It was revealed that tetragonality of crystal lattice, dislocation density and residual stresses are in good correlation with Sc-vales from corrosion tests. Nb precipitates (especially niobium carbides) have beneficial influence when producing the steels with low sensitivity to SSC. (authors)

  16. Anti-proteinase 3 antibodies in diffuse systemic sclerosis (SSc with normotensive renal impairment: is it suggestive for an overlapping between SSc and idiopathic vasculitis?

    Directory of Open Access Journals (Sweden)

    V. Campanella

    2011-09-01

    Full Text Available Objective. To test the prevalence of anti-neutrophil cytoplasmic antibodies (ANCA in systemic sclerosis (SSc and to verify a possible association of ANCA with normotensive renal involvement in SSc. Patients and methods: 51 patients affected by SSc, 35 with diffuse scleroderma (dSSc and 16 with limited scleroderma (lSSc, were tested for ANCA by indirect immunofluorescence (IIF on human ethanol and formalin-acetone-fixed granulocytes (before and after DNase treatment, by conventional enzyme linked immuno-sorbent assay (ELISA and by capture-ELISA. Results. Six out of 51 selected SSc patients had ANCA by IIF (11.7% and five presented a perinuclear/nuclear atypical ANCA pattern. In all cases we only found anti-proteinase3 (aPR3 antibodies. All ANCA positive patients had diffuse form of SSc (17.1%, all were anti-Scl70 positive (aScl70, five patients had proteinuria, three had microscopic haematuria. All ANCA positive patients were normotensive with normal renin plasma levels, the mean erythrocyte sedimentation rate (ESR was higher in this group compared to the other SSc patients. Conclusions. Our study shows that aPR3 is not rare in dSSc. According to the clinical and serological findings and to the recent literature, we can hypothesise that when ANCA are found in SSc, an overlapping of scleroderma with systemic necrotizing vasculitis should be suspected.

  17. Dicty_cDB: SSC537 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSC5-B/SSC537Q.Seq.d/ ...RAFT SEQUENCE, 26 unordered pieces. 48 0.11 1 BH238352 |BH238352.1 ATYCE41TR ATYC Arabidopsis thaliana genomic clone ATYC... 48 0.30 2 BH238452 |BH238452.1 ATYCG46TF ATYC Arabidopsis thaliana genomic clone ATYC...G46, DNA sequence. 36 0.34 2 BH239363 |BH239363.1 ATYCH35TR ATYC Arabidopsis thaliana genomic clone ATYC...H35, DNA sequence. 36 0.34 2 BH239114 |BH239114.1 ATYCK83TF ATYC Arabidopsis thaliana genomic clone ATYCK83

  18. Design and Evaluation of joint resistance in SSC Rutherford type cable splices for Torus magnet for the Jefferson Lab 12 GeV Upgrade

    Energy Technology Data Exchange (ETDEWEB)

    Ghoshal, Probir K. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Fair, Ruben J. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Kashy, David H. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Legg, Robert A. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Rajput-Ghoshal, Renuka [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampshire, Damian; Tsui, Yeekin; Haden-Gates, Virginia

    2016-06-01

    The Hall B 3.6-T superconducting torus magnet is being designed and built as part of the Jefferson Lab 12-GeV upgrade. The magnet consists of six trapezoidal coils connected in series, with an operating current of 3770 A. The magnet and the joints (or splices) connecting the coils are all conduction cooled by supercritical 4.6-K helium. This paper studies the design and manufacturing process of the splices made between two SSC Rutherford-type cables and discusses the tests performed to evaluate the performance of the splices under varying incident magnetic fields.

  19. The Superconducting Super Collider: A status report

    Energy Technology Data Exchange (ETDEWEB)

    Schwitters, R.F.

    1993-04-01

    The design of the Superconducting Super Collider (SSC) is briefly reviewed, including its key machine parameters. The scientific objectives are twofold: (1) investigation of high-mass, low-rate, rare phenomena beyond the standard model; and (2) investigation of processes within the domain of the standard model. Machine luminosity, a key parameter, is a function of beam brightness and current, and it must be preserved through the injector chain. Features of the various injectors are discussed. The superconducting magnet system is reviewed in terms of model magnet performance, including the highly successful Accelerator System String Test Various magnet design modifications are noted, reflecting minor changes in the collider arcs and improved installation procedures. The paper concludes with construction scenarios and priority issues for ensuring the earliest collider commissioning.

  20. The MAGIC of SSC and how it affects LHC

    CERN Document Server

    Mavromatos, Nick E

    2009-01-01

    We discuss the phenomenology of Supercritical String Cosmology (SSC) in the context of Dark Matter constraints on supersymmetric particle physics models at LHC. We also link our results with recent findings of the MAGIC, H.E.S.S. and Fermi Telescopes on delayed arrival of highly energetic photons from the distant Galaxies and GRBs. The link is provided by a concrete model of space-time foam in (supercritical) string theory, involving space-time defects and their interaction with matter in a brane world scenario.

  1. On the Use of SSC Method in English Teaching

    Institute of Scientific and Technical Information of China (English)

    朱清侠

    2010-01-01

    @@ Structural, Situational and Communicative (SSC) method stresses on situation. In these situations, the teacher can mix new language structures with old knowledge structures.English is a foreign language for the students of our country, most of them lack the circumstance to study and use it. The interesting and natural situations what the teacher set up just can arouse the interest of the students' studying English, so the situations can foster the students' communicative ability and make them practice the language easily and actively.

  2. SSC San Diego Command History Calendar Year 2006

    Science.gov (United States)

    2007-03-01

    Alamos, New Mexico . 8 Head, Pacific C4ISR Department6 George McCarty was selected to head the Pacific C4ISR Department. Prior to his selection...assistance in the rescue and care of eight dolphins that were washed out into the Gulf of Mexico when Hurricane Katrina’s storm surge destroyed their...years of Navy communications on Point Loma,” Outlook, 24 March 2006, Volume 29, Number 6, Outlook, “SSC San Diego will hold open house and Fiesta Picnic

  3. Delta-function Approximation SSC Model in 3C 273

    Indian Academy of Sciences (India)

    S. J. Kang; Y. G. Zheng; Q. Wu

    2014-09-01

    We obtain an approximate analytical solution using approximate calculation on the traditional one-zone synchrotron self-Compton (SSC) model. In this model, we describe the electron energy distribution by a broken power-law function with a sharp cut-off, and non-thermal photons are produced by both synchrotron and inverse Compton scattering of synchrotron photons. We calculate the radiation energy spectrum of electrons by the function. We apply this model to the multi-wavelength Spectral Energy Distributions (SED) of the 3C 273 in different states, and obtain excellent fits to the observed spectra of this source.

  4. Coil end design for the SSC collider dipole magnet

    Energy Technology Data Exchange (ETDEWEB)

    Brandt, J.; Bartlett, N.; Bossert, R.; Carson, J.; Konc, J.; Lee, G. [Fermi National Accelerator Lab., Batavia, IL (United States); Cook, J. [Argonne National Lab., IL (United States); Caspi, S. [Lawrence Berkeley Lab., CA (United States); Gordon, M.; Nobrega, F. [Superconducting Super Collider Lab., Dallas, TX (United States)

    1991-07-01

    This paper describes the design of the coil end for the 50mm aperture SSC collider dipole magnets built at Fermilab. The cable paths are determined from both magnetic and mechanical considerations. The end spacers are designed using the developable surface, grouped end approach, which allows the analysis of strain energy within the conductor groups. Techniques for strain energy minimization are presented and the behavior of individual conductors within a group is analyzed. The relationship between optimization of magnetic and mechanical variables is discussed. Requirements of manufacturing and inspection of coil end parts are outlined. 7 refs.

  5. Object-oriented system building for the SSC

    Energy Technology Data Exchange (ETDEWEB)

    Ludgate, G.A. [TRIUMF, Vancouver (Canada)

    1989-04-01

    The concepts and terminology of object-oriented system development are presented assuming the reader is familiar with the Structured Analysis and Structured Design (SA/SD) methodology. An improvement to SA/SD, known as Object Oriented Analysis/Object Oriented Design (OOA/OOD) is described and the steps in such an undertaking explained. Object Oriented Programming (OOP) is briefly introduced before SA/SD and OOA/OOD are compared. A recommendation to the SSC Central Design Group concludes the paper.

  6. Superconducting Microelectronics.

    Science.gov (United States)

    Henry, Richard W.

    1984-01-01

    Discusses superconducting microelectronics based on the Josephson effect and its advantages over conventional integrated circuits in speed and sensitivity. Considers present uses in standards laboratories (voltage) and in measuring weak magnetic fields. Also considers future applications in superfast computer circuitry using Superconducting…

  7. Superconducting Super Collider: A step in the 21st century

    Science.gov (United States)

    McAshan, M.

    1991-08-01

    The development of superconducting materials and the development of helium temperature refrigeration technology have both been propelled by their wide application in large-scale scientific research. The development of materials and technology for the Tevatron proton storage ring at Fermi National Accelerator Laboratory, Batavia, IL USA, in the decade of the seventies provided the basis in the decade of the eighties, for example, for the use of superconducting helium-cooled whole-body magnets for magnetic resonance imaging in medical diagnosis. In the decade of the nineties a number of particle accelerators for high energy physics will be constructed in national and international laboratories around the world. These devices will employ superconductivity on an ambitious scale, and their operation will require more than double the amount of helium refrigeration capacity now installed worldwide. This large increase in the use of helium refrigeration will have a significant effect on the technology and on the industry that produces it. The largest of these accelerator projects is the Superconducting Super Collider (SSC) now under construction at a new laboratory near Dallas, TX USA. This report discusses the development of this cryogenic system for the SSC magnets.

  8. Report of the task force on SSC commissioning and operations

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1985-07-01

    In 1985 January a Taskforce was organized to study the impact of magnet design on the commissioning and operation of the SSC. The results of the study, in the form of this report, are intended as one of several sources of input for the Magnet Type Selection Committee. Other major input will come from the Magnet Taskforce, the Test String Taskforce, the Cost Estimating Taskforce, and other study groups. All of these efforts will culminate in a magnet type selection, after which concentrated R&D on the selected magnet can commence. The study began with a one-week workshop, held on the UC Berkeley campus in 1985 January 14--18. An interim report of the Taskforce, based on the results of the Workshop, was published on 1985 January 28 (SSC-05). With very few exceptions, the work of the Taskforce was carried out by the participants in the Workshop, both during the workshop and in the subsequent weeks. This report is the collective effort of that group, whose very substantial contribution of time, effort, and thought is gratefully acknowledged.

  9. Color superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Wilczek, F. [Institute for Advanced Study, Princeton, NJ (United States)

    1997-09-22

    The asymptotic freedom of QCD suggests that at high density - where one forms a Fermi surface at very high momenta - weak coupling methods apply. These methods suggest that chiral symmetry is restored and that an instability toward color triplet condensation (color superconductivity) sets in. Here I attempt, using variational methods, to estimate these effects more precisely. Highlights include demonstration of a negative pressure in the uniform density chiral broken phase for any non-zero condensation, which we take as evidence for the philosophy of the MIT bag model; and demonstration that the color gap is substantial - several tens of MeV - even at modest densities. Since the superconductivity is in a pseudoscalar channel, parity is spontaneously broken.

  10. SUPERCONDUCTING PHOTOCATHODES.

    Energy Technology Data Exchange (ETDEWEB)

    SMEDLEY, J.; RAO, T.; WARREN, J.; SEKUTOWICZ, LANGNER, J.; STRZYZEWSKI, P.; LEFFERS, R.; LIPSKI, A.

    2005-10-09

    We present the results of our investigation of lead and niobium as suitable photocathode materials for superconducting RF injectors. Quantum efficiencies (QE) have been measured for a range of incident photon energies and a variety of cathode preparation methods, including various lead plating techniques on a niobium substrate. The effects of operating at ambient and cryogenic temperatures and different vacuum levels on the cathode QE have also been studied.

  11. Particle-In-Cell Simulation of RFQ in SSC - Linac

    CERN Document Server

    Chen, Xiao; You-Jin, Yuan; Yong, Liu; Jia-Wen, Xia; Yuan-Rong, Lu; Batygin, Yuri

    2010-01-01

    A 52MHz Radio Frequency Quadrupole (RFQ) linear accelerator (linac) is designed to serve as an initial structure for the SSC-linac system (injector into Separated Sector Cyclotron). The designed injection and output energy are 3.5 keV/u and 143 keV/u, respectively. Beam dynamics study in RFQ was done using 3-dimensional particle-in-cell code BEAMPATH [1]. Simulation results show that this RFQ structure is characterized by stable value of beam transmission efficiency (at least 95%) for both zero-current mode and for space charge dominated regime. The beam accelerated in RFQ has good quality in both transversal and longitudinal directions, and could be easily accepted by Drift Tube Linac (DTL). Effects of vane errors and of the space charge on beam parameters are studied as well to define the engineering tolerance for RFQ vane machining and alignment.

  12. Design study of the SSC-LINAC re-buncher

    Science.gov (United States)

    Sun, Lie-Peng; Zhao, Hong-Wei; Sun, Zhou-Ping; He, Yuan; Shi, Ai-Min; Xiao, Chen; Du, Xiao-Nan; Zhang, Cong; Zhang, Zhou-Li

    2013-02-01

    A re-buncher with spiral arms for a heavy ion linear accelerator named as SSC-LINAC at HIRFL (the heavy ion research facility of Lanzhou) has been constructed. The re-buncher, which is used for beam longitudinal modulation and matching between the RFQ and DTL, is designed to be operated in continuous wave (CW) mode at the Medium-Energy Beam-Transport (MEBT) line to maintain the beam intensity and quality. Because of the longitudinal space limitation, the re-buncher has to be very compact and will be built with four gaps. We determined the key parameters of the re-buncher cavity from the simulations using Microwave Studio software, such as the resonant frequency, the quality factor Q and the shunt impedance. The detailed design of a 53.667 MHz spiral cavity and measurement results of its prototype will be presented.

  13. Current Approaches to the Treatment of Systemic-Sclerosis-Associated Pulmonary Arterial Hypertension (SSc-PAH).

    Science.gov (United States)

    Sobanski, Vincent; Launay, David; Hachulla, Eric; Humbert, Marc

    2016-02-01

    Pulmonary arterial hypertension (PAH) is a severe condition causing significant morbidity and mortality in patients with systemic sclerosis (SSc). Despite the use of specific treatments, SSc-PAH survival remains poorer than in idiopathic PAH (IPAH). Recent therapeutic advances in PAH show a lower magnitude of response in SSc-PAH and a higher risk of adverse events, as compared to IPAH. The multifaceted underlying mechanisms and the multisystem nature of SSc probably explain part of the worse outcomes in SSc-PAH compared to IPAH. This review describes the current management of SSc-PAH with an emphasis on the impact of the different organ involvements in the prognosis and treatment response. An earlier detection of PAH and a better characterization of the clinical phenotypes of SSc-PAH are warranted in clinical practice and future trials. Determinants of prognosis, surrogate markers of clinical improvement or worsening, and relevance of the common endpoints used in clinical trials should be evaluated in this specific population. A multidisciplinary approach in expert referral centers is mandatory for SSc-PAH management.

  14. Itinerant Ferromagnetism and Superconductivity

    OpenAIRE

    Karchev, Naoum

    2004-01-01

    Superconductivity has again become a challenge following the discovery of unconventional superconductivity. Resistance-free currents have been observed in heavy-fermion materials, organic conductors and copper oxides. The discovery of superconductivity in a single crystal of $UGe_2$, $ZrZn_2$ and $URhGe$ revived the interest in the coexistence of superconductivity and ferromagnetism. The experiments indicate that: i)The superconductivity is confined to the ferromagnetic phase. ii)The ferromag...

  15. 100 years of superconductivity

    CERN Document Server

    Rogalla, Horst

    2011-01-01

    Even a hundred years after its discovery, superconductivity continues to bring us new surprises, from superconducting magnets used in MRI to quantum detectors in electronics. 100 Years of Superconductivity presents a comprehensive collection of topics on nearly all the subdisciplines of superconductivity. Tracing the historical developments in superconductivity, the book includes contributions from many pioneers who are responsible for important steps forward in the field.The text first discusses interesting stories of the discovery and gradual progress of theory and experimentation. Emphasizi

  16. Effect of test method on SSC performance of modified 13Cr steel

    Energy Technology Data Exchange (ETDEWEB)

    Kimura, Mitsuo; Miyata, Yukio; Toyooka, Takaaki; Nakano, Yoshifumi; Murase, Fumio; Takojima, Kozo [Kawasaki Steel Corp., Handa, Aichi (Japan)

    1998-12-31

    Effect of test method on SSC performance of modified 13Cr martensitic stainless steel (0.025C-13Cr-Ni-Mo) are investigated. The SSC for martensitic stainless steel initiates at the pitting and propagates by hydrogen embrittlement. The pH stability of the test solution affects the test results. SSC threshold stress for modified 13Cr steel in the stable solution is higher than that in the unstable solution. This difference seems to depend on the pH value in the pitting, since a great volume of hydrogen enters into steel at low pH condition and causes SSC. The SSC susceptibility for subsize specimens is higher than that for full size specimens. The oxygen in the test solution causes pitting. The deaeration procedure affects the SSC test result. The deaerated test solution should be transferred to test vessel. The SSC performance for martensitic stainless steel should be evaluated by full size test specimens under stable pH condition.

  17. The XMM-Newton SSC survey of the Galactic Plane

    CERN Document Server

    Gomez-Moran, A Nebot; Barcons, X; Carrera, F J; Ceballos, M T; Cropper, M; Grosso, N; Guillout, P; Herent, O; Mateos, S; Michel, L; Osborne, J P; Pakull, M; Pineau, F -X; Pye, J P; Roberts, T P; Rosen, S R; Schwope, A D; Watson, M G; Webb, N

    2013-01-01

    Many different classes of X-ray sources contribute to the Galactic landscape at high energies. Although the nature of the most luminous X-ray emitters is now fairly well understood, the population of low-to-medium X-ray luminosity (Lx = 10^27-10^34 erg/s) sources remains much less studied, our knowledge being mostly based on the observation of local members. The advent of wide field and high sensitivity X-ray telescopes such as XMM-Newton now offers the opportunity to observe this low-to-medium Lx population at large distances. We report on the results of a Galactic plane survey conducted by the XMM-Newton Survey Science Centre (SSC). Beyond its astrophysical goals, this survey aims at gathering a representative sample of identified X-ray sources at low latitude that can be used later on to statistically identify the rest of the serendipitous sources discovered in the Milky Way. The survey is based on 26 XMM-Newton observations, obtained at |b| < 20 deg, distributed over a large range in Galactic longitude...

  18. Torus CLAS12-Superconducting Magnet Quench Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Kashikhin, V S; Elouadhiri, L; Ghoshal, P K; Kashy, D; Makarov, A; Pastor, O; Quettier, L; Velev, G; Wiseman, M

    2014-06-01

    The JLAB Torus magnet system consists of six superconducting trapezoidal racetrack-type coils assembled in a toroidal configuration. These coils are wound with SSC-36 Nb-Ti superconductor and have the peak magnetic field of 3.6 T. The first coil manufacturing based on the JLAB design began at FNAL. The large magnet system dimensions (8 m diameter and 14 MJ of stored energy) dictate the need for quench protection. Each coil is placed in an aluminum case mounted inside a cryostat and cooled by 4.6 K supercritical helium gas flowing through a copper tube attached to the coil ID. The large coil dimensions and small cryostat thickness drove the design to challenging technical solutions, suggesting that Lorentz forces due to transport currents and eddy currents during quench and various failure scenarios are analyzed. The paper covers the magnet system quench analysis using the OPERA3d Quench code.

  19. Control Surveys for Underground Construction of the Superconducting Super Collider

    Energy Technology Data Exchange (ETDEWEB)

    Greening, W.J.Trevor; Robinson, Gregory L.; /Measurment Science Inc.; Robbins, Jeffrey S.; Ruland, Robert E.; /SLAC

    2005-08-16

    Particular care had to be taken in the design and implementation of the geodetic control systems for the Superconducting Super Collider (SSC) due to stringent accuracy requirements, the demanding tunneling schedule, long duration and large size of the construction effort of the project. The surveying requirements and the design and implementation of the surface and underground control scheme for the precise location of facilities which include approximately 120 km of bored tunnel are discussed. The methodology used for the densification of the surface control networks, the technique used for the transfer of horizontal and vertical control into the underground facilities, and the control traverse scheme employed in the tunnels is described.

  20. Control Surveys for Underground Construction of the Superconducting Super Collider

    Energy Technology Data Exchange (ETDEWEB)

    Greening, W.J.Trevor; Robinson, Gregory L.; /Measurment Science Inc.; Robbins, Jeffrey S.; Ruland, Robert E.; /SLAC

    2005-08-16

    Particular care had to be taken in the design and implementation of the geodetic control systems for the Superconducting Super Collider (SSC) due to stringent accuracy requirements, the demanding tunneling schedule, long duration and large size of the construction effort of the project. The surveying requirements and the design and implementation of the surface and underground control scheme for the precise location of facilities which include approximately 120 km of bored tunnel are discussed. The methodology used for the densification of the surface control networks, the technique used for the transfer of horizontal and vertical control into the underground facilities, and the control traverse scheme employed in the tunnels is described.

  1. Best practices: Strategic stigma change (SSC): five principles for social marketing campaigns to reduce stigma.

    Science.gov (United States)

    Corrigan, Patrick W

    2011-08-01

    This column describes strategic stigma change (SSC), which comprises five principles and corresponding practices developed as a best practice to erase prejudice and discrimination associated with mental illness and promote affirming behaviors and social inclusion. SSC principles represent more than ten years of insights from the National Consortium on Stigma and Empowerment. The principles, which are centered on consumer contact that is targeted, local, credible, and continuous, were developed to inform the growth of large-scale social marketing campaigns supported by governments and nongovernmental organizations. Future social marketing efforts to address stigma and the need for evidence to determine SSC's penetration and impact are also discussed.

  2. High field superconducting magnets

    Science.gov (United States)

    Hait, Thomas P. (Inventor); Shirron, Peter J. (Inventor)

    2011-01-01

    A superconducting magnet includes an insulating layer disposed about the surface of a mandrel; a superconducting wire wound in adjacent turns about the mandrel to form the superconducting magnet, wherein the superconducting wire is in thermal communication with the mandrel, and the superconducting magnet has a field-to-current ratio equal to or greater than 1.1 Tesla per Ampere; a thermally conductive potting material configured to fill interstices between the adjacent turns, wherein the thermally conductive potting material and the superconducting wire provide a path for dissipation of heat; and a voltage limiting device disposed across each end of the superconducting wire, wherein the voltage limiting device is configured to prevent a voltage excursion across the superconducting wire during quench of the superconducting magnet.

  3. Theory of superconductivity

    CERN Document Server

    Crisan, Mircea

    1989-01-01

    This book discusses the most important aspects of the theory. The phenomenological model is followed by the microscopic theory of superconductivity, in which modern formalism of the many-body theory is used to treat most important problems such as superconducting alloys, coexistence of superconductivity with the magnetic order, and superconductivity in quasi-one-dimensional systems. It concludes with a discussion on models for exotic and high temperature superconductivity. Its main aim is to review, as complete as possible, the theory of superconductivity from classical models and methods up t

  4. Increasing NASA SSC Range Safety by Developing the Framework to Monitor Airspace and Enforce Restrictions Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Engine testing at NASA SSC poses a significant risk to general aviation due to potential smoke and excessive turbulence. The airspace over Stennis has been...

  5. Development of Deformation-Semisolid-Casting (D-SSC) Process and Applications to Some Aluminum Alloys

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Recent advances in the semisolid casting technologies are introduced for aluminum alloys. The advantages of the rheocast and thixocast methods to fabricate alloys with refined spheroidized α-Al particles are described.The deformation-semisolid-casting (D-SSC) process developed by the author's group is presented. The D-SSC process is extremely effective to produce microstructures of refined intermetallic compound particles as well as the spheroidized α-Al particles in the Al-Si based alloys containing highly concentrated Fe. In the D-SSC processed Al-Si-Cu alloy high elongation of about 20% was achieved even contained concentrated impurity of Fe. The D-SSC process is also useful to produce wrought aluminum alloys with microstructures of refined α-Al particles.

  6. Obtaining slow beam spills at the SSC collider

    Energy Technology Data Exchange (ETDEWEB)

    Ritson, D.

    1993-08-01

    There is substantial interest in providing slow-spill external proton beams in parallel with ``interaction running`` at the 20 TeV SSC collider. The proposal is to cause a flux of particles to impinge on a target consisting of a bent crystal extraction channel. Additionally, a slow spill onto a conventional internal target could be used as a source of secondary beams for physics or test purposes and might also be used for B-physics as proposed for HERA. The ``natural`` beam loss rates from elastic and diffractive beam gas scattering and IP collisions are not sufficient to provide suitably intense external proton beams. To prevent loss of luminosity, the rf excitation is non-linear and preferentially blows up the halo of the beam. The ``target`` is to be located at a region of high dispersion forcing particles at the edge of the momentum space onto the target. T. Lohse in this workshop has described a proposed internal target to be used at HERA that will not employ rf excitation but will use the finite loss rates observed at the HERA machine. The Hera losses are caused by a variety of sources in addition to beam gas scattering or IP interactions. Initially, the beam lifetime at HERA was too short to obtain satisfactory integrated luminosities. Subsequently, through careful attention to detail, the beam lifetime was increased to > 20 hours. Even with these changes, present loss rates provide the required intensity onto an internal target. The Tevatron and SPS proton anti-proton colliders have had similar experiences with their investigations of loss rates and also find that beam lifetimes may be substantially shorter than expected solely from beam gas and IP interactions. This paper proposes deliberately introducing controlled errors li

  7. Advanced thermohydraulic simulation code for pool-type LMFBRs (SSC-P code)

    Energy Technology Data Exchange (ETDEWEB)

    Madni, I.K.; Cazzoli, E.G.

    1980-09-01

    Models for components and processes that are needed for simulation of thermohydraulic transient in a pool-type liquid metal fast breeder reactor (LMFBR) plant are described in this report. A computer code, SSC-P, has been developed as a part of the Super System Code (SSC) development project. A user's manual is being prepared as a separate document. 27 refs., 26 figs., 1 tab.

  8. Development of the component models for the KALIMER safety analysis code SSC-K

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Young Min; Lee, Yong Bum; Chang, Won Pyo [Korea Atomic Energy Research Institute, Taejon (Korea)

    1999-05-01

    The SSC-K code is intended to simulate system responses to operational transients or accidents of the pool-type KALIMER (Korea Advanced Liquid Metal Reactor). As a part of the SSC-K development task, some primary component models have been developed and generalized correlations were recommended based on the technical review. Plant modules for the PSDRS, EMP were developed based on the analytical models. The IHX model of SSC-L was modified to take into account the thermo-hydraulic characteristics of pool. Correlations used for piping and in-core assemblies were reviewed and user options were provided for SSC-K. The merged version of SSC-K with PSDRE program was proved out to be valid by test run of ULOHS. The developed component models will be implemented into the SSC-K code and options will be provided for user to select proper correlations for friction factor and heat transfer coefficients. 30 refs., 31 figs., 9 tabs. (Author)

  9. Injection and extraction computer control system HIRFL-SSC The HIRFL-SSC is stated for Heavy Ion Research Facility of Lanzhou-Separated Sector Cyclotron

    CERN Document Server

    Zhang Wei; Chen Yun; Zhang Xia; Hu Jian Jun; Xu Xing Ming

    2002-01-01

    The injection and extraction computer control system of HIRFL-SSC (Heavy Ion Research Facility of Lanzhou-Separated Sector Cyclotron) have been introduced. Software is described briefly. Hardware structure is mainly presented. The computer control system realize that the adjustment of injection and extraction can done by PC and operate interface is Windows style. The system can make the adjustment convenient and veracious

  10. Simple Superconducting "Permanent" Electromagnet

    Science.gov (United States)

    Israelson, Ulf E.; Strayer, Donald M.

    1992-01-01

    Proposed short tube of high-temperature-superconducting material like YBa2Cu3O7 acts as strong electromagnet that flows as long as magnetic field remains below critical value and temperature of cylinder maintained sufficiently below superconducting-transition temperature. Design exploits maximally anisotropy of high-temperature-superconducting material.

  11. Basic principle of superconductivity

    OpenAIRE

    De Cao, Tian

    2007-01-01

    The basic principle of superconductivity is suggested in this paper. There have been two vital wrong suggestions on the basic principle, one is the relation between superconductivity and the Bose-Einstein condensation (BEC), and another is the relation between superconductivity and pseudogap.

  12. Superconductivity in Medicine

    Science.gov (United States)

    Alonso, Jose R.; Antaya, Timothy A.

    2012-01-01

    Superconductivity is playing an increasingly important role in advanced medical technologies. Compact superconducting cyclotrons are emerging as powerful tools for external beam therapy with protons and carbon ions, and offer advantages of cost and size reduction in isotope production as well. Superconducting magnets in isocentric gantries reduce their size and weight to practical proportions. In diagnostic imaging, superconducting magnets have been crucial for the successful clinical implementation of magnetic resonance imaging. This article introduces each of those areas and describes the role which superconductivity is playing in them.

  13. Enhanced superconductivity of fullerenes

    Energy Technology Data Exchange (ETDEWEB)

    Washington, II, Aaron L.; Teprovich, Joseph A.; Zidan, Ragaiy

    2017-06-20

    Methods for enhancing characteristics of superconductive fullerenes and devices incorporating the fullerenes are disclosed. Enhancements can include increase in the critical transition temperature at a constant magnetic field; the existence of a superconducting hysteresis over a changing magnetic field; a decrease in the stabilizing magnetic field required for the onset of superconductivity; and/or an increase in the stability of superconductivity over a large magnetic field. The enhancements can be brought about by transmitting electromagnetic radiation to the superconductive fullerene such that the electromagnetic radiation impinges on the fullerene with an energy that is greater than the band gap of the fullerene.

  14. Superconducting microfabricated ion traps

    CERN Document Server

    Wang, Shannon X; Labaziewicz, Jaroslaw; Dauler, Eric; Berggren, Karl; Chuang, Isaac L

    2010-01-01

    We fabricate superconducting ion traps with niobium and niobium nitride and trap single 88Sr ions at cryogenic temperatures. The superconducting transition is verified and characterized by measuring the resistance and critical current using a 4-wire measurement on the trap structure, and observing change in the rf reflection. The lowest observed heating rate is 2.1(3) quanta/sec at 800 kHz at 6 K and shows no significant change across the superconducting transition, suggesting that anomalous heating is primarily caused by noise sources on the surface. This demonstration of superconducting ion traps opens up possibilities for integrating trapped ions and molecular ions with superconducting devices.

  15. Superconducting material development

    Science.gov (United States)

    1987-09-01

    A superconducting compound was developed that showed a transition to a zero-resistance state at 65 C, or 338 K. The superconducting material, which is an oxide based on strontium, barium, yttrium, and copper, continued in the zero-resistance state similar to superconductivity for 10 days at room temperature in the air. It was also noted that measurements of the material allowed it to observe a nonlinear characteristic curve between current and voltage at 65 C, which is another indication of superconductivity. The research results of the laboratory experiment with the superconducting material will be published in the August edition of the Japanese Journal of Applied Physics.

  16. Protective link for superconducting coil

    Science.gov (United States)

    Umans, Stephen D.

    2009-12-08

    A superconducting coil system includes a superconducting coil and a protective link of superconducting material coupled to the superconducting coil. A rotating machine includes first and second coils and a protective link of superconducting material. The second coil is operable to rotate with respect to the first coil. One of the first and second coils is a superconducting coil. The protective link is coupled to the superconducting coil.

  17. Superconductivity in transition metals.

    Science.gov (United States)

    Slocombe, Daniel R; Kuznetsov, Vladimir L; Grochala, Wojciech; Williams, Robert J P; Edwards, Peter P

    2015-03-13

    A qualitative account of the occurrence and magnitude of superconductivity in the transition metals is presented, with a primary emphasis on elements of the first row. Correlations of the important parameters of the Bardeen-Cooper-Schrieffer theory of superconductivity are highlighted with respect to the number of d-shell electrons per atom of the transition elements. The relation between the systematics of superconductivity in the transition metals and the periodic table high-lights the importance of short-range or chemical bonding on the remarkable natural phenomenon of superconductivity in the chemical elements. A relationship between superconductivity and lattice instability appears naturally as a balance and competition between localized covalent bonding and so-called broken covalency, which favours d-electron delocalization and superconductivity. In this manner, the systematics of superconductivity and various other physical properties of the transition elements are related and unified.

  18. Review of project definition studies of possible on-site uses of superconducting super collider assets and facilities. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-12-01

    This document reports on the results of a peer review and evaluation of studies made of potential uses of assets from the terminated Superconducting Super Collider (SSC) project. These project definition studies focused on nine areas of use of major assets and facilities at the SSC site near Waxahachie, Texas. The studies were undertaken as part of the effort to maximize the value of the investment made in the SSC and were supported by two sets of grants, one to the Texas National Research Laboratory Commission (TNRLC) and the second to various universities and other institutions for studies of ideas raised by a public call for expressions of interest. The Settlement Agreement, recently signed by the Department of Energy (DOE) and TNRLC, provides for a division of SSC property. As part of the goal of maximizing the value of the SSC investment, the findings contained in this report are thus addressed to officials in both the Department and TNRLC. In addition, this review had several other goals: to provide constructive feedback to those doing the studies; to judge the benefits and feasibility (including funding prospects) of the projects studied; and to help worthy projects become reality by matching projects with possible funding sources.

  19. Review of project definition studies of possible on-site uses of superconducting super collider assets and facilities

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-12-01

    This document reports on the results of a peer review and evaluation of studies made of potential uses of assets from the terminated Superconducting Super Collider (SSC) project. These project definition studies focused on nine areas of use of major assets and facilities at the SSC site near Waxahachie, Texas. The studies were undertaken as part of the effort to maximize the value of the investment made in the SSC and were supported by two sets of grants, one to the Texas National Research Laboratory Commission (TNRLC) and the second to various universities and other institutions for studies of ideas raised by a public call for expressions of interest. The Settlement Agreement, recently signed by the Department of Energy (DOE) and TNRLC, provides for a division of SSC property. As part of the goal of maximizing the value of the SSC investment, the findings contained in this report are thus addressed to officials in both the Department and TNRLC. In addition, this review had several other goals: to provide constructive feedback to those doing the studies; to judge the benefits and feasibility (including funding prospects) of the projects studied; and to help worthy projects become reality by matching projects with possible funding sources.

  20. Advanced thermohydraulic simulation code for transients in LMFBRs (SSC-L code)

    Energy Technology Data Exchange (ETDEWEB)

    Agrawal, A.K.

    1978-02-01

    Physical models for various processes that are encountered in preaccident and transient simulation of thermohydraulic transients in the entire liquid metal fast breeder reactor (LMFBR) plant are described in this report. A computer code, SSC-L, was written as a part of the Super System Code (SSC) development project for the ''loop''-type designs of LMFBRs. This code has the self-starting capability, i.e., preaccident or steady-state calculations are performed internally. These results then serve as the starting point for the transient simulation.

  1. From mobile ADCP to high-resolution SSC: a cross-section calibration tool

    Science.gov (United States)

    Boldt, Justin A.

    2015-01-01

    Sediment is a major cause of stream impairment, and improved sediment monitoring is a crucial need. Point samples of suspended-sediment concentration (SSC) are often not enough to provide an understanding to answer critical questions in a changing environment. As technology has improved, there now exists the opportunity to obtain discrete measurements of SSC and flux while providing a spatial scale unmatched by any other device. Acoustic instruments are ubiquitous in the U.S. Geological Survey (USGS) for making streamflow measurements but when calibrated with physical sediment samples, they may be used for sediment measurements as well. The acoustic backscatter measured by an acoustic Doppler current profiler (ADCP) has long been known to correlate well with suspended sediment, but until recently, it has mainly been qualitative in nature. This new method using acoustic surrogates has great potential to leverage the routine data collection to provide calibrated, quantitative measures of SSC which hold promise to be more accurate, complete, and cost efficient than other methods. This extended abstract presents a method for the measurement of high spatial and temporal resolution SSC using a down-looking, mobile ADCP from discrete cross-sections. The high-resolution scales of sediment data are a primary advantage and a vast improvement over other discrete methods for measuring SSC. Although acoustic surrogate technology using continuous, fixed-deployment ADCPs (side-looking) is proven, the same methods cannot be used with down-looking ADCPs due to the fact that the SSC and particle-size distribution variation in the vertical profile violates theory and complicates assumptions. A software tool was developed to assist in using acoustic backscatter from a down-looking, mobile ADCP as a surrogate for SSC. This tool has a simple graphical user interface that loads the data, assists in the calibration procedure, and provides data visualization and output options. This tool

  2. Frontiers in Superconducting Materials

    CERN Document Server

    Narlikar, Anant V

    2005-01-01

    Frontiers in Superconducting Materials gives a state-of-the-art report of the most important topics of the current research in superconductive materials and related phenomena. It comprises 30 chapters written by renowned international experts in the field. It is of central interest to researchers and specialists in Physics and Materials Science, both in academic and industrial research, as well as advanced students. It also addresses electronic and electrical engineers. Even non-specialists interested in superconductivity might find some useful answers.

  3. Superconducting energy recovery linacs

    Science.gov (United States)

    Ben-Zvi, Ilan

    2016-10-01

    High-average-power and high-brightness electron beams from a combination of laser photocathode electron guns and a superconducting energy recovery linac (ERL) is an emerging accelerator science with applications in ERL light sources, high repetition rate free electron lasers , electron cooling, electron ion colliders and more. This paper reviews the accelerator physics issues of superconducting ERLs, discusses major subsystems and provides a few examples of superconducting ERLs.

  4. High-Temperature Superconductivity

    Science.gov (United States)

    Tanaka, Shoji

    2006-12-01

    A general review on high-temperature superconductivity was made. After prehistoric view and the process of discovery were stated, the special features of high-temperature superconductors were explained from the materials side and the physical properties side. The present status on applications of high-temperature superconductors were explained on superconducting tapes, electric power cables, magnets for maglev trains, electric motors, superconducting quantum interference device (SQUID) and single flux quantum (SFQ) devices and circuits.

  5. Fundamentals of Superconducting Nanoelectronics

    CERN Document Server

    Sidorenko, Anatolie

    2011-01-01

    This book demonstrates how the new phenomena in superconductivity on the nanometer scale (FFLO state, triplet superconductivity, Crossed Andreev Reflection, synchronized generation etc.) serve as the basis for the invention and development of novel nanoelectronic devices and systems. It demonstrates how rather complex ideas and theoretical models, like odd-pairing, non-uniform superconducting state, pi-shift etc., adequately describe the processes in real superconducting nanostructues and novel devices based on them. The book is useful for a broad audience of readers, researchers, engineers, P

  6. Superconductive imaging surface magnetometer

    Science.gov (United States)

    Overton, Jr., William C.; van Hulsteyn, David B.; Flynn, Edward R.

    1991-01-01

    An improved pick-up coil system for use with Superconducting Quantum Interference Device gradiometers and magnetometers involving the use of superconducting plates near conventional pick-up coil arrangements to provide imaging of nearby dipole sources and to deflect environmental magnetic noise away from the pick-up coils. This allows the practice of gradiometry and magnetometry in magnetically unshielded environments. One embodiment uses a hemispherically shaped superconducting plate with interior pick-up coils, allowing brain wave measurements to be made on human patients. another embodiment using flat superconducting plates could be used in non-destructive evaluation of materials.

  7. Superconducting optical modulator

    Science.gov (United States)

    Bunt, Patricia S.; Ference, Thomas G.; Puzey, Kenneth A.; Tanner, David B.; Tache, Nacira; Varhue, Walter J.

    2000-12-01

    An optical modulator based on the physical properties of high temperature superconductors has been fabricated and tested. The modulator was constructed form a film of Yttrium Barium Copper Oxide (YBCO) grown on undoped silicon with a buffer layer of Yttria Stabilized Zirconia. Standard lithographic procedures were used to pattern the superconducting film into a micro bridge. Optical modulation was achieved by passing IR light through the composite structure normal to the micro bridge and switching the superconducting film in the bridge region between the superconducting and non-superconducting states. In the superconducting state, IR light reflects from the superconducting film surface. When a critical current is passed through the micro bridge, it causes the film in this region to switch to the non-superconducting state allowing IR light to pass through it. Superconducting materials have the potential to switch between these two states at speeds up to 1 picosecond using electrical current. Presently, fiber optic transmission capacity is limited by the rate at which optical data can be modulated. The superconducting modulator, when combined with other components, may have the potential to increase the transmission capacity of fiber optic lines.

  8. Basic Study of Superconductive Actuator

    OpenAIRE

    涌井, 和也; 荻原, 宏康

    2000-01-01

    There are two kinds of electromagnetic propulsion ships : a superconductive electromagnetic propulsion ship and a superconductive electricity propulsion ship. A superconductive electromagnetic propulsion ship uses the electromagnetic force (Lorenz force) by the interaction between a magnetic field and a electric current. On the other hand, a superconductive electricity propulsion ship uses screws driven by a superconductive motor. A superconductive propulsion ship technique has the merits of ...

  9. Central and Eastern United States (CEUS) Seismic Source Characterization (SSC) for Nuclear Facilities Project

    Energy Technology Data Exchange (ETDEWEB)

    Kevin J. Coppersmith; Lawrence A. Salomone; Chris W. Fuller; Laura L. Glaser; Kathryn L. Hanson; Ross D. Hartleb; William R. Lettis; Scott C. Lindvall; Stephen M. McDuffie; Robin K. McGuire; Gerry L. Stirewalt; Gabriel R. Toro; Robert R. Youngs; David L. Slayter; Serkan B. Bozkurt; Randolph J. Cumbest; Valentina Montaldo Falero; Roseanne C. Perman' Allison M. Shumway; Frank H. Syms; Martitia (Tish) P. Tuttle

    2012-01-31

    This report describes a new seismic source characterization (SSC) model for the Central and Eastern United States (CEUS). It will replace the Seismic Hazard Methodology for the Central and Eastern United States, EPRI Report NP-4726 (July 1986) and the Seismic Hazard Characterization of 69 Nuclear Plant Sites East of the Rocky Mountains, Lawrence Livermore National Laboratory Model, (Bernreuter et al., 1989). The objective of the CEUS SSC Project is to develop a new seismic source model for the CEUS using a Senior Seismic Hazard Analysis Committee (SSHAC) Level 3 assessment process. The goal of the SSHAC process is to represent the center, body, and range of technically defensible interpretations of the available data, models, and methods. Input to a probabilistic seismic hazard analysis (PSHA) consists of both seismic source characterization and ground motion characterization. These two components are used to calculate probabilistic hazard results (or seismic hazard curves) at a particular site. This report provides a new seismic source model. Results and Findings The product of this report is a regional CEUS SSC model. This model includes consideration of an updated database, full assessment and incorporation of uncertainties, and the range of diverse technical interpretations from the larger technical community. The SSC model will be widely applicable to the entire CEUS, so this project uses a ground motion model that includes generic variations to allow for a range of representative site conditions (deep soil, shallow soil, hard rock). Hazard and sensitivity calculations were conducted at seven test sites representative of different CEUS hazard environments. Challenges and Objectives The regional CEUS SSC model will be of value to readers who are involved in PSHA work, and who wish to use an updated SSC model. This model is based on a comprehensive and traceable process, in accordance with SSHAC guidelines in NUREG/CR-6372, Recommendations for Probabilistic

  10. ATPase domain and interdomain linker play a key role in aggregation of mitochondrial Hsp70 chaperone Ssc1.

    Science.gov (United States)

    Blamowska, Marta; Sichting, Martin; Mapa, Koyeli; Mokranjac, Dejana; Neupert, Walter; Hell, Kai

    2010-02-12

    The co-chaperone Hep1 is required to prevent the aggregation of mitochondrial Hsp70 proteins. We have analyzed the interaction of Hep1 with mitochondrial Hsp70 (Ssc1) and the determinants in Ssc1 that make it prone to aggregation. The ATPase and peptide binding domain (PBD) of Hsp70 proteins are connected by a linker segment that mediates interdomain communication between the domains. We show here that the minimal Hep1 binding entity of Ssc1 consists of the ATPase domain and the interdomain linker. In the absence of Hep1, the ATPase domain with the interdomain linker had the tendency to aggregate, in contrast to the ATPase domain with the mutated linker segment or without linker, and in contrast to the PBD. The closest homolog of Ssc1, bacterial DnaK, and a Ssc1 chimera, in which a segment of the ATPase domain of Ssc1 was replaced by the corresponding segment from DnaK, did not aggregate in Delta hep1 mitochondria. The propensity to aggregate appears to be a specific property of the mitochondrial Hsp70 proteins. The ATPase domain in combination with the interdomain linker is crucial for aggregation of Ssc1. In conclusion, our results suggest that interdomain communication makes Ssc1 prone to aggregation. Hep1 counteracts aggregation by binding to this aggregation-prone conformer.

  11. Particle-in-cell mode beam dynamics simulation of the low energy beam transport for the SSC-linac injector

    Institute of Scientific and Technical Information of China (English)

    XIAO Chen; HE Yuan; YUAN You-Jin; YAO Qing-Gao; WANG Zhi-Jun; CHANG Wei; LIU Yong; XIA Jia-Wen

    2011-01-01

    A new SSC-linac system (injector into separated sector cyclotron) is being designed in the HIRFL (heavy ion research facility of Lanzhou). As part of SSC-Linac, the LEBT (low energy beam transport) consists of seven solenoids, four quadrupoles, a bending

  12. Beam dynamics simulation of HEBT for the SSC-linac injector

    Institute of Scientific and Technical Information of China (English)

    LI Xiao-Ni; YUAN You-Jin; XIAO Chen; HE Yuan; WANG Zhi-Jun; SHENG Li-Na

    2012-01-01

    The SSC-linac (a new injector for the Separated Sector Cyclotron) is being designed in the HIRFL (Heavy Ion Research Facility in Lanzhou) system to accelerate 238U34+ from 3.72 keV/u to 1.008 MeV/u.As a part of the SSC-linac injector,the HEBT (high energy beam transport) has been designed by using the TRACE-3D code and simulated by the 3D PIC (particle-in-cell) Track code.The total length of the HEBT is about 12 meters and a beam line of about 6 meters are shared with the exiting beam line of the HIRFL system.The simulation results show that the particles can be delivered efficiently in the HEBT and the particles at the exit of the HEBT well match the acceptance of the SSC for further acceleration.The dispersion is eliminated absolutely in the HEBT.The space-charge effect calculated by the Track code is inconspicuous.According to the simulation,more than 60 percent of the particles from the ion source can be transported into the acceptance of the SSC.

  13. Mechanism underlying formation of SSC in optical glass due to dynamic impact of single diamond scratch

    Institute of Scientific and Technical Information of China (English)

    陈江; 赵航; 张飞虎; 张元晶; 张勇

    2015-01-01

    During the grinding of optical glass, the abrasion directly affects the morphology and depth of subsurface cracks (SSC). The effect of dynamic impact of grinding abrasives on optical glass is an important issue in the field of optics manufacturing. In this work, a single diamond scratch was used to grind optical glass, and grinding parameters were collaboratively controlled to ensure that the cutting layer remained constant. A dynamometer was used to record the duration of the impact process, and the cross-section of the test piece was polished for scanning electron microscopy (SEM) to determine the depth of the SSCs. The experimental results show that as wheel speed increases, SSC depth tends to decrease. When the wheel speed gradually increases from 500 r/min to 2500 r/min, the probability distribution curve for the maximum SSC depth shifts downward by around 80 µm. The effect of the dynamic impact of single diamond scratch is found to be an important cause of SSC formation in optical glass during grinding, i.e., the faster the grinding, the shallower the SSCs.

  14. Mechanism underlying formation of SSC in optical glass due to dynamic impact of single diamond scratch

    Institute of Scientific and Technical Information of China (English)

    陈江; 赵航; 张飞虎; 张元晶; 张勇

    2015-01-01

    During the grinding of optical glass, the abrasion directly affects the morphology and depth of subsurface cracks(SSC). The effect of dynamic impact of grinding abrasives on optical glass is an important issue in the field of optics manufacturing. In this work, a single diamond scratch was used to grind optical glass, and grinding parameters were collaboratively controlled to ensure that the cutting layer remained constant. A dynamometer was used to record the duration of the impact process, and the cross-section of the test piece was polished for scanning electron microscopy(SEM) to determine the depth of the SSCs. The experimental results show that as wheel speed increases, SSC depth tends to decrease. When the wheel speed gradually increases from 500 r/min to 2500 r/min, the probability distribution curve for the maximum SSC depth shifts downward by around 80 μm. The effect of the dynamic impact of single diamond scratch is found to be an important cause of SSC formation in optical glass during grinding, i.e., the faster the grinding, the shallower the SSCs.

  15. New insight into the SSC8 genetic determination of fatty acid composition in pigs

    NARCIS (Netherlands)

    Revilla, M.; Ramayo-Caldas, Y.; Castello, A.; Corominas, J.; Puig-Oliveras, A.; Ibanez-Escriche, N.; Munoz, M.; Ballester, M.; Folch, J.M.

    2014-01-01

    BACKGROUND: Fat content and fatty acid composition in swine are becoming increasingly studied because of their effect on sensory and nutritional quality of meat. A QTL (quantitative trait locus) for fatty acid composition in backfat was previously detected on porcine chromosome 8 (SSC8) in an Iberia

  16. Tunnel visions the rise and fall of the Superconducting Super Collider

    CERN Document Server

    Riordan, Michael; Kolb, Adrienne W

    2015-01-01

    Starting in the 1950s, US physicists dominated the search for elementary particles; aided by the association of this research with national security, they held this position for decades. In an effort to maintain their hegemony and track down the elusive Higgs boson, they convinced President Reagan and Congress to support construction of the multibillion-dollar Superconducting Super Collider project in Texas-the largest basic-science project ever attempted. But after the Cold War ended and the estimated SSC cost surpassed ten billion dollars, Congress terminated the project in October 1993. Drawing on extensive archival research, contemporaneous press accounts, and over one hundred interviews with scientists, engineers, government officials, and others involved, Tunnel Visions tells the riveting story of the aborted SSC project. The authors examine the complex, interrelated causes for its demise, including problems of large-project management, continuing cost overruns, and lack of foreign contributions. In doi...

  17. Graphene: Carbon's superconducting footprint

    Science.gov (United States)

    Vafek, Oskar

    2012-02-01

    Graphene exhibits many extraordinary properties, but superconductivity isn't one of them. Two theoretical studies suggest that by decorating the surface of graphene with the right species of dopant atoms, or by using ionic liquid gating, superconductivity could yet be induced.

  18. Superconducting cavities for LEP

    CERN Multimedia

    1983-01-01

    Above: a 350 MHz superconducting accelerating cavity in niobium of the type envisaged for accelerating electrons and positrons in later phases of LEP. Below: a small 1 GHz cavity used for investigating the surface problems of superconducting niobium. Albert Insomby stays on the right. See Annual Report 1983 p. 51.

  19. Academic training: Applied superconductivity

    CERN Multimedia

    2007-01-01

    LECTURE SERIES 17, 18, 19 January from 11.00 to 12.00 hrs Council Room, Bldg 503 Applied Superconductivity : Theory, superconducting Materials and applications E. PALMIERI/INFN, Padova, Italy When hearing about persistent currents recirculating for several years in a superconducting loop without any appreciable decay, one realizes that we are dealing with a phenomenon which in nature is the closest known to the perpetual motion. Zero resistivity and perfect diamagnetism in Mercury at 4.2 K, the breakthrough during 75 years of several hundreds of superconducting materials, the revolution of the "liquid Nitrogen superconductivity"; the discovery of still a binary compound becoming superconducting at 40 K and the subsequent re-exploration of the already known superconducting materials: Nature discloses drop by drop its intimate secrets and nobody can exclude that the last final surprise must still come. After an overview of phenomenology and basic theory of superconductivity, the lectures for this a...

  20. Evaluation of SSC resistance on super 13Cr stainless steel in sour applications

    Energy Technology Data Exchange (ETDEWEB)

    Ueda, Masakatsu; Kushida, Takahiro [Sumitomo Metal Industries, Ltd., Amagasaki (Japan). Iron and Steel Research Labs.; Mori, Tomoki [Sumitomo Metal Industries, Ltd., Wakayama (Japan). Wakayama Steel Works

    1995-10-01

    The super 13Cr martensitic stainless steel consists of low C content below 0.03mass%, 13mass% Cr 5.5mass% Ni and 2mass% Mo and has good resistance of both sulfide stress cracking(SSC) at room temperature and localized corrosion at elevated temperatures compared with conventional 13Cr steel(AISI 420). The buffer solution containing CH{sub 3}COONa-CH{sub 3}COOH with high buffer power has been developed in order to carry out a more exact experiment under a constant pH between 3.0 and 5.5 The effect of H{sub 2}S partial pressure and pH on SSC resistance of the super 13Cr stainless steel was evaluated in the newly developed buffer solution by constant strain method, slow strain rate technique(SSRT) and the cyclic SSRT in which the tensile and compression tests were repeated 15 times at the strain rate of 4 {times} 10{sup {minus}6} s{sup {minus}1} between 0.95 and 0.60 {times} yield strength. The SSC resistance was characterized and quantified by means of correlating H{sub 2}S partial pressure and solution pH. SSRT gave the most severe evaluation for the SSC resistance of all the methods tested because SCC susceptibility in SSRT was evaluated under the plastic deformation condition up to failure. The constant strain tests which are 4 point bent beam test with notch and NACE tensile test according to NACE TM0177-90, and the cyclic SSRT showed almost the same evaluation result. Therefore, the cyclic SSRT was recommended as a very effective quick evaluation method for the SSC resistance of the super 13Cr stainless steel.

  1. A Novel superconducting toroidal field magnet concept using advanced materials

    Science.gov (United States)

    Schwartz, J.

    1992-03-01

    The plasma physics database indicates that two distinct approaches to tokamak design may lead to commercial fusion reactors: low Aspect ratio, high plasma current, relatively low magnetic field devices, and high Aspect ratio, high field devices. The former requires significant enhancements in plasma performance, while the latter depends primarily upon technology development. The key technology for the commercialization of the high-field approach is large, high magnetic field superconducting magnets. In this paper, the physics motivation for the high field approach and key superconducting magnet (SCM) development issues are reviewed. Improved SCM performance may be obtained from improved materials and/or improved engineering. Superconducting materials ranging from NbTi to high- T c oxides are reviewed, demonstrating the broad range of potential superconducting materials. Structural material options are discussed, including cryogenic steel alloys and fiber-reinforced composite materials. Again, the breadth of options is highlighted. The potential for improved magnet engineering is quantified in terms of the Virial Theorem Limit, and two examples of approaches to highly optimized magnet configurations are discussed. The force-reduced concept, which is a finite application of the force-free solutions to Ampere's Law, appear promising for large SCMs but may be limited by the electromagnetics of a fusion plasma. The Solid Superconducting Cylinder (SSC) concept is proposed. This concept combines the unique properties of high- T c superconductors within a low- T c SCM to obtain (1) significant reductions in the structural material volume, (2) a decoupling of the tri-axial (compressive and tensile) stress state, and (3) a demountable TF magnet system. The advantages of this approach are quantified in terms of a 24 T commercial reactor TF magnet system. Significant reductions in the mechanical stress and the TF radial build are demonstrated.

  2. Superconductivity in carbon nanomaterials

    Science.gov (United States)

    Dlugon, Katarzyna

    The purpose of this thesis is to explain the phenomenon of superconductivity in carbon nanomaterials such as graphene, fullerenes and carbon nanotubes. In the introductory chapter, there is a description of superconductivity and how it occurs at critical temperature (Tc) that is characteristic and different to every superconducting material. The discovery of superconductivity in mercury in 1911 by Dutch physicist Heike Kamerlingh Onnes is also mentioned. Different types of superconductors, type I and type II, low and high temperatures superconductors, as well as the BCS theory that was developed in 1957 by Bardeen, Cooper, and Schrieffer, are also described in detail. The BCS theory explains how Cooper's pairs are formed and how they are responsible for the superconducting properties of many materials. The following chapters explain superconductivity in doped fullerenes, graphene and carbon nanotubes, respectively. There is a thorough explanation followed by many examples of different types of carbon nanomaterials in which small changes in chemical structure cause significant changes in superconducting properties. The goal of this research was not only to take into consideration well known carbon based superconductors but also to search for the newest available materials such as the fullerene nanowhiskers discovered quite recently. There is also a presentation of fairly new ideas about inducing superconductivity in a monolayer of graphene which is more challenging than inducing superconductivity in graphite by simply intercalating metal atoms between its graphene sheets. An effort has been taken to look for any available information about carbon nanomaterials that have the potential to superconduct at room temperature, mainly because discovery of such materials would be a real revolution in the modern world, although no such materials have been discovered yet.

  3. Superconductivity in aromatic hydrocarbons

    Energy Technology Data Exchange (ETDEWEB)

    Kubozono, Yoshihiro, E-mail: kubozono@cc.okayama-u.ac.jp [Research Laboratory for Surface Science, Okayama University, Okayama 700-8530 (Japan); Research Center of New Functional Materials for Energy Production, Storage and Transport, Okayama University, Okayama 700-8530 (Japan); Japan Science and Technology Agency, ACT-C, Kawaguchi 332-0012 (Japan); Goto, Hidenori; Jabuchi, Taihei [Research Laboratory for Surface Science, Okayama University, Okayama 700-8530 (Japan); Yokoya, Takayoshi [Research Laboratory for Surface Science, Okayama University, Okayama 700-8530 (Japan); Research Center of New Functional Materials for Energy Production, Storage and Transport, Okayama University, Okayama 700-8530 (Japan); Kambe, Takashi [Department of Physics, Okayama University, Okayama 700-8530 (Japan); Sakai, Yusuke; Izumi, Masanari; Zheng, Lu; Hamao, Shino; Nguyen, Huyen L.T. [Research Laboratory for Surface Science, Okayama University, Okayama 700-8530 (Japan); Sakata, Masafumi; Kagayama, Tomoko; Shimizu, Katsuya [Center of Science and Technology under Extreme Conditions, Osaka University, Osaka 560-8531 (Japan)

    2015-07-15

    Highlights: • Aromatic superconductor is one of core research subjects in superconductivity. Superconductivity is observed in certain metal-doped aromatic hydrocarbons. Some serious problems to be solved exist for future advancement of the research. This article shows the present status of aromatic superconductors. - Abstract: ‘Aromatic hydrocarbon’ implies an organic molecule that satisfies the (4n + 2) π-electron rule and consists of benzene rings. Doping solid aromatic hydrocarbons with metals provides the superconductivity. The first discovery of such superconductivity was made for K-doped picene (K{sub x}picene, five benzene rings). Its superconducting transition temperatures (T{sub c}’s) were 7 and 18 K. Recently, we found a new superconducting K{sub x}picene phase with a T{sub c} as high as 14 K, so we now know that K{sub x}picene possesses multiple superconducting phases. Besides K{sub x}picene, we discovered new superconductors such as Rb{sub x}picene and Ca{sub x}picene. A most serious problem is that the shielding fraction is ⩽15% for K{sub x}picene and Rb{sub x}picene, and it is often ∼1% for other superconductors. Such low shielding fractions have made it difficult to determine the crystal structures of superconducting phases. Nevertheless, many research groups have expended a great deal of effort to make high quality hydrocarbon superconductors in the five years since the discovery of hydrocarbon superconductivity. At the present stage, superconductivity is observed in certain metal-doped aromatic hydrocarbons (picene, phenanthrene and dibenzopentacene), but the shielding fraction remains stubbornly low. The highest priority research area is to prepare aromatic superconductors with a high superconducting volume-fraction. Despite these difficulties, aromatic superconductivity is still a core research target and presents interesting and potentially breakthrough challenges, such as the positive pressure dependence of T{sub c} that is clearly

  4. The superconducting spin valve and triplet superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Garifullin, I.A., E-mail: ilgiz_garifullin@yahoo.com [Zavoisky Physical-Technical Institute, Kazan Scientific Center of Russian Academy of Sciences, 420029 Kazan (Russian Federation); Leksin, P.V.; Garif' yanov, N.N.; Kamashev, A.A. [Zavoisky Physical-Technical Institute, Kazan Scientific Center of Russian Academy of Sciences, 420029 Kazan (Russian Federation); Fominov, Ya.V. [L. D. Landau Institute for Theoretical Physics RAS, 119334 Moscow (Russian Federation); Moscow Institute of Physics and Technology, 141700 Dolgoprudny (Russian Federation); Schumann, J.; Krupskaya, Y.; Kataev, V.; Schmidt, O.G. [Leibniz Institute for Solid State and Materials Research IFW Dresden, D-01171 Dresden (Germany); Büchner, B. [Leibniz Institute for Solid State and Materials Research IFW Dresden, D-01171 Dresden (Germany); Institut für Festkörperphysik, Technische Universität Dresden, D-01062 Dresden (Germany)

    2015-01-01

    A review of our recent results on the spin valve effect is presented. We have used a theoretically proposed spin switch design F1/F2/S comprising a ferromagnetic bilayer (F1/F2) as a ferromagnetic component, and an ordinary superconductor (S) as the second interface component. Based on it we have prepared and studied in detail a set of multilayers CoO{sub x}/Fe1/Cu/Fe2/S (S=In or Pb). In these heterostructures we have realized for the first time a full spin switch effect for the superconducting current, have observed its sign-changing oscillating behavior as a function of the Fe2-layer thickness and finally have obtained direct evidence for the long-range triplet superconductivity arising due to noncollinearity of the magnetizations of the Fe1 and Fe2 layers. - Highlights: • We studied a spin switch design F1/F2/S. • We prepared a set of multilayers CoOx/Fe1/Cu/Fe2/S (S=In or Pb). • The full spin switch effect for the superconducting current was realized. • We observed its oscillating behavior as a function of the Fe2-layer thickness. • We obtained direct evidence for the long-range triplet superconductivity.

  5. Tunneling in superconducting structures

    Science.gov (United States)

    Shukrinov, Yu. M.

    2010-12-01

    Here we review our results on the breakpoint features in the coupled system of IJJ obtained in the framework of the capacitively coupled Josephson junction model with diffusion current. A correspondence between the features in the current voltage characteristics (CVC) and the character of the charge oscillations in superconducting layers is demonstrated. Investigation of the correlations of superconducting currents in neighboring Josephson junctions and the charge correlations in neighboring superconducting layers reproduces the features in the CVC and gives a powerful method for the analysis of the CVC of coupled Josephson junctions. A new method for determination of the dissipation parameter is suggested.

  6. Superconductivity in doped insulators

    Energy Technology Data Exchange (ETDEWEB)

    Emery, V.J. [Brookhaven National Lab., Upton, NY (United States); Kivelson, S.A. [California Univ., Los Angeles, CA (United States). Dept. of Physics

    1995-12-31

    It is shown that many synthetic metals, including high temperature superconductors are ``bad metals``, with such a poor conductivity that the usual meanfield theory of superconductivity breaks down because of anomalously large classical and quantum fluctuations of the phase of the superconducting order parameter. It is argued that the supression of a first order phase transition (phase separation) by the long-range Coulomb interaction leads to high temperature superconductivity accompanied by static or dynamical charge inhomogeneIty. Evidence in support of this picture for high temperature superconductors is described.

  7. Short sample testing facility for the Superconducting Super Collider

    Energy Technology Data Exchange (ETDEWEB)

    Zbasnik, J.; Scanlan, R.; Taylor, C.; Peters, C.; Pope, W.; Royet, J. (Lawrence Berkeley Lab., CA (USA))

    1989-06-01

    In this paper we present the system requirements of the apparatus measuring the short sample critical current of the cable for the Superconducting Super Collider (SSC), and the current status of our development work. Key features of the system presented here are: a sample holder which clamps the samples sufficiently well such that no training quenches are required to perform critical current measurements and another which may allow for faster sample mounting; voltage tap boards using a printed-circuit technique which eliminates the necessity of soldering wires for the voltage measurements; a 1-m ling, 5-cm-bore dipole magnet with close-in iron designed to produce 7.5 T with a 6000 A excitation current; and an air-lock system that allows repeated sample changes without the magnet chamber being contaminated with air and other impurities. 7 refs., 6 figs.

  8. A cryogenic test stand for full length SSC magnets with superfluid capability

    Energy Technology Data Exchange (ETDEWEB)

    Peterson, T.J.; Mazur, P.O.

    1989-02-01

    The Fermilab Magnet Test Facility performs testing of the full scale SSC magnets on test stands capable of simulating the cryogenic environment of the SSC main ring. One of these test stands, Stand 5, also has the ability to operate the magnet under test at temperatures from 1.8K to 4.5K with either supercritical helium or subcooled liquid, providing at least 25 Watts of refrigeration. At least 50 g/s flow is available from 2.3K to 4.5K, whereas superfluid operation occurs with zero flow. Cooldown time from 4.5K to 1.8K is 1.5 hours. A maximum current capability of 10,000 amps is provided, as is instrumentation to monitor and control the cryogenic conditions. This paper describes the cryogenic design of this test stand. 8 refs., 6 figs.

  9. Superconducting wind turbine generators

    DEFF Research Database (Denmark)

    Abrahamsen, Asger Bech; Mijatovic, Nenad; Seiler, Eugen

    2010-01-01

    , the main challenge of the superconducting direct drive technology is to prove that the reliability is superior to the alternative drive trains based on gearboxes or permanent magnets. A strategy of successive testing of superconducting direct drive trains in real wind turbines of 10 kW, 100 kW, 1 MW and 10...... offshore turbines of 8 and 10 MW have been determined from an up-scaling of an existing 5 MW turbine and the necessary properties of the superconducting drive train are discussed. We have found that the absence of the gear box is the main benefit and the reduced weight and size is secondary. However...... MW generator and it is concluded that the present production capacity of coated conductors must be increased by a factor of 36 by 2020, resulting in a ten times lower price of the tape in order to reach a realistic price level for the superconducting drive train....

  10. Magnetic and superconducting nanowires

    DEFF Research Database (Denmark)

    Piraux, L.; Encinas, A.; Vila, L.

    2005-01-01

    magnetic and superconducting nanowires. Using different approaches entailing measurements on both single wires and arrays, numerous interesting physical properties have been identified in relation to the nanoscopic dimensions of these materials. Finally, various novel applications of the nanowires are also...

  11. Superconductivity fundamentals and applications

    CERN Document Server

    Buckel, Werner

    2004-01-01

    This is the second English edition of what has become one of the definitive works on superconductivity in German -- currently in its sixth edition. Comprehensive and easy to understand, this introductory text is written especially with the non-specialist in mind. The authors, both long-term experts in this field, present the fundamental considerations without the need for extensive mathematics, describing the various phenomena connected with the superconducting state, with liberal insertion of experimental facts and examples for modern applications. While all fields of superconducting phenomena are dealt with in detail, this new edition pays particular attention to the groundbreaking discovery of magnesium diboride and the current developments in this field. In addition, a new chapter provides an overview of the elements, alloys and compounds where superconductivity has been observed in experiments, together with their major characteristics. The chapter on technical applications has been considerably expanded...

  12. B&W Vertical Test Facility for SSC collider quadrupole magnets

    Energy Technology Data Exchange (ETDEWEB)

    Dixon, K.D.; Billingsly, A.L.; Boyes, D.W.; Cantor, B.I.; Hlasnicek, P.; Kelley, J.P.; Leamon, C.K.; Maloney, J.E.; Pare, G.; Rey, C.M. [Babcock & Wilcox, Lynchburg, VA (United States)] [and others

    1994-12-31

    Developmental or {open_quotes}model{close_quotes} SSC quadrupole cold masses and collared coils are successfully being tested at the Vertical Test Facility (VTF) in Lynchburg, Virginia. Within this facility, a vertical dewar maintains a pool boiling liquid helium environment of 3.85 K to 4.5 K in order to observe the quenching and magnetic field characteristics of these coils. A description of the facility performance and its contents, including the dewar and ancillary equipment, is described hereafter.

  13. Superconductivity and symmetry breaking

    Energy Technology Data Exchange (ETDEWEB)

    Sarasua, L.G., E-mail: sarasua@fisica.edu.uy [Instituto de Fisica, Facultad de Ciencias, Universidad de la Republica, Montevideo (Uruguay)

    2012-02-15

    In the present work we consider the relation between superconductivity and spontaneous gauge symmetry breaking (SGBS). We show that ODLRO does not require in principle SBGS, even in the presence of particle number fluctuations, by examining exact solutions of a fermionic pairing model. The criteria become equivalent if a symmetry breaking field is allowed, which can be attributed to the interaction with the environment. However, superconducting states without SBGS are not forbidden.

  14. Photoemission, Correlation and Superconductivity:

    Science.gov (United States)

    Abrecht, M.; Ariosa, D.; Cloëtta, D.; Pavuna, D.; Perfetti, L.; Grioni, M.; Margaritondo, G.

    We review some of the problems still affecting photoemission as a probe of high-temperature superconductivity, as well as important recent results concerning their solution. We show, in particular, some of the first important results on thin epitaxial films grown by laser ablation, which break the monopoly of cleaved BCSCO in this type of experiments. Such results, obtained on thin LSCO, may have general implications on the theory of high-temperature superconductivity.

  15. Emergent Higgsless Superconductivity

    Directory of Open Access Journals (Sweden)

    Cristina Diamantini M.

    2017-01-01

    Full Text Available We present a new Higgsless model of superconductivity, inspired from anyon superconductivity but P- and T-invariant and generalizable to any dimension. While the original anyon superconductivity mechanism was based on incompressible quantum Hall fluids as average field states, our mechanism involves topological insulators as average field states. In D space dimensions it involves a (D-1-form fictitious pseudovector gauge field which originates from the condensation of topological defects in compact lowenergy effective BF theories. There is no massive Higgs scalar as there is no local order parameter. When electromagnetism is switched on, the photon acquires mass by the topological BF mechanism. Although the charge of the gapless mode (2 and the topological order (4 are the same as those of the standard Higgs model, the two models of superconductivity are clearly different since the origins of the gap, reflected in the high-energy sectors are totally different. In 2D thi! s type of superconductivity is explicitly realized as global superconductivity in Josephson junction arrays. In 3D this model predicts a possible phase transition from topological insulators to Higgsless superconductors.

  16. Superconducting Fullerene Nanowhiskers

    Directory of Open Access Journals (Sweden)

    Yoshihiko Takano

    2012-04-01

    Full Text Available We synthesized superconducting fullerene nanowhiskers (C60NWs by potassium (K intercalation. They showed large superconducting volume fractions, as high as 80%. The superconducting transition temperature at 17 K was independent of the K content (x in the range between 1.6 and 6.0 in K-doped C60 nanowhiskers (KxC60NWs, while the superconducting volume fractions changed with x. The highest shielding fraction of a full shielding volume was observed in the material of K3.3C60NW by heating at 200 °C. On the other hand, that of a K-doped fullerene (K-C60 crystal was less than 1%. We report the superconducting behaviors of our newly synthesized KxC60NWs in comparison to those of KxC60 crystals, which show superconductivity at 19 K in K3C60. The lattice structures are also discussed, based on the x-ray diffraction (XRD analyses.

  17. High temperature interfacial superconductivity

    Science.gov (United States)

    Bozovic, Ivan [Mount Sinai, NY; Logvenov, Gennady [Port Jefferson Station, NY; Gozar, Adrian Mihai [Port Jefferson, NY

    2012-06-19

    High-temperature superconductivity confined to nanometer-scale interfaces has been a long standing goal because of potential applications in electronic devices. The spontaneous formation of a superconducting interface in bilayers consisting of an insulator (La.sub.2CuO.sub.4) and a metal (La.sub.1-xSr.sub.xCuO.sub.4), neither of which is superconducting per se, is described. Depending upon the layering sequence of the bilayers, T.sub.c may be either .about.15 K or .about.30 K. This highly robust phenomenon is confined to within 2-3 nm around the interface. After exposing the bilayer to ozone, T.sub.c exceeds 50 K and this enhanced superconductivity is also shown to originate from a 1 to 2 unit cell thick interfacial layer. The results demonstrate that engineering artificial heterostructures provides a novel, unconventional way to fabricate stable, quasi two-dimensional high T.sub.c phases and to significantly enhance superconducting properties in other superconductors. The superconducting interface may be implemented, for example, in SIS tunnel junctions or a SuFET.

  18. In Orbit Performance of the MAXI/SSC onboard the ISS

    CERN Document Server

    Tsunemi, Hiroshi; Katayama, Haruyoshi; Kimura, Masashi; Daikyuji, Arata; Miyaguchi, Kazuhisa; Maeda, Kentaro

    2011-01-01

    We report here the in orbit performance of the CCD camera (MAXI/SSC) onboard the International Space Station (ISS). It was commissioned in August, 2009. This is the first all-sky survey mission employing X-ray CCDs. It consists of 32 CCDs each of which is 1 inch square. It is a slit camera with a field of view of 1deg.5x 90deg and scans the sky as the rotation of the ISS. The CCD on the SSC is cooled down to the working temperature around -60degC by the combination of the peltier cooler, a loop heat pipe and a radiator. The standard observation mode of the CCD is in a parallel sum mode (64-binning). The CCD functions properly although it suffers an edge glow when the Sun is near the field of view (FOV) which reduces the observation efficiency of the SSC down to about 30%. The performance of the CCD is continuously monitored both by the Mn-K X-rays and by the Cu-K X-rays. There are many sources detected, not only point sources but extended sources. Due to the lack of the effective observation time, we need mor...

  19. Report of the Task Force on SSC Magnet System Test Site

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1984-10-01

    The Task Force on SSC Magnet Systems test Site was appointed by Maury Tigner, Director of the SSC, Phase 1 in August 1984. In brief, the charge asked the Task Force to make a critical evaluation of potential test sites for a major SSC magnet System Test Facility (STF) with regard to: (1) availability of the needed space, utilities, staff and other requirements on the desired time scale; and (2) the cost of preparing the sites for the tests and for operating the facilities during the test period. The charge further suggests that, by virtue of existing facilities and availability of experienced staff, BNL and FNAL are the two best candidate sites and that is therefore appears appropriate to restrict the considerations of the Task Force to these sites. During the subsequent deliberations of the Task Force, no new facts were revealed that altered the assumptions of the charge in this regard. The charge does not ask for a specific site recommendation for the STF. Indeed, an agreement on such a recommendation would be difficult to achieve considering the composition of the Task Force, wherein a large fraction of the membership is drawn from the two contending laboratories. Instead, we have attempted to describe the purpose of the facility, outline a productive test program, list the major facilities required, carefully review the laboratories` responses to the facility requirements, and make objective comparisons of the specific features and capabilities offered.

  20. On the performance analysis of SSC diversity system over η-μ fading channels

    Science.gov (United States)

    Khatalin, Sari

    2016-06-01

    In this paper, we study key performance measures of dual-branch switch-and-stay combining (SSC) system operating in ? fading environment. Specifically, analytical expressions for the kth order moment, average signal-to-noise ratio, amount of fading and outage probability are obtained for an SSC system operating over ? fading channels. Expressions of the average bit error rate (BER) for coherent detection and non-coherent detection were also derived with SSC for various modulation schemes. The BER expressions for the coherent detection case were derived using the moment generating function-based approach. Some of the final expressions are presented in the form of infinite series. Therefore, those series are truncated and upper bounds are derived for truncation errors. Expressions to determine the optimum adaptive switching thresholds are also presented. Corresponding results for Nakagami-q and Nakagami-m fading are derived in this paper as special cases. Numerical results are provided to demonstrate the applications of the new results.

  1. The superconducting spin valve and triplet superconductivity

    Science.gov (United States)

    Garifullin, I. A.; Leksin, P. V.; Garif`yanov, N. N.; Kamashev, A. A.; Fominov, Ya. V.; Schumann, J.; Krupskaya, Y.; Kataev, V.; Schmidt, O. G.; Büchner, B.

    2015-01-01

    A review of our recent results on the spin valve effect is presented. We have used a theoretically proposed spin switch design F1/F2/S comprising a ferromagnetic bilayer (F1/F2) as a ferromagnetic component, and an ordinary superconductor (S) as the second interface component. Based on it we have prepared and studied in detail a set of multilayers CoOx/Fe1/Cu/Fe2/S (S=In or Pb). In these heterostructures we have realized for the first time a full spin switch effect for the superconducting current, have observed its sign-changing oscillating behavior as a function of the Fe2-layer thickness and finally have obtained direct evidence for the long-range triplet superconductivity arising due to noncollinearity of the magnetizations of the Fe1 and Fe2 layers.

  2. Research accomplishments and future goals in particle physics

    Energy Technology Data Exchange (ETDEWEB)

    1990-11-30

    This document presents our proposal to continue the activities of Boston University researchers in high energy physics research. We have a broad program of participation in both non-accelerator and accelerator-based efforts. High energy research at Boston University has a special focus on the physics program of the Superconducting Supercollider. We are active in research and development for detector subsystems, in the design of experiments, and in study of the phenomenology of the very high energy interactions to be observed at the SSC. The particular areas discussed in this paper are: colliding beams physics; accelerator design physics; MACRO project; proton decay project; theoretical particle physics; muon G-2 project; fast liquid scintillators; SSCINTCAL project; TRD project; massively parallel processing for the SSC; and physics analysis and vertex detector upgrade at L3.

  3. Workshop on electroweak symmetry breaking: proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Hinchliffe, I. (ed.)

    1984-10-01

    A theoretical workshop on electroweak symmetry breaking at the Superconducting Supercollider was held at Lawrence Berkeley Laboratory, June 4-22, 1984. The purpose of the workshop was to focus theoretical attention on the ways in which experimentation at the SSC could reveal manifestations of the phenomenon responsible for electroweak symmetry breaking. This issue represents, at present, the most compelling scientific argument for the need to explore the energy region to be made accessible by the SSC, and a major aim of the workshop was to involve a broad cross section of particle theorists in the ongoing process of sharpening the requirements for both accelerator and detector design that will ensure detection and identification of meaningful signals, whatever form the electroweak symmetry breaking phenomenon should actually take. Separate entries were prepared for the data base for the papers presented.

  4. Nanoscience and Engineering in Superconductivity

    CERN Document Server

    Moshchalkov, Victor; Lang, Wolfgang

    2010-01-01

    For emerging energy saving technologies, superconducting materials with superior performance are needed. Such materials can be developed by manipulating the 'elementary building blocks' through nanostructuring. For superconductivity the 'elementary blocks' are Cooper pair and fluxon (vortex). This book presents new ways how to modify superconductivity and vortex matter through nanostructuring and the use of nanoscale magnetic templates. The basic nano-effects, vortex and vortex-antivortex patterns, vortex dynamics, Josephson phenomena, critical currents, and interplay between superconductivity

  5. Interface high-temperature superconductivity

    Science.gov (United States)

    Wang, Lili; Ma, Xucun; Xue, Qi-Kun

    2016-12-01

    Cuprate high-temperature superconductors consist of two quasi-two-dimensional (2D) substructures: CuO2 superconducting layers and charge reservoir layers. The superconductivity is realized by charge transfer from the charge reservoir layers into the superconducting layers without chemical dopants and defects being introduced into the latter, similar to modulation-doping in the semiconductor superlattices of AlGaAs/GaAs. Inspired by this scheme, we have been searching for high-temperature superconductivity in ultra-thin films of superconductors epitaxially grown on semiconductor/oxide substrates since 2008. We have observed interface-enhanced superconductivity in both conventional and unconventional superconducting films, including single atomic layer films of Pb and In on Si substrates and single unit cell (UC) films of FeSe on SrTiO3 (STO) substrates. The discovery of high-temperature superconductivity with a superconducting gap of ∼20 meV in 1UC-FeSe/STO has stimulated tremendous interest in the superconductivity community, for it opens a new avenue for both raising superconducting transition temperature and understanding the pairing mechanism of unconventional high-temperature superconductivity. Here, we review mainly the experimental progress on interface-enhanced superconductivity in the three systems mentioned above with emphasis on 1UC-FeSe/STO, studied by scanning tunneling microscopy/spectroscopy, angle-resolved photoemission spectroscopy and transport experiments. We discuss the roles of interfaces and a possible pairing mechanism inferred from these studies.

  6. Connectivity and superconductivity

    CERN Document Server

    Rubinstein, Jacob

    2000-01-01

    The motto of connectivity and superconductivity is that the solutions of the Ginzburg--Landau equations are qualitatively influenced by the topology of the boundaries, as in multiply-connected samples. Special attention is paid to the "zero set", the set of the positions (also known as "quantum vortices") where the order parameter vanishes. The effects considered here usually become important in the regime where the coherence length is of the order of the dimensions of the sample. It takes the intuition of physicists and the awareness of mathematicians to find these new effects. In connectivity and superconductivity, theoretical and experimental physicists are brought together with pure and applied mathematicians to review these surprising results. This volume is intended to serve as a reference book for graduate students and researchers in physics or mathematics interested in superconductivity, or in the Schrödinger equation as a limiting case of the Ginzburg--Landau equations.

  7. Large Superconducting Magnet Systems

    CERN Document Server

    Védrine, P.

    2014-07-17

    The increase of energy in accelerators over the past decades has led to the design of superconducting magnets for both accelerators and the associated detectors. The use of Nb−Ti superconducting materials allows an increase in the dipole field by up to 10 T compared with the maximum field of 2 T in a conventional magnet. The field bending of the particles in the detectors and generated by the magnets can also be increased. New materials, such as Nb3Sn and high temperature superconductor (HTS) conductors, can open the way to higher fields, in the range 13–20 T. The latest generations of fusion machines producing hot plasma also use large superconducting magnet systems.

  8. Increased frequency and compromised function of T regulatory cells in systemic sclerosis (SSc is related to a diminished CD69 and TGFbeta expression.

    Directory of Open Access Journals (Sweden)

    Timothy R D J Radstake

    Full Text Available BACKGROUND: Regulatory T cells (Tregs are essential in the control of tolerance. Evidence implicates Tregs in human autoimmune conditions. Here we investigated their role in systemic sclerosis (SSc. METHODS/PRINCIPAL FINDINGS: Patients were subdivided as having limited cutaneous SSc (lcSSc, n = 20 or diffuse cutaneous SSc (dcSSc, n = 48. Further subdivision was made between early dcSSc (n = 24 and late dcSSc (n = 24 based upon the duration of disease. 26 controls were studied for comparison. CD3+ cells were isolated using FACS and subsequently studied for the expression of CD4, CD8, CD25, FoxP3, CD127, CD62L, GITR, CD69 using flow cytometry. T cell suppression assays were performed using sorted CD4CD25(highCD127(- and CD4CD25(lowCD127(high and CD3(+ cells. Suppressive function was correlated with CD69 surface expression and TGFbeta secretion/expression. The frequency of CD4(+CD25(+ and CD25(highFoxP3(highCD127(neg T cells was highly increased in all SSc subgroups. Although the expression of CD25 and GITR was comparable between groups, expression of CD62L and CD69 was dramatically lower in SSc patients, which correlated with a diminished suppressive function. Co-incubation of Tregs from healthy donors with plasma from SSc patients fully abrogated suppressive activity. Activation of Tregs from healthy donors or SSc patients with PHA significantly up regulated CD69 expression that could be inhibited by SSc plasma. CONCLUSIONS/SIGNIFICANCE: These results indicate that soluble factors in SSc plasma inhibit Treg function specifically that is associated with altered Treg CD69 and TGFbeta expression. These data suggest that a defective Treg function may underlie the immune dysfunction in systemic sclerosis.

  9. Failed theories of superconductivity

    CERN Document Server

    Schmalian, Joerg

    2010-01-01

    Almost half a century passed between the discovery of superconductivity by Kammerlingh Onnes and the theoretical explanation of the phenomenon by Bardeen, Cooper and Schrieffer. During the intervening years the brightest minds in theoretical physics tried and failed to develop a microscopic understanding of the effect. A summary of some of those unsuccessful attempts to understand superconductivity not only demonstrates the extraordinary achievement made by formulating the BCS theory, but also illustrates that mistakes are a natural and healthy part of the scientific discourse, and that inapplicable, even incorrect theories can turn out to be interesting and inspiring.

  10. Superconducting magnetic quadrupole

    Energy Technology Data Exchange (ETDEWEB)

    Kim, J.W.; Shepard, K.W.; Nolen, J.A.

    1995-08-01

    A design was developed for a 350 T/m, 2.6-cm clear aperture superconducting quadrupole focussing element for use in a very low q/m superconducting linac as discussed below. The quadrupole incorporates holmium pole tips, and a rectangular-section winding using standard commercially-available Nb-Ti wire. The magnet was modeled numerically using both 2D and 3D codes, as a basis for numerical ray tracing using the quadrupole as a linac element. Components for a prototype singlet are being procured during FY 1995.

  11. Fingerprints of Mott Superconductivity

    Institute of Scientific and Technical Information of China (English)

    王强华

    2003-01-01

    We improve a previous theory of doped Mott insulators with duality between pairing and magnetism by a further duality transform. As the result we obtained a quantum Ginzburg-Landau theory describing the Cooper pair condensate and the dual of spin condensate. We address the superconductivity by doping a Mott insulator,which we call the Mott superconductivity. Some fingerprints of such novelty in cuprates are the scaling between neutron resonance energy and superfluid density, and the induced quantized spin moment by vortices or Zn impurity (together with circulating charge super-current to be checked by experiments).

  12. A Bridge Too Far: The Demise of the Superconducting Super Collider, 1989-1993

    Science.gov (United States)

    Riordan, Michael

    2015-04-01

    In October 1993 the US Congress terminated the Superconducting Super Collider -- at over 10 billion the largest and costliest basic-science project ever attempted. It was a disastrous loss for the nation's once-dominant high-energy physics community, which has been slowly declining since then. With the 2012 discovery of the Higgs boson at CERN's Large Hadron Collider, Europe has assumed world leadership in this field. A combination of fiscal austerity, continuing SSC cost overruns, intense Congressional scrutiny, lack of major foreign contributions, waning Presidential support, and the widespread public perception of mismanagement led to the project's demise nearly five years after it had begun. Its termination occurred against the political backdrop of changing scientific needs as US science policy shifted to a post-Cold War footing during the early 1990s. And the growing cost of the SSC inevitably exerted undue pressure upon other worthy research, thus weakening its support in Congress and the broader scientific community. As underscored by the Higgs boson discovery, at a mass substantially below that of the top quark, the SSC did not need to collide protons at 40 TeV in order to attain its premier physics goal. The selection of this design energy was governed more by politics than by physics, given that Europeans could build the LHC by eventually installing superconducting magnets in the LEP tunnel under construction in the mid-1980s. In hindsight, there were good alternative projects the US high-energy physics community could have pursued that did not involve building a gargantuan, multibillion-dollar machine at a green-field site in Texas. Research supported by the National Science Foundation, Department of Energy, and the Richard Lounsbery Foundation.

  13. Superconducting Magnets for Particle Accelerators

    CERN Document Server

    Rossi, L

    2012-01-01

    Superconductivity has been the most influential technology in the field of accelerators in the last 30 years. Since the commissioning of the Tevatron, which demonstrated the use and operability of superconductivity on a large scale, superconducting magnets and rf cavities have been at the heart of all new large accelerators. Superconducting magnets have been the invariable choice for large colliders, as well as cyclotrons and large synchrotrons. In spite of the long history of success, superconductivity remains a difficult technology, requires adequate R&D and suitable preparation, and has a relatively high cost. Hence, it is not surprising that the development has also been marked by a few setbacks. This article is a review of the main superconducting accelerator magnet projects; it highlights the main characteristics and main achievements, and gives a perspective on the development of superconducting magnets for the future generation of very high energy colliders.

  14. Spin-orbit-coupled superconductivity.

    Science.gov (United States)

    Lo, Shun-Tsung; Lin, Shih-Wei; Wang, Yi-Ting; Lin, Sheng-Di; Liang, C-T

    2014-06-25

    Superconductivity and spin-orbit (SO) interaction have been two separate emerging fields until very recently that the correlation between them seemed to be observed. However, previous experiments concerning SO coupling are performed far beyond the superconducting state and thus a direct demonstration of how SO coupling affects superconductivity remains elusive. Here we investigate the SO coupling in the critical region of superconducting transition on Al nanofilms, in which the strength of disorder and spin relaxation by SO coupling are changed by varying the film thickness. At temperatures T sufficiently above the superconducting critical temperature T(c), clear signature of SO coupling reveals itself in showing a magneto-resistivity peak. When T superconductivity. By studying such magneto-resistivity peaks under different strength of spin relaxation, we highlight the important effects of SO interaction on superconductivity.

  15. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  16. Superconducting Technology Assessment

    Science.gov (United States)

    2005-08-01

    of Nb/Al- Nx /NbTiN junctions for SIS mixer applications,” IEEE Trans. Appl. Superconduct., vol. 11, pp. 76–79, Mar. 2001. [48] M. Gurvitch, W. A...Another connector developed by IBM for commercial applications using a dendritic interposer technology. A “beam-on-pad” approach developed by Siemens

  17. Hybrid superconducting neutron detectors

    Energy Technology Data Exchange (ETDEWEB)

    Merlo, V.; Lucci, M.; Ottaviani, I. [Dipartimento di Fisica, Università Tor Vergata, Via della Ricerca Scientifica, I-00133 Roma (Italy); Salvato, M.; Cirillo, M. [Dipartimento di Fisica, Università Tor Vergata, Via della Ricerca Scientifica, I-00133 Roma (Italy); CNR SPIN Salerno, Università di Salerno, Via Giovanni Paolo II, n.132, 84084 Fisciano (Italy); Scherillo, A. [Science and Technology Facility Council, ISIS Facility Chilton, Didcot, Oxfordshire OX11 0QX (United Kingdom); Celentano, G. [ENEA Frascati Research Centre, Via. E. Fermi 45, 00044 Frascati (Italy); Pietropaolo, A., E-mail: antonino.pietropaolo@enea.it [ENEA Frascati Research Centre, Via. E. Fermi 45, 00044 Frascati (Italy); Mediterranean Institute of Fundamental Physics, Via Appia Nuova 31, 00040 Marino, Roma (Italy)

    2015-03-16

    A neutron detection concept is presented that is based on superconductive niobium (Nb) strips coated by a boron (B) layer. The working principle of the detector relies on the nuclear reaction, {sup 10}B + n → α + {sup 7}Li, with α and Li ions generating a hot spot on the current-biased Nb strip which in turn induces a superconducting-normal state transition. The latter is recognized as a voltage signal which is the evidence of the incident neutron. The above described detection principle has been experimentally assessed and verified by irradiating the samples with a pulsed neutron beam at the ISIS spallation neutron source (UK). It is found that the boron coated superconducting strips, kept at a temperature T = 8 K and current-biased below the critical current I{sub c}, are driven into the normal state upon thermal neutron irradiation. As a result of the transition, voltage pulses in excess of 40 mV are measured while the bias current can be properly modulated to bring the strip back to the superconducting state, thus resetting the detector. Measurements on the counting rate of the device are presented and the basic physical features of the detector are discussed.

  18. Levitation Kits Demonstrate Superconductivity.

    Science.gov (United States)

    Worthy, Ward

    1987-01-01

    Describes the "Project 1-2-3" levitation kit used to demonstrate superconductivity. Summarizes the materials included in the kit. Discusses the effect demonstrated and gives details on how to obtain kits. Gives an overview of the documentation that is included. (CW)

  19. LEP superconducting cavity

    CERN Multimedia

    1995-01-01

    Engineers work in a clean room on one of the superconducting cavities for the upgrade to the LEP accelerator, known as LEP-2. The use of superconductors allow higher electric fields to be produced so that higher beam energies can be reached.

  20. Niobium superconducting cavity

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    This 5-cell superconducting cavity, made from bulk-Nb, stems from the period of general studies, not all directed towards direct use at LEP. This one is dimensioned for 1.5 GHz, the frequency used at CEBAF and also studied at Saclay (LEP RF was 352.2 MHz). See also 7908227, 8007354, 8209255, 8210054, 8312339.

  1. LHC Superconducting Magnets

    CERN Document Server

    Jean Leyder

    2000-01-01

    The LHC is the next step in CERN's quest to unravel the mysteries of the Universe. It will accelerate protons to energies never before achieved in laboratories, and to hold them on course it will use powerful superconducting magnets on an unprecedented scale.

  2. Coupled superconducting flux qubits

    NARCIS (Netherlands)

    Plantenberg, J.H.

    2007-01-01

    This thesis presents results of theoretical and experimental work on superconducting persistent-current quantum bits. These qubits offer an attractive route towards scalable solid-state quantum computing. The focus of this work is on the gradiometer flux qubit which has a special geometric design, t

  3. Superconducting Quantum Circuits

    NARCIS (Netherlands)

    Majer, J.B.

    2002-01-01

    This thesis describes a number of experiments with superconducting cir- cuits containing small Josephson junctions. The circuits are made out of aluminum islands which are interconnected with a very thin insulating alu- minum oxide layer. The connections form a Josephson junction. The current trough

  4. Checking BEBC superconducting magnet

    CERN Multimedia

    1974-01-01

    The superconducting coils of the magnet for the 3.7 m Big European Bubble Chamber (BEBC) had to be checked, see Annual Report 1974, p. 60. The photo shows a dismantled pancake. By December 1974 the magnet reached again the field design value of 3.5 T.

  5. Nonequilibrium superconducting detectors

    Science.gov (United States)

    Cristiano, R.; Ejrnaes, M.; Esposito, E.; Lisitskyi, M. P.; Nappi, C.; Pagano, S.; Perez de Lara, D.

    2006-03-01

    Nonequilibrium superconducting detectors exploit the early stages of the energy down cascade which occur after the absorption of radiation. They operate on a short temporal scale ranging from few microseconds down to tens of picoseconds. In such a way they provide fast counting capability, high time discrimination and also, for some devices, energy sensitivity. Nonequilibrium superconducting detectors are developed for their use both in basic science and in practical applications for detection of single photons or single ionized macromolecules. In this paper we consider two devices: distributed readout imaging detectors (DROIDs) based on superconducting tunnel junctions (STJs), which are typically used for high-speed energy spectroscopy applications, and hot-electron superconductive detectors (HESDs), which are typically used as fast counters and time discriminators. Implementation of the DROID geometry to use a single superconductor is discussed. Progress in the fabrication technology of NbN nanostructured HESDs is presented. The two detectors share the high sensitivity that makes them able to efficiently detect even single photons down to infrared energy.

  6. Nonequilibrium superconducting detectors

    Energy Technology Data Exchange (ETDEWEB)

    Cristiano, R [CNR-Istituto di Cibernetica E. Caianiello, 80078 Pozzuoli (Namibia) (Italy); Ejrnaes, M [CNR-Istituto di Cibernetica E. Caianiello, 80078 Pozzuoli (Namibia) (Italy); INFN Sezione di Napoli, 80126 Naples (Italy); Esposito, E [CNR-Istituto di Cibernetica E. Caianiello, 80078 Pozzuoli (Namibia) (Italy); Lisitskyi, M P [CNR-Istituto di Cibernetica E. Caianiello, 80078 Pozzuoli (Namibia) (Italy); Nappi, C [CNR-Istituto di Cibernetica E. Caianiello, 80078 Pozzuoli (Namibia) (Italy); Pagano, S [CNR-Istituto di Cibernetica E. Caianiello, 80078 Pozzuoli (Namibia) (Italy); Dipartimento di Fisica, Universita di Salerno, 84081 Baronissi (Saudi Arabia) (Italy); Perez de Lara, D [CNR-Istituto di Cibernetica E. Caianiello, 80078 Pozzuoli (Namibia) (Italy)

    2006-03-15

    Nonequilibrium superconducting detectors exploit the early stages of the energy down cascade which occur after the absorption of radiation. They operate on a short temporal scale ranging from few microseconds down to tens of picoseconds. In such a way they provide fast counting capability, high time discrimination and also, for some devices, energy sensitivity. Nonequilibrium superconducting detectors are developed for their use both in basic science and in practical applications for detection of single photons or single ionized macromolecules. In this paper we consider two devices: distributed readout imaging detectors (DROIDs) based on superconducting tunnel junctions (STJs), which are typically used for high-speed energy spectroscopy applications, and hot-electron superconductive detectors (HESDs), which are typically used as fast counters and time discriminators. Implementation of the DROID geometry to use a single superconductor is discussed. Progress in the fabrication technology of NbN nanostructured HESDs is presented. The two detectors share the high sensitivity that makes them able to efficiently detect even single photons down to infrared energy.

  7. LHC superconducting strand

    CERN Multimedia

    Patrice Loiez

    1999-01-01

    This cross-section through a strand of superconducting matieral as used in the LHC shows the 8000 Niobium-Titanium filaments embedded like a honeycomb in copper. When cooled to 1.9 degrees above absolute zero in the LHC accelerator, these filaments will have zero resistance and so will carry a high electric current with no energy loss.

  8. Superconducting doped topological materials

    Energy Technology Data Exchange (ETDEWEB)

    Sasaki, Satoshi, E-mail: sasaki@sanken.osaka-u.ac.jp [Institute of Scientific and Industrial Research, Osaka University, Ibaraki, Osaka 567-0047 (Japan); Mizushima, Takeshi, E-mail: mizushima@mp.es.osaka-u.ac.jp [Department of Materials Engineering Science, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Department of Physics, Okayama University, Okayama 700-8530 (Japan)

    2015-07-15

    Highlights: • Studies on both normal- and SC-state properties of doped topological materials. • Odd-parity pairing systems with the time-reversal-invariance. • Robust superconductivity in the presence of nonmagnetic impurity scattering. • We propose experiments to identify the existence of Majorana fermions in these SCs. - Abstract: Recently, the search for Majorana fermions (MFs) has become one of the most important and exciting issues in condensed matter physics since such an exotic quasiparticle is expected to potentially give rise to unprecedented quantum phenomena whose functional properties will be used to develop future quantum technology. Theoretically, the MFs may reside in various types of topological superconductor materials that is characterized by the topologically protected gapless surface state which are essentially an Andreev bound state. Superconducting doped topological insulators and topological crystalline insulators are promising candidates to harbor the MFs. In this review, we discuss recent progress and understanding on the research of MFs based on time-reversal-invariant superconducting topological materials to deepen our understanding and have a better outlook on both the search for and realization of MFs in these systems. We also discuss some advantages of these bulk systems to realize MFs including remarkable superconducting robustness against nonmagnetic impurities.

  9. Nonlinearities in Microwave Superconductivity

    OpenAIRE

    Ledenyov, Dimitri O.; Ledenyov, Viktor O.

    2012-01-01

    The research is focused on the modeling of nonlinear properties of High Temperature Superconducting (HTS) thin films, using Bardeen, Cooper, Schrieffer and Lumped Element Circuit theories, with purpose to enhance microwave power handling capabilities of microwave filters and optimize design of microwave circuits in micro- and nano- electronics.

  10. Coupled superconducting flux qubits

    NARCIS (Netherlands)

    Plantenberg, J.H.

    2007-01-01

    This thesis presents results of theoretical and experimental work on superconducting persistent-current quantum bits. These qubits offer an attractive route towards scalable solid-state quantum computing. The focus of this work is on the gradiometer flux qubit which has a special geometric design, t

  11. Applications of Superconductivity

    Science.gov (United States)

    Goodkind, John M.

    1971-01-01

    Presents a general review of current practical applications of the properties of superconducters. The devices are classified into groups according to the property that is of primary importance. The article is inteded as a first introduction for students and professionals. (Author/DS)

  12. Levitation Kits Demonstrate Superconductivity.

    Science.gov (United States)

    Worthy, Ward

    1987-01-01

    Describes the "Project 1-2-3" levitation kit used to demonstrate superconductivity. Summarizes the materials included in the kit. Discusses the effect demonstrated and gives details on how to obtain kits. Gives an overview of the documentation that is included. (CW)

  13. ISR Superconducting Quadrupoles

    CERN Multimedia

    1977-01-01

    Michel Bouvier is preparing for curing the 6-pole superconducting windings inbedded in the cylindrical wall separating liquid helium from vacuum in the quadrupole aperture. The heat for curing the epoxy glue was provided by a ramp of infrared lamps which can be seen above the slowly rotating cylinder. See also 7703512X, 7702690X.

  14. High temperature interface superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Gozar, A., E-mail: adrian.gozar@yale.edu [Yale University, New Haven, CT 06511 (United States); Bozovic, I. [Yale University, New Haven, CT 06511 (United States); Brookhaven National Laboratory, Upton, NY 11973 (United States)

    2016-02-15

    Highlight: • This review article covers the topic of high temperature interface superconductivity. • New materials and techniques used for achieving interface superconductivity are discussed. • We emphasize the role played by the differences in structure and electronic properties at the interface with respect to the bulk of the constituents. - Abstract: High-T{sub c} superconductivity at interfaces has a history of more than a couple of decades. In this review we focus our attention on copper-oxide based heterostructures and multi-layers. We first discuss the technique, atomic layer-by-layer molecular beam epitaxy (ALL-MBE) engineering, that enabled High-T{sub c} Interface Superconductivity (HT-IS), and the challenges associated with the realization of high quality interfaces. Then we turn our attention to the experiments which shed light on the structure and properties of interfacial layers, allowing comparison to those of single-phase films and bulk crystals. Both ‘passive’ hetero-structures as well as surface-induced effects by external gating are discussed. We conclude by comparing HT-IS in cuprates and in other classes of materials, especially Fe-based superconductors, and by examining the grand challenges currently laying ahead for the field.

  15. Effects of environmental factors on SSC property of modified 13Cr steels in oil and gas fields

    Energy Technology Data Exchange (ETDEWEB)

    Sakamoto, S.; Maruyama, K. [Nippon Steel Corp., Kitakyushu (Japan). Yawata R and D Lab.; Asahi, H. [Nippon Steel Corp., Chiba (Japan). Steel Research Lab.; Kaneta, H. [Japan National Oil Corp., Chiba (Japan). Technology Research Center

    1997-08-01

    Effects of environmental factors such as H{sub 2}S partial pressure, pH, Cl{sup {minus}} concentration and temperature on SSC property of modified 13Cr steels were systematically investigated. Critical H{sub 2}S partial pressure for SSC is affected mainly by temperature and chloride concentration, while pH effect was quite small. In mild conditions such as chloride free solution at 25 C, the steels presented the passive state inhibiting hydrogen entry into steel so that no SSC susceptibility was observed. With increase in Cl{sup {minus}} concentration, corrosion morphology changed from passive state into either pitting or general corrosion allowing hydrogen entry into steel so that SSC susceptibility was observed. In higher temperature condition, passive film also became unstable to cause general corrosion, however, cracking susceptibility was decreased. Based on the test results, a principal SSC mechanism of modified 13Cr steels is considered to be hydrogen embrittlement in condition that some breakdown of passive film undergoes beforehand.

  16. Genome-Wide Scan Reveals LEMD3 and WIF1 on SSC5 as the Candidates for Porcine Ear Size

    Science.gov (United States)

    Luo, Weizhen; Liu, Xin; Yan, Hua; Zhao, Kebin; Shi, Huibi; Zhang, Yuebo; Wang, Ligang; Wang, Lixian

    2014-01-01

    The quantitative trait loci (QTL) for porcine ear size was previously reported to mainly focus on SSC5 and SSC7. Recently, a missense mutation, G32E, in PPARD in the QTL interval on SSC7 was identified as the causative mutation for ear size. However, on account of the large interval of QTL, the responsible gene on SSC5 has not been identified. In this study, an intercross population was constructed from the large-eared Minzhu, an indigenous Chinese pig breed, and the Western commercial Large White pig to examine the genetic basis of ear size diversity. A GWAS was performed to detect SNPs significantly associated with ear size. Thirty-five significant SNPs defined a 10.78-Mb (30.14–40.92 Mb) region on SSC5. Further, combining linkage disequilibrium and haplotype sharing analysis, a reduced region of 3.07-Mb was obtained. Finally, by using a selective sweep analysis, a critical region of about 450-kb interval containing two annotated genes LEMD3 and WIF1 was refined in this work. Functional analysis indicated that both represent biological candidates for porcine ear size, with potential application in breeding programs. The two genes could also be used as novel references for further study of the mechanism underlying human microtia. PMID:25006967

  17. Genome-wide scan reveals LEMD3 and WIF1 on SSC5 as the candidates for porcine ear size.

    Science.gov (United States)

    Zhang, Longchao; Liang, Jing; Luo, Weizhen; Liu, Xin; Yan, Hua; Zhao, Kebin; Shi, Huibi; Zhang, Yuebo; Wang, Ligang; Wang, Lixian

    2014-01-01

    The quantitative trait loci (QTL) for porcine ear size was previously reported to mainly focus on SSC5 and SSC7. Recently, a missense mutation, G32E, in PPARD in the QTL interval on SSC7 was identified as the causative mutation for ear size. However, on account of the large interval of QTL, the responsible gene on SSC5 has not been identified. In this study, an intercross population was constructed from the large-eared Minzhu, an indigenous Chinese pig breed, and the Western commercial Large White pig to examine the genetic basis of ear size diversity. A GWAS was performed to detect SNPs significantly associated with ear size. Thirty-five significant SNPs defined a 10.78-Mb (30.14-40.92 Mb) region on SSC5. Further, combining linkage disequilibrium and haplotype sharing analysis, a reduced region of 3.07-Mb was obtained. Finally, by using a selective sweep analysis, a critical region of about 450-kb interval containing two annotated genes LEMD3 and WIF1 was refined in this work. Functional analysis indicated that both represent biological candidates for porcine ear size, with potential application in breeding programs. The two genes could also be used as novel references for further study of the mechanism underlying human microtia.

  18. Test Facilities Capability Handbook: Volume 1 - Stennis Space Center (SSC); Volume 2 - Marshall Space Flight Center (MSFC)

    Science.gov (United States)

    Hensarling, Paula L.

    2007-01-01

    The John C. Stennis Space Center (SSC) is located in Southern Mississippi near the Mississippi-Louisiana state line. SSC is chartered as the National Aeronautics and Space Administration (NASA) Center of Excellence for large space transportation propulsion system testing. This charter has led to many unique test facilities, capabilities and advanced technologies provided through the supporting infrastructure. SSC has conducted projects in support of such diverse activities as liquid, and hybrid rocket testing and development; material development; non-intrusive plume diagnostics; plume tracking; commercial remote sensing; test technology and more. On May 30, 1996 NASA designated SSC the lead center for rocket propulsion testing, giving the center total responsibility for conducting and/or managing all NASA rocket engine testing. Test services are now available not only for NASA but also for the Department of Defense, other government agencies, academia, and industry. This handbook was developed to provide a summary of the capabilities that exist within SSC. It is intended as a primary resource document, which will provide the reader with the top-level capabilities and characteristics of the numerous test facilities, test support facilities, laboratories, and services. Due to the nature of continually evolving programs and test technologies, descriptions of the Center's current capabilities are provided. Periodic updates and revisions of this document will be made to maintain its completeness and accuracy.

  19. Angiotensin II Type 1 receptor (AGTR1) gene polymorphisms are associated with vascular manifestations in patients with systemic sclerosis (SSc).

    Science.gov (United States)

    Rodríguez-Reyna, Tatiana S; Núñez-Alvarez, Carlos; Cruz-Lagunas, Alfredo; Posadas-Sánchez, Rosalinda; Pérez-Hernández, Nonanzit; Jiménez-Alvarez, Luis; Ramírez-Martínez, Gustavo; Granados, Julio; Vargas-Alarcón, Gilberto; Zúñiga, Joaquín

    2016-07-01

    Systemic sclerosis (SSc) shows variable clinical expression in different ethnic groups; vascular abnormalities are a prominent feature of this disease and its clinical expression may be influenced by genetic factors. Herein, we describe 15 polymorphisms of the renin-angiotensin-aldosterone pathway in 170 Mexican admixed SSc patients (defined as patients with Mexican ancestry for at least 3 generations) and 199 healthy controls. We determined the presence of angiotensin II Type 1 receptor (AGTR1), angiotensin converting enzyme (ACE) and Endothelin 1 single nucleotide polymorphisms (SNPs) using 5' exonuclease TaqMan genotyping assays on a 7900HT real-time fast polymerase chain reaction (PCR) system. These polymorphisms had a similar distribution between SSc patients and controls, but we found that the AGTR1 G-680T (rs275652) (p = 0.02; OR 3.5; 95%CI 1.2-10.4) and AGTR1 A-119G (rs275653) (p = 0.008; OR 4.2; 95% CI 1.5-12.1) polymorphisms were associated with severe vascular involvement in our SSc patients. This is the first report of the association of these polymorphisms with vasculopathy in Mexican admixed SSc patients. Our findings suggested that the angiotensin II Type 1 receptor genotype may influence the clinical expression of vasculopathy in these patients. Functional analyses should follow. © The Author(s) 2016.

  20. Teaching English Idioms through Mnemonic Devices at SSC Level in Pakistan

    Directory of Open Access Journals (Sweden)

    Sidra Mahmood

    2014-03-01

    Full Text Available This research dealt with teaching English idioms through mnemonic devices at SSC level in a school in pakistan. As the students in Pakistan, especially at SSC level, have a habit to learn idioms by rote and face many problems due the technique, the problem was selected for the investigation. Needs Analysis Questionnaire was used to determine the needs and problems faced by the students and their expectations for solution to the problem. Understanding the problems faced by the students in English idioms, an alternative methodology was selected in the form of mnemonic devices and the selected students were taught using the methodology to test its effectiveness in not only teaching English idioms but also making learning motivating, interesting and learner-involving. A post-test was given to understand the effect (if any of the selected alternative method of mnemonics and it was observed that teaching English idioms through mnemonic devices not only helped the learners but also helped in sharpening their memory.

  1. Superconductivity an introduction

    CERN Document Server

    Kleiner, Reinhold

    2016-01-01

    The third edition of this proven text has been developed further in both scope and scale to reflect the potential for superconductivity in power engineering to increase efficiency in electricity transmission or engines. The landmark reference remains a comprehensive introduction to the field, covering every aspect from fundamentals to applications, and presenting the latest developments in organic superconductors, superconducting interfaces, quantum coherence, and applications in medicine and industry. Due to its precise language and numerous explanatory illustrations, it is suitable as an introductory textbook, with the level rising smoothly from chapter to chapter, such that readers can build on their newly acquired knowledge. The authors cover basic properties of superconductors and discuss stability and different material groups with reference to the latest and most promising applications, devoting the last third of the book to applications in power engineering, medicine, and low temperature physics. An e...

  2. Superconducting Accelerator Magnets

    CERN Document Server

    Mess, K H; Wolff, S

    1996-01-01

    The main topic of the book are the superconducting dipole and quadrupole magnets needed in high-energy accelerators and storage rings for protons, antiprotons or heavy ions. The basic principles of low-temperature superconductivity are outlined with special emphasis on the effects which are relevant for accelerator magnets. Properties and fabrication methods of practical superconductors are described. Analytical methods for field calculation and multipole expansion are presented for coils without and with iron yoke. The effect of yoke saturation and geometric distortions on field quality is studied. Persistent magnetization currents in the superconductor and eddy currents the copper part of the cable are analyzed in detail and their influence on field quality and magnet performance is investigated. Superconductor stability, quench origins and propagation and magnet protection are addressed. Some important concepts of accelerator physics are introduced which are needed to appreciate the demanding requirements ...

  3. Statistical mechanics of superconductivity

    CERN Document Server

    Kita, Takafumi

    2015-01-01

    This book provides a theoretical, step-by-step comprehensive explanation of superconductivity for undergraduate and graduate students who have completed elementary courses on thermodynamics and quantum mechanics. To this end, it adopts the unique approach of starting with the statistical mechanics of quantum ideal gases and successively adding and clarifying elements and techniques indispensible for understanding it. They include the spin-statistics theorem, second quantization, density matrices, the Bloch–De Dominicis theorem, the variational principle in statistical mechanics, attractive interaction, and bound states. Ample examples of their usage are also provided in terms of topics from advanced statistical mechanics such as two-particle correlations of quantum ideal gases, derivation of the Hartree–Fock equations, and Landau’s Fermi-liquid theory, among others. With these preliminaries, the fundamental mean-field equations of superconductivity are derived with maximum mathematical clarity based on ...

  4. Superconducting switch pack

    Energy Technology Data Exchange (ETDEWEB)

    Srivastava, V.C.; Wollan, J.J.

    1990-07-24

    This patent describes a superconducting switch pack at least one switch element. The switch element including a length of superconductive wire having a switching portion and two lead portions, the switching portion being between the lead portions; means for supporting the switching portion in a plane in a common mold; hardened resin means encapsulating the switching portion in the plane in a solid body; wherein the solid body has an exterior surface which is planar and substantially parallel with and spaced apart from the plane in which the switching portion is positioned. The exterior surface being exposed to the exterior of the switch pack and the resin means filling the space between the exterior surface and the plane of the switching portion so as to provide uninterrupted thermal communication between the plane of the switching portion and the exterior of the switch pack; and a heater element in thermal contact with the switching portion.

  5. Tunable superconducting nanoinductors

    Energy Technology Data Exchange (ETDEWEB)

    Annunziata, Anthony J; Santavicca, Daniel F; Frunzio, Luigi; Rooks, Michael J; Prober, Daniel E [Department of Applied Physics, Yale University, New Haven, CT 06511 (United States); Catelani, Gianluigi [Department of Physics, Yale University, New Haven, CT 06511 (United States); Frydman, Aviad, E-mail: anthony.annunziata@yale.edu, E-mail: daniel.prober@yale.edu [Department of Physics, Bar-Ilan University, Ramat Gan 52900 (Israel)

    2010-11-05

    We characterize inductors fabricated from ultra-thin, approximately 100 nm wide strips of niobium (Nb) and niobium nitride (NbN). These nanowires have a large kinetic inductance in the superconducting state. The kinetic inductance scales linearly with the nanowire length, with a typical value of 1 nH {mu}m{sup -1} for NbN and 44 pH {mu}m{sup -1} for Nb at a temperature of 2.5 K. We measure the temperature and current dependence of the kinetic inductance and compare our results to theoretical predictions. We also simulate the self-resonant frequencies of these nanowires in a compact meander geometry. These nanowire inductive elements have applications in a variety of microwave frequency superconducting circuits.

  6. Time ripe for superconductivity?

    Directory of Open Access Journals (Sweden)

    George Marsh

    2002-04-01

    But there is a crucial deadline and failure to meet it could send superconductivity back to the commercial shadows (at least outside the medical and scientific niches where it is a key enabler in analytical instruments, magnetic resonance imaging, and particle accelerators for another 30 years. Later this decade, the vintage infrastructure of dense copper conductors that supports power distribution in developed countries, in particular in the US, will become due for renewal. (Recent power problems in California were largely those of distribution infrastructure. At the same time, boosting capacity to serve the needs of increasingly affluent populations will pose a challenge. Superconductivity could provide the answer — if the technology matures in time and cost targets are met.

  7. Mechanical and electromagnetic analysis of 50 millimeter designs for the SSC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Jayakumar, J.; Leung, K.; Nobrega, F.; Orrell, D.; Sanger, P.; Snitchler, G.; Spigo, G.; Turner, J. (Superconducting Super Collider Lab., Dallas, TX (United States)); Goodzeit, C.; Gupta, R.; Kahn, S.; Morgan, G.; Willen, E. (Brookhaven National Lab., Upton, NY (United States)); Kerby, J.; Strait, J. (Fermi National Accelerator Lab., Batavia, IL (United States)); Schermer, R. (Lawrence Berkeley Lab., CA (Uni

    1990-09-01

    Several designs for the Superconducting Super Collider dipole magnet have been analyzed. This note discusses the mechanical and electromagnetic features of each design. Electromagnetic and Mechanical analyses were performed using hand, computer programs and finite element techniques to evaluate the design. 10 refs., 6 figs., 3 tabs.

  8. Relativistic Model for two-band Superconductivity

    OpenAIRE

    Ohsaku, Tadafumi

    2003-01-01

    To understand the superconductivity in MgB2, several two-band models of superconductivity were proposed. In this paper, by using the relativistic fermion model, we clearize the effect of the lower band in the superconductivity.

  9. Topological confinement and superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Al-hassanieh, Dhaled A [Los Alamos National Laboratory; Batista, Cristian D [Los Alamos National Laboratory

    2008-01-01

    We derive a Kondo Lattice model with a correlated conduction band from a two-band Hubbard Hamiltonian. This mapping allows us to describe the emergence of a robust pairing mechanism in a model that only contains repulsive interactions. The mechanism is due to topological confinement and results from the interplay between antiferromagnetism and delocalization. By using Density-Matrix-Renormalization-Group (DMRG) we demonstrate that this mechanism leads to dominant superconducting correlations in aID-system.

  10. Unconventional superconductivity near inhomogeneities

    Energy Technology Data Exchange (ETDEWEB)

    Poenicke, A.F.

    2008-01-25

    After the presentation of a quasi-classical theory the specific heat of Sr{sub 2}RuO{sub 4} is considered. Then tunneling spectroscopy on cuprate superconductors is discussed. Thereafter the subharmonic gap structure in d-wave superconductors is considered. Finally the application of the S-matrix in superconductivity is discussed with spin mixing, CrO{sub 2} as example, and an interface model. (HSI)

  11. Helical superconducting black holes.

    Science.gov (United States)

    Donos, Aristomenis; Gauntlett, Jerome P

    2012-05-25

    We construct novel static, asymptotically five-dimensional anti-de Sitter black hole solutions with Bianchi type-VII(0) symmetry that are holographically dual to superconducting phases in four spacetime dimensions with a helical p-wave order. We calculate the precise temperature dependence of the pitch of the helical order. At zero temperature the black holes have a vanishing entropy and approach domain wall solutions that reveal homogenous, nonisotropic dual ground states with an emergent scaling symmetry.

  12. Silicon superconducting quantum interference device

    Energy Technology Data Exchange (ETDEWEB)

    Duvauchelle, J. E.; Francheteau, A.; Marcenat, C.; Lefloch, F., E-mail: francois.lefloch@cea.fr [Université Grenoble Alpes, CEA - INAC - SPSMS, F-38000 Grenoble (France); Chiodi, F.; Débarre, D. [Université Paris-sud, CNRS - IEF, F-91405 Orsay - France (France); Hasselbach, K. [Université Grenoble Alpes, CNRS - Inst. Néel, F-38000 Grenoble (France); Kirtley, J. R. [Center for probing at nanoscale, Stanford University, Palo Alto, California 94305-4045 (United States)

    2015-08-17

    We have studied a Superconducting Quantum Interference Device (SQUID) made from a single layer thin film of superconducting silicon. The superconducting layer is obtained by heavily doping a silicon wafer with boron atoms using the gas immersion laser doping technique. The SQUID is composed of two nano-bridges (Dayem bridges) in a loop and shows magnetic flux modulation at low temperature and low magnetic field. The overall behavior shows very good agreement with numerical simulations based on the Ginzburg-Landau equations.

  13. Superconducting Qubit Optical Transducer (SQOT)

    Science.gov (United States)

    2015-08-05

    SECURITY CLASSIFICATION OF: The SQOT (Superconducting Qubit Optical Transducer ) project proposes to build a novel electro-optic system which can...Apr-2015 Approved for Public Release; Distribution Unlimited Final Report: "Superconducting Qubit Optical Transducer " (SQOT) The views, opinions and...journals: Number of Papers published in non peer-reviewed journals: Final Report: "Superconducting Qubit Optical Transducer " (SQOT) Report Title The

  14. Hybrid Superconducting Neutron Detectors

    CERN Document Server

    Merlo, V; Cirillo, M; Lucci, M; Ottaviani, I; Scherillo, A; Celentano, G; Pietropaolo, A

    2014-01-01

    A new neutron detection concept is presented that is based on superconductive niobium (Nb) strips coated by a boron (B) layer. The working principle of the detector relies on the nuclear reaction 10B+n $\\rightarrow$ $\\alpha$+ 7Li , with $\\alpha$ and Li ions generating a hot spot on the current-biased Nb strip which in turn induces a superconducting-normal state transition. The latter is recognized as a voltage signal which is the evidence of the incident neutron. The above described detection principle has been experimentally assessed and verified by irradiating the samples with a pulsed neutron beam at the ISIS spallation neutron source (UK). It is found that the boron coated superconducting strips, kept at a temperature T = 8 K and current-biased below the critical current Ic, are driven into the normal state upon thermal neutron irradiation. As a result of the transition, voltage pulses in excess of 40 mV are measured while the bias current can be properly modulated to bring the strip back to the supercond...

  15. Navy superconductivity efforts

    Science.gov (United States)

    Gubser, D. U.

    1990-04-01

    Both the new high temperature superconductors (HTS) and the low temperature superconductors (LTS) are important components of Navy's total plan to integrate superconductivity into field operational systems. Fundamental research is an important component of the total Navy program and focuses on the HTS materials. Power applications (ship propulsion, etc.) use LTS materials while space applications (MMW electronics, etc.) use HTS materials. The Space Experiment being conducted at NRL will involve space flight testing of HTS devices built by industry and will demonstrate the ability to engineer and space qualify these devices for systems use. Another important component of the Navy's effort is the development of Superconducting Quantum Interference Device (SQUID) magnetometers. This program will use LTS materials initially, but plans to implement HTS materials as soon as possible. Hybrid HTS/LTS systems are probable in many applications. A review of the status of the Navy's HTS materials research is given as well as an update on the Navy's development efforts in superconductivity, with particular emphasis on the related SDIO sponsored program on HTS applications.

  16. US Navy superconductivity program

    Science.gov (United States)

    Gubser, Donald U.

    1991-01-01

    Both the new high temperature superconductors (HTS) and the low temperature superconductors (LTS) are important components of the Navy's total plan to integrate superconductivity into field operational systems. Fundamental research is an important component of the total Navy program and focuses on the HTS materials. Power applications (ship propulsion) use LTS materials while space applications (millimeter wave electronics) use HTS materials. The Space Experiment to be conducted at NRL will involve space flight testing of HTS devices built by industry and will demonstrate the ability to engineer and space qualify these devices for systems use. Another important component of the Navy's effort is the development of Superconducting Quantum Interference Device (SQUID) magnetometers. This program will use LTS materials initially, but plans to implement HTS materials as soon as possible. Hybrid HTS/LTS systems are probable in many applications. A review of the status of the Navy's HTS materials research is given as well as an update on the Navy's development efforts in superconductivity.

  17. Navy superconductivity efforts

    Science.gov (United States)

    Gubser, D. U.

    1990-01-01

    Both the new high temperature superconductors (HTS) and the low temperature superconductors (LTS) are important components of Navy's total plan to integrate superconductivity into field operational systems. Fundamental research is an important component of the total Navy program and focuses on the HTS materials. Power applications (ship propulsion, etc.) use LTS materials while space applications (MMW electronics, etc.) use HTS materials. The Space Experiment being conducted at NRL will involve space flight testing of HTS devices built by industry and will demonstrate the ability to engineer and space qualify these devices for systems use. Another important component of the Navy's effort is the development of Superconducting Quantum Interference Device (SQUID) magnetometers. This program will use LTS materials initially, but plans to implement HTS materials as soon as possible. Hybrid HTS/LTS systems are probable in many applications. A review of the status of the Navy's HTS materials research is given as well as an update on the Navy's development efforts in superconductivity, with particular emphasis on the related SDIO sponsored program on HTS applications.

  18. Superconductivity in CVD diamond films.

    Science.gov (United States)

    Takano, Yoshihiko

    2009-06-24

    A beautiful jewel of diamond is insulator. However, boron doping can induce semiconductive, metallic and superconducting properties in diamond. When the boron concentration is tuned over 3 × 10(20) cm(-3), diamonds enter the metallic region and show superconductivity at low temperatures. The metal-insulator transition and superconductivity are analyzed using ARPES, XAS, NMR, IXS, transport and magnetic measurements and so on. This review elucidates the physical properties and mechanism of diamond superconductor as a special superconductivity that occurs in semiconductors.

  19. Unconventional superconductivity in honeycomb lattice

    Directory of Open Access Journals (Sweden)

    P Sahebsara

    2013-03-01

    Full Text Available   ‎ The possibility of symmetrical s-wave superconductivity in the honeycomb lattice is studied within a strongly correlated regime, using the Hubbard model. The superconducting order parameter is defined by introducing the Green function, which is obtained by calculating the density of the electrons ‎ . In this study showed that the superconducting order parameter appears in doping interval between 0 and 0.5, and x=0.25 is the optimum doping for the s-wave superconductivity in honeycomb lattice.

  20. Superconductivity in graphite intercalation compounds

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Robert P. [Cavendish Laboratory, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Weller, Thomas E.; Howard, Christopher A. [Department of Physics & Astronomy, University College of London, Gower Street, London WCIE 6BT (United Kingdom); Dean, Mark P.M. [Department of Condensed Matter Physics and Materials Science, Brookhaven National Laboratory, Upton, NY 11973 (United States); Rahnejat, Kaveh C. [Department of Physics & Astronomy, University College of London, Gower Street, London WCIE 6BT (United Kingdom); Saxena, Siddharth S. [Cavendish Laboratory, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Ellerby, Mark, E-mail: mark.ellerby@ucl.ac.uk [Department of Physics & Astronomy, University College of London, Gower Street, London WCIE 6BT (United Kingdom)

    2015-07-15

    Highlights: • Historical background of graphite intercalates. • Superconductivity in graphite intercalates and its place in the field of superconductivity. • Recent developments. • Relevant modeling of superconductivity in graphite intercalates. • Interpretations that pertain and questions that remain. - Abstract: The field of superconductivity in the class of materials known as graphite intercalation compounds has a history dating back to the 1960s (Dresselhaus and Dresselhaus, 1981; Enoki et al., 2003). This paper recontextualizes the field in light of the discovery of superconductivity in CaC{sub 6} and YbC{sub 6} in 2005. In what follows, we outline the crystal structure and electronic structure of these and related compounds. We go on to experiments addressing the superconducting energy gap, lattice dynamics, pressure dependence, and how these relate to theoretical studies. The bulk of the evidence strongly supports a BCS superconducting state. However, important questions remain regarding which electronic states and phonon modes are most important for superconductivity, and whether current theoretical techniques can fully describe the dependence of the superconducting transition temperature on pressure and chemical composition.

  1. Korea's developmental program for superconductivity

    Science.gov (United States)

    Hong, Gye-Won; Won, Dong-Yeon; Kuk, Il-Hyun; Park, Jong-Chul

    1995-01-01

    Superconductivity research in Korea was firstly carried out in the late 70's by a research group in Seoul National University (SNU), who fabricated a small scale superconducting magnetic energy storage system under the financial support from Korea Electric Power Company (KEPCO). But a few researchers were involved in superconductivity research until the oxide high Tc superconductor was discovered by Bednorz and Mueller. After the discovery of YBaCuO superconductor operating above the boiling point of liquid nitrogen (77 K)(exp 2), Korean Ministry of Science and Technology (MOST) sponsored a special fund for the high Tc superconductivity research to universities and national research institutes by recognizing its importance. Scientists engaged in this project organized 'High Temperature Superconductivity Research Association (HITSRA)' for effective conducting of research. Its major functions are to coordinate research activities on high Tc superconductivity and organize the workshop for active exchange of information. During last seven years the major superconductivity research has been carried out through the coordination of HITSRA. The major parts of the Korea's superconductivity research program were related to high temperature superconductor and only a few groups were carrying out research on conventional superconductor technology, and Korea Atomic Energy Research Institute (KAERI) and Korea Electrotechnology Research Institute (KERI) have led this research. In this talk, the current status and future plans of superconductivity research in Korea will be reviewed based on the results presented in interim meeting of HITSRA, April 1-2, 1994. Taejeon, as well as the research activity of KAERI.

  2. Regulation loops for the ring magnet power supplies in the SSC accelerator complex

    Energy Technology Data Exchange (ETDEWEB)

    Tacconi, E.; Christiansen, C.

    1993-05-01

    The SSC complex consists of five cascaded accelerators: The linear accelerator (linac) and four synchrotrons: The low energy booster (LEB), the medium energy booster (MEB), the high energy booster (HEB), and the collider. Twelve- or 24-pulse phase-controlled SCR power supplies are used to energize the ring magnets. Each power supply has a voltage loop designed to regulate the voltage applied to the magnets. The voltage regulation loops for these synchrotrons and the current regulation for the LEB are analyzed in this work. The digital voltage regulator is fiber-optic isolated from the power converter. It has a closed-loop bandwidth of 150 Hz with band rejections for 60-Hz and 120-Hz perturbations. The LEB has a very precise current regulation system composed of a feedforward compensator, a fast feedback regulator, and a slow synchronous regulator. The current regulation design is corroborated by computer simulations.

  3. Analyzing Classroom Strategy: Evaluating the Concept Mapping Technique at SSC Level in Pakistan

    Directory of Open Access Journals (Sweden)

    Sidra Mahmood

    2015-08-01

    Full Text Available This study documents the usage of Concept Mapping in the teaching-learning situation of English at SSC Level. The study is descriptive and analytical in nature and tries to investigate the effects which Concept Mapping renders in the academic environment in the context of ESL classroom setting. The research offers strategies for adopting certain techniques and up gradation of the content taught at the mentioned level by the inculcation of such techniques. Overall, the study produced a range of implementable outcomes by a pervasive discussion of Concept Mapping, the role of the textbooks, the importance of adding the technique to the contents of ESL classroom setting. For data collection and data analysis, two classes were selected. Both were taught the same content under controlled conditions. The concept mapping technique in the class guided the learners towards the improved way of learning the text of second language.

  4. Coil measurement data acquisition and curing press control system for SSC dipole magnet coils

    Energy Technology Data Exchange (ETDEWEB)

    Dickey, C.E.

    1989-03-01

    A coil matching program, similar in theory to the methods used to match Tevatron coils, is being developed at Fermilab. Modulus of elasticity and absolute coil size will be determined at 18-inch intervals along the coils while in the coil curing press immediately following the curing process. A data acquisition system is under construction to automatically acquire and manage the large quantities of data that result. Data files will be transferred to Fermilab's VAX Cluster for long-term storage and actual coil matching. The data acquisition system will also provide the control algorithm for the curing press hydraulic system. A description of the SSC Curing Press Data Acquisition and Controls System will be reported. 20 figs.

  5. Design optimization of the APF DTL in the SSC-linac

    Institute of Scientific and Technical Information of China (English)

    WANG Zhi-Jun; HE Yuan; WU Wei; YANG Ya-Qing; XIAO Chen

    2010-01-01

    A linear accelerator as a new injector for the SSC(Separated Sector Cyclotron)of the HIRFL(Heavy Ion Research Facility Lanzhou)is being designed.The DTL(Drift-Tube-Linac)has been designed to accelerate 23Su34+from 0.140 MeV/u to 0.97 MeV/u.To the first accelerating tank which accelerates23SU34+to 0.54 MeV/u,the approach of Alternating-Phase-Focusing(APF)is applied.The phase array isobtained by coupling optimization software Dakota and beam optics code LINREV.With the hybrid of Multiobjective Genetic Algorithm(MOGA)and a pattern search method,an optimum array of asynchronous phases is determined.The final growth,both transversely and longitudinally,can meet the design requirements.In this paper,the deign optimization of the APF DTL is presented.

  6. A Particle-in-cell scheme of the RFQ in the SSC-Linac

    Science.gov (United States)

    Xiao, Chen; He, Yuan; Lu, Yuan-Rong; Yuri, Batygin; Yin, Ling; Wang, Zhi-Jun; Yuan, You-Jin; Liu, Yong; Chang, Wei; Du, Xiao-Nan; Wang, Zhi; Xia, Jia-Wen

    2010-11-01

    A 52 MHz Radio Frequency Quadrupole (RFQ) linear accelerator (linac) is designed to serve as an initial structure for the SSC-Linac system (injector into Separated Sector Cyclotron). The designed injection and output energy are 3.5 keV/u and 143 keV/u, respectively. The beam dynamics in this RFQ have been studied using a three-dimensional Particle-In-Cell (PIC) code BEAMPATH. Simulation results show that this RFQ structure is characterized by stable values of beam transmission efficiency (at least 95%) for both zero-current mode and the space charge dominated regime. The beam accelerated in the RFQ has good quality in both transverse and longitudinal directions, and could easily be accepted by Drift Tube Linac (DTL). The effect of the vane error and that of the space charge on the beam parameters have been studied as well to define the engineering tolerance for RFQ vane machining and alignment.

  7. Design optimization of the APF DTL in the SSC-linac

    Science.gov (United States)

    Wang, Zhi-Jun; He, Yuan; Wu, Wei; Yang, Ya-Qing; Xiao, Chen

    2010-10-01

    A linear accelerator as a new injector for the SSC (Separated Sector Cyclotron) of the HIRFL (Heavy Ion Research Facility Lanzhou) is being designed. The DTL (Drift-Tube-Linac) has been designed to accelerate 238U34+ from 0.140 MeV/u to 0.97 MeV/u. To the first accelerating tank which accelerates 238U34+ to 0.54 MeV/u, the approach of Alternating-Phase-Focusing (APF) is applied. The phase array is obtained by coupling optimization software Dakota and beam optics code LINREV. With the hybrid of Multi-objective Genetic Algorithm (MOGA) and a pattern search method, an optimum array of asynchronous phases is determined. The final growth, both transversely and longitudinally, can meet the design requirements. In this paper, the deign optimization of the APF DTL is presented.

  8. Comparative Analyses of the Teaching Methods and Evaluation Practices in English Subject at Secondary School Certificate (SSC) and General Certificate of Education (GCE O-Level) in Pakistan

    Science.gov (United States)

    Behlol, Malik Ghulam; Anwar, Mohammad

    2011-01-01

    The study was conducted to compare the teaching methods and evaluation practices in English subject at secondary school certificate (SSC) and general certificate of education GCE-O-level in Pakistan. The population of the study was students, teachers and experts at SSC and 0-level in the Punjab province. Purposive and random sampling techniques…

  9. Optimization of superconducting tiling pattern for superconducting bearings

    Energy Technology Data Exchange (ETDEWEB)

    Hull, John R. (Hinsdale, IL)

    1996-01-01

    An apparatus and method for reducing magnetic field inhomogeneities which produce rotational loss mechanisms in high temperature superconducting magnetic bearings. Magnetic field inhomogeneities are reduced by dividing high temperature superconducting structures into smaller structures, and arranging the smaller structures into tiers which stagger the magnetic field maximum locations of the smaller structures.

  10. A blanket design, apparatus, and fabrication techniques for the mass production of multilayer insulation blankets for the Superconducting Super Collider

    Energy Technology Data Exchange (ETDEWEB)

    Gonczy, J.D.; Boroski, W.N.; Niemann, R.C.; Otavka, J.G.; Ruschman, M.K.; Schoo, C.J.

    1989-09-01

    The multilayer insulation (MLI) system for the Superconducting Super Collider (SSC) consists of full cryostat length assemblies of aluminized polyester film fabricated in the form of blankets and installed as blankets to the 4.5K cold mass and the 20K and 80K thermal radiation shields. Approximately 40,000 MLI blankets will be required in the 10,000 cryogenic devices comprising the SSC accelerator. Each blanket is nearly 17 meters long and 1.8 meters wide. This paper reports the blanket design, an apparatus, and the fabrication method used to mass produce pre-fabricated MLI blankets. Incorporated in the blanket design are techniques which automate quality control during installation of the MLI blankets in the SSC cryostat. The apparatus and blanket fabrication method insure consistency in the mass produced blankets by providing positive control of the dimensional parameters which contribute to the thermal performance of the MLI blanket. By virtue of the fabrication process, the MLI blankets have inherent features of dimensional stability three-dimensional uniformity, controlled layer density, layer-to-layer registration, interlayer cleanliness, and interlayer material to accommodate thermal contraction differences. 11 refs., 6 figs., 1 tab.

  11. The Scavenger Receptor SSc5D Physically Interacts with Bacteria through the SRCR-Containing N-Terminal Domain

    Science.gov (United States)

    Bessa Pereira, Catarina; Bocková, Markéta; Santos, Rita F.; Santos, Ana Mafalda; Martins de Araújo, Mafalda; Oliveira, Liliana; Homola, Jiří; Carmo, Alexandre M.

    2016-01-01

    The scavenger receptor cysteine-rich (SRCR) family comprises a group of membrane-attached or secreted proteins that contain one or more modules/domains structurally similar to the membrane distal domain of type I macrophage scavenger receptor. Although no all-inclusive biological function has been ascribed to the SRCR family, some of these receptors have been shown to recognize pathogen-associated molecular patterns (PAMP) of bacteria, fungi, or other microbes. SSc5D is a recently described soluble SRCR receptor produced by monocytes/macrophages and T lymphocytes, consisting of an N-terminal portion, which contains five SRCR modules, and a large C-terminal mucin-like domain. Toward establishing a global common role for SRCR domains, we interrogated whether the set of five SRCR domains of SSc5D displayed pattern recognition receptor (PRR) properties. For that purpose, we have expressed in a mammalian expression system the N-terminal SRCR-containing moiety of SSc5D (N-SSc5D), thus excluding the mucin-like domain likely by nature to bind microorganisms, and tested the capacity of the SRCR functional groups to physically interact with bacteria. Using conventional protein–bacteria binding assays, we showed that N-SSc5D had a superior capacity to bind to Escherichia coli strains RS218 and IHE3034 compared with that of the extracellular domains of the SRCR proteins CD5 and CD6 (sCD5 and sCD6, respectively), and similar E. coli-binding properties as Spα, a proven PRR of the SRCR family. We have further designed a more sensitive, real-time, and label-free surface plasmon resonance (SPR)-based assay and examined the capacity of N-SSc5D, Spα, sCD5, and sCD6 to bind to different bacteria. We demonstrated that N-SSc5D compares with Spα in the capacity to bind to E. coli and Listeria monocytogenes, and further that it can distinguish between pathogenic E. coli RS218 and IHE3034 strains and the non-pathogenic laboratory E. coli strain BL21(DE3). Our work thus advocates the

  12. The scavenger receptor SSc5D physically interacts with bacteria through the SRCR-containing N-terminal domain

    Directory of Open Access Journals (Sweden)

    Catarina Bessa-Pereira

    2016-10-01

    Full Text Available The scavenger receptor cysteine-rich (SRCR family comprises a group of membrane-attached or secreted proteins that contain one or more modules/domains structurally similar to the membrane distal domain of type I macrophage scavenger receptor. Although no all-inclusive biological function has been ascribed to the SRCR family, some of these receptors have been shown to recognize pathogen-associated molecular patterns (PAMP of bacteria, fungi or other microbes. SSc5D is a recently described soluble SRCR receptor produced by monocytes/macrophages and T lymphocytes, consisting of an N-terminal portion which contains five SRCR modules, and a large C-terminal mucin-like domain. Towards establishing a global common role for SRCR domains, we interrogated whether the set of five SRCR domains of SSc5D displayed pattern recognition receptor (PRR properties. For that purpose, we have expressed in a mammalian expression system the N-terminal SRCR-containing moiety of SSC5D (N-SSc5D, thus excluding the mucin-like domain likely by nature to bind microorganisms, and tested the capacity of the SRCR functional groups to physically interact with bacteria. Using conventional protein-bacteria binding assays, we showed that N-SSc5D had a superior capacity to bind to E. coli strains RS218 and IHE3034 compared with that of the extracellular domains of the SRCR proteins CD5 and CD6 (sCD5 and sCD6, respectively, and similar E. coli-binding properties as Spα, a proven PRR of the SRCR family. We have further designed a more sensitive, real-time and label-free surface plasmon resonance (SPR-based assay, and examined the capacity of N-SSc5D, Spα, sCD5 and sCD6 to bind to different bacteria. We demonstrated that the N-SSc5D compares with Spα in the capacity to bind to E. coli and L. monocytogenes, and further that it can distinguish between pathogenic E. coli RS218 and IHE3034 strains and the non-pathogenic laboratory E. coli strain BL21(DE3. Our work thus advocates the

  13. Role of the mitochondrial Hsp70s, Ssc1 and Ssq1, in the maturation of Yfh1.

    Science.gov (United States)

    Voisine, C; Schilke, B; Ohlson, M; Beinert, H; Marszalek, J; Craig, E A

    2000-05-01

    The mitochondrial matrix of the yeast Saccharomyces cerevisiae contains two molecular chaperones of the Hsp70 class, Ssc1 and Ssq1. We report that Ssc1 and Ssq1 play sequential roles in the import and maturation of the yeast frataxin homologue (Yfh1). In vitro, radiolabeled Yfh1 was not imported into ssc1-3 mutant mitochondria, remaining in a protease-sensitive precursor form. As reported earlier, the Yfh1 intermediate form was only slowly processed to the mature form in Deltassq1 mitochondria (S. A. B. Knight, N. B. V. Sepuri, D. Pain, and A. Dancis, J. Biol. Chem. 273:18389-18393, 1998). However, the intermediate form in both wild-type and Deltassq1 mitochondria was entirely within the inner membrane, as it was resistant to digestion with protease after disruption of the outer membrane. Therefore, we conclude that Ssc1, which is present in mitochondria in approximately a 1,000-fold excess over Ssq1, is required for Yfh1 import into the matrix, while Ssq1 is necessary for the efficient processing of the intermediate to the mature form in isolated mitochondria. However, the steady-state level of mature Yfh1 in Deltassq1 mitochondria is approximately 75% of that found in wild-type mitochondria, indicating that this retardation in processing does not dramatically affect cellular concentrations. Therefore, Ssq1 likely has roles in addition to facilitating the processing of Yfh1. Twofold overexpression of Ssc1 partially suppresses the cold-sensitive growth phenotype of Deltassq1 cells, as well as the accumulation of mitochondrial iron and the defects in Fe/S enzyme activities normally found in Deltassq1 mitochondria. Deltassq1 mitochondria containing twofold-more Ssc1 efficiently converted the intermediate form of Yfh1 to the mature form. This correlation between the observed processing defect and suppression of in vivo phenotypes suggests that Ssc1 is able to carry out the functions of Ssq1, but only when present in approximately a 2,000-fold excess over normal levels

  14. The Danish Superconducting Cable Project

    DEFF Research Database (Denmark)

    Tønnesen, Ole

    1997-01-01

    The design and construction of a superconducting cable is described. The cable has a room temperature dielectric design with the cryostat placed inside the electrical insulation.BSCCO 2223 superconducting tapes wound in helix form around a former are used as the cable conductor. Results from...

  15. Superconducting bearings for flywheel applications

    DEFF Research Database (Denmark)

    Abrahamsen, A.B.

    2001-01-01

    A literature study on the application of superconducting bearings in energy storage flywheel systems. The physics of magnetic levitation and superconductors are presented in the first part of the report, followed by a discussion of the literature found onthe applications of superconducting bearings...

  16. A superconducting magnetic gear

    Science.gov (United States)

    Campbell, A. M.

    2016-05-01

    A comparison is made between a magnetic gear using permanent magnets and superconductors. The objective is to see if there are any fundamental reasons why superconducting magnets should not provide higher power densities than permanent magnets. The gear is based on the variable permeability design of Attilah and Howe (2001 IEEE Trans. Magn. 37 2844-46) in which a ring of permanent magnets surrounding a ring of permeable pole pieces with a different spacing gives an internal field component at the beat frequency. Superconductors can provide much larger fields and forces but will saturate the pole pieces. However the gear mechanism still operates, but in a different way. The magnetisation of the pole pieces is now constant but rotates with angle at the beat frequency. The result is a cylindrical Halbach array which produces an internal field with the same symmetry as in the linear regime, but has an analytic solution. In this paper a typical gear system is analysed with finite elements using FlexPDE. It is shown that the gear can work well into the saturation regime and that the Halbach array gives a good approximation to the results. Replacing the permanent magnets with superconducting tapes can give large increases in torque density, and for something like a wind turbine a combined gear and generator is possible. However there are major practical problems. Perhaps the most fundamental is the large high frequency field which is inevitably present and which will cause AC losses. Also large magnetic fields are required, with all the practical problems of high field superconducting magnets in rotating machines. Nevertheless there are ways of mitigating these difficulties and it seems worthwhile to explore the possibilities of this technology further.

  17. Superconductivity in a chiral nanotube

    Science.gov (United States)

    Qin, F.; Shi, W.; Ideue, T.; Yoshida, M.; Zak, A.; Tenne, R.; Kikitsu, T.; Inoue, D.; Hashizume, D.; Iwasa, Y.

    2017-02-01

    Chirality of materials are known to affect optical, magnetic and electric properties, causing a variety of nontrivial phenomena such as circular dichiroism for chiral molecules, magnetic Skyrmions in chiral magnets and nonreciprocal carrier transport in chiral conductors. On the other hand, effect of chirality on superconducting transport has not been known. Here we report the nonreciprocity of superconductivity--unambiguous evidence of superconductivity reflecting chiral structure in which the forward and backward supercurrent flows are not equivalent because of inversion symmetry breaking. Such superconductivity is realized via ionic gating in individual chiral nanotubes of tungsten disulfide. The nonreciprocal signal is significantly enhanced in the superconducting state, being associated with unprecedented quantum Little-Parks oscillations originating from the interference of supercurrent along the circumference of the nanotube. The present results indicate that the nonreciprocity is a viable approach toward the superconductors with chiral or noncentrosymmetric structures.

  18. Japan. Superconductivity for Smart Grids

    Energy Technology Data Exchange (ETDEWEB)

    Hayakawa, K.

    2012-11-15

    Currently, many smart grid projects are running or planned worldwide. These aim at controlling the electricity supply more efficiently and more stably in a new power network system. In Japan, especially superconductivity technology development projects are carried out to contribute to the future smart grid. Japanese cable makers such as Sumitomo Electric and Furukawa Electric are leading in the production of high-temperature superconducting (HTS) power cables. The world's largest electric current and highest voltage superconductivity proving tests have been started this year. Big cities such as Tokyo will be expected to introduce the HTS power cables to reduce transport losses and to meet the increased electricity demand in the near future. Superconducting devices, HTS power cables, Superconducting Magnetic Energy Storage (SMES) and flywheels are the focus of new developments in cooperations between companies, universities and research institutes, funded by the Japanese research and development funding organization New Energy and Industrial Technology Development Organization (NEDO)

  19. Superconducting dipole electromagnet

    Science.gov (United States)

    Purcell, John R.

    1977-07-26

    A dipole electromagnet of especial use for bending beams in particle accelerators is wound to have high uniformity of magnetic field across a cross section and to decrease evenly to zero as the ends of the electromagnet are approached by disposing the superconducting filaments of the coil in the crescent-shaped nonoverlapping portions of two intersecting circles. Uniform decrease at the ends is achieved by causing the circles to overlap increasingly in the direction of the ends of the coil until the overlap is complete and the coil is terminated.

  20. 100 years of superconductivity

    CERN Multimedia

    Globe Info

    2011-01-01

    Public lecture by Philippe Lebrun, who works at CERN on applications of superconductivity and cryogenics for particle accelerators. He was head of CERN’s Accelerator Technology Department during the LHC construction period. Centre culturel Jean Monnet, route de Gex Tuesday 11 October from 8.30 p.m. to 10.00 p.m. » Suitable for all – Admission free - Lecture in French » Number of places limited For further information: +33 (0)4 50 42 29 37

  1. TOPICAL REVIEW: Superconducting bearings

    Science.gov (United States)

    Hull, John R.

    2000-02-01

    The physics and technology of superconducting bearings is reviewed. Particular attention is given to the use of high-temperature superconductors (HTSs) in rotating bearings. The basic phenomenology of levitational forces is presented, followed by a brief discussion of the theoretical models that can be used for conceptual understanding and calculations. The merits of various HTS bearing designs are presented, and the behaviour of HTS bearings in typical situations is discussed. The article concludes with a brief survey of various proposed applications for HTS bearings.

  2. Conventional and unconventional superconductivity

    Science.gov (United States)

    Fernandes, R. M.

    2012-02-01

    Superconductivity has been one of the most fruitful areas of research in condensed matter physics, bringing together researchers with distinct interests in a collaborative effort to understand from its microscopic basis to its potential for unprecedented technological applications. The concepts, techniques, and methods developed along its centennial history have gone beyond the realm of condensed matter physics and influenced the development of other fascinating areas, such as particle physics and atomic physics. These notes, based on a set of lectures given at the 2011 Advanced Summer School of Cinvestav, aim to motivate the young undergraduate student in getting involved in the exciting world of conventional and unconventional superconductors.

  3. Superconductivity from correlated hopping

    CERN Document Server

    Batista, C D; Aligia, A A

    1995-01-01

    We consider a chain described by a next-nearest-neighbor hopping combined with a nearest-neighbor spin flip. In two dimensions this three-body term arises from a mapping of the three-band Hubbard model for CuO$_2$ planes to a generalized $t-J$ model and for large O-O hopping favors resonance-valence-bond superconductivity of predominantly $d$-wave symmetry. Solving the ground state and low-energy excitations by analytical and numerical methods we find that the chain is a Luther-Emery liquid with correlation exponent $K_{\\rho} = (2-n)^2/2$, where $n$ is the particle density.

  4. Superconductivity in nanowires

    CERN Document Server

    Bezryadin, Alexey

    2012-01-01

    The importance and actuality of nanotechnology is unabated and will be for years to come. A main challenge is to understand the various properties of certain nanostructures, and how to generate structures with specific properties for use in actual applications in Electrical Engineering and Medicine.One of the most important structures are nanowires, in particular superconducting ones. They are highly promising for future electronics, transporting current without resistance and at scales of a few nanometers. To fabricate wires to certain defined standards however, is a major challenge, and so i

  5. Introduction to superconductivity

    CERN Document Server

    Rose-Innes, AC

    1978-01-01

    Introduction to Superconductivity differs from the first edition chiefly in Chapter 11, which has been almost completely rewritten to give a more physically-based picture of the effects arising from the long-range coherence of the electron-waves in superconductors and the operation of quantum interference devices. In this revised second edition, some further modifications have been made to the text and an extra chapter dealing with """"high-temperature"""" superconductors has been added. A vast amount of research has been carried out on these since their discovery in 1986 but the results, both

  6. Superconducting Electronic Film Structures

    Science.gov (United States)

    1991-02-14

    cubic, yttria stabilized, zirconia (YSZ) single crystals with (100) orientation and ao = 0.512 to 0.516 nm. Films were magnetron-sputtered... Crown by Solid-State and Vapor-Phase Epitaxy," IEEE Trans. Uagn. 25(2), 2538 (1989). 6. J. H. Kang, R. T. Kampwirth, and K. E. Gray, "Superconductivity...summarized in Fig. 1, are too high for SrTiO3 or yttria- stabilized zirconia (YSZ) to be used in rf applications. MgO, LaAIO 3 , and LaGaO3 have a tan 6

  7. Heavy fermion superconductivity

    Science.gov (United States)

    Brison, Jean-Pascal; Glémot, Loı̈c; Suderow, Hermann; Huxley, Andrew; Kambe, Shinsaku; Flouquet, Jacques

    2000-05-01

    The quest for a precise identification of the symmetry of the order parameter in heavy fermion systems has really started with the discovery of the complex superconducting phase diagram in UPt 3. About 10 years latter, despite numerous experiments and theoretical efforts, this is still not achieved, and we will quickly review the present status of knowledge and the main open question. Actually, the more forsaken issue of the nature of the pairing mechanism has been recently tackled by different groups with macroscopic or microscopic measurement, and significant progress have been obtained. We will discuss the results emerging from these recent studies which all support non-phonon-mediated mechanisms.

  8. Improving the design and analysis of superconducting magnets for particle accelerators

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, Ramesh Chandra [Univ. of Rajasthan, Jaipur (India). Dept. of Physics

    1996-11-01

    High energy particle accelerators are now the primary means of discovering the basic building blocks of matter and understanding the forces between them. In order to minimize the cost of building these machines, superconducting magnets are used in essentially all present day high energy proton and heavy ion colliders. The cost of superconducting magnets is typically in the range of 20--30% of the total cost of building such machines. The circulating particle beam goes through these magnets a large number of times (over hundreds of millions). The luminosity performance and life time of the beam in these machines depends significantly on the field quality in these magnets. Therefore, even a small error in the magnetic field shape may create a large cumulative effect in the beam trajectory to throw the particles of the magnet aperture. The superconducting accelerator magnets must, therefore, be designed and constructed so that these errors are small. In this thesis the research and development work will be described 3which has resulted in significant improvements in the field quality of the superconducting magnets for the Relativistic Heavy Ion Collider (RHIC). The design and the field quality improvements in the prototype of the main collider dipole magnet for the Superconducting Super Collider (SSC) will also be presented. RHIC will accelerate and collide two counter rotating beams of heavy ions up to 100 GeV/u and protons up to 250 GeV. It is expected that RHIC will create a hot, dense quark-gluon plasma and the conditions which, according to the Big Bang theory, existed in the early universe.

  9. Overview on superconducting photoinjectors

    CERN Document Server

    Arnold, A

    2011-01-01

    The success of most of the proposed energy recovery linac (ERL) based electron accelerator projects for future storage ring replacements (SRR) and high power IR–free-electron lasers (FELs) largely depends on the development of an appropriate source. For example, to meet the FEL specifications [J.W. Lewellen, Proc. SPIE Int. Soc. Opt. Eng. 5534, 22 (2004)] electron beams with an unprecedented combination of high brightness, low emittance (0.1 µmrad), and high average current (hundreds of mA) are required. An elegant way to create a beam of such quality is to combine the high beam quality of a normal conducting rf photoinjector with the superconducting technology, i.e., to build a superconducting rf photoinjector (SRF gun). SRF gun R&D programs based on different approaches have been launched at a growing number of institutes and companies (AES, Beijing University, BESSY, BNL, DESY, FZD, TJNAF, Niowave, NPS, Wisconsin University). Substantial progress was achieved in recent years and the first long term ...

  10. Overview of Superconducting Photoinjectors

    CERN Document Server

    Arnold, A

    2009-01-01

    The success of most of the proposed ERL based electron accelerator projects for future storage ring replacements (SRR) and high power IR-FELs is contingent upon the development of an appropriate source. Electron beams with an unprecedented combination of high brightness, low emittance (0.1 µm rad) and high average current (hundreds of mA) are required to meet the FEL specification [1]. An elegant way to create such an unique beam is to combine the high beam quality of a normal conducting RF photo injector with the superconducting technology to get a superconducting RF photo injector (SRF gun). SRF gun R&D programs based on different approaches are under investigation at a growing number of institutes and companies (AES, Beijing University, BESSY, BNL, DESY, FZD, JLab, Niowave, NPS, Wisconsin University). Lot of progress could be achieved during the last years and first long term operation was demonstrated at the FZD [2]. In the near future, this effort will lead to SRF guns, which are indispensab...

  11. Superconducting magnets for MRI

    Energy Technology Data Exchange (ETDEWEB)

    Williams, J.E.

    1984-08-01

    Three types of magnets are currently used to provide the background field required for magnet resonance imaging (MRI). (i) Permanent magnets produce fields of up to 0.3 T in volumes sufficient for imaging the head or up to 0.15 T for whole body imaging. Cost and simplicity of operation are advantages, but relatively low field, weight (up to 100 tonnes) and, to a small extent, instability are limitations. (ii) Water-cooled magnets provide fields of up to 0.25 T in volumes suitable for whole body imaging, but at the expense of power (up to 150 kW for 0.25 T) and water-cooling. Thermal stability of the field requires the maintenance of constant temperature through periods both of use and of quiescence. (iii) Because of the limitations imposed by permanent and resistive magnets, particularly on field strength, the superconducting magnet is now most widely used to provide background fields of up to 2 T for whole body MRI. It requires very low operating power and that only for refrigeration. Because of the constant low temperature, 4.2 K, at which its stressed structure operates, its field is stable. The following review deals principally with superconducting magnets for MRI. However, the sections on field analysis apply to all types of magnet and the description of the source terms of circular coils and of the principals of design of solenoids apply equally to resistive solenoidal magnets.

  12. Superconductivity in doped Dirac semimetals

    Science.gov (United States)

    Hashimoto, Tatsuki; Kobayashi, Shingo; Tanaka, Yukio; Sato, Masatoshi

    2016-07-01

    We theoretically study intrinsic superconductivity in doped Dirac semimetals. Dirac semimetals host bulk Dirac points, which are formed by doubly degenerate bands, so the Hamiltonian is described by a 4 ×4 matrix and six types of k -independent pair potentials are allowed by the Fermi-Dirac statistics. We show that the unique spin-orbit coupling leads to characteristic superconducting gap structures and d vectors on the Fermi surface and the electron-electron interaction between intra and interorbitals gives a novel phase diagram of superconductivity. It is found that when the interorbital attraction is dominant, an unconventional superconducting state with point nodes appears. To verify the experimental signature of possible superconducting states, we calculate the temperature dependence of bulk physical properties such as electronic specific heat and spin susceptibility and surface state. In the unconventional superconducting phase, either dispersive or flat Andreev bound states appear between point nodes, which leads to double peaks or a single peak in the surface density of states, respectively. As a result, possible superconducting states can be distinguished by combining bulk and surface measurements.

  13. Meissner effect in superconducting microtraps

    Energy Technology Data Exchange (ETDEWEB)

    Cano, Daniel

    2009-04-30

    This thesis investigates the impact of the Meissner effect on magnetic microtraps for ultracold atoms near superconducting microstructures. This task has been accomplished both theoretically and experimentally. The Meissner effect distorts the magnetic fields near superconducting surfaces, thus altering the parameters of magnetic microtraps. Both computer simulations and experimental measurements demonstrate that the Meissner effect shortens the distance between the magnetic microtrap and the superconducting surface, reduces the magnetic-field gradients and dramatically lowers the trap depth. A novel numerical method for calculating magnetic fields in atom chips with superconducting microstructures has been developed. This numerical method overcomes the geometrical limitations of other calculation techniques and can solve superconducting microstructures of arbitrary geometry. The numerical method has been used to calculate the parameters of magnetic microtraps in computer-simulated chips containing thin-film wires. Simulations were carried out for both the superconducting and the normal-conducting state, and the differences between the two cases were analyzed. Computer simulations have been contrasted with experimental measurements. The experimental apparatus generates a magnetic microtrap for ultracold Rubidium atoms near a superconducting Niobium wire of circular cross section. The design and construction of the apparatus has met the challenge of integrating the techniques for producing atomic quantum gases with the techniques for cooling solid bodies to cryogenic temperatures. By monitoring the position of the atom cloud, one can observe how the Meissner effect influences the magnetic microtrap. (orig.)

  14. Correlation of delta high-resolution computed tomography (HRCT) score with delta clinical variables in early systemic sclerosis (SSc) patients

    Science.gov (United States)

    Euathrongchit, Juntima; Wattanawittawas, Pittaporn; Kasitanon, Nuntana

    2016-01-01

    Background The correlation of changes (delta: Δ) of high-resolution computed tomography (HRCT) score with the Δ of other clinical variables has not been well studied. The purpose of this study was to determine the correlation of Δ HRCT score with Δ percent predicted forced vital capacity (%pFVC), Δ modified Rodnan Skin Score (mRSS), Δ erythrocyte sedimentation rate (ESR), and Δ percent of oxygen saturation at room air (%SpO2) in patients with early systemic sclerosis (SSc). Methods We used an inception cohort of early-SSc patients seen at the Rheumatology Clinic, Chiang Mai University, Thailand, between January 2010 and June 2014. All patients underwent HRCT at study entry and every 12 months thereafter. Thirty-one SSc patients who underwent pulmonary function test (PFT) within 12 weeks of their corresponding HRCT at baseline and last visit were identified. The extent of ground glass (GG), lung fibrosis (Fib), bronchiectasis (B), and honeycombing (HC) was scored, and then aggregated to produce a total (t) HRCT score. Results Mean ± SD age and disease duration from non-Raynaud’s phenomenon (NRP) to undergo HRCT at baseline were 52.2±8.8 years and 11.7±7.1 months, respectively. Seventeen (54.8%) patients were female and 20 (64.5%) were classified as dcSSc. The mean ± SD interval between the two HRCT tests was 16.0±7.2 months. The Δ HRCT scores [total fibrosis scores (t-Fib), total bronchiectasis scores (t-B), and total HRCT score (t-HRCT) scores] and Δ mRSS, but not Δ %pFVC, showed significant change over the observation period. We found significant correlation of Δ total honeycombing scores (t-HC) with Δ ESR (r=−0.44, P<0.05), and Δ t-Fib with Δ %SpO2 (r=−0.38, P<0.05). However, no significant correlation of any Δ HRCT scores with Δ %pFVC and Δ mRSS were observed. Conclusions In this study, the changes in the HRCT scores were greater than %pFVC; this, along with their correlations with the changes in ESR and %SpO2, suggest that HRCT

  15. Operational Merits of Maritime Superconductivity

    Science.gov (United States)

    Ross, R.; Bosklopper, J. J.; van der Meij, K. H.

    The perspective of superconductivity to transfer currents without loss is very appealing in high power applications. In the maritime sector many machines and systems exist in the roughly 1-100 MW range and the losses are well over 50%, which calls for dramatic efficiency improvements. This paper reports on three studies that aimed at the perspectives of superconductivity in the maritime sector. It is important to realize that the introduction of superconductivity comprises two technology transitions namely firstly electrification i.e. the transition from mechanical drives to electric drives and secondly the transition from normal to superconductive electrical machinery. It is concluded that superconductivity does reduce losses, but its impact on the total energy chain is of little significance compared to the investments and the risk of introducing a very promising but as yet not proven technology in the harsh maritime environment. The main reason of the little impact is that the largest losses are imposed on the system by the fossil fueled generators as prime movers that generate the electricity through mechanical torque. Unless electric power is supplied by an efficient and reliable technology that does not involve mechanical torque with the present losses both normal as well as superconductive electrification of the propulsion will hardly improve energy efficiency or may even reduce it. One exception may be the application of degaussing coils. Still appealing merits of superconductivity do exist, but they are rather related to the behavior of superconductive machines and strong magnetic fields and consequently reduction in volume and mass of machinery or (sometimes radically) better performance. The merits are rather convenience, design flexibility as well as novel applications and capabilities which together yield more adequate systems. These may yield lower operational costs in the long run, but at present the added value of superconductivity rather seems more

  16. Spinon Superconductivity and Superconductivities Mediated by Spin-Waves and Phonons in Cuprates

    OpenAIRE

    Mourachkine, A.

    1998-01-01

    The disclosure of spinon superconductivity and superconductivity mediated by spin-waves in hole-doped Bi2212 cuprate raises the question about the origin of the superconductivity in other cuprates and specially in an electron-doped NCCO cuprate.

  17. Superconducting interfaces between insulating oxides.

    Science.gov (United States)

    Reyren, N; Thiel, S; Caviglia, A D; Kourkoutis, L Fitting; Hammerl, G; Richter, C; Schneider, C W; Kopp, T; Rüetschi, A-S; Jaccard, D; Gabay, M; Muller, D A; Triscone, J-M; Mannhart, J

    2007-08-31

    At interfaces between complex oxides, electronic systems with unusual electronic properties can be generated. We report on superconductivity in the electron gas formed at the interface between two insulating dielectric perovskite oxides, LaAlO3 and SrTiO3. The behavior of the electron gas is that of a two-dimensional superconductor, confined to a thin sheet at the interface. The superconducting transition temperature of congruent with 200 millikelvin provides a strict upper limit to the thickness of the superconducting layer of congruent with 10 nanometers.

  18. Antiferromagnetic hedgehogs with superconducting cores

    Energy Technology Data Exchange (ETDEWEB)

    Goldbart, P.M.; Sheehy, D.E. [Department of Physics and Materials Research Laboratory, University of Illinois at Urbana-Champaign, Urbana, Illinois 61801 (United States)

    1998-09-01

    Excitations of the antiferromagnetic state that resemble antiferromagnetic hedgehogs at large distances but are predominantly superconducting inside a core region are discussed within the context of Zhang{close_quote}s SO(5)-symmetry-based approach to the physics of high-temperature superconducting materials. Nonsingular, in contrast with their hedgehog cousins in pure antiferromagnetism, these texture excitations are what hedgehogs become when the antiferromagnetic order parameter is permitted to {open_quotes}escape{close_quotes} into superconducting directions. The structure of such excitations is determined in a simple setting, and a number of their experimental implications are examined. {copyright} {ital 1998} {ital The American Physical Society}

  19. Superconducting cable connections and methods

    Energy Technology Data Exchange (ETDEWEB)

    van der Laan, Daniel Cornelis

    2017-09-05

    Superconducting cable connector structures include a terminal body (or other structure) onto which the tapes from the superconducting cable extend. The terminal body (or other structure) has a diameter that is sufficiently larger than the diameter of the former of the superconducting cable, so that the tapes spread out over the outer surface of the terminal body. As a result, gaps are formed between tapes on the terminal body (or other structure). Those gaps are filled with solder (or other suitable flowable conductive material), to provide a current path of relatively high conductivity in the radial direction. Other connector structures omit the terminal body.

  20. Domain wall description of superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Brito, F.A. [Departamento de Física, Universidade Federal de Campina Grande, Caixa Postal 10071, 58109-970 Campina Grande, Paraíba (Brazil); Freire, M.L.F. [Departamento de Física, Universidade Estadual da Paraíba, 58109-753 Campina Grande, Paraíba (Brazil); Mota-Silva, J.C. [Departamento de Física, Universidade Federal de Campina Grande, Caixa Postal 10071, 58109-970 Campina Grande, Paraíba (Brazil); Departamento de Física, Universidade Federal da Paraíba, Caixa Postal 5008, 58051-970 João Pessoa, Paraíba (Brazil)

    2014-01-20

    In the present work we shall address the issue of electrical conductivity in superconductors in the perspective of superconducting domain wall solutions in the realm of field theory. We take our set up made out of a dynamical complex scalar field coupled to gauge field to be responsible for superconductivity and an extra scalar real field that plays the role of superconducting domain walls. The temperature of the system is interpreted through the fact that the soliton following accelerating orbits is a Rindler observer experiencing a thermal bath.

  1. Aspects of Color Superconductivity

    CERN Document Server

    Hong, D K

    2001-01-01

    I discuss some aspects of recent developments in color superconductivity in high density quark matter. I calculate the Cooper pair gap and the critical points at high density, where magnetic gluons are not screened. The ground state of high density QCD with three light flavors is shown to be a color-flavor locking state, which can be mapped into the low-density hadronic phase. The meson mass at the CFL superconductor is also calculated. The CFL color superconductor is bosonized, where the Fermi sea is identified as a $Q$-matter and the gapped quarks as topological excitations, called superqualitons, of mesons. Finally, as an application of color supercoductivity, I discuss the neutrino interactions in the CFL color superconductor.

  2. Superconducting Hadron Linacs

    CERN Document Server

    Ostroumov, Peter

    2013-01-01

    This article discusses the main building blocks of a superconducting (SC) linac, the choice of SC resonators, their frequencies, accelerating gradients and apertures, focusing structures, practical aspects of cryomodule design, and concepts to minimize the heat load into the cryogenic system. It starts with an overview of design concepts for all types of hadron linacs differentiated by duty cycle (pulsed or continuous wave) or by the type of ion species (protons, H-, and ions) being accelerated. Design concepts are detailed for SC linacs in application to both light ion (proton, deuteron) and heavy ion linacs. The physics design of SC linacs, including transverse and longitudinal lattice designs, matching between different accelerating–focusing lattices, and transition from NC to SC sections, is detailed. Design of high-intensity SC linacs for light ions, methods for the reduction of beam losses, preventing beam halo formation, and the effect of HOMs and errors on beam quality are discussed. Examples are ta...

  3. Superconducting energy storage

    Energy Technology Data Exchange (ETDEWEB)

    Giese, R.F.

    1993-10-01

    This report describes the status of energy storage involving superconductors and assesses what impact the recently discovered ceramic superconductors may have on the design of these devices. Our description is intended for R&D managers in government, electric utilities, firms, and national laboratories who wish an overview of what has been done and what remains to be done. It is assumed that the reader is acquainted with superconductivity, but not an expert on the topics discussed here. Indeed, it is the author`s aim to enable the reader to better understand the experts who may ask for the reader`s attention, support, or funding. This report may also inform scientists and engineers who, though expert in related areas, wish to have an introduction to our topic.

  4. Anyon Superconductivity of Sb

    Science.gov (United States)

    Maksoed, Wh-; Parengkuan, August

    2016-10-01

    In any permutatives to Pedro P. Kuczhynski from Peru, for anyon superconductivity sought EZ Kuchinskii et al.: ``Anion height dependence of Tc & d.o.s of Fe-based Superconductors'', 2010 as well as ``on the basis of electron microscopy & AFM measurements, these phenomena are quantified with focus on fractal dimension, particle perimeter & size of the side branch(tip width) in bert Stegemann et al.:Crystallization of Sb nanoparticles-Pattern Formation & Fractal Growth'', J.PhysChem B., 2004. For dendritic & dendrimer fractal characters shown further: ``antimony denrites were found to be composed of well-crystallized nanoflakes with size 20-4 nm''- Bou Zhau, et al., MaterialLetters, 59 (2005). The alkyl triisopropyl attached in TIPSb those includes in DNA, haemoglobin membrane/fixed-bed reactor for instance quotes in Dragony Fu, Nature Review Cancer, 12 (Feb 2012). Heartfelt Gratitudes to HE. Mr. Prof. Ir. Handojo.

  5. Superconductivity of columbium

    Energy Technology Data Exchange (ETDEWEB)

    Cook, D.B.; Zemansky, M.W.; Boorse, H.A.

    1950-11-15

    Isothermal critical magnetic field curves and zero field transitions for several annealed specimens of columbium have been measured by an a.c. mutual inductance method at temperatures from 5.1 deg K to the zero field transition temperature. The H-T curve was found to fit the usual parabolic relationship H = H{sub 0}(1-T(2)/T(2){sub 0}) with H{sub 0} = 8250 oersteds and T{sub 0} = 8.65 deg K. The initial slope of the curve was 1910 oersteds/deg. The electronic specific heat in the normal state calculated from the thermodynamic equations is 0.0375T and the approximate Debye characteristic temperature in the superconducting state, 67 deg K. Results on a different grade of columbium with a tantalum impurity of 0.4 percent, according to neutron scattering measurements, were in agreement, with the data obtained from columbium of 0.2 percent maximum tantalum impurity.

  6. Superconducting pulsed magnets

    CERN Document Server

    CERN. Geneva

    2006-01-01

    Lecture 1. Introduction to Superconducting Materials Type 1,2 and high temperature superconductors; their critical temperature, field & current density. Persistent screening currents and the critical state model. Lecture 2. Magnetization and AC Loss How screening currents cause irreversible magnetization and hysteresis loops. Field errors caused by screening currents. Flux jumping. The general formulation of ac loss in terms of magnetization. AC losses caused by screening currents. Lecture 3. Twisted Wires and Cables Filamentary composite wires and the losses caused by coupling currents between filaments, the need for twisting. Why we need cables and how the coupling currents in cables contribute more ac loss. Field errors caused by coupling currents. Lecture 4. AC Losses in Magnets, Cooling and Measurement Summary of all loss mechanisms and calculation of total losses in the magnet. The need for cooling to minimize temperature rise in a magnet. Measuring ac losses in wires and in magnets. Lecture 5. Stab...

  7. Particle-in-cell mode beam dynamics simulation of the low energy beam transport for the SSC-linac injector

    Institute of Scientific and Technical Information of China (English)

    XIAO Chen; HE Yuan; YUAN You-Jin; YAO Qing-Gao; WANG Zhi-Jun; CHANG Wei; LIU Yong; XIA Jia-Wen

    2011-01-01

    A new SSC-linac system (injector into separated sector cyclotron) is being designed in the HIRFL (heavy ion research facility of Lanzhou). As part of SSC-Linac, the LEBT (low energy beam transport) consists of seven solenoids, four quadrupoles, a bending magnet and an extra multi-harmonic buncher. The total length of this segment is about 7 meters. The beam dynamics in this LEBT has been studied using three-dimensional PIC (particle-in-cell) code BEAMPATH. The simulation results show that the continuous beam from the ion source is first well analyzed by a charge-to-mass selection system, and the beam of the selected charge-to-mass ratio is then efficiently pre-bunched by a multi-harmonic buncher and optimally matched into the RFQ (radio frequency quadrupole) for further acceleration. The principles and effects of the solenoid collimation channel are discussed, and it could limit the beam emittance by changing the aperture size.

  8. Overview on superconducting photoinjectors

    Directory of Open Access Journals (Sweden)

    A. Arnold

    2011-02-01

    Full Text Available The success of most of the proposed energy recovery linac (ERL based electron accelerator projects for future storage ring replacements (SRR and high power IR–free-electron lasers (FELs largely depends on the development of an appropriate source. For example, to meet the FEL specifications [J. W. Lewellen, Proc. SPIE Int. Soc. Opt. Eng. 5534, 22 (2004PSISDG0277-786X10.1117/12.557378] electron beams with an unprecedented combination of high brightness, low emittance (0.1  μmrad, and high average current (hundreds of mA are required. An elegant way to create a beam of such quality is to combine the high beam quality of a normal conducting rf photoinjector with the superconducting technology, i.e., to build a superconducting rf photoinjector (SRF gun. SRF gun R&D programs based on different approaches have been launched at a growing number of institutes and companies (AES, Beijing University, BESSY, BNL, DESY, FZD, TJNAF, Niowave, NPS, Wisconsin University. Substantial progress was achieved in recent years and the first long term operation was demonstrated at FZD [R. Xiang et al., in Proceedings of the 31st International Free Electron Laser Conference (FEL 09, Liverpool, UK (STFC Daresbury Laboratory, Warrington, 2009, p. 488]. In the near future SRF guns are expected to play an important role for linac-driven FEL facilities. In this paper we will review the concepts, the design parameters, and the status of the major SRF gun projects.

  9. Glucocorticoid-induced leucine zipper (GILZ regulates testicular FOXO1 activity and spermatogonial stem cell (SSC function.

    Directory of Open Access Journals (Sweden)

    Devi Ngo

    Full Text Available Spermatogonia stem cell (SSC self-renewal and differentiation are tightly regulated processes that ensure a continued production of mature sperm throughout male adulthood. In the present study, we investigated the role of glucocorticoid-induced leucine zipper (GILZ in maintenance of the male germline and spermatogenesis. GILZ was detectable in germ cells of wild type mice on the day of birth, suggesting a role for GILZ in prospermatogonia and SSC pool formation. Gilz KO mice were generated and adult males were azoospermic and sterile. During the first wave of spermatogenesis in Gilz KO mice, spermatogenesis arrested part way through pachytene of meiosis I. Subsequent waves resulted in a progressive depletion of germ cells through apoptosis to ultimately produce a Sertoli cell-only phenotype. Further, in contrast to wild type littermates, PLZF(+ cells were detected in the peri-luminal region of Gilz KO mice at day 6 post-natal, suggesting a defect in prospermatogonia migration in the absence of GILZ. At age 30 days, transient accumulation of PLZF(+ cells in a subset of tubules and severely compromised spermatogenesis were observed in Gilz KO mice, consistent with defective SSC differentiation. GILZ deficiency was associated with an increase in FOXO1 transcriptional activity, which leads to activation of a selective set of FOXO1 target genes, including a pro-apoptotic protein, BIM. On the other hand, no evidence of a heightened immune response was observed. Together, these results suggest that GILZ suppresses FOXO1 nuclear translocation, promotes SSC differentiation over self-renewal, and favours germ cell survival through inhibition of BIM-dependent pro-apoptotic signals. These findings provide a mechanism for the effects of GILZ on spermatogenesis and strengthen the case for GILZ being a critical molecule in the regulation of male fertility.

  10. Superconducting Aero Propulsion Motor Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Superconducting electric propulsion systems will yield improvements in total ownership costs due to the simplicity of electric drive when compared with gas turbine...

  11. Mixed-mu superconducting bearings

    Energy Technology Data Exchange (ETDEWEB)

    Hull, John R. (Hinsdale, IL); Mulcahy, Thomas M. (Western Springs, IL)

    1998-01-01

    A mixed-mu superconducting bearing including a ferrite structure disposed for rotation adjacent a stationary superconductor material structure and a stationary permanent magnet structure. The ferrite structure is levitated by said stationary permanent magnet structure.

  12. Superconductivity in all its states

    CERN Multimedia

    Globe Info

    2011-01-01

    Temporary exhibition at the Saint-Genis-Pouilly Tourist Office. For the 100th anniversary of its discovery, take a plunge into the amazing world of superconductivity. Some materials, when cooled down to extreme temperatures, acquire a remarkable property -  they become superconducting. Superconductivity is a rare example of a quantum effect that can be witnessed on the macroscopic scale and is today at the heart of much research. In laboratories, researchers try to gain a better understanding of its origins, study new superconducting materials, explore the phenomenon at the nanometric scale and pursue their indefatigable search for new applications. Monday to Friday: 09:00 a.m. to 12:00 and 2:30 p.m. to 6:30 p.m. Saturday: 10:00 a.m. to 12:00 noon » Open to all – Admission free For further information: +33 (0)4 50 42 29 37

  13. Search for superconductivity in micrometeorites.

    Science.gov (United States)

    Guénon, S; Ramírez, J G; Basaran, Ali C; Wampler, J; Thiemens, M; Taylor, S; Schuller, Ivan K

    2014-12-05

    We have developed a very sensitive, highly selective, non-destructive technique for screening inhomogeneous materials for the presence of superconductivity. This technique, based on phase sensitive detection of microwave absorption is capable of detecting 10(-12) cc of a superconductor embedded in a non-superconducting, non-magnetic matrix. For the first time, we apply this technique to the search for superconductivity in extraterrestrial samples. We tested approximately 65 micrometeorites collected from the water well at the Amundsen-Scott South pole station and compared their spectra with those of eight reference materials. None of these micrometeorites contained superconducting compounds, but we saw the Verwey transition of magnetite in our microwave system. This demonstrates that we are able to detect electro-magnetic phase transitions in extraterrestrial materials at cryogenic temperatures.

  14. Advanced Superconducting Test Accelerator (ASTA)

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Superconducting Test Accelerator (ASTA) facility will be based on upgrades to the existing NML pulsed SRF facility. ASTA is envisioned to contain 3 to 6...

  15. Superconductivity in Layered Organic Metals

    Directory of Open Access Journals (Sweden)

    Jochen Wosnitza

    2012-04-01

    Full Text Available In this short review, I will give an overview on the current understanding of the superconductivity in quasi-two-dimensional organic metals. Thereby, I will focus on charge-transfer salts based on bis(ethylenedithiotetrathiafulvalene (BEDT-TTF or ET for short. In these materials, strong electronic correlations are clearly evident, resulting in unique phase diagrams. The layered crystallographic structure leads to highly anisotropic electronic as well as superconducting properties. The corresponding very high orbital critical field for in-plane magnetic-field alignment allows for the occurrence of the Fulde–Ferrell– Larkin–Ovchinnikov state as evidenced by thermodynamic measurements. The experimental picture on the nature of the superconducting state is still controversial with evidence both for unconventional as well as for BCS-like superconductivity.

  16. Advanced Superconducting Test Accelerator (ASTA)

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Superconducting Test Accelerator (ASTA) facility will be based on upgrades to the existing NML pulsed SRF facility. ASTA is envisioned to contain 3 to...

  17. Cryogenic Systems and Superconductive Power

    Science.gov (United States)

    The report defines, investigates, and experimentally evaluates the key elements of a representative crogenic turborefrigerator subsystem suitable for providing reliable long-lived cryogenic refrigeration for a superconductive ship propulsion system.

  18. Recent advances in fullerene superconductivity

    CERN Document Server

    Margadonna, S

    2002-01-01

    Superconducting transition temperatures in bulk chemically intercalated fulleride salts reach 33 K at ambient pressure and in hole-doped C sub 6 sub 0 derivatives in field-effect-transistor (FET) configurations, they reach 117 K. These advances pose important challenges for our understanding of high-temperature superconductivity in these highly correlated organic metals. Here we review the structures and properties of intercalated fullerides, paying particular attention to the correlation between superconductivity and interfullerene separation, orientational order/disorder, valence state, orbital degeneracy, low-symmetry distortions, and metal-C sub 6 sub 0 interactions. The metal-insulator transition at large interfullerene separations is discussed in detail. An overview is also given of the exploding field of gate-induced superconductivity of fullerenes in FET electronic devices.

  19. The superconducting bending magnets 'CESAR'

    CERN Document Server

    Pérot, J

    1978-01-01

    In 1975, CERN decided to build two high precision superconducting dipoles for a beam line in the SPS north experimental area. The aim was to determine whether superconducting magnets of the required accuracy and reliability can be built and what their economies and performances in operation will be. Collaboration between CERN and CAE /SACLAY was established in order to make use of the knowledge and experience already acquired in the two laboratories. (0 refs).

  20. Y-Ba Superconducting Ceramics

    Science.gov (United States)

    Shunbao, Tian; Xiaofei, Li; Tinglian, Wen; Zuxiang, Lin; Shichun, Li; Huijun, Yu

    Polycrystalline Y-Ba-Cu-O superconducting materials have been studied. It was found that chemical composition and processing condition may play an important role in the final structure and superconducting properties. The density has been determined and compared with the calculated value according to the structure model reported by Bell Labs. The grain size and the morphology of the materials were observed by SEM.

  1. Composite conductor containing superconductive wires

    Energy Technology Data Exchange (ETDEWEB)

    Larson, W.L.; Wong, J.

    1974-03-26

    A superconductor cable substitute made by coworking multiple rods of superconductive niobium--titanium or niobium--zirconium alloy with a common copper matrix to extend the copper and rods to form a final elongated product which has superconductive wires distributed in a reduced cross-section copper conductor with a complete metallurgical bond between the normal-conductive copper and the superconductor wires contained therein is described. The superconductor cable can be in the form of a tube.

  2. Entanglement witnessing in superconducting beamsplitters

    Science.gov (United States)

    Soller, H.; Hofstetter, L.; Reeb, D.

    2013-06-01

    We analyse a large class of superconducting beamsplitters for which the Bell parameter (CHSH violation) is a simple function of the spin detector efficiency. For these superconducting beamsplitters all necessary information to compute the Bell parameter can be obtained in Y-junction setups for the beamsplitter. Using the Bell parameter as an entanglement witness, we propose an experiment which allows to verify the presence of entanglement in Cooper pair splitters.

  3. Superconductivity in domains with corners

    DEFF Research Database (Denmark)

    Bonnaillie-Noel, Virginie; Fournais, Søren

    2007-01-01

    We study the two-dimensional Ginzburg-Landau functional in a domain with corners for exterior magnetic field strengths near the critical field where the transition from the superconducting to the normal state occurs. We discuss and clarify the definition of this field and obtain a complete...... asymptotic expansion for it in the large $\\kappa$ regime. Furthermore, we discuss nucleation of superconductivity at the boundary....

  4. Recent developments in superconducting materials including ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Tachikawa, Kyoji

    1987-06-01

    This report describes the history of superconduction starting in 1911, when the superconducting phenomenon was first observed in murcury, until the recent discovery of superconducting materials with high critical temperatures. After outlining the BCS theory, basic characteristics are discussed including the critical temperature, magnetic field and current density to be reached for realizing the superconducting state. Various techniques for practical superconducting materials are discussed, including methods for producing extra fine multiconductor wires from such superconducting alloys as Nb-Ti, intermetallic Nb/sub 3/Sn compound and V/sub 3/Ga, as well as methods for producing wires of Nb/sub 3/Al, Nb/sub 3/(Al, Ge) and Nb/sub 3/Ge such as continuous melt quenching, electron beam irradiation, laser beam irradiation and chemical evaporation. Characteristics of superconducting ceramics are described, along with their applications including superconducting magnets and superconducting elements. (15 figs, 1 tab, 19 refs)

  5. [Hyperspectral technology combined with CARS algorithm to quantitatively determine the SSC in Korla fragrant pear].

    Science.gov (United States)

    Zhan, Bai-Shao; Ni, Jun-Hui; Li, Jun

    2014-10-01

    Hyperspectral imaging has large data volume and high dimensionality, and original spectra data includes a lot of noises and severe scattering. And, quality of acquired hyperspectral data can be influenced by non-monochromatic light, external stray light and temperature, which resulted in having some non-linear relationship between the acquired hyperspectral data and the predicted quality index. Therefore, the present study proposed that competitive adaptive reweighted sampling (CARS) algorithm is used to select the key variables from visible and near infrared hyperspectral data. The performance of CARS was compared with full spectra, successive projections algorithm (SPA), Monte Carlo-uninformative variable elimination (MC-UVE), genetic algorithm (GA) and GA-SPA (genetic algorithm-successive projections algorithm). Two hundred Korla fragrant pears were used as research object. SPXY algorithm was used to divided sample set to correction set with 150 samples and prediction set with 50 samples, respectively. Based on variables selected by different methods, linear PLS and nonlinear LS-SVM models were developed, respectively, and the performance of models was assessed using parameters r2, RMSEP and RPD. A comprehensive comparison found that GA, GA-SPA and CARS can effectively select the variables with strong and useful information. These methods can be used for selection of Vis-NIR hyperspectral data variables, particularly for CARS. LS-SVM model can obtain the best results for SSC prediction of Korla fragrant pear based on variables obtained from CARS method. r2, RMSEP and RPD were 0.851 2, 0.291 3 and 2.592 4, respectively. The study showed that CARS is an effectively hyperspectral variable selection method, and nonlinear LS-SVM model is more suitable than linear PLS model for quantitatively determining the quality of fra- grant pear based on hyperspectral information.

  6. [Nondestructive measurement of SSC in western pear using genetic algorithms and FT-NIR spectroscopy].

    Science.gov (United States)

    Wang, Jia-Hua; Pan, Lu; Sun, Qian; Li, Peng-Fei; Han, Dong-Hai

    2009-03-01

    An improved genetic algorithm was used to implement an automated wavelength selection procedure for use in building multivariate calibration models based on partial least squares regression (PLS). The region selecting by genetic algorithms (R-SGA) was applied in building calibration model of soluble solid content (SSC) of Western pear, and the numbers of latent variables used to build calibration model were further reduced. The Fourier transform near infrared reflectance (FT-NIR) spectra were processed by GA after MSC or SNV, and four PLS calibration models were built by using the optimal combinations of these sub-regions. Meanwhile, the full region selecting PLS (Fr-PLS) models were developed. The R-SGA models variables were 434, 496, 310 and 496, for Early Red Comice, Wujiuxiang, Cascade and Kang Buddha, respectively. Despite the complexity of the spectral data, the R-SGA procedure was found to perform well (RMSEP = 0.428, 0.567 for Early Red Comice and Kang Buddha, respectively), leading to calibration models that significantly outperform those based on full-spectrum analyses (RM-SEP = 0.518, 0.633). The prediction precision of GA-PLS models was similar to that of Fr-PLS for Wujiuxiang and Cascade, with RMSEP of 0.696/0.694 and 0.425/0.421 respectively. This work proved that the R-SGA could find optimal values for several disparate variables associated with the calibration model and that the PLS procedure could be integrated into the objective function driving the optimization.

  7. Early assessment of sub-clinical cardiac involvement in systemic sclerosis (SSc) using delayed enhancement cardiac magnetic resonance (CE-MRI)

    Energy Technology Data Exchange (ETDEWEB)

    Di Cesare, Ernesto, E-mail: ernesto.dicesare@cc.univaq.it [Department of Radiology, University of L’Aquila, Via Vetoio 1, 67100 L’Aquila (Italy); Battisti, Sara; Di Sibio, Alessandra [Department of Radiology, University of L’Aquila, Via Vetoio 1, 67100 L’Aquila (Italy); Cipriani, Paola; Giacomelli, Roberto; Liakouli, Vasiliky; Ruscitti, Piero [Rheumatology Clinic, Department of Internal Medicine and Public Health, University of L’Aquila, L’Aquila (Italy); Masciocchi, Carlo [Department of Radiology, University of L’Aquila, Via Vetoio 1, 67100 L’Aquila (Italy)

    2013-06-15

    Objectives: Systemic sclerosis heart involvement (SHI) is one of systemic sclerosis (SSc) most frequent complications, both in diffuse (dcSSc) and limited (lcSSc) cutaneous forms of disease. Nowadays, SHI is a major factor decreasing SSc survival rate because, when clinically evident, is associated with 70% of mortality at 5 years. SHI shows different forms, primary and/or secondary. Primary myocardial SHI is characterized by fibrosis. Aim of our study is to assess the presence and pattern of fibrosis as detected by cardiac magnetic resonance (CMR) in systemic sclerosis. Methods: In this study, we used CE-MRI (contrast enhanced-MRI) in 58 female SSc patients. Images were evaluated to obtain functional parameters and to see presence, location and pattern (nodular, linear or diffuse) of myocardial LE, sign of fibrosis. CE-MRI findings were correlated with patients clinical setting. Results: Myocardial fibrosis was detected in 25 of 58 patients (43%). The main finding observed in 16 of these 25 patients was a late enhancement showing a linear pattern, without coronary distribution and sparing the sub-endocardial myocardial layers. A patchy nodular enhancement pattern was observed in 9 patients (36%). Patients with linear pattern presented dcSSc, on the contrary patients with nodular LE displayed the lcSSc form. Conclusions: This study shows that CE-MRI is a reliable technique to detect SHI earlier than other methods. SHI increase passive myocardial stiffness, proportional to collagen deposition degree, leading to cardiac remodelling with possible development of heart failure, even with normal ejection fraction. An early treatment of SHI might improve SSc patients outcome.

  8. The road to superconducting spintronics

    Science.gov (United States)

    Eschrig, Matthias

    Energy efficient computing has become a major challenge, with the increasing importance of large data centres across the world, which already today have a power consumption comparable to that of Spain, with steeply increasing trend. Superconducting computing is progressively becoming an alternative for large-scale applications, with the costs for cooling being largely outweighed by the gain in energy efficiency. The combination of superconductivity and spintronics - ``superspintronics'' - has the potential and flexibility to develop into such a green technology. This young field is based on the observation that new phenomena emerge at interfaces between superconducting and other, competing, phases. The past 15 years have seen a series of pivotal predictions and experimental discoveries relating to the interplay between superconductivity and ferromagnetism. The building blocks of superspintronics are equal-spin Cooper pairs, which are generated at the interface between superconducting and a ferromagnetic materials in the presence of non-collinear magnetism. Such novel, spin-polarised Cooper pairs carry spin-supercurrents in ferromagnets and thus contribute to spin-transport and spin-control. Geometric Berry phases appear during the singlet-triplet conversion process in structures with non-coplanar magnetisation, enhancing functionality of devices, and non-locality introduced by superconducting order leads to long-range effects. With the successful generation and control of equal-spin Cooper pairs the hitherto notorious incompatibility of superconductivity and ferromagnetism has been not only overcome, but turned synergistic. I will discuss these developments and their extraordinary potential. I also will present open questions posed by recent experiments and point out implications for theory. This work is supported by the Engineering and Physical Science Research Council (EPSRC Grant No. EP/J010618/1).

  9. The New Big Science: What's New, What's Not, and What's the Difference

    Science.gov (United States)

    Westfall, Catherine

    2016-03-01

    This talk will start with a brief recap of the development of the ``Big Science'' epitomized by high energy physics, that is, the science that flourished after WWII based on accelerators, teams, and price tags that grew ever larger. I will then explain the transformation that started in the 1980s and culminated in the 1990s when the Cold War ended and the next big machine needed to advance high energy physics, the multi-billion dollar Superconducting Supercollider (SSC), was cancelled. I will go on to outline the curious series of events that ushered in the New Big Science, a form of research well suited to a post-Cold War environment that valued practical rather than esoteric projects. To show the impact of the New Big Science I will describe how decisions were ``set into concrete'' during the development of experimental equipment at the Thomas Jefferson National Accelerator Facility in Newport News, Virginia.

  10. Modulator considerations for beam chopping in the low energy beam transport at the SSC Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, D.; Pappas, G.

    1991-06-01

    Beam chopping in the low energy transport line at the Superconducting Super Collider Laboratory is accomplished using an electrostatic deflection system. LINAC requirements dictate the design of two modulators operating at 10 Hz with rise and fall times (as measured from approximately 10--99%) of {approximately}100 ns. Design of the first pulser, normally at 10 kV and pulsed to ground potential, utilizes a transformer-coupled diode-clamped solid state circuit to achieve the 2--35 {mu}s pulse width range required. The second pulser, which pulses from ground to approximately 7 kV, relies on a series vacuum tube circuit. The current designs, as well as recent test results and other circuit topologies considered, will be presented. 6 refs.

  11. Superconductivity of lead

    Energy Technology Data Exchange (ETDEWEB)

    Boorse, H.A.; Cook, D.B.; Zemansky, W.M.

    1950-06-01

    Numerous determinations of the zero-field transition temperature of lead have been made. All of these observations except that of Daunt were made by the direct measurement of electrical resistance. Daunt`s method involved the shielding effect of persistent currents in a hollow cylinder. In the authors work on columbium to be described in a forthcoming paper an a.c. induction method was used for the measurement of superconducting transitions. The superconductor was mounted as a cylindrical core of a coil which functioned as the secondary of a mutual inductance. The primary coil was actuated by an oscillator which provided a maximum a.c. field within the secondary of 1.5 oersteds at a frequency of 1000 cycles per second. The secondary e.m.f. which was dependent for its magnitude on the permeability of the core was amplified, rectifie, and observed on a recording potentiometer. During the application of this method to the study of columbium it appeared that a further check on the zero-field transition temperature of lead would be worth while especially if agreement between results for very pure samples could be obtained using this method. Such result would help in establishing the lead transition temperature as a reasonably reproducible reference point in the region between 4 deg and 10 deg K.

  12. High temperature superconducting compounds

    Science.gov (United States)

    Goldman, Allen M.

    1992-11-01

    The major accomplishment of this grant has been to develop techniques for the in situ preparation of high-Tc superconducting films involving the use of ozone-assisted molecular beam epitaxy. The techniques are generalizable to the growth of trilayer and multilayer structures. Films of both the DyBa2Cu3O(7-x) and YBa2Cu3O(7-x) compounds as well as the La(2-x)Sr(x)CuO4 compound have been grown on the usual substrates, SrTiO3, YSZ, MgO, and LaAlO3, as well as on Si substrates without any buffer layer. A bolometer has been fabricated on a thermally isolated SiN substrate coated with YSZ, an effort carried out in collaboration with Honeywell Inc. The deposition process facilitates the fabrication of very thin and transparent films creating new opportunities for the study of superconductor-insulator transitions and the investigation of photo-doping with carriers of high temperature superconductors. In addition to a thin film technology, a patterning technology has been developed. Trilayer structures have been developed for FET devices and tunneling junctions. Other work includes the measurement of the magnetic properties of bulk single crystal high temperature superconductors, and in collaboration with Argonne National Laboratory, measurement of electric transport properties of T1-based high-Tc films.

  13. The Superconducting TESLA Cavities

    CERN Document Server

    Aune, B.; Bloess, D.; Bonin, B.; Bosotti, A.; Champion, M.; Crawford, C.; Deppe, G.; Dwersteg, B.; Edwards, D.A.; Edwards, H.T.; Ferrario, M.; Fouaidy, M.; Gall, P-D.; Gamp, A.; Gössel, A.; Graber, J.; Hubert, D.; Hüning, M.; Juillard, M.; Junquera, T.; Kaiser, H.; Kreps, G.; Kuchnir, M.; Lange, R.; Leenen, M.; Liepe, M.; Lilje, L.; Matheisen, A.; Möller, W-D.; Mosnier, A.; Padamsee, H.; Pagani, C.; Pekeler, M.; Peters, H-B.; Peters, O.; Proch, D.; Rehlich, K.; Reschke, D.; Safa, H.; Schilcher, T.; Schmüser, P.; Sekutowicz, J.; Simrock, S.; Singer, W.; Tigner, M.; Trines, D.; Twarowski, K.; Weichert, G.; Weisend, J.; Wojtkiewicz, J.; Wolff, S.; Zapfe, K.

    2000-01-01

    The conceptional design of the proposed linear electron-positron colliderTESLA is based on 9-cell 1.3 GHz superconducting niobium cavities with anaccelerating gradient of Eacc >= 25 MV/m at a quality factor Q0 > 5E+9. Thedesign goal for the cavities of the TESLA Test Facility (TTF) linac was set tothe more moderate value of Eacc >= 15 MV/m. In a first series of 27industrially produced TTF cavities the average gradient at Q0 = 5E+9 wasmeasured to be 20.1 +- 6.2 MV/m, excluding a few cavities suffering fromserious fabrication or material defects. In the second production of 24 TTFcavities additional quality control measures were introduced, in particular aneddy-current scan to eliminate niobium sheets with foreign material inclusionsand stringent prescriptions for carrying out the electron-beam welds. Theaverage gradient of these cavities at Q0 = 5E+9 amounts to 25.0 +- 3.2 MV/mwith the exception of one cavity suffering from a weld defect. Hence only amoderate improvement in production and preparation technique...

  14. Superconductivity basics and applications to magnets

    CERN Document Server

    Sharma, R G

    2015-01-01

    This book presents the basics and applications of superconducting magnets. It explains the phenomenon of superconductivity, theories of superconductivity, type II superconductors and high-temperature cuprate superconductors. The main focus of the book is on the application to superconducting magnets to accelerators and fusion reactors and other applications of superconducting magnets. The thermal and electromagnetic stability criteria of the conductors and the present status of the fabrication techniques for future magnet applications are addressed. The book is based on the long experience of the author in studying superconducting materials, building magnets and numerous lectures delivered to scholars. A researcher and graduate student will enjoy reading the book to learn various aspects of magnet applications of superconductivity. The book provides the knowledge in the field of applied superconductivity in a comprehensive way.

  15. Superconductive articles including cerium oxide layer

    Science.gov (United States)

    Wu, Xin D.; Muenchausen, Ross E.

    1993-01-01

    A ceramic superconductor comprising a metal oxide substrate, a ceramic high temperature superconductive material, and a intermediate layer of a material having a cubic crystal structure, said layer situated between the substrate and the superconductive material is provided, and a structure for supporting a ceramic superconducting material is provided, said structure comprising a metal oxide substrate, and a layer situated over the surface of the substrate to substantially inhibit interdiffusion between the substrate and a ceramic superconducting material deposited upon said structure.

  16. 4. MESOSCOPIC SUPERCONDUCTIVITY: Proximity Action theory of superconductive nanostructures

    Science.gov (United States)

    Skvortsov, M. A.; Larkin, A. I.; Feigel'man, M. V.

    2001-10-01

    We review a novel approach to the superconductive proximity effect in disordered normal-superconducting (N-S) structures. The method is based on the multicharge Keldysh action and is suitable for the treatment of interaction and fluctuation effects. As an application of the formalism, we study the subgap conductance and noise in two-dimensional N-S systems in the presence of the electron-electron interaction in the Cooper channel. It is shown that singular nature of the interaction correction at large scales leads to a nonmonotonuos temperature, voltage and magnetic field dependence of the Andreev conductance.

  17. Superconducting Metallic Glass Transition-Edge-Sensors

    Science.gov (United States)

    Hays, Charles C. (Inventor)

    2013-01-01

    A superconducting metallic glass transition-edge sensor (MGTES) and a method for fabricating the MGTES are provided. A single-layer superconducting amorphous metal alloy is deposited on a substrate. The single-layer superconducting amorphous metal alloy is an absorber for the MGTES and is electrically connected to a circuit configured for readout and biasing to sense electromagnetic radiation.

  18. Gifts from the superconducting curiosity shop

    Institute of Scientific and Technical Information of China (English)

    David Mandrus

    2011-01-01

    Superconductivity has just celebrated its 100th birthday,and yet despite its advanced age it has never been more alive.Given that most subfields of materials physics have a half-life of about seven years,what accounts for the enduring popularity of superconductivity? What is it about superconductivity that continues to fascinate?

  19. LLNL superconducting magnets test facility

    Energy Technology Data Exchange (ETDEWEB)

    Manahan, R; Martovetsky, N; Moller, J; Zbasnik, J

    1999-09-16

    The FENIX facility at Lawrence Livermore National Laboratory was upgraded and refurbished in 1996-1998 for testing CICC superconducting magnets. The FENIX facility was used for superconducting high current, short sample tests for fusion programs in the late 1980s--early 1990s. The new facility includes a 4-m diameter vacuum vessel, two refrigerators, a 40 kA, 42 V computer controlled power supply, a new switchyard with a dump resistor, a new helium distribution valve box, several sets of power leads, data acquisition system and other auxiliary systems, which provide a lot of flexibility in testing of a wide variety of superconducting magnets in a wide range of parameters. The detailed parameters and capabilities of this test facility and its systems are described in the paper.

  20. Superconductivity, antiferromagnetism, and neutron scattering

    Energy Technology Data Exchange (ETDEWEB)

    Tranquada, John M., E-mail: jtran@bnl.gov; Xu, Guangyong; Zaliznyak, Igor A.

    2014-01-15

    High-temperature superconductivity in both the copper-oxide and the iron–pnictide/chalcogenide systems occurs in close proximity to antiferromagnetically ordered states. Neutron scattering has been an essential technique for characterizing the spin correlations in the antiferromagnetic phases and for demonstrating how the spin fluctuations persist in the superconductors. While the nature of the spin correlations in the superconductors remains controversial, the neutron scattering measurements of magnetic excitations over broad ranges of energy and momentum transfers provide important constraints on the theoretical options. We present an overview of the neutron scattering work on high-temperature superconductors and discuss some of the outstanding issues. - Highlights: • High-temperature superconductivity is closely associated with antiferromagnetism. • Antiferromagnetic spin fluctuations coexist with the superconductivity. • Neutron scattering is essential for characterising the full spectrum of spin excitations.

  1. Sensing with Superconducting Point Contacts

    Directory of Open Access Journals (Sweden)

    Argo Nurbawono

    2012-05-01

    Full Text Available Superconducting point contacts have been used for measuring magnetic polarizations, identifying magnetic impurities, electronic structures, and even the vibrational modes of small molecules. Due to intrinsically small energy scale in the subgap structures of the supercurrent determined by the size of the superconducting energy gap, superconductors provide ultrahigh sensitivities for high resolution spectroscopies. The so-called Andreev reflection process between normal metal and superconductor carries complex and rich information which can be utilized as powerful sensor when fully exploited. In this review, we would discuss recent experimental and theoretical developments in the supercurrent transport through superconducting point contacts and their relevance to sensing applications, and we would highlight their current issues and potentials. A true utilization of the method based on Andreev reflection analysis opens up possibilities for a new class of ultrasensitive sensors.

  2. Domain wall description of superconductivity

    CERN Document Server

    Brito, F A; Silva, J C M

    2012-01-01

    In the present work we shall address the issue of electrical conductivity in superconductors in the perspective of superconducting domain wall solutions in the realm of field theory. We take our set up made out of a dynamical complex scalar field coupled to gauge field to be responsible for superconductivity and an extra scalar real field that plays the role of superconducting domain walls. The temperature of the system is interpreted as the parameter to move type I to type II domain walls. Alternatively, this means that the domain wall surface is suffering an acceleration as one goes from one type to another. On the other hand, changing from type I to type II state means a formation of a condensate what is in perfect sense of lowering the temperature around the superconductor. One can think of this scenario as an analog of holographic scenarios where this set up is replaced by a black hole near the domain wall.

  3. Stripes and superconductivity in cuprates

    Science.gov (United States)

    Tranquada, John M.

    2012-06-01

    Holes doped into the CuO2 planes of cuprate parent compounds frustrate the antiferromagnetic order. The development of spin and charge stripes provides a compromise between the competing magnetic and kinetic energies. Static stripe order has been observed only in certain particular compounds, but there are signatures which suggest that dynamic stripe correlations are common in the cuprates. Though stripe order is bad for superconducting phase coherence, stripes are compatible with strong pairing. Ironically, magnetic-field-induced stripe order appears to enhance the stability of superconducting order within the planes.

  4. Stripes and superconductivity in cuprates

    Energy Technology Data Exchange (ETDEWEB)

    Tranquada, John M., E-mail: jtran@bnl.gov [Condensed Matter Physics and Materials Science Dept., Brookhaven National Laboratory, Upton, NY 11973-5000 (United States)

    2012-06-01

    Holes doped into the CuO{sub 2} planes of cuprate parent compounds frustrate the antiferromagnetic order. The development of spin and charge stripes provides a compromise between the competing magnetic and kinetic energies. Static stripe order has been observed only in certain particular compounds, but there are signatures which suggest that dynamic stripe correlations are common in the cuprates. Though stripe order is bad for superconducting phase coherence, stripes are compatible with strong pairing. Ironically, magnetic-field-induced stripe order appears to enhance the stability of superconducting order within the planes.

  5. Large superconducting wind turbine generators

    DEFF Research Database (Denmark)

    Abrahamsen, Asger Bech; Magnusson, Niklas; Jensen, Bogi Bech

    2012-01-01

    and the rotation speed is lowered in order to limit the tip speed of the blades. The ability of superconducting materials to carry high current densities with very small losses might facilitate a new class of generators operating with an air gap flux density considerably higher than conventional generators...... and thereby having a smaller size and weight [1, 2]. A 5 MW superconducting wind turbine generator forms the basics for the feasibility considerations, particularly for the YBCO and MgB2 superconductors entering the commercial market. Initial results indicate that a 5 MW generator with an active weight of 34...

  6. 索尼(SONY)SSC-G103模拟枪式摄像机

    Institute of Scientific and Technical Information of China (English)

    胡学慧

    2011-01-01

    索尼SSC-G103通过“Super HAD CCD Ⅱ”组合“索尼最新的Effio-E DSP平台”的全新搭配应用,实现了高清晰度和高灵敏度,并提供日夜转换、自动暗区补偿、智能背光补偿、自动白平衡、数字降噪等一系列功能。

  7. A Novel Idea for Coil Collar Structures in Accelerator Superconducting Magnets

    CERN Document Server

    Fessia, P

    2002-01-01

    The dipoles for several different machines (LHC, SSC, HERA) were designed using non-magnetic metallic collars to contain the superconducting coils. The coils are of two types, main and floating. This paper describes a structure with combined steel and plastic collars. Since the floating collars do not give an important contribution to the global rigidity of the dipole we propose to suppress them. The plastic collars are just fillers to limit the helium contained in the cold mass. Some data about thermoplastic materials to be possibly used for the collars are given and some estimations of mass and cost of this configuration are made. Finally the results of the tests of a 1-m-long twin aperture dipole with mixed steel-plastic collars are shortly described. The replacement of expensive alloys by high performance plastic in non-structural components can be a cost-effective solution in view of future projects where superconducting magnets are involved and contained costs are a key issue.

  8. Hierarchic Models of Turbulence, Superfluidity and Superconductivity

    CERN Document Server

    Kaivarainen, A

    2000-01-01

    New models of Turbulence, Superfluidity and Superconductivity, based on new Hierarchic theory, general for liquids and solids (physics/0102086), have been proposed. CONTENTS: 1 Turbulence. General description; 2 Mesoscopic mechanism of turbulence; 3 Superfluidity. General description; 4 Mesoscopic scenario of fluidity; 5 Superfluidity as a hierarchic self-organization process; 6 Superfluidity in 3He; 7 Superconductivity: General properties of metals and semiconductors; Plasma oscillations; Cyclotron resonance; Electroconductivity; 8. Microscopic theory of superconductivity (BCS); 9. Mesoscopic scenario of superconductivity: Interpretation of experimental data in the framework of mesoscopic model of superconductivity.

  9. Superconductivity in highly disordered dense carbon disulfide.

    Science.gov (United States)

    Dias, Ranga P; Yoo, Choong-Shik; Struzhkin, Viktor V; Kim, Minseob; Muramatsu, Takaki; Matsuoka, Takahiro; Ohishi, Yasuo; Sinogeikin, Stanislav

    2013-07-16

    High pressure plays an increasingly important role in both understanding superconductivity and the development of new superconducting materials. New superconductors were found in metallic and metal oxide systems at high pressure. However, because of the filled close-shell configuration, the superconductivity in molecular systems has been limited to charge-transferred salts and metal-doped carbon species with relatively low superconducting transition temperatures. Here, we report the low-temperature superconducting phase observed in diamagnetic carbon disulfide under high pressure. The superconductivity arises from a highly disordered extended state (CS4 phase or phase III[CS4]) at ~6.2 K over a broad pressure range from 50 to 172 GPa. Based on the X-ray scattering data, we suggest that the local structural change from a tetrahedral to an octahedral configuration is responsible for the observed superconductivity.

  10. Phase slips in superconducting weak links

    Energy Technology Data Exchange (ETDEWEB)

    Kimmel, Gregory; Glatz, Andreas; Aranson, Igor S.

    2017-01-01

    Superconducting vortices and phase slips are primary mechanisms of dissipation in superconducting, superfluid, and cold-atom systems. While the dynamics of vortices is fairly well described, phase slips occurring in quasi-one- dimensional superconducting wires still elude understanding. The main reason is that phase slips are strongly nonlinear time-dependent phenomena that cannot be cast in terms of small perturbations of the superconducting state. Here we study phase slips occurring in superconducting weak links. Thanks to partial suppression of superconductivity in weak links, we employ a weakly nonlinear approximation for dynamic phase slips. This approximation is not valid for homogeneous superconducting wires and slabs. Using the numerical solution of the time-dependent Ginzburg-Landau equation and bifurcation analysis of stationary solutions, we show that the onset of phase slips occurs via an infinite period bifurcation, which is manifested in a specific voltage-current dependence. Our analytical results are in good agreement with simulations.

  11. Using GOCI Retrieval Data to Initialize and Validate a Sediment Transport Model for Monitoring Diurnal Variation of SSC in Hangzhou Bay, China

    Directory of Open Access Journals (Sweden)

    Xuefei Yang

    2016-03-01

    Full Text Available The diurnal variation of the suspended sediment concentration (SSC in Hangzhou Bay, China has been investigated using remotely-sensed SSC derived from the Geostationary Ocean Color Imager (GOCI in combination with a coupled hydrodynamic-ecological model for regional and shelf seas (COHERENS. The SSC maps were inferred through a UV-AC atmospheric correction algorithm and an empirical inversion algorithm from the GOCI Level-1B data. The sediment transport model was initialized from maps of the GOCI-derived SSC and the model results were validated through a comparison with remotely-sensed data. The comparison demonstrated that the model results agreed well with the observations. The relationship between SSC distribution and hydrodynamic conditions was analyzed to investigate the sediment transport dynamics. The model’s results indicate that the action of tidal currents dominate the sediment deposition and re-suspension in the coastal waters of the East China Sea. This is especially the case in Hangzhou Bay where the tidal currents are strongest. The satellite-derived sediment data product can not only dramatically improve the specification of the initial conditions for the sediment model, but can also provide valuable information for the model validation, thereby improving the model’s overall performance.

  12. A unified theory of superconductivity

    CERN Document Server

    Huang, Xiuqing

    2008-01-01

    In this work, we argue that the phonon-mediated BCS theory may be incorrect. Two kinds of glues, pairing (pseudogap) glue and superconducting glue, are suggested based on a real space Coulomb confinement effect. The scenarios provide a unified explanation of the pairing symmetry, pseudogap and superconducting states, spin--charge stripe order, magic doping fractions and vortex structures in conventional and unconventional (the high-Tc cuprates, MgB2 and the newly-discovered Fe-based family) superconductors. The theory agrees with the existence of a pseudogap in high-temperature superconductors, while no pseudogap feature could be observed in MgB2, iron-based and most of the conventional superconductors. Our results indicate that the superconducting phase can coexist with a triangular vortex lattice in pure MgB2 single crystal with a charge carrier density n=1.49*10^22/cm3. For iron-based superconductors, the relationship between the superconducting vortex phases and the optimal doping levels are analytically ...

  13. Power applications for superconducting cables

    DEFF Research Database (Denmark)

    Tønnesen, Ole; Hansen, Steen; Jørgensen, Preben

    2000-01-01

    High temperature superconducting (HTS) cables for use in electric ac power systems are under development around the world today. There are two main constructions under development: the room temperature dielectric design and the cryogenic dielectric design. However, theoretical studies have shown...

  14. Superconductivity by kinetic energy saving?

    NARCIS (Netherlands)

    Van der Marel, D; Molegraaf, HJA; Presura, C; Santoso, [No Value; Hewson, AC; Zlatic,

    2003-01-01

    A brief introduction is given in the generic microscopic framework of superconductivity. The consequences for the temperature dependence of the kinetic energy, and the correlation energy are discussed for two cases: The BCS scenario and the non-Fermi liquid scenario. A quantitative comparison is mad

  15. Superconducting cavity model for LEP

    CERN Multimedia

    1979-01-01

    A superconducting cavity model is being prepared for testing in a vertical cryostat.At the top of the assembly jig is H.Preis while A.Scharding adjusts some diagnostic equipment to the cavity. See also photo 7912501X.

  16. Superconductivity of small metal grains

    Institute of Scientific and Technical Information of China (English)

    ZHENG; Renrong; CHEN; Zhiqian; ZHU; Shunquan

    2005-01-01

    The formulas of the energy gap and superconducting critical temperature appropriate for systems with both odd and even number of electrons are derived; the bases of the derivations are BCS theory and energy level statistics. Numerical results qualitatively agree with the experimental phenomena. i.e., the superconductivity of small metallic grains will first enhance then decrease to zero when the grain are getting smaller and smaller. The calculations indicate that the above phenomena happen in the metallic grains belonging to Gaussian Orthogonal Ensemble (GOE) and Gaussian Unitary ensemble (GUE) with zero spin; The superconductivity of small metallic grains in Gaussian Symplectic Ensemble (GSE) will monotonically decrease to zero with the decreasing of the grain size. The analyses suggest that the superconductivity enhancements come from pairing and the balance of the strengths between spin-orbital coupling and external magnetic field. In order to take the latter into account, it is necessary to include the level statistics given by Random Matrix Theory (RMT) in describing small metallic grains.

  17. Superconductivity by kinetic energy saving?

    NARCIS (Netherlands)

    Van der Marel, D; Molegraaf, HJA; Presura, C; Santoso, [No Value; Hewson, AC; Zlatic,

    2003-01-01

    A brief introduction is given in the generic microscopic framework of superconductivity. The consequences for the temperature dependence of the kinetic energy, and the correlation energy are discussed for two cases: The BCS scenario and the non-Fermi liquid scenario. A quantitative comparison is

  18. Discovering superconductivity an investigative approach

    CERN Document Server

    Ireson, Gren

    2012-01-01

    The highly-illustrated text will serve as excellent introduction for students, with and without a physics background, to superconductivity. With a strong practical, experimental emphasis, it will provide readers with an overview of the topic preparing them for more advanced texts used in more advanced undergraduate and post-graduate courses.

  19. Collaring of Po Superconducting Dipole

    CERN Multimedia

    1983-01-01

    The picture shows the placing of a stack of stainless steel collars around the superconducting coils.Pre-assembled collar stacks were placed under and on top of the coils,the collars interleaving as comb teeth. During the following collaring operation of compression under a press the collars were locked together by means of side wedges. See also photos 8211532X, 7903168

  20. Superconductivity resulting from antiferromagnetic states

    Energy Technology Data Exchange (ETDEWEB)

    Feng Shi-Ping (Department of Physics, Beijing Normal University (CN))

    1989-09-01

    When the dopping is low enough, the holes obey Bose statistics, Bose-Einstein condensation of these holes may lead to occurance of superconductivity. In this framework, we have calculated some physical quantities, the results are in qualitative agreement with experiments.

  1. Superconductivity by kinetic energy saving?

    NARCIS (Netherlands)

    Van der Marel, D; Molegraaf, HJA; Presura, C; Santoso, [No Value; Hewson, AC; Zlatic,

    2003-01-01

    A brief introduction is given in the generic microscopic framework of superconductivity. The consequences for the temperature dependence of the kinetic energy, and the correlation energy are discussed for two cases: The BCS scenario and the non-Fermi liquid scenario. A quantitative comparison is mad

  2. Nonlinear diffusion and superconducting hysteresis

    Energy Technology Data Exchange (ETDEWEB)

    Mayergoyz, I.D. [Univ. of Maryland, College Park, MD (United States)

    1996-12-31

    Nonlinear diffusion of electromagnetic fields in superconductors with ideal and gradual resistive transitions is studied. Analytical results obtained for linear and nonlinear polarizations of electromagnetic fields are reported. These results lead to various extensions of the critical state model for superconducting hysteresis.

  3. Fireballs from Superconducting Cosmic Strings

    CERN Document Server

    Gruzinov, Andrei

    2016-01-01

    Thermalized fireballs should be created by cusp events on superconducting cosmic strings. This simple notion allows to reliably estimate particle emission from the cusps in a given background magnetic field. With plausible assumptions about intergalactic magnetic fields, the cusp events can produce observable fluxes of high-energy photons and neutrinos with unique signatures.

  4. Fireballs from superconducting cosmic strings

    Science.gov (United States)

    Gruzinov, Andrei; Vilenkin, Alexander

    2017-01-01

    Thermalized fireballs should be created by cusp events on superconducting cosmic strings. This simple notion allows to reliably estimate particle emission from the cusps in a given background magnetic field. With plausible assumptions about intergalactic magnetic fields, the cusp events can produce observable fluxes of high-energy photons and neutrinos with unique signatures.

  5. Superconducting Qubits and Quantum Resonators

    NARCIS (Netherlands)

    Forn-Díaz, P.

    2010-01-01

    Superconducting qubits are fabricated "loss-free" electrical circuits on a chip with size features of tens of nanometers. If cooled to cryogenic temperatures below -273 °C they behave as quantum elements, similar to atoms and molecules. Such a qubit can be manipulated by fast-oscillating magnetic fi

  6. Tutorial on Superconducting Accelerator Magnets

    Science.gov (United States)

    Ball, M. J. Penny; Goodzeit, Carl L.

    1997-05-01

    A multimedia CD-ROM tutorial on the physics and engineering concepts of superconducting magnets for particle accelerators is being developed under a U.S. Dept. of Energy SBIR grant. The tutorial, scheduled for distribution this summer, is targeted to undergraduate junior or senior level science students. However, its unified presentation of the broad range of issues involved in the design of superconducting magnets for accelerators and the extensive detail about the construction process (including animations and video clips) will also be of value to staff of research institutes and industrial concerns with an interest in applied superconductivity or magnet development. The source material, which is based on the world-wide R and D programs to develop superconducting accelerator magnets, is organized in five units with the following themes: Introduction to magnets and accelerators; (2) Superconductors for accelerator magnets; (3) Magnetic design methods for accelerator magnets; (4) Electrical, mechanical, and cryogenic considerations for the final magnet package; (5) Performance characteristics and measurement methods. A detailed outline and examples will be shown.

  7. Demonstration of superconducting micromachined cavities

    Energy Technology Data Exchange (ETDEWEB)

    Brecht, T., E-mail: teresa.brecht@yale.edu; Reagor, M.; Chu, Y.; Pfaff, W.; Wang, C.; Frunzio, L.; Devoret, M. H.; Schoelkopf, R. J. [Department of Applied Physics, Yale University, New Haven, Connecticut 06511 (United States)

    2015-11-09

    Superconducting enclosures will be key components of scalable quantum computing devices based on circuit quantum electrodynamics. Within a densely integrated device, they can protect qubits from noise and serve as quantum memory units. Whether constructed by machining bulk pieces of metal or microfabricating wafers, 3D enclosures are typically assembled from two or more parts. The resulting seams potentially dissipate crossing currents and limit performance. In this letter, we present measured quality factors of superconducting cavity resonators of several materials, dimensions, and seam locations. We observe that superconducting indium can be a low-loss RF conductor and form low-loss seams. Leveraging this, we create a superconducting micromachined resonator with indium that has a quality factor of two million, despite a greatly reduced mode volume. Inter-layer coupling to this type of resonator is achieved by an aperture located under a planar transmission line. The described techniques demonstrate a proof-of-principle for multilayer microwave integrated quantum circuits for scalable quantum computing.

  8. Photon-detecting superconducting resonators

    NARCIS (Netherlands)

    Barends, R.

    2009-01-01

    One of the greatest challenges in astronomy is observing star and planetary formation, redshifted distant galaxies and molecular spectral ‘fingerprints’ in the far-infrared spectrum of light, using highly sensitive and large cameras. In this thesis we investigate superconducting resonators for

  9. The First MAXI/SSC Catalog of X-ray Sources in 0.7--7.0~keV

    CERN Document Server

    Tomida, Hiroshi; Tsunemi, Hiroshi; Imatani, Ritsuko; Kimura, Masashi; Nakahira, Satoshi; Hanayama, Takanori; Yoshidome, Koshiro

    2016-01-01

    We present the first source catalog of the Solid-state Slit Camera (SSC) of the Monitor of All-sky X-ray Image (MAXI) mission on the International Space Station, using the 45-month data from 2010 August to 2014 April in 0.7--7.0~keV bands. Sources are searched for in two energy bands, 0.7--1.85~keV (soft) and 1.85--7.0~keV (hard), the limiting sensitivity of 3 and 4~mCrab are achieved and 140 and 138 sources are detected in the soft and hard energy bands, respectively. Combining the two energy bands, 170 sources are listed in the MAXI/SSC catalog. All but 2 sources are identified with 22 galaxies including AGNs, 29 cluster of galaxies, 21 supernova remnants, 75 X-ray binaries, 8 stars, 5 isolated pulsars, and 9 non-categorized objects. Comparing the soft-band fluxes at the brightest end in our catalog with the ROSAT survey, which was performed about 20 years ago, 10\\% of the cataloged sources are found to have changed the flux since the ROSAT era.

  10. Simulation of the prompt energization and transport of radiation belt particles during the March 24, 1991 SSC

    Science.gov (United States)

    Li, Xinlin; Roth, I.; Temerin, M.; Wygant, J. R.; Hudson, M. K.; Blake, J. B.

    1993-01-01

    We model the rapid (about 1 min) formation of a new electron radiation belt at L about or = 2.5 that resulted from the Storm Sudden Commencement (SSC) of March 24, 1991 as observed by the Combined Release and Radiation Effects Satellite (CRRES) satellite. Guided by the observed electric and magnetic fields, we represent the time-dependent magnetospheric electric field during the SSC by an asymmetric bipolar pulse that is associated with the compression and relaxation of the Earth's magnetic field. We follow the electrons using a relativistic guiding center code. The test-particle simulations show that electrons with energies of a few MeV at L greater than 6 were energized up to 40 MeV and transported to L about or = 2.5 during a fraction of their drift period. The energization process conserves the first adiabatic invariant and is enhanced due to resonance of the electron drift motion with the time-varying electric field. Our simulation results, with an initial W(exp -8) energy flux spectra, reproduce the observed electron drift echoes and show that the interplanetary shock impacted the magnetosphere between 1500 and 1800 MLT.

  11. An intense SFE and SSC event in geomagnetic H, Y and Z fields at the Indian chain of observatories

    Directory of Open Access Journals (Sweden)

    S. Alex

    Full Text Available Changes in the three components of geomagnetic field are reported at the chain of ten geomagnetic observatories in India during an intense solar crochet that occurred at 1311 h 75° EMT on 15 June 1991 and the subsequent sudden commencement (SSC of geomagnetic storm at 1518 h on 17 June 1991. The solar flare effects (SFE registered on the magnetograms appear to be an augmentation of the ionospheric current system existing at the start time of the flare. An equatorial enhancement in ΔH due to SFE is observed to be similar in nature to the latitudinal variation of SQ (H at low latitude. ΔY registered the largest effect at 3.6° dip latitude at the fringe region of the electrojet. ΔZ had positive amplitudes at the equatorial stations and negative at stations north of Hyderabad. The SSC amplitude in the H component is fairly constant with latitude, whereas the Z component again showed larger positive excursions at stations within the electrojet belt. These results are discussed in terms of possible currents of internal and external origin. The changes in the Y field strongly support the idea that meridional current at an equatorial electrojet station flows in the ionospheric dynamo, E.

  12. Suzaku X-ray Observations of the Fermi Bubbles: Northernmost Cap and Southeast Claw Discovered with MAXI-SSC

    CERN Document Server

    Tahara, Masaya

    2015-01-01

    We report on Suzaku observations of large-scale X-ray structures possibly related with the Fermi Bubbles obtained in 2013 with a total duration of ~ 80 ks. The observed regions were the: (i) northern cap (N-cap; l ~ 0 deg, 45 deg < b < 55 deg) seen in the Mid-band (1.7-4.0 keV) map recently provided by MAXI-SSC and (ii) southeast claw (SE-claw; l ~ 10 deg, -20 deg < b < -10 deg) seen in the ROSAT all-sky map and MAXI-SSC Low-band (0.7-1.7 keV) map. In each region, we detected diffuse X-ray emissions which are represented by a three component plasma model consisting of an unabsorbed thermal component (kT ~ 0.1 keV) from the Local Bubble, absorbed kT = 0.30+/-0.05 keV emission representing the Galactic Halo, and a power-law component due to the isotropic cosmic X-ray background radiation. The emission measure of the GH component in the SE-claw shows an excess by a factor of ~ 2.5 over the surrounding emission at 2 deg away. We also found a broad excess in the 1.7-4.0 keV count rates across the N-cap...

  13. A particle-in-cell mode beam dynamics simulation of medium energy beam transport for the SSC-Linac

    Institute of Scientific and Technical Information of China (English)

    XIAO Chen; XU Meng-Xin; HE Shou-Bo; XIA Jia-Wen; HE Yuan; YUAN You-Jin; LU Yuan-Rong; LIU Yong; WANG Zhi-Jun; DU Xiao-Nan; YAO Qing-Gao; LIU Ge

    2012-01-01

    A new linear accelerator system,called the SSC-Linac injector,is being designed at HIRFL (the heavy ion research facility of Lanzhou).As part of the SSC-Linac,the medium energy beam transport (MEBT) consists of seven magnetic quadrupoles,a re-buncher and a diagnose box.The total length of this segment is about 1.75 m.The beam dynamics simulation in MEBT has been studied using the TRACK 3D particlein-cell code,and the simulation result shows that the beam accelerated from the radio frequency quadrupole (RFQ) matches well with the acceptance of the following drift tube linac (DTL) in both the transverse and longitudinal phase spaces,and that most of the particles can be captured by the final sector focusing cyclotronfor further acceleration.The longitudinal emittance of the RFQ and the longitudinal acceptance of the DTL was calculated in detail,and a multi-particle beam dynamics simulation from the ion source to the end of the DTL was done to verify the original design.

  14. A particle-in-cell mode beam dynamics simulation of medium energy beam transport for the SSC-Linac

    Science.gov (United States)

    Xiao, Chen; He, Yuan; Yuan, You-Jin; Lu, Yuan-Rong; Liu, Yong; Wang, Zhi-Jun; Du, Xiao-Nan; Yao, Qing-Gao; Liu, Ge; Xu, Meng-Xin; He, Shou-Bo; Xia, Jia-Wen

    2012-01-01

    A new linear accelerator system, called the SSC-Linac injector, is being designed at HIRFL (the heavy ion research facility of Lanzhou). As part of the SSC-Linac, the medium energy beam transport (MEBT) consists of seven magnetic quadrupoles, a re-buncher and a diagnose box. The total length of this segment is about 1.75 m. The beam dynamics simulation in MEBT has been studied using the TRACK 3D particle-in-cell code, and the simulation result shows that the beam accelerated from the radio frequency quadrupole (RFQ) matches well with the acceptance of the following drift tube linac (DTL) in both the transverse and longitudinal phase spaces, and that most of the particles can be captured by the final sector focusing cyclotron for further acceleration. The longitudinal emittance of the RFQ and the longitudinal acceptance of the DTL was calculated in detail, and a multi-particle beam dynamics simulation from the ion source to the end of the DTL was done to verify the original design.

  15. The Italian version of the Mouth Handicap in Systemic Sclerosis scale (MHISS) is valid, reliable and useful in assessing oral health-related quality of life (OHRQoL) in systemic sclerosis (SSc) patients.

    Science.gov (United States)

    Maddali Bongi, S; Del Rosso, A; Miniati, I; Galluccio, F; Landi, G; Tai, G; Matucci-Cerinic, M

    2012-09-01

    In systemic sclerosis (SSc), mouth and face involvement leads to problems in oral health-related quality of life (OHRQoL). Mouth Handicap in Systemic Sclerosis scale (MHISS) is a 12-item questionnaire specifically quantifying mouth disability in SSc, organized in 3 subscales. Our aim was to validate Italian version of MHISS, by assessing its test-retest reliability and internal and external consistency in Italian SSc patients. Forty SSc patients (7 dSSc, 33 lSSc; age and disease duration: 57.27 ± 11.41, 9.4 ± 4.4 years; 22 with sicca syndrome) were evaluated with MHISS. MHISS was translated following a forward-backward translation procedure, with independent translations and counter-translation. Test-retest reliability was evaluated, comparing the results of two administrations, with intraclass correlation coefficient (ICC). Internal consistency was assessed by Cronbach's α and external consistency by comparison with mouth opening. MHISS has a good test-retest reliability (ICC: 0.93) and internal consistency (Cronbach's α:0.99). A good external consistency was confirmed by correlation with mouth opening (rho: -0,3869, p: 0.0137). Total MHISS score was 17.65 ± 5.20, with scores of subscale 1 (reduced mouth opening) of 6.60 ± 2.85 and scores of subscales 2 (sicca syndrome) and 3 (aesthetic concerns) of 7.82 ± 2.59 and 3.22 ± 1.14. Total and subscale 2 scores are higher in dSSc than in lSSc. This result may be due to the higher presence of sicca syndrome in dSSc than in lSSc (p = 0.0109). Our results support validity and reliability in Italian SSc patients of MHISS, specifically measuring SSc OHRQoL.

  16. Superconductivity: The persistence of pairs

    Energy Technology Data Exchange (ETDEWEB)

    Edelman, Alex; Littlewood, Peter

    2015-05-20

    Superconductivity stems from a weak attraction between electrons that causes them to form bound pairs and behave much like bosons. These so-called Cooper pairs are phase coherent, which leads to the astonishing properties of zero electrical resistance and magnetic flux expulsion typical of superconducting materials. This coherent state may be qualitatively understood within the Bose–Einstein condensate (BEC) model, which predicts that a gas of interacting bosons will become unstable below a critical temperature and condense into a phase of matter with a macroscopic, coherent population in the lowest energy state, as happens in 4He or cold atomic gases. The successful theory proposed by Bardeen, Cooper and Schrieffer (BCS) predicts that at the superconducting transition temperature Tc, electrons simultaneously form pairs and condense, with no sign of pairing above Tc. Theorists have long surmised that the BCS and BEC models are opposite limits of a single theory and that strong interactions or low density can, in principle, drive the system to a paired state at a temperature Tpair higher than Tc, making the transition to the superconducting state BEC-like (Fig. 1). Yet most superconductors to date are reasonably well described by BCS theory or its extensions, and there has been scant evidence in electronic materials for the existence of pairing independent of the full superconducting state (though an active debate rages over the cuprate superconductors). Writing in Nature, Jeremy Levy and colleagues have now used ingenious nanostructured devices to provide evidence for electron pairing1. Perhaps surprisingly, the material they have studied is a venerable, yet enigmatic, low-temperature superconductor, SrTiO3.

  17. Superconducting Super Collider Laboratory : tunnel boring

    CERN Multimedia

    SSC Media Production

    1999-01-01

    This film will take you down into the tunnel, show you the technology involved in boring the tunnel, and show what the SSC fmeans to the U.S. in terms of scientific discovery, innovative collaborations with industry and stimulating the job base nation-wide.

  18. SSC编码体系的研究与应用%The Investigation And Application of SSC Encoding System

    Institute of Scientific and Technical Information of China (English)

    陈皞

    2015-01-01

    Nuclear power projects usually last a long period and include large amount of data. On the top of that, many corporations and institutes participate in the projects of nuclear power plant. Therefore, it's important to manage data and information accurately if administrators want to keep nuclear power project in efficient and smooth running. So an effective and universal encoding system, which is used to manage the component and activity of projects, makes sense to operate plants efficiently and with good quality. Now there are a series of international reference standards, which are based on industry and construction, applied to establish naming system. SSC is a kind of naming standard which is short for structure, system and component. Regarding the process of engineering, procurement, construction and testing, SSC shows value on nuclear power project management, because it would integrate the data from different levels, modules and stages based on different dimensions. All in all, SSC is a naming system used for all parts of nuclear power plant, as a result, it can be used as the tool for nuclear project management.%核电项目的周期长,涉及数据量大,参与单位多,如何能够全面、准确地管理信息和数据,一定程度上决定了该项目是否能高效和稳定的推进.因此,能否为项目管理所涉及的实体建立一套有效而通用的编码体系,对提高核电项目管理的质量和效率有着重要的作用.如今国际上已经有了建立工业现场和电厂的参考命名系统的相应标准,SSC便是其中之一.SSC为核电厂的构筑物、系统和设备的总称.就核电厂的设计、采购、施工和调试工作而言,SSC的作用主要体现在对核电项目的全局管控能力,基于不同的维度,SSC可将不同管理层级、业务模块以及各阶段的数据进行良好的整合,形成对项目的全程管控.

  19. Surface superconductivity in thin cylindrical Bi nanowire.

    Science.gov (United States)

    Tian, Mingliang; Wang, Jian; Ning, Wei; Mallouk, Thomas E; Chan, Moses H W

    2015-03-11

    The physical origin and the nature of superconductivity in nanostructured Bi remains puzzling. Here, we report transport measurements of individual cylindrical single-crystal Bi nanowires, 20 and 32 nm in diameter. In contrast to nonsuperconducting Bi nanoribbons with two flat surfaces, cylindrical Bi nanowires show superconductivity below 1.3 K. However, their superconducting critical magnetic fields decrease with their diameter, which is the opposite of the expected behavior for thin superconducting wires. Quasiperiodic oscillations of magnetoresistance were observed in perpendicular fields but were not seen in the parallel orientation. These results can be understood by a model of surface superconductivity with an enhanced surface-to-bulk volume in small diameter wires, where the superconductivity originates from the strained surface states of the nanowires due to the surface curvature-induced stress.

  20. Superconducting Josephson vortex flow transistors

    CERN Document Server

    Tavares, P A C

    2002-01-01

    The work reported in this thesis focuses on the development of high-temperature superconducting Josephson vortex-flow transistors (JVFTs). The JVFT is a particular type of superconducting transistor, i.e. an electromagnetic device capable of delivering gain while keeping the control and output circuits electrically isolated. Devices were fabricated from (100) YBa sub 2 Cu sub 3 O sub 7 sub - subdelta thin films grown by Pulsed Laser Deposition on 24 deg magnesium oxide and strontium titanate bicrystals. The design of the JVFTs was guided by numerical simulations and the devices were optimised for current gain. Improvements were made to the fabrication process in order to accurately pattern the small structures required. The devices exhibited current gains higher than 60 in liquid nitrogen. Gains measured at lower temperatures were significantly higher. As part of the work a data acquisition suite was developed for the characterisation of three-terminal devices and, in particular, of JVFTs.

  1. Superconductivity in the Tungsten Bronzes

    Science.gov (United States)

    Wu, Phillip; Ishii, Satoshi; Tanabe, Kenji; Munakata, Ko; Hammond, Robert H.; Tokiwa, Kazuyasu; Geballe, Theodore H.; Beasley, Malcolm R.

    2015-03-01

    Via pulsed laser deposition and post-annealing, high quality K-doped WO3-y films with reproducible transport properties are obtained. A home built two-coil mutual inductance setup is used to probe the behavior of the films in the superconducting and normal state. The inverse penetration depths and dissipation peaks are measured as a function of temperature and field. Separately, via thin film deposition techniques, we report for the first time stable crystalline hexagonal WO3 on substrates. In order to tune the physical properties of the undoped material, we utilized an ionic liquid gating technique. We observe an insulator-to-metal transition, showing the ionic liquid gate to be a viable technique to alter the electrical transport properties of this material. By comparing the alkali and ionic liquid gated WO3, we conclude with some remarks regarding how superconductivity arises in this system.

  2. Superconducting wires and fractional flux

    Science.gov (United States)

    Sá de Melo, C. A. R.

    1996-05-01

    The quantization of flux quanta in superconductors is revisited and analyzed in a new geometry. The system analyzed is a superconducting wire. The geometry is such that the superconducting wire winds N times around an insulating cylinder and that the wire has its end connected back to its beginning, thus producing an N-loop short circuited solenoid. The winding number N acts as a topological index that controls flux quantization. In this case, fractional flux quanta can be measured through the center of the insulating cylinder, provided that the cylinder radius is small enough. The Little-Parks experiment for an identical geometry is discussed. The period of oscillation of the transition temperature of the wire is found to vary as 1/N in units of flux Φ relative to the flux quantum Φ0. When a SQUID is made in such a geometry the maximal current through the SQUID varies with period Φ0/N.

  3. Stripes and Superconductivity in Cuprates

    OpenAIRE

    Tranquada, John M.

    2011-01-01

    Holes doped into the CuO2 planes of cuprate parent compounds frustrate the antiferromagnetic order. The development of spin and charge stripes provides a compromise between the competing magnetic and kinetic energies. Static stripe order has been observed only in certain particular compounds, but there are signatures which suggest that dynamic stripe correlations are common in the cuprates. Though stripe order is bad for superconducting phase coherence, stripes are compatible with strong pair...

  4. Superconducting Qubits: A Short Review

    OpenAIRE

    Devoret, M. H.; Wallraff, A.; Martinis, J. M.

    2004-01-01

    Superconducting qubits are solid state electrical circuits fabricated using techniques borrowed from conventional integrated circuits. They are based on the Josephson tunnel junction, the only non-dissipative, strongly non-linear circuit element available at low temperature. In contrast to microscopic entities such as spins or atoms, they tend to be well coupled to other circuits, which make them appealling from the point of view of readout and gate implementation. Very recently, new designs ...

  5. Inelastic tunneling in superconducting junctions

    Energy Technology Data Exchange (ETDEWEB)

    Hlobil, Patrik Christian

    2016-06-10

    In this dissertation a theoretical formalism of elastic and inelastic tunneling spectroscopy is developed for superconductors. The underlying physical processes behind the different two tunneling channels and their implications for the interpretation of experimental tunneling data are investigated in detail, which can explain the background conductance seen in the cuprate and iron-based superconductors. Further, the properties of the emitted light from a superconducting LED are investigated.

  6. Stimulated Superconductivity at Strong Coupling

    Energy Technology Data Exchange (ETDEWEB)

    Bao, Ning; Dong, Xi; Silverstein, Eva; Torroba, Gonzalo; /Stanford U., ITP /Stanford U., Phys. Dept. /SLAC

    2011-08-12

    Stimulating a system with time dependent sources can enhance instabilities, thus increasing the critical temperature at which the system transitions to interesting low-temperature phases such as superconductivity or superfluidity. After reviewing this phenomenon in non-equilibrium BCS theory (and its marginal fermi liquid generalization) we analyze the effect in holographic superconductors. We exhibit a simple regime in which the transition temperature increases parametrically as we increase the frequency of the time-dependent source.

  7. RF Characterization of Superconducting Samples

    CERN Document Server

    Junginger, T; Welsch, C

    2009-01-01

    At CERN a compact Quadrupole Resonator has been re-commissioned for the RF characterization of superconducting materials at 400 MHz. In addition the resonator can also be excited at multiple integers of this frequency. Besides Rs it enables determination of the maximum RF magnetic field, the thermal conductivity and the penetration depth of the attached samples, at different temperatures. The features of the resonator will be compared with those of similar RF devices and first results will be presented.

  8. Activities on RF superconductivity at DESY

    Energy Technology Data Exchange (ETDEWEB)

    Matheisen, A. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); TESLA Collaboration

    1996-01-01

    At DESY the HERA electron storage ring is supplied with normal and superconducting cavities. The superconducting system transfers up to 1 MW klystron power to the beam. Experiences are reported on luminosity and machine study runs. Since 1993 one major activity in the field of RF superconducting cavities is the installation of the TESLA Test Facility. Set-up of hardware and first tests of s.c. resonators are presented. (R.P.). 11 refs.

  9. Superconducting electron and hole lenses

    Science.gov (United States)

    Cheraghchi, H.; Esmailzadeh, H.; Moghaddam, A. G.

    2016-06-01

    We show how a superconducting region (S), sandwiched between two normal leads (N), in the presence of barriers, can act as a lens for propagating electron and hole waves by virtue of the so-called crossed Andreev reflection (CAR). The CAR process, which is equivalent to Cooper pair splitting into two N electrodes, provides a unique possibility of constructing entangled electrons in solid state systems. When electrons are locally injected from an N lead, due to the CAR and normal reflection of quasiparticles by the insulating barriers at the interfaces, sequences of electron and hole focuses are established inside another N electrode. This behavior originates from the change of momentum during electron-hole conversion beside the successive normal reflections of electrons and holes due to the barriers. The focusing phenomena studied here are fundamentally different from the electron focusing in other systems, such as graphene p-n junctions. In particular, due to the electron-hole symmetry of the superconducting state, the focusing of electrons and holes is robust against thermal excitations. Furthermore, the effects of the superconducting layer width, the injection point position, and barrier strength are investigated on the focusing behavior of the junction. Very intriguingly, it is shown that by varying the barrier strength, one can separately control the density of electrons or holes at the focuses.

  10. Attenuation in Superconducting Circular Waveguides

    Directory of Open Access Journals (Sweden)

    K. H. Yeap

    2016-09-01

    Full Text Available We present an analysis on wave propagation in superconducting circular waveguides. In order to account for the presence of quasiparticles in the intragap states of a superconductor, we employ the characteristic equation derived from the extended Mattis-Bardeen theory to compute the values of the complex conductivity. To calculate the attenuation in a circular waveguide, the tangential fields at the boundary of the wall are first matched with the electrical properties (which includes the complex conductivity of the wall material. The matching of fields with the electrical properties results in a set of transcendental equations which is able to accurately describe the propagation constant of the fields. Our results show that although the attenuation in the superconducting waveguide above cutoff (but below the gap frequency is finite, it is considerably lower than that in a normal waveguide. Above the gap frequency, however, the attenuation in the superconducting waveguide increases sharply. The attenuation eventually surpasses that in a normal waveguide. As frequency increases above the gap frequency, Cooper pairs break into quasiparticles. Hence, we attribute the sharp rise in attenuation to the increase in random collision of the quasiparticles with the lattice structure.

  11. Ballistic superconductivity in semiconductor nanowires

    Science.gov (United States)

    Zhang, Hao; Gül, Önder; Conesa-Boj, Sonia; Nowak, Michał P.; Wimmer, Michael; Zuo, Kun; Mourik, Vincent; de Vries, Folkert K.; van Veen, Jasper; de Moor, Michiel W. A.; Bommer, Jouri D. S.; van Woerkom, David J.; Car, Diana; Plissard, Sébastien R.; Bakkers, Erik P. A. M.; Quintero-Pérez, Marina; Cassidy, Maja C.; Koelling, Sebastian; Goswami, Srijit; Watanabe, Kenji; Taniguchi, Takashi; Kouwenhoven, Leo P.

    2017-07-01

    Semiconductor nanowires have opened new research avenues in quantum transport owing to their confined geometry and electrostatic tunability. They have offered an exceptional testbed for superconductivity, leading to the realization of hybrid systems combining the macroscopic quantum properties of superconductors with the possibility to control charges down to a single electron. These advances brought semiconductor nanowires to the forefront of efforts to realize topological superconductivity and Majorana modes. A prime challenge to benefit from the topological properties of Majoranas is to reduce the disorder in hybrid nanowire devices. Here we show ballistic superconductivity in InSb semiconductor nanowires. Our structural and chemical analyses demonstrate a high-quality interface between the nanowire and a NbTiN superconductor that enables ballistic transport. This is manifested by a quantized conductance for normal carriers, a strongly enhanced conductance for Andreev-reflecting carriers, and an induced hard gap with a significantly reduced density of states. These results pave the way for disorder-free Majorana devices.

  12. Interfacing superconducting qubits and single optical photons

    CERN Document Server

    Das, Sumanta; Sørensen, Anders S

    2016-01-01

    We propose an efficient light-matter interface at optical frequencies between a superconducting qubit and a single photon. The desired interface is based on a hybrid architecture composed of an organic molecule embedded inside an optical waveguide and electrically coupled to a superconducting qubit far from the optical axis. We show that high fidelity, photon-mediated, entanglement between distant superconducting qubits can be achieved with incident pulses at the single photon level. Such low light level is highly sought for to overcome the decoherence of the superconducting qubit caused by absorption of optical photons.

  13. Anisotropic superconductivity driven by kinematic interaction

    Science.gov (United States)

    Ivanov, V. A.

    2000-11-01

    We have analysed the effect of kinematic pairing on the symmetry of superconducting order parameter for a square lattice in the frame of the strongly correlated Hubbard model. It is argued that in the first perturbation order the kinematic interaction renormalizes the Hubbard-I dispersions and provides at low doping the mixed singlet (s + s*)-wave superconductivity, giving way at higher doping to the triplet p-wave superconductivity. The obtained phase diagram depends only on the hopping integral parameter. The influence of the Coulomb repulsion on the kinematic superconducting pairing has been estimated. The (s + s*)-wave gap and the thermodynamic critical magnetic field have been derived.

  14. Superconducting fault current limiter for railway transport

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, L. M., E-mail: LMFisher@niitfa.ru; Alferov, D. F.; Akhmetgareev, M. R.; Budovskii, A. I.; Evsin, D. V.; Voloshin, I. F.; Kalinov, A. V. [National Technical Physics and Automation Research Institute (Russian Federation)

    2015-12-15

    A resistive switching superconducting fault current limiter (SFCL) for DC networks with voltage of 3.5 kV and nominal current of 2 kA is developed. The SFCL consists of two series-connected units: block of superconducting modules and high-speed vacuum breaker with total disconnection time not more than 8 ms. The results of laboratory tests of superconducting SFCL modules in current limiting mode are presented. The recovery time of superconductivity is experimentally determined. The possibility of application of SFCL on traction substations of Russian Railways is considered.

  15. Foreword: Focus on Superconductivity in Semiconductors

    Directory of Open Access Journals (Sweden)

    Yoshihiko Takano

    2008-01-01

    Full Text Available Since the discovery of superconductivity in diamond, much attention has been given to the issue of superconductivity in semiconductors. Because diamond has a large band gap of 5.5 eV, it is called a wide-gap semiconductor. Upon heavy boron doping over 3×1020 cm−3, diamond becomes metallic and demonstrates superconductivity at temperatures below 11.4 K. This discovery implies that a semiconductor can become a superconductor upon carrier doping. Recently, superconductivity was also discovered in boron-doped silicon and SiC semiconductors. The number of superconducting semiconductors has increased. In 2008 an Fe-based superconductor was discovered in a research project on carrier doping in a LaCuSeO wide-gap semiconductor. This discovery enhanced research activities in the field of superconductivity, where many scientists place particular importance on superconductivity in semiconductors.This focus issue features a variety of topics on superconductivity in semiconductors selected from the 2nd International Workshop on Superconductivity in Diamond and Related Materials (IWSDRM2008, which was held at the National Institute for Materials Science (NIMS, Tsukuba, Japan in July 2008. The 1st workshop was held in 2005 and was published as a special issue in Science and Technology of Advanced Materials (STAM in 2006 (Takano 2006 Sci. Technol. Adv. Mater. 7 S1.The selection of papers describe many important experimental and theoretical studies on superconductivity in semiconductors. Topics on boron-doped diamond include isotope effects (Ekimov et al and the detailed structure of boron sites, and the relation between superconductivity and disorder induced by boron doping. Regarding other semiconductors, the superconducting properties of silicon and SiC (Kriener et al, Muranaka et al and Yanase et al are discussed, and In2O3 (Makise et al is presented as a new superconducting semiconductor. Iron-based superconductors are presented as a new series of high

  16. Survey of SSC12 regions affecting fatty acid composition of intramuscular fat using high density SNP data

    Directory of Open Access Journals (Sweden)

    María eMuñoz

    2012-01-01

    Full Text Available Fatty acid composition is a critical aspect of pork because it affects sensorial and technological aspects of meat quality and it is relevant for human health. Previous studies identified significant QTLs in porcine chromosome 12 for fatty acid profile of backfat and intramuscular fat. In the present study, 374 SNPs mapped in SSC12 from the 60K Porcine SNP Beadchip were used. We have combined linkage and association analyses with expression data analysis in order to identify regions of SSC12 that could affect fatty acid composition of intramuscular fat in longissimus muscle. The QTL scan showed a region around the 60 cM position that significantly affects palmitic fatty acid and two related fatty acid indexes. The Iberian QTL allele increased the palmitic content (+2.6% of mean trait. This QTL does not match any of those reported in the previous study on fatty acid composition of backfat, suggesting different genetic control acting at both tissues. The SNP association analyses showed significant associations with linolenic and palmitic acids besides several indexes. Among the polymorphisms that affect palmitic fatty acid and match the QTL region at 60 cM, there were three that mapped in the Phosphatidylcholine Transfer Protein (PCTP gene and one in the Acetyl-CoA Carboxylase  gene (ACACA. Interestingly one of the PCTP SNPs also affected significantly unsaturated and double bound indexes and the ratio between polyunsaturated/monounsaturated fatty acids. Differential expression was assessed on longissimus muscle conditional on the genotype of the QTL and on the most significant SNPs, according to the results obtained in the former analyses. Results from the microarray expression analyses, validated by RT-qPCR, showed that PCTP expression levels significantly vary depending on the QTL as well as on the own PCTP genotype. The results obtained with the different approaches point out the PCTP gene as a powerful candidate underlying the QTL for

  17. Mrk 421 active state in 2008: the MAGIC view, simultaneous multi-wavelength observations and SSC model constrained

    Science.gov (United States)

    Aleksić, J.; Alvarez, E. A.; Antonelli, L. A.; Antoranz, P.; Asensio, M.; Backes, M.; Barrio, J. A.; Bastieri, D.; Becerra González, J.; Bednarek, W.; Berdyugin, A.; Berger, K.; Bernardini, E.; Biland, A.; Blanch, O.; Bock, R. K.; Boller, A.; Bonnoli, G.; Borla Tridon, D.; Braun, I.; Bretz, T.; Cañellas, A.; Carmona, E.; Carosi, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Cossio, L.; Covino, S.; Dazzi, F.; De Angelis, A.; De Caneva, G.; De Cea del Pozo, E.; De Lotto, B.; Delgado Mendez, C.; Diago Ortega, A.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Elsaesser, D.; Ferenc, D.; Fonseca, M. V.; Font, L.; Fruck, C.; García López, R. J.; Garczarczyk, M.; Garrido, D.; Giavitto, G.; Godinović, N.; Hadasch, D.; Häfner, D.; Herrero, A.; Hildebrand, D.; Höhne-Mönch, D.; Hose, J.; Hrupec, D.; Huber, B.; Jogler, T.; Kellermann, H.; Klepser, S.; Krähenbühl, T.; Krause, J.; La Barbera, A.; Lelas, D.; Leonardo, E.; Lindfors, E.; Lombardi, S.; López, A.; López, M.; Lorenz, E.; Makariev, M.; Maneva, G.; Mankuzhiyil, N.; Mannheim, K.; Maraschi, L.; Mariotti, M.; Martínez, M.; Mazin, D.; Meucci, M.; Miranda, J. M.; Mirzoyan, R.; Miyamoto, H.; Moldón, J.; Moralejo, A.; Munar-Adrover, P.; Nieto, D.; Nilsson, K.; Orito, R.; Oya, I.; Paneque, D.; Paoletti, R.; Pardo, S.; Paredes, J. M.; Partini, S.; Pasanen, M.; Pauss, F.; Perez-Torres, M. A.; Persic, M.; Peruzzo, L.; Pilia, M.; Pochon, J.; Prada, F.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Reichardt, I.; Reinthal, R.; Rhode, W.; Ribó, M.; Rico, J.; Rügamer, S.; Saggion, A.; Saito, K.; Saito, T. Y.; Salvati, M.; Satalecka, K.; Scalzotto, V.; Scapin, V.; Schultz, C.; Schweizer, T.; Shayduk, M.; Shore, S. N.; Sillanpää, A.; Sitarek, J.; Sobczynska, D.; Spanier, F.; Spiro, S.; Stamerra, A.; Steinke, B.; Storz, J.; Strah, N.; Surić, T.; Takalo, L.; Takami, H.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Tibolla, O.; Torres, D. F.; Treves, A.; Uellenbeck, M.; Vankov, H.; Vogler, P.; Wagner, R. M.; Weitzel, Q.; Zabalza, V.; Zandanel, F.; Zanin, R.

    2012-06-01

    Context. The blazar Markarian 421 is one of the brightest TeV gamma-ray sources of the northern sky. From December 2007 until June 2008 it was intensively observed in the very high energy (VHE, E > 100 GeV) band by the single-dish Major Atmospheric Gamma-ray Imaging Cherenkov telescope (MAGIC-I). Aims: We aimed to measure the physical parameters of the emitting region of the blazar jet during active states. Methods: We performed a dense monitoring of the source in VHE with MAGIC-I, and also collected complementary data in soft X-rays and optical-UV bands; then, we modeled the spectral energy distributions (SED) derived from simultaneous multi-wavelength data within the synchrotron self-Compton (SSC) framework. Results: The source showed intense and prolonged γ-ray activity during the whole period, with integral fluxes (E > 200 GeV) seldom below the level of the Crab Nebula, and up to 3.6 times this value. Eight datasets of simultaneous optical-UV (KVA, Swift/UVOT), soft X-ray (Swift/XRT) and MAGIC-I VHE data were obtained during different outburst phases. The data constrain the physical parameters of the jet, once the spectral energy distributions obtained are interpreted within the framework of a single-zone SSC leptonic model. Conclusions: The main outcome of the study is that within the homogeneous model high Doppler factors (40 ≤ δ ≤ 80) are needed to reproduce the observed SED; but this model cannot explain the observed short time-scale variability, while it can be argued that inhomogeneous models could allow for less extreme Doppler factors, more intense magnetic fields and shorter electron cooling times compatible with hour or sub-hour scale variability.

  18. Topological superconductivity induced by ferromagnetic metal chains

    Science.gov (United States)

    Li, Jian; Chen, Hua; Drozdov, Ilya K.; Yazdani, A.; Bernevig, B. Andrei; MacDonald, A. H.

    2014-12-01

    Recent experiments have provided evidence that one-dimensional (1D) topological superconductivity can be realized experimentally by placing transition-metal atoms that form a ferromagnetic chain on a superconducting substrate. We address some properties of this type of system by using a Slater-Koster tight-binding model to account for important features of the electronic structure of the transition-metal chains on the superconducting substrate. We predict that topological superconductivity is nearly universal when ferromagnetic transition-metal chains form straight lines on superconducting substrates and that it is possible for more complex chain structures. When the chain is weakly coupled to the substrate and is longer than superconducting coherence lengths, its proximity-induced superconducting gap is ˜Δ ESO/J where Δ is the s -wave pair potential on the chain, ESO is the spin-orbit splitting energy induced in the normal chain state bands by hybridization with the superconducting substrate, and J is the exchange splitting of the ferromagnetic chain d bands. Because of the topological character of the 1D superconducting state, Majorana end modes appear within the gaps of finite length chains. We find, in agreement with the experiment, that when the chain and substrate orbitals are strongly hybridized, Majorana end modes are substantially reduced in amplitude when separated from the chain end by less than the coherence length defined by the p -wave superconducting gap. We conclude that Pb is a particularly favorable substrate material for ferromagnetic chain topological superconductivity because it provides both strong s -wave pairing and strong Rashba spin-orbit coupling, but that there is an opportunity to optimize properties by varying the atomic composition and structure of the chain. Finally, we note that in the absence of disorder, a new chain magnetic symmetry, one that is also present in the crystalline topological insulators, can stabilize multiple

  19. Superconducting integrated submillimeter receiver for TELIS

    NARCIS (Netherlands)

    Koshelets, Valery P.; Ermakov, Andrey B.; Filippenko, Lyudmila V.; Khudchenko, Andrey V.; Kiselev, Oleg S.; Sobolev, Alexander S.; Torgashin, Mikhail Yu.; Yagoubov, Pavel A.; Hoogeveen, Ruud W. M.; Wild, Wolfgang

    2007-01-01

    In this report an overview of the results on the development of a single-chip superconducting integrated receiver for the Terahertz Limb Sounder (TELIS) balloon project intended to measure a variety of stratosphere trace gases is presented. The Superconducting Integrated Receiver (SIR) comprises in

  20. Insulation systems for superconducting transmission cables

    DEFF Research Database (Denmark)

    Tønnesen, Ole

    1996-01-01

    the electrical insulation is placed outside both the superconducting tube and the cryostat. The superconducting tube is cooled by liquid nitrogen which is pumped through the hollow part of the tube.2) The cryogenic dielectric design, where the electrical insulation is placed inside the cryostat and thus is kept...

  1. 17th International Conference on RF Superconductivity

    CERN Document Server

    2015-01-01

    RF superconductivity is the key technology of accelerators for particle physics, nuclear physics and light sources. SRF 2015 covered the latest advances in the science, technology, and applications of superconducting RF. There was also an industrial exhibit during the conference with the key vendors in the community available to discuss their capabilities and products.

  2. Superconducting magnets. Citations from NTIS data base

    Science.gov (United States)

    Reimherr, G. W.

    1980-10-01

    The cited reports discuss research on materials studies, theory, design and applications of superconducting magnets. Examples of applications include particle accelerators, MHD power generation, superconducting generators, nuclear fusion research devices, energy storage systems, and magnetic levitation. This updated bibliography contains 218 citations, 88 of which are new entries to the previous edition.

  3. Superconducting Materials, Magnets and Electric Power Applications

    Science.gov (United States)

    Crabtree, George

    2011-03-01

    The surprising discovery of superconductivity a century ago launched a chain of convention-shattering innovations and discoveries in superconducting materials and applications that continues to this day. The range of large-scale applications grows with new materials discoveries - low temperature NbTi and Nb3 Sn for liquid helium cooled superconducting magnets, intermediate temperature MgB2 for inexpensive cryocooled applications including MRI magnets, and high temperature YBCO and BSSCO for high current applications cooled with inexpensive liquid nitrogen. Applications based on YBCO address critical emerging challenges for the electricity grid, including high capacity superconducting cables to distribute power in urban areas; transmission of renewable electricity over long distances from source to load; high capacity DC interconnections among the three US grids; fast, self-healing fault current limiters to increase reliability; low-weight, high capacity generators enabling off-shore wind turbines; and superconducting magnetic energy storage for smoothing the variability of renewable sources. In addition to these grid applications, coated conductors based on YBCO deposited on strong Hastelloy substrates enable a new generation of all superconducting high field magnets capable of producing fields above 30 T, approximately 50% higher than the existing all superconducting limit based on Nb3 Sn . The high fields, low power cost and the quiet electromagnetic and mechanical operation of such magnets could change the character of high field basic research on materials, enable a new generation of high-energy colliding beam experiments and extend the reach of high density superconducting magnetic energy storage.

  4. Superconducting chip receivers for imaging application

    NARCIS (Netherlands)

    Shitov, SV; Koshelets, VP; Ermakov, AB; Filippenko, LV; Baryshev, AM; Luinge, W; Gao, [No Value

    1999-01-01

    Experimental details of a unique superconducting imaging array receiver are discussed. Each pixel contains an internally pumped receiver chip mounted on the back of the elliptical microwave lens. Each chip comprises a quasi-optical SIS mixer integrated with a superconducting flux-flow oscillator (FF

  5. Diagram of a LEP superconducting cavity

    CERN Multimedia

    1991-01-01

    This diagram gives a schematic representation of the superconducting radio-frequency cavities at LEP. Liquid helium is used to cool the cavity to 4.5 degrees above absolute zero so that very high electric fields can be produced, increasing the operating energy of the accelerator. Superconducting cavities were used only in the LEP-2 phase of the accelerator, from 1996 to 2000.

  6. 17th International Conference on RF Superconductivity

    CERN Document Server

    Laxdal, Robert E.; Schaa, Volker R.W.

    2015-01-01

    RF superconductivity is the key technology of accelerators for particle physics, nuclear physics and light sources. SRF 2015 covered the latest advances in the science, technology, and applications of superconducting RF. There was also an industrial exhibit during the conference with the key vendors in the community available to discuss their capabilities and products.

  7. Josephson plasma resonance in superconducting multilayers

    DEFF Research Database (Denmark)

    Pedersen, Niels Falsig; Sakai, S

    1998-01-01

    We derive an analytical solution for the Josephson plasma resonance of superconducting multilayers. This analytical solution is derived mainly for low-T-c systems with magnetic coupling between the superconducting layers. but many features of our results are more general, and thus an application...

  8. Research progresses shed light on superconductivity mechanism

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    @@ The spring of 2008 saw substantial breakthroughs in superconductivity research. Four groups of physicists, one after another, achieved remarkable progresses in the study of iron-based materials after the breakthrough made by H. Hosono's group in Japan, providing renewed insights into the fundamental mechanism of high-temperature superconductivity (HTSC), a perplexing enigma on the frontier of condensed matter physics.

  9. Josephson plasma resonance in superconducting multilayers

    DEFF Research Database (Denmark)

    Pedersen, Niels Falsig

    1999-01-01

    We derive an analytical solution for the josephson plasma resonance of superconducting multilayers. This analytical solution is derived mainly for low T-c systems with magnetic coupling between the superconducting layers, but many features of our results are more general, and thus an application...

  10. Interfacing superconducting qubits and single optical photons

    NARCIS (Netherlands)

    Das, Sumanta; Faez, Sanli; Sørensen, Anders S.

    2016-01-01

    We propose an efficient light-matter interface at optical frequencies between a superconducting qubit and a single photon. The desired interface is based on a hybrid architecture composed of an organic molecule embedded inside an optical waveguide and electrically coupled to a superconducting qubit

  11. Interaction between ionic lattices and superconducting condensates

    OpenAIRE

    2007-01-01

    The interaction of the ionic lattice with the superconducting condensate is treated in terms of the electrostatic force in superconductors. It is shown that this force is similar but not identical to the force suggested by the volume difference of the normal and superconducting states. The BCS theory shows larger deviations than the two-fluid model.

  12. Superconductivity in compensated and uncompensated semiconductors.

    Science.gov (United States)

    Yanase, Youichi; Yorozu, Naoyuki

    2008-12-01

    We investigate the localization and superconductivity in heavily doped semiconductors. The crossover from the superconductivity in the host band to that in the impurity band is described on the basis of the disordered three-dimensional attractive Hubbard model for binary alloys. The microscopic inhomogeneity and the thermal superconducting fluctuation are taken into account using the self-consistent 1-loop order theory. The superconductor-insulator transition accompanies the crossover from the host band to the impurity band. We point out an enhancement of the critical temperature Tc around the crossover. Further localization of electron wave functions leads to the localization of Cooper pairs and induces the pseudogap. We find that both the doping compensation by additional donors and the carrier increase by additional acceptors suppress the superconductivity. A theoretical interpretation is proposed for the superconductivity in the boron-doped diamond, SiC, and Si.

  13. Superconductivity in compensated and uncompensated semiconductors

    Directory of Open Access Journals (Sweden)

    Youichi Yanase and Naoyuki Yorozu

    2008-01-01

    Full Text Available We investigate the localization and superconductivity in heavily doped semiconductors. The crossover from the superconductivity in the host band to that in the impurity band is described on the basis of the disordered three-dimensional attractive Hubbard model for binary alloys. The microscopic inhomogeneity and the thermal superconducting fluctuation are taken into account using the self-consistent 1-loop order theory. The superconductor-insulator transition accompanies the crossover from the host band to the impurity band. We point out an enhancement of the critical temperature Tc around the crossover. Further localization of electron wave functions leads to the localization of Cooper pairs and induces the pseudogap. We find that both the doping compensation by additional donors and the carrier increase by additional acceptors suppress the superconductivity. A theoretical interpretation is proposed for the superconductivity in the boron-doped diamond, SiC, and Si.

  14. Method for producing substrates for superconducting layers

    DEFF Research Database (Denmark)

    2013-01-01

    There is provided a method for producing a substrate (600) suitable for supporting an elongated superconducting element, wherein, e.g., a deformation process is utilized in order to form disruptive strips in a layered solid element, and where etching is used to form undercut volumes (330, 332......) between an upper layer (316) and a lower layer (303) of the layered solid element. Such relatively simple steps enable providing a substrate which may be turned into a superconducting structure, such as a superconducting tape, having reduced AC losses, since the undercut volumes (330, 332) may be useful...... for separating layers of material. In a further embodiment, there is placed a superconducting layer on top of the upper layer (316) and/or lower layer (303), so as to provide a superconducting structure with reduced AC losses....

  15. Superconducting Radio Frequency Technology: An Overview

    Energy Technology Data Exchange (ETDEWEB)

    Peter Kneisel

    2003-06-01

    Superconducting RF cavities are becoming more often the choice for larger scale particle accelerator projects such as linear colliders, energy recovery linacs, free electron lasers or storage rings. Among the many advantages compared to normal conducting copper structures, the superconducting devices dissipate less rf power, permit higher accelerating gradients in CW operation and provide better quality particle beams. In most cases these accelerating cavities are fabricated from high purity bulk niobium, which has superior superconducting properties such as critical temperature and critical magnetic field when compared to other superconducting materials. Research during the last decade has shown, that the metallurgical properties--purity, grain structure, mechanical properties and oxidation behavior--have significant influence on the performance of these accelerating devices. This contribution attempts to give a short overview of the superconducting RF technology with emphasis on the importance of the material properties of the high purity niobium.

  16. STRIPES AND SUPERCONDUCTIVITY IN CUPRATE SUPERCONDUCTORS

    Energy Technology Data Exchange (ETDEWEB)

    TRANQUADA, J.M.

    2005-08-22

    One type of order that has been observed to compete with superconductivity in cuprates involves alternating charge and antiferromagnetic stripes. Recent neutron scattering studies indicate that the magnetic excitation spectrum of a stripe-ordered sample is very similar to that observed in superconducting samples. In fact, it now appears that there may be a universal magnetic spectrum for the cuprates. One likely implication of this universal spectrum is that stripes of a dynamic form are present in the superconducting samples. On cooling through the superconducting transition temperature, a gap opens in the magnetic spectrum, and the weight lost at low energy piles up above the gap; the transition temperature is correlated with the size of the spin gap. Depending on the magnitude of the spin gap with respect to the magnetic spectrum, the enhanced magnetic scattering at low temperature can be either commensurate or incommensurate. Connections between stripe correlations and superconductivity are discussed.

  17. Stripes and superconductivity in cuprate superconductors

    Science.gov (United States)

    Tranquada, J. M.

    2005-08-01

    One type of order that has been observed to compete with superconductivity in cuprates involves alternating charge and antiferromagnetic stripes. Recent neutron scattering studies indicate that the magnetic excitation spectrum of a stripe-ordered sample is very similar to that observed in superconducting samples. In fact, it now appears that there may be a universal magnetic spectrum for the cuprates. One likely implication of this universal spectrum is that stripes of a dynamic form are present in the superconducting samples. On cooling through the superconducting transition temperature, a gap opens in the magnetic spectrum, and the weight lost at low energy piles up above the gap; the transition temperature is correlated with the size of the spin gap. Depending on the magnitude of the spin gap with respect to the magnetic spectrum, the enhanced magnetic scattering at low temperature can be either commensurate or incommensurate. Connections between stripe correlations and superconductivity are discussed.

  18. Free-standing oxide superconducting articles

    Science.gov (United States)

    Wu, Xin D.; Muenchausen, Ross E.

    1993-01-01

    A substrate-free, free-standing epitaxially oriented superconductive film including a layer of a template material and a layer of a ceramic superconducting material is provided together with a method of making such a substrate-free ceramic superconductive film by coating an etchable material with a template layer, coating the template layer with a layer of a ceramic superconductive material, coating the layer of ceramic superconductive material with a protective material, removing the etchable material by an appropriate means so that the etchable material is separated from a composite structure including the template lay This invention is the result of a contract with the Department of Energy (Contract No. W-7405-ENG-36).

  19. Development of Superconducting Wind Turbine Generators

    DEFF Research Database (Denmark)

    Jensen, Bogi Bech; Mijatovic, Nenad; Abrahamsen, Asger Bech

    2012-01-01

    (HTS); and one is a fully superconducting generator based on MgB2. It is concluded that there is large commercial interest in superconducting machines, with an increasing patenting activity. Such generators are however not without their challenges. The superconductors have to be cooled down......In this paper the commercial activities in the field of superconducting machines, particularly superconducting wind turbine generators, are reviewed and presented. Superconducting generators have the potential to provide a compact and light weight drive train at high torques and slow rotational...... to somewhere between 4K and 50K, depending on what type of superconductor is employed, which poses a significant challenge both from a construction and operation point of view. The high temperature superconductors can facilitate a higher operation temperature and simplified cooling, but the current price...

  20. Quantum Memristors with Superconducting Circuits

    Science.gov (United States)

    Salmilehto, J.; Deppe, F.; di Ventra, M.; Sanz, M.; Solano, E.

    2017-02-01

    Memristors are resistive elements retaining information of their past dynamics. They have garnered substantial interest due to their potential for representing a paradigm change in electronics, information processing and unconventional computing. Given the advent of quantum technologies, a design for a quantum memristor with superconducting circuits may be envisaged. Along these lines, we introduce such a quantum device whose memristive behavior arises from quasiparticle-induced tunneling when supercurrents are cancelled. For realistic parameters, we find that the relevant hysteretic behavior may be observed using current state-of-the-art measurements of the phase-driven tunneling current. Finally, we develop suitable methods to quantify memory retention in the system.

  1. Superconductivity in Metals and Alloys

    Science.gov (United States)

    1963-02-01

    sintered material (Reed, Gatos , LaFleur, and Roddy, 1962). It has great importance for any materials work, since generalizations based only on stoichio...1961),Phys. Rev. Letters 6, 597. Goodman, B. B., (1962) IBM J. Research and Development 6, 63. Gor’kov, L. P., (1960), Soy . Phys. JETP 10, 998...34Superconductivity in Metals and Alloys-Technical Documentary Report No. ASD-TDR-62-269, Contract No. AF 33(616)-640 5. Reed, T. B., Gatos , H. C., LaFleur, W. j

  2. The crystallography of color superconductivity

    CERN Document Server

    Bowers, J A; Bowers, Jeffrey A.; Rajagopal, Krishna

    2003-01-01

    We describe the crystalline phase of color superconducting quark matter. This phase may occur in quark matter at densities relevant for compact star physics, with possible implications for glitch phenomena in pulsars. We use a Ginzburg-Landau approach to determine that the crystal has a face-centered-cubic (FCC) structure. Moreover, our results indicate that the phase is robust, with gaps, critical temperature, and free energy comparable to those of the color-flavor-locked (CFL) phase. Our calculations also predict ``crystalline superfluidity'' in ultracold gases of fermionic atoms.

  3. Superconductivity, antiferromagnetism, and neutron scattering

    Science.gov (United States)

    Tranquada, John M.; Xu, Guangyong; Zaliznyak, Igor A.

    2014-01-01

    High-temperature superconductivity in both the copper-oxide and the iron-pnictide/chalcogenide systems occurs in close proximity to antiferromagnetically ordered states. Neutron scattering has been an essential technique for characterizing the spin correlations in the antiferromagnetic phases and for demonstrating how the spin fluctuations persist in the superconductors. While the nature of the spin correlations in the superconductors remains controversial, the neutron scattering measurements of magnetic excitations over broad ranges of energy and momentum transfers provide important constraints on the theoretical options. We present an overview of the neutron scattering work on high-temperature superconductors and discuss some of the outstanding issues.

  4. Superconductivity a very short introduction

    CERN Document Server

    Blundell, Stephen

    2009-01-01

    Superconductivity is one of the most exciting areas of research in physics today. Outlining the history of its discovery, and the race to understand its many mysterious and counter-intuitive phenomena, this Very Short Introduction explains in accessible terms the theories that have been developed, and how they have influenced other areas of science, including the Higgs boson of particle physics and ideas about the early Universe. It is an engaging and informative accountof a fascinating scientific detective story, and an intelligible insight into some deep and beautiful ideas of physics

  5. Quantum Memristors with Superconducting Circuits

    Science.gov (United States)

    Salmilehto, J.; Deppe, F.; Di Ventra, M.; Sanz, M.; Solano, E.

    2017-01-01

    Memristors are resistive elements retaining information of their past dynamics. They have garnered substantial interest due to their potential for representing a paradigm change in electronics, information processing and unconventional computing. Given the advent of quantum technologies, a design for a quantum memristor with superconducting circuits may be envisaged. Along these lines, we introduce such a quantum device whose memristive behavior arises from quasiparticle-induced tunneling when supercurrents are cancelled. For realistic parameters, we find that the relevant hysteretic behavior may be observed using current state-of-the-art measurements of the phase-driven tunneling current. Finally, we develop suitable methods to quantify memory retention in the system. PMID:28195193

  6. Superconductive Signal-Processing Circuits

    Science.gov (United States)

    1994-08-01

    September 1991. 13. P. H. Xiao, E. Charbon , A. Sangiovanni-Vincentelli, T. Van Duzer,and S.W. Whiteley, "INDEX: An inductance extractor for superconducting...wideband analog-to-digital to a useful binary representation. In order to achieve an N-bit converter reported earlier [1]. The original design has been...rises, the SQUID Parameter Original Modified switches to the voltage state, and the output goes high. Ic(J1) 337 367 I tA S gaicGate: The comparator

  7. Fermionic models with superconducting circuits

    Energy Technology Data Exchange (ETDEWEB)

    Las Heras, Urtzi; Garcia-Alvarez, Laura; Mezzacapo, Antonio; Lamata, Lucas [University of the Basque Country UPV/EHU, Department of Physical Chemistry, Bilbao (Spain); Solano, Enrique [University of the Basque Country UPV/EHU, Department of Physical Chemistry, Bilbao (Spain); IKERBASQUE, Basque Foundation for Science, Bilbao (Spain)

    2015-12-01

    We propose a method for the efficient quantum simulation of fermionic systems with superconducting circuits. It consists in the suitable use of Jordan-Wigner mapping, Trotter decomposition, and multiqubit gates, be with the use of a quantum bus or direct capacitive couplings. We apply our method to the paradigmatic cases of 1D and 2D Fermi-Hubbard models, involving couplings with nearest and next-nearest neighbours. Furthermore, we propose an optimal architecture for this model and discuss the benchmarking of the simulations in realistic circuit quantum electrodynamics setups. (orig.)

  8. Terahertz superconducting plasmonic hole array

    CERN Document Server

    Tian, Zhen; Han, Jiaguang; Gu, Jianqiang; Xing, Qirong; Zhang, Weili

    2010-01-01

    We demonstrate thermally tunable superconductor hole array with active control over their resonant transmission induced by surface plasmon polaritons . The array was lithographically fabricated on high temperature YBCO superconductor and characterized by terahertz-time domain spectroscopy. We observe a clear transition from the virtual excitation of the surface plasmon mode to the real surface plasmon mode. The highly tunable superconducting plasmonic hole arrays may have promising applications in the design of low-loss, large dynamic range amplitude modulation, and surface plasmon based terahertz devices.

  9. Characterization of superconducting multilayers samples

    CERN Document Server

    Antoine, C Z; Berry, S; Bouat, S; Jacquot, J F; Villegier, J C; Lamura, G; Gurevich, A

    2009-01-01

    Best RF bulk niobium accelerating cavities have nearly reached their ultimate limits at rf equatorial magnetic field H  200 mT close to the thermodynamic critical field Hc. In 2006 Gurevich proposed to use nanoscale layers of superconducting materials with high values of Hc > HcNb for magnetic shielding of bulk niobium to increase the breakdown magnetic field inside SC RF cavities [1]. Depositing good quality layers inside a whole cavity is rather difficult but we have sputtered high quality samples by applying the technique used for the preparation of superconducting electronics circuits and characterized these samples by X-ray reflectivity, dc resistivity (PPMS) and dc magnetization (SQUID). Dc magnetization curves of a 250 nm thick Nb film have been measured, with and without a magnetron sputtered coating of a single or multiple stack of 15 nm MgO and 25 nm NbN layers. The Nb samples with/without the coating clearly exhibit different behaviors. Because SQUID measurements are influenced by edge an...

  10. Recent developments in superconducting receivers

    Science.gov (United States)

    Richards, Paul L.

    1990-09-01

    A description is given of recent work at Berkeley on superconducting mixers and detectors for infrared and millimeter wavelengths. The first report is a review article which summarizes the status of development of superconducting components for infrared and millimeter wave receivers. The next report describes accurate measurements and also theoretical modeling of an SIS quasiparticle waveguide mixer for W-band which uses very high quality Ta junctions. The best mixer noise is only 1.3 times the quantum limit. Both the mixer gain and the noise are in quantitative agreement with the quantum theory. Next, a report is given on measurements and theoretical modeling of the absorptivity (surface resistance) of high quality epitaxial films of the high Tc superconductor YBCO from 750 GHz to 21 THz. Finally, there are reports on the design and experimental performance of two different types of high Tc bolometric detectors. One is a conventional bolometer with a gold-black absorber. The other is an antenna coupled microbolometer.

  11. Superconducting rf development at ATLAS

    Energy Technology Data Exchange (ETDEWEB)

    Shepard, K.W.; Kedzie, M.; Clifft, B.E. [Argonne National Lab., IL (United States); Roy, A.; Potukuchi, P. [Nuclear Science Centre, New Delhi (India); Givens, J.; Potter, J.; Crandall, K. [AccSys Technology, Inc., Pleasanton, CA (United States); Added, N. [Sao Paulo Univ., SP (Brazil)

    1993-12-31

    The ATLAS superconducting heavy-ion linac began operation in 1978 and has operated nearly continuously since that time, while undergoing a series of upgrades and expansions, the most recent being the ``uranium upgrade`` completed earlier this year and described below. In its present configuration the ATLAS linac consists of an array of 64 resonant cavities operating from 48 to 145 MHz, which match a range of particle velocities .007 < {beta} = v/c < .2. The linac provides approximately 50 MV of effective accelerating potential for ions of q/m > 1/10 over the entire periodic table. Delivered beams include 5 {minus} 7 pnA of {sup 238}U{sup 39+} at 1535 MeV. At present more than 10{sup 6} cavity-hours of operation at surface electric fields of 15 MV/m have been accumulated. Superconducting structure development at ATLAS is aimed at improving the cost/performance of existing low velocity structures both for possible future ATLAS upgrades, and also for heavy-ion linacs at other institutions. An application of particular current interest is to develop structures suitable for accelerating radioactive ion beams. Such structures must accelerate very low charge to mass ratio beams and must also have very large transverse acceptance.

  12. DC superconducting fault current limiter

    Science.gov (United States)

    Tixador, P.; Villard, C.; Cointe, Y.

    2006-03-01

    There is a lack of satisfying solutions for fault currents using conventional technologies, especially in DC networks, where a superconducting fault current limiter could play a very important part. DC networks bring a lot of advantages when compared to traditional AC ones, in particular within the context of the liberalization of the electric market. Under normal operation in a DC network, the losses in the superconducting element are nearly zero and only a small, i.e. a low cost, refrigeration system is then required. The absence of zero crossing of a DC fault current favourably accelerates the normal zone propagation. The very high current slope at the time of the short circuit in a DC grid is another favourable parameter. The material used for the experiments is YBCO deposited on Al2O3 as well as YBCO coated conductors. The DC limitation experiments are compared to AC ones at different frequencies (50-2000 Hz). Careful attention is paid to the quench homogenization, which is one of the key issues for an SC FCL. The University of Geneva has proposed constrictions. We have investigated an operating temperature higher than 77 K. As for YBCO bulk, an operation closer to the critical temperature brings a highly improved homogeneity in the electric field development. The material can then absorb large energies without degradation. We present tests at various temperatures. These promising results are to be confirmed over long lengths.

  13. High Temperature Superconducting Underground Cable

    Energy Technology Data Exchange (ETDEWEB)

    Farrell, Roger, A.

    2010-02-28

    The purpose of this Project was to design, build, install and demonstrate the technical feasibility of an underground high temperature superconducting (HTS) power cable installed between two utility substations. In the first phase two HTS cables, 320 m and 30 m in length, were constructed using 1st generation BSCCO wire. The two 34.5 kV, 800 Arms, 48 MVA sections were connected together using a superconducting joint in an underground vault. In the second phase the 30 m BSCCO cable was replaced by one constructed with 2nd generation YBCO wire. 2nd generation wire is needed for commercialization because of inherent cost and performance benefits. Primary objectives of the Project were to build and operate an HTS cable system which demonstrates significant progress towards commercial progress and addresses real world utility concerns such as installation, maintenance, reliability and compatibility with the existing grid. Four key technical areas addressed were the HTS cable and terminations (where the cable connects to the grid), cryogenic refrigeration system, underground cable-to-cable joint (needed for replacement of cable sections) and cost-effective 2nd generation HTS wire. This was the world’s first installation and operation of an HTS cable underground, between two utility substations as well as the first to demonstrate a cable-to-cable joint, remote monitoring system and 2nd generation HTS.

  14. Superconductivity in Ca-doped graphene laminates

    Science.gov (United States)

    Chapman, J.; Su, Y.; Howard, C. A.; Kundys, D.; Grigorenko, A. N.; Guinea, F.; Geim, A. K.; Grigorieva, I. V.; Nair, R. R.

    2016-01-01

    Despite graphene’s long list of exceptional electronic properties and many theoretical predictions regarding the possibility of superconductivity in graphene, its direct and unambiguous experimental observation has not been achieved. We searched for superconductivity in weakly interacting, metal decorated graphene crystals assembled into so-called graphene laminates, consisting of well separated and electronically decoupled graphene crystallites. We report robust superconductivity in all Ca-doped graphene laminates. They become superconducting at temperatures (Tc) between ≈4 and ≈6 K, with Tc’s strongly dependent on the confinement of the Ca layer and the induced charge carrier concentration in graphene. We find that Ca is the only dopant that induces superconductivity in graphene laminates above 1.8 K among several dopants used in our experiments, such as potassium, caesium and lithium. By revealing the tunability of the superconducting response through doping and confinement of the metal layer, our work shows that achieving superconductivity in free-standing, metal decorated monolayer graphene is conditional on an optimum confinement of the metal layer and sufficient doping, thereby bringing its experimental realization within grasp. PMID:26979564

  15. Superconductivity in Ca-doped graphene laminates

    Science.gov (United States)

    Chapman, J.; Su, Y.; Howard, C. A.; Kundys, D.; Grigorenko, A. N.; Guinea, F.; Geim, A. K.; Grigorieva, I. V.; Nair, R. R.

    2016-03-01

    Despite graphene’s long list of exceptional electronic properties and many theoretical predictions regarding the possibility of superconductivity in graphene, its direct and unambiguous experimental observation has not been achieved. We searched for superconductivity in weakly interacting, metal decorated graphene crystals assembled into so-called graphene laminates, consisting of well separated and electronically decoupled graphene crystallites. We report robust superconductivity in all Ca-doped graphene laminates. They become superconducting at temperatures (Tc) between ≈4 and ≈6 K, with Tc’s strongly dependent on the confinement of the Ca layer and the induced charge carrier concentration in graphene. We find that Ca is the only dopant that induces superconductivity in graphene laminates above 1.8 K among several dopants used in our experiments, such as potassium, caesium and lithium. By revealing the tunability of the superconducting response through doping and confinement of the metal layer, our work shows that achieving superconductivity in free-standing, metal decorated monolayer graphene is conditional on an optimum confinement of the metal layer and sufficient doping, thereby bringing its experimental realization within grasp.

  16. Visualizing domain wall and reverse domain superconductivity.

    Science.gov (United States)

    Iavarone, M; Moore, S A; Fedor, J; Ciocys, S T; Karapetrov, G; Pearson, J; Novosad, V; Bader, S D

    2014-08-28

    In magnetically coupled, planar ferromagnet-superconductor (F/S) hybrid structures, magnetic domain walls can be used to spatially confine the superconductivity. In contrast to a superconductor in a uniform applied magnetic field, the nucleation of the superconducting order parameter in F/S structures is governed by the inhomogeneous magnetic field distribution. The interplay between the superconductivity localized at the domain walls and far from the walls leads to effects such as re-entrant superconductivity and reverse domain superconductivity with the critical temperature depending upon the location. Here we use scanning tunnelling spectroscopy to directly image the nucleation of superconductivity at the domain wall in F/S structures realized with Co-Pd multilayers and Pb thin films. Our results demonstrate that such F/S structures are attractive model systems that offer the possibility to control the strength and the location of the superconducting nucleus by applying an external magnetic field, potentially useful to guide vortices for computing application.

  17. Sample of superconducting wiring (Niobium Titanium)

    CERN Multimedia

    About NbTi cable: The cable consists of 36 strands of superconducting wire, each strand has a diameter of 0.825 mm and houses 6300 superconducting filaments of niobium-titanium (Nb-Ti, a superconducting alloy). Each filament has a diameter of about 0.006 mm, i.e. 10 times smaller than a typical human hair. The filaments are embedded in a high-purity copper matrix. Copper is a normal conducting material. The filaments are in the superconductive state when the temperature is below about -263ºC (10.15 K). When the filaments leave the superconductive state, the copper acts as conductor transports the electrical current. Each strand of The NbTi cable (at superconducting state) has a current density of up to above 2000 A/mm2 at 9 T and -271ºC (2.15 K). A cable transport a current of about 13000 A at 10 T and -271ºC (2.15 K). About LHC superconducting wiring: The high magnetic fields needed for the LHC can only be reached using superconductors. At very low temperatures, superconductors have no electrical resista...

  18. Sample of superconducting wiring (Niobium Titanium)

    CERN Multimedia

    About NbTi cable: The cable consists of 36 strands of superconducting wire, each strand has a diameter of 0.825 mm and houses 6300 superconducting filaments of niobium-titanium (Nb-Ti, a superconducting alloy). Each filament has a diameter of about 0.006 mm, i.e. 10 times smaller than a typical human hair. The filaments are embedded in a high-purity copper matrix. Copper is a normal conducting material. The filaments are in the superconductive state when the temperature is below about -263ºC (10.15 K). When the filaments leave the superconductive state, the copper acts as conductor transports the electrical current. Each strand of The NbTi cable (at superconducting state) has a current density of up to above 2000 A/mm2 at 9 T and -271ºC (2.15 K). A cable transport a current of about 13000 A at 10 T and -271ºC (2.15 K). About LHC superconducting wiring: The high magnetic fields needed for the LHC can only be reached using superconductors. At very low temperatures, superconductors have no electrical resistan...

  19. Superconducting phase transition in STM tips

    Energy Technology Data Exchange (ETDEWEB)

    Eltschka, Matthias; Jaeck, Berthold; Assig, Maximilian; Etzkorn, Markus; Ast, Christian R. [Max Planck Institute for Solid State Research, Stuttgart (Germany); Kern, Klaus [Max Planck Institute for Solid State Research, Stuttgart (Germany); Ecole Polytechnique Federale de Lausanne (Switzerland)

    2015-07-01

    The superconducting properties of systems with dimensions comparable to the London penetration depth considerably differ from macroscopic systems. We have studied the superconducting phase transition of vanadium STM tips in external magnetic fields. Employing Maki's theory we extract the superconducting parameters such as the gap or the Zeeman splitting from differential conductance spectra. While the Zeeman splitting follows the theoretical description of a system with s=1/2 and g=2, the superconducting gaps as well as the critical fields depend on the specific tip. For a better understanding of the experimental results, we solve a one dimensional Usadel equation modeling the superconducting tip as a cone with the opening angle α in an external magnetic field. We find that only a small region at the apex of the tip is superconducting in high magnetic fields and that the order of the phase transition is directly determined by α. Further, the spectral broadening increases with α indicating an intrinsic broadening mechanism due to the conical shape of the tip. Comparing these calculations to our experimental results reveals the order of the superconducting phase transition of the STM tips.

  20. Superconductivity in Ca-doped graphene laminates.

    Science.gov (United States)

    Chapman, J; Su, Y; Howard, C A; Kundys, D; Grigorenko, A N; Guinea, F; Geim, A K; Grigorieva, I V; Nair, R R

    2016-03-16

    Despite graphene's long list of exceptional electronic properties and many theoretical predictions regarding the possibility of superconductivity in graphene, its direct and unambiguous experimental observation has not been achieved. We searched for superconductivity in weakly interacting, metal decorated graphene crystals assembled into so-called graphene laminates, consisting of well separated and electronically decoupled graphene crystallites. We report robust superconductivity in all Ca-doped graphene laminates. They become superconducting at temperatures (Tc) between ≈4 and ≈6 K, with Tc's strongly dependent on the confinement of the Ca layer and the induced charge carrier concentration in graphene. We find that Ca is the only dopant that induces superconductivity in graphene laminates above 1.8 K among several dopants used in our experiments, such as potassium, caesium and lithium. By revealing the tunability of the superconducting response through doping and confinement of the metal layer, our work shows that achieving superconductivity in free-standing, metal decorated monolayer graphene is conditional on an optimum confinement of the metal layer and sufficient doping, thereby bringing its experimental realization within grasp.

  1. Mrk 421 active state in 2008: the MAGIC view, simultaneous multi-wavelength observations and SSC model constrained

    CERN Document Server

    Aleksic, J; Antonelli, L A; Antoranz, P; Asensio, M; Backes, M; Barrio, J A; Bastieri, D; Gonzalez, J Becerra; Bednarek, W; Berdyugin, A; Berger, K; Bernardini, E; Biland, A; Blanch, O; Bock, R K; Boller, A; Bonnoli, G; Tridon, D Borla; Braun, I; Bretz, T; Canellas, A; Carmona, E; Carosi, A; Colin, P; Colombo, E; Contreras, J L; Cortina, J; Cossio, L; Covino, S; Dazzi, F; De Angelis, A; De Caneva, G; del Pozo, E De Cea; De Lotto, B; Mendez, C Delgado; Ortega, A Diago; Doert, M; Dominguez1, A; Prester, D Dominis; Dorner, D; Doro, M; Elsaesser, D; Ferenc, D; Fonseca, M V; Font, L; Fruck, C; Lopez, R J Garcia; Garczarczyk, M; Garrido, D; Giavitto, G; Godinovic, N; Hadasch, D; Häfner, D; Herrero, A; Hildebrand, D; Höhne-Mönch, D; Hose, J; Hrupec, D; Huber, B; Jogler, T; Kellermann, H; Klepser, S; Krahenbuh, T; Krause, J; La Barbera, A; Lelas, D; Leonardo, E; Lindfors, E; Lombardi, S; Lopez, A; Lopez, M; Lorenz, E; Makariev, M; Maneva, G; Mankuzhiyil, N; Mannheim, K; Maraschi, L; Mariotti, M; Martinez, M; Mazin, D; Meucci, M; Miranda, J M; Mirzoyan, R; Miyamoto, H; Moldon, J; Moralejo, A; Munar-Adrover, P; Nieto, D; Nilsson, K; Orito, R; Oya, I; Paneque, D; Paoletti, R; Pardo, S; Paredes, J M; Partini, S; Pasanen, M; Pauss, F; Perez-Torres, M A; Persic, M; Peruzzo, L; Pilia, M; Pochon, J; Prada, F; Moroni, P G Prada; Prandini, E; Puljak, I; Reichardt, I; Reinthal, R; Rhode, W; Ribo, M; Rico, J; Rügamer, S; Saggion, A; Saito, K; Saito, T Y; Salvati, M; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Shayduk, M; Shore, S N; Sillanpaa, A; Sitarek, J; Sobczynska, D; Spanier, F; Spiro, S; Stamerra, A; Steinke, B; Storz, J; Strah, N; Suric, T; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzic, T; Tescaro, D; Teshima, M; Tibolla, O; Torres, D F; Treves, A; Uellenbeck, M; Vankov, H; Vogler, P; Wagner, R M; Weitzel, Q; Zabalza, V; Zandanel, F; Zanin, R

    2011-01-01

    Context. The HBL-type blazar Markarian 421 is one of the brightest TeV gamma-ray sources of the northern sky. From December 2007 until June 2008 it was intensively observed in the VHE (E > 100 GeV) band by the single dish Major Atmospheric Gamma-ray Imaging Cherenkov telescope (MAGIC-I). Aims. We aimed to sample the evolution of the source emission at VHE and in other bands, and to model the broad band spectral energy distribution (SED) of selected states, reconstructed by means of sets of multi-wavelength (MWL) data observed simultaneously. Methods. We performed a dense monitoring of the source in VHE with MAGIC-I, collecting also complementary data in soft X-rays and optical-UV bands; then, we modeled the SEDs derived from simultaneous MWL data within the Synchrotron Self-Compton (SSC) framework. Results. The source showed intense and prolonged gamma-ray activity during the whole period, with integral fluxes (E > 200 GeV) sel- dom below the level of Crab Nebula, and up to 3.6 times this value. Eight dataset...

  2. The SSC cycle: a PDCA approach to address site-specific characteristics in a continuous shallow water quality monitoring project.

    Science.gov (United States)

    Miles, Eduardo J

    2008-05-01

    In any water quality-monitoring project there are several critical success factors that must be adequately addressed in order to ensure the implementation and realization of the monitoring objectives. Site selection is one of these critical success factors. The monitoring sites must be selected to comply with the monitoring and data quality objectives. In the real world, ideal monitoring setting conditions are difficult to achieve, and compromises must be made in order to locate the monitoring stations that best represent the environment to be monitored. Site-specific characteristics are all the environmental, logistical and management factors particular to the monitoring site, that could influence the fulfilment of the monitoring and data quality objectives. Therefore, during the site selection process, it is essential to properly consider and evaluate these site-specific characteristics. The SSC cycle was developed with this goal in mind, to assist the monitoring team to systematically address site-specific characteristics. The cycle is a methodology to organize the site-specific characteristics in different categories, and to ensure a comprehensive overview of these characteristics throughout the project life cycle.

  3. Comparison of SSC and epidemiological approaches to evaluating links between heat stress and mortality in Prague, Czech Republic

    Science.gov (United States)

    Urban, Aleš; Kyselý, Jan

    2016-04-01

    Reduced numbers of deaths during heat waves related to introduction of heat early warning systems has been demonstrated in many areas of the world. These systems are most often based on synoptic or epidemiological approaches to assessing the impact of heat on mortality. While the synoptic approach is based on the classification of air masses and the subsequent identification of oppressive air masses (OAMs), the epidemiological approach identifies direct relationship between time series of mortality and meteorological data (mostly air temperature). In this study, OAMs and oppressive days (ODs) will be identified in the period May-September 1994-2013 using selected methods of the synoptic (SSC) and epidemiological approach (GAM, piecewise regression), respectively. Relations between mortality daily data (adjusted for long-term and seasonal changes) and both meteorological and non-meteorological factors (pollution, day of the season, the length of heat waves, year) within OAMs and ODs, will be identified in the "training" years. The resulting regression relationships will be tested on independent "testing" years to evaluate the ability of different approaches to predict days with increased mortality. The results of the project may help to refine the criteria for issuing biometeorological forecasts and warnings of possible adverse heat effects.

  4. Time-dependent simulations of emission from FSRQ PKS1510-089: multiwavelength variability of external Compton and SSC models

    CERN Document Server

    Chen, Xuhui; Liang, Edison; Boettcher, Markus

    2012-01-01

    [abridged] We present results of modeling the SED and multiwavelength variability of the bright FSRQ PKS1510-089 with our time-dependent multizone Monte Carlo/Fokker-Planck code (Chen et al. 2001). As primary source of seed photons for inverse Compton scattering, we consider radiation from the broad line region (BLR), from the molecular torus, and the local synchrotron radiation (SSC). Different scenarios are assessed by comparing simulated light curves and SEDs with one of the best flares by PKS1510-089, in March 2009. The time-dependence of our code and its correct handling of light travel time effects allow us to fully take into account the effect of the finite size of the active region, and in turn to fully exploit the information carried by time resolved observed SEDs, increasingly available since the launch of Fermi. We confirm that the spectrum adopted for the external radiation has an important impact on the modeling of the SED, in particular for the lower energy end of the Compton component, observed...

  5. Hadron supercolliders: The 1-TeV scale and beyond

    Energy Technology Data Exchange (ETDEWEB)

    Quigg, C.

    1990-08-10

    Greater understanding of the connection between the weak and electromagnetic interactions is central to progress in elementary-particle physics. A definitive exploration of the mechanism for electroweak symmetry breaking will require collisions between fundamental constituents at energies on the order of 1 TeV. This goal drives the design of high-energy, high-luminosity hadron colliders that will be commissioned during the next decade, but by no means completely defines their scientific potential. These three lectures are devoted to a review of the standard-model issues that motivated an experimental assault on the 1-TeV scale, an introduction to the machines and the experimental environment they will present, and a survey of possibilities for measurement and discovery with a multi-TeV hadron collider. 72 refs., 29 figs.

  6. Hadron supercolliders: The 1-TeV scale and beyond

    Energy Technology Data Exchange (ETDEWEB)

    Quigg, C.

    1990-08-10

    Greater understanding of the connection between the weak and electromagnetic interactions is central to progress in elementary-particle physics. A definitive exploration of the mechanism for electroweak symmetry breaking will require collisions between fundamental constituents at energies on the order of 1 TeV. This goal drives the design of high-energy, high-luminosity hadron colliders that will be commissioned during the next decade, but by no means completely defines their scientific potential. These three lectures are devoted to a review of the standard-model issues that motivated an experimental assault on the 1-TeV scale, an introduction to the machines and the experimental environment they will present, and a survey of possibilities for measurement and discovery with a multi-TeV hadron collider. 72 refs., 29 figs.

  7. The cold wars a history of superconductivity

    CERN Document Server

    Matricon, Jean

    1994-01-01

    Among the most peculiar of matter¡¦s behaviors is superconductivity„oelectric current without resistance. Since the 1986 discovery that superconductivity is possible at temperatures well above absolute zero, research into practical applications has flourished. The Cold Wars tells the history of superconductivity, providing perspective on the development of the field and its relationship with the rest of physics. Superconductivity offers an excellent example of the evolution of physics in the twentieth century: the science itself, its foundations, and its social context. The authors also introduce the reader to the fascinating scientific personalities, including 2003 Nobel Prize winners Alexei Alexeievich Abrikosov and Vitali Ginzburg, and political struggles behind this research.

  8. Dimensionality of high temperature superconductivity in oxides

    Science.gov (United States)

    Chu, C. W.

    1989-01-01

    Many models have been proposed to account for the high temperature superconductivity observed in oxide systems. Almost all of these models proposed are based on the uncoupled low dimensional carrier Cu-O layers of the oxides. Results of several experiments are presented and discussed. They suggest that the high temperature superconductivity observed cannot be strictly two- or one-dimensional, and that the environment between the Cu-O layers and the interlayer coupling play an important role in the occurrence of such high temperature superconductivity. A comment on the very short coherence length reported is also made.

  9. Downsized superconducting magnetic energy storage systems

    Science.gov (United States)

    Palmer, David N.

    Scaled-down superconductive magnetic energy storage systems (DSMES) and superconductive magnetic energy power sources (SMEPS) are proposed for residential, commercial/retail, industrial off-peak and critical services, telephone and other communication systems, computer operations, power back-up/energy storages, power sources for space stations, and in-field military logistics/communication systems. Recent advances in high-Tc superconducting materials technology are analyzed. DSMES/SMEPS concepts are presented, and design, materials, and systems requirements are discussed. Problems ar identified, and possible solutions are offered. Comparisons are made with mechanical and primary and secondary energy storage and conversion systems.

  10. Proximity Action theory of superconductive nanostructures

    Energy Technology Data Exchange (ETDEWEB)

    Skvortsov, M A; Larkin, A I; Feigel' man, M V [L D Landau Institute for Theoretical Physics, Russian Academy of Sciences, ul. Kosygina 2, 117940 Moscow (Russian Federation)

    2001-10-01

    We review a novel approach to the superconductive proximity effect in disordered normal-superconducting (N-S) structures. The method is based on the multicharge Keldysh action and is suitable for the treatment of interaction and fluctuation effects. As an application of the formalism, we study the subgap conductance and noise in two-dimensional N-S systems in the presence of the electron-electron interaction in the Cooper channel. It is shown that singular nature of the interaction correction at large scales leads to a nonmonotonuos temperature, voltage and magnetic field dependence of the Andreev conductance. (4. mesoscopic superconductivity)

  11. Energizer keep going: 100 years of superconductivity

    Institute of Scientific and Technical Information of China (English)

    Pengcheng Dai; Xing-jiang Zhou; Dao-xin Yao

    2011-01-01

    It has been 100 years since Heike Kamerlingh Onnes discovered superconductivity on April 8,1911.Amazingly,this field is still very active and keeps booming,like a magic.A lot of new phenomena and materials have been found,and superconductors have been used in many different fields to improve our lives.Onnes won the Nobel Prize for this incredible discovery in 1913 and used the word superconductivity for the first time.Onnes believed that quantum mechanics would explain the effect,but he could not produce a theory at that time.Now we know superconductivity is a macroscopic quantum phenomenon.

  12. Magnetism and superconductivity in heavy fermion systems

    Energy Technology Data Exchange (ETDEWEB)

    Flouquet, J. (DRFMC, C.E.N.G., 38 - Grenoble (France)); Brison, J.P.; Hasselbach, K.; Taillefer, L. (C.N.R.S., 38 - Grenoble (France)); Behnia, K.; Jaccard, D. (DPMC, Geneva Univ. (Switzerland)); Visser, A. de (Natuurkundig Lab., Univ. van Amsterdam (Netherlands))

    1991-12-01

    The normal and superconducting properties of heavy fermion compounds are reviewed. The discussion is focus on the three uranium compounds: UBe{sub 13}, UPt{sub 3} and URu{sub 2}Si{sub 2}. Special attention is given: 1) to unusual (H.T) superconducting phase diagram as discovered in UPt{sub 3} where two successive superconducting phases seem to occur in zero magnetic field; 2) to the role of long range ordering as found in URu{sub 2}Si{sub 2} and UPt{sub 3}. (orig.).

  13. DC Characterization of the Coaxial Superconducting Cable

    Science.gov (United States)

    Šouc, J.; Gömöry, F.; Vojenčiak, M.; Frolek, L.; Isfort, D.; Ehrenberg, J.; Bock, J.

    2008-01-01

    Coaxial cable model with superconducting core and superconducting shield conductor was constructed and tested in DC regime. While the core was already examined in our previous works, in this contribution the detailed study of the superconducting shield conductor in DC conditions is presented. It consists of 16 ReBCO coated tapes with critical current 35 A each connected in parallel. Using shunts with known values placed in series the currents in individual tapes were possible to measure. Distribution of the total cable current into the individual tapes was monitored and its influence on critical current of the cable is discussed.

  14. Thermodynamic Green functions in theory of superconductivity

    Directory of Open Access Journals (Sweden)

    N.M.Plakida

    2006-01-01

    Full Text Available A general theory of superconductivity is formulated within the thermodynamic Green function method for various types of pairing mediated by phonons, spin fluctuations, and strong Coulomb correlations in the Hubbard and t-J models. A rigorous Dyson equation for matrix Green functions is derived in terms of a self-energy as a many-particle Green function. By applying the noncrossing approximation for the self-energy, a closed self-consistent system of equations is obtained, similar to the conventional Eliashberg equations. A brief discussion of superconductivity mediated by kinematic interaction with an estimation of a superconducting transition temperature in the Hubbard model is given.

  15. SSC Resistance of Super 13Cr Martensitic Stainless Steel%超级13Cr马氏体不锈钢抗SSC性能研究

    Institute of Scientific and Technical Information of China (English)

    吕祥鸿; 赵国仙; 王宇; 张建兵; 谢凯意

    2011-01-01

    H2S stress corrosion cracking (SSC) behavior of super 13Cr martensitic stainless steel at the simulated and standard environments has been studied with four-point bent test, electrochemical measurement as well as Scanning Electron Microscopy (SEM) analysis methods. The results show that the super 13Cr martensitic stainless steel behaves a high SSC susceptibility at the standard environments, and the cracks stem from surface corrosion pits because of the occurrence of H2S and Clmaking the pitting potential of super 13Cr martensitic stainless steel decreased significantly. While at the simulated environments, the SSC susceptibility of super 13Cr martensitic stainless steel decreased, and no cracks are found on the surface of the test specimen.%采用四点弯曲实验方法、电化学测试技术及扫描电子显微镜(SEM)等分析手段研究了超级13Cr马氏体不锈钢在模拟工况和标准工况中的H2S应力腐蚀开裂(SSC)行为.结果表明:超级13Cr 马氏体不锈钢在标准工况条件下具有很高的SSC敏感性,裂纹起源于表面点蚀坑处,H2S腐蚀性气体的存在及Cl-浓度的增加显著降低超级13Cr马氏体不锈钢的点蚀电位,明显增加超级13Cr马氏体不锈钢的SSC敏感性;在模拟工况条件下,超级13Cr发生SSC的敏感性降低,没有发生开裂现象.

  16. Wide Area Recovery & Resiliency Program (WARRP) Transition Manager Series, Coalition Warrior Interoperability Demonstration (CWID) 2011: SSC Pacific Civilian Message Systems in Trial 2.32

    Science.gov (United States)

    2011-07-01

    They acquired materials and equipment on short notice, and shipped and tracked equipment to the various locations for testing and operations. SSC...displayed sensor readings and maps: an Apple iPad and a Samsung Galaxy Tab. • Mobile Wi-Fi Hotspot: A 3G AT&T MiFi integrated the sensors, laptops and...Sullivan (1) 85300 Archive Stock (1) 53627 Francis Cortez (1) Defense Technical Information Center Fort Belvoir, VA 22060

  17. Coherent controlization using superconducting qubits.

    Science.gov (United States)

    Friis, Nicolai; Melnikov, Alexey A; Kirchmair, Gerhard; Briegel, Hans J

    2015-01-01

    Coherent controlization, i.e., coherent conditioning of arbitrary single- or multi-qubit operations on the state of one or more control qubits, is an important ingredient for the flexible implementation of many algorithms in quantum computation. This is of particular significance when certain subroutines are changing over time or when they are frequently modified, such as in decision-making algorithms for learning agents. We propose a scheme to realize coherent controlization for any number of superconducting qubits coupled to a microwave resonator. For two and three qubits, we present an explicit construction that is of high relevance for quantum learning agents. We demonstrate the feasibility of our proposal, taking into account loss, dephasing, and the cavity self-Kerr effect.

  18. Pairing theory of striped superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Loder, Florian; Kampf, Arno P.; Kopp, Thilo; Graser, Siegfried [Center for Electronic Correlations and Magnetism, Institute of Physics, Augsburg (Germany)

    2011-07-01

    Striped high-T{sub c} superconductors such as La{sub 7/8}Ba{sub 1/8}CuO{sub 4} show a fascinating competition between spin and charge order on the one hand and superconductivity on the other. A theory for these systems therefore has to capture both the spin correlations in an antiferromagnet and the pair-correlation of a superconductor. For this purpose we have developed an effective Hartree-Fock theory by merging electron pairing with finite center-of-mass momentum and antiferromagnetism. We show that this theory reproduces the key experimental features such as the formation of the antiferromagnetic stripe patterns at 7/8 band filling or the quasi one-dimensional electronic structure observed by photoemission spectroscopy.

  19. Advanced Manufacturing of Superconducting Magnets

    Science.gov (United States)

    Senti, Mark W.

    1996-01-01

    The development of specialized materials, processes, and robotics technology allows for the rapid prototype and manufacture of superconducting and normal magnets which can be used for magnetic suspension applications. Presented are highlights of the Direct Conductor Placement System (DCPS) which enables automatic design and assembly of 3-dimensional coils and conductor patterns using LTS and HTS conductors. The system enables engineers to place conductors in complex patterns with greater efficiency and accuracy, and without the need for hard tooling. It may also allow researchers to create new types of coils and patterns which were never practical before the development of DCPS. The DCPS includes a custom designed eight-axis robot, patented end effector, CoilCAD(trademark) design software, RoboWire(trademark) control software, and automatic inspection.

  20. Feeding helium to superconducting magnets

    CERN Multimedia

    1979-01-01

    The photo shows two of the 3 superconducting magnets (two MBS dipoles (CESAR) of 150 mm bore and 4.5 T, and one quadrupole (CASTOR) of 90 mm bore and 54 T/m) which were installed in the hall EHN1 (Annual Report 1978 p. 134) and ran until 1985. They formed a section of the beam H6 travelling from target T4 (down the bottom of the photo) towards the NA30 setup followed by the NA11 setup. The two big transversal pipelines are the quench lines of the two magnets (on the right, one quadrupole and one dipole, the other dipole lays down the photo and is not visible). The Jura side of the hall is on the right.

  1. Towards inducing superconductivity into graphene

    Science.gov (United States)

    Efetov, Dmitri K.

    Graphenes transport properties have been extensively studied in the 10 years since its discovery in 2004, with ground-breaking experimental observations such as Klein tunneling, fractional quantum Hall effect and Hofstadters butterfly. Though, so far, it turned out to be rather poor on complex correlated electronic ground states and phase transitions, despite various theoretical predictions. The purpose of this thesis is to help understanding the underlying theoretical and experimental reasons for the lack of strong electronic interactions in graphene, and, employing graphenes high tunability and versatility, to identify and alter experimental parameters that could help to induce stronger correlations. In particular graphene holds one last, not yet experimentally discovered prediction, namely exhibiting intrinsic superconductivity. With its vanishingly small Fermi surface at the Dirac point, graphene is a semi-metal with very weak electronic interactions. Though, if it is doped into the metallic regime, where the size of the Fermi surface becomes comparable to the size of the Brillouin zone, the density of states becomes sizeable and electronic interactions are predicted to be dramatically enhanced, resulting in competing correlated ground states such as superconductivity, magnetism and charge density wave formation. Following these predictions, this thesis first describes the creation of metallic graphene at high carrier doping via electrostatic doping techniques based on electrolytic gates. Due to graphenes surface only properties, we are able to induce carrier densities above n>1014 cm-2 (epsilonF>1eV) into the chemically inert graphene. While at these record high carrier densities we yet do not observe superconductivity, we do observe fundamentally altered transport properties as compared to semi-metallic graphene. Here, detailed measurements of the low temperature resistivity reveal that the electron-phonon interactions are governed by a reduced, density

  2. Durability Evaluation of Superconducting Magnets

    Science.gov (United States)

    Inoue, Akihiko; Ogata, Masafumi; Nakauchi, Masahiko; Asahara, Tetsuo; Herai, Toshiki; Nishikawa, Yoichi

    2006-06-01

    It is one of the most essential things to verify the durability of devices and components of JR-Maglev system to realize the system into the future inauguration. Since the load requirements were insufficient in terms of the durability under vibrations under mere running tests carried out on Yamanashi Maglev Test Line hereinafter referred to YMTL, we have developed supplemental method with bench tests. Superconducting magnets hereinafter referred to SCM as used in the experimental running for the last seven years on the YMTL were brought to Kunitachi Technical Research Institute; we conducted tests to evaluate the durability of SCM up to a period of the service life in commercial use. The test results have indicated that no irregularity in each part of SCM proving that SCM are sufficiently durable for the practical application.

  3. Nonclassical correlations in superconducting circuits

    Energy Technology Data Exchange (ETDEWEB)

    Migliore, Rosanna [Dipartimento di Scienze Fisiche ed Astronomiche, Universita di Palermo (Italy); CNR-INFM, UdR CNISM di Palermo, Palermo (Italy); Scala, Matteo [Dipartimento di Scienze Fisiche ed Astronomiche, Universita di Palermo (Italy); Departamento de Optica, Facultad de Fisica, Universidad Complutense, Madrid (Spain); Guccione, Marina; Sanchez-Soto, Luis L. [Dipartimento di Scienze Fisiche ed Astronomiche, Universita di Palermo (Italy); Messina, Antonino [Departamento de Optica, Facultad de Fisica, Universidad Complutense, Madrid (Spain)

    2009-05-15

    A key step on the road map to solid-state quantum information processing (and to a deeper understanding of many counterintuitive aspects of quantum mechanics) is the generation and manipulation of nonclassical correlations between different quantum systems. Within this framework, we analyze the possibility of generating maximally entangled states in a system of two superconducting flux qubits, as well as the effectof their own environments on the entanglement dynamics. The analysis reported here confirms that the phenomena of sudden birth and sudden death of the entanglement do not depend on the particular measure of the entanglement adopted (copyright 2009 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  4. Gapless superconductivity and string theory

    CERN Document Server

    Khlebnikov, S

    2014-01-01

    Coexistence of superconducting and normal components in nanowires at currents below the critical (a "mixed" state) would have important consequences for the nature and range of potential applications of these systems. From the theoretical perspective, it represents a genuine interaction effect, not seen in the mean-field theory. Here we consider properties of such a state in the gravity dual of a strongly coupled superconductor constructed from D3 and D5 branes. We find numerically uniform gapless solutions containing both components but argue that they are unstable against phase separation, as their free energies are not convex. We speculate on the possible nature of the resulting non-uniform sate ("emulsion") and draw analogies between that state and the familiar mixed state of a type II superconductor in a magnetic field.

  5. Superconducting magnets and their applications

    Energy Technology Data Exchange (ETDEWEB)

    Williams, J.E.C. (Massachusetts Inst. of Tech., Cambridge, MA (USA). Francis Bitter National Magnet Lab.)

    1989-08-01

    Superconducting magnets are now being used in applications as diverse as medical imaging, fusion research, and power conditioning. The steady improvement in the understanding of instability and quenching has allowed increases in current density and compactness of winding. The reduction in winding size that has thus followed has allowed the construction of economic magnets for imaging, for acceleration, and for high-resolution spectrometers. Large magnets for fusion and energy applications have been made possible by composite conductors containing large fractions of copper or aluminum. The advent of high-temperature superconductors may hold the promise, eventually, of very-high-field magnets. Meanwhile low-temperature superconductors capable of generating fields up to 30 T have been developed.

  6. An experimental superconducting helical undulator

    Energy Technology Data Exchange (ETDEWEB)

    Caspi, S.; Taylor, C. [Lawrence Berkeley Lab., CA (United States)

    1995-12-31

    Improvements in the technology of superconducting magnets for high energy physics and recent advancements in SC materials with the artificial pinning centers (APC){sup 2}, have made a bifilar helical SC device an attractive candidate for a single-pass free electron laser (FEL){sup 3}. Initial studies have suggested that a 6.5 mm inner diameter helical device, with a 27 mm period, can generate a central field of 2-2.5 Tesla. Additional studies have also suggested that with a stored energy of 300 J/m, such a device can be made self-protecting in the event of a quench. However, since the most critical area associated with high current density SC magnets is connected with quenching and training, a short experimental device will have to be built and tested. In this paper we discuss technical issues relevant to the construction of such a device, including a conceptual design, fields, and forces.

  7. More superconductivity questions than answers.

    Science.gov (United States)

    Robinson, A L

    1987-07-17

    Although making liquid nitrogen-temperature superconductors is easy enough that high school science projects already feature them, researchers still have little idea how the new ceramic oxides work and therefore little guidance for improving them. At the International Workshop on Novel Mechanisms of Superconductivity, held from 22 to 26 June in Berkeley, California, theorists reviewed a host of competing explanations of how these materials come by their remarkable properties, but they could not, get far in sifting through the candidates for the best one. One cause of the unsettled situation is that theorists have not yet pushed their models far enough to make many specific predictions about physical properties and therefore to provide a reason to choose one theory over another. But experimental data for comparison with theory are lacking, too. For example, experimentalists are just now succeeding in being able to grow single crystals and thin films of the ceramic oxide superconductors, whose properties were shown at the workshop to be highly anisotropic. Measurements already made on the polycrystalline sintered material available up to now are difficult to interpret and therefore need to be repeated on good-quality crystals and films, where the variation of properties with crystallographic orientation can be mapped out. Given the high level of Japanese activity in the field, it was surprising that no researchers from industrial laboratories in Japan presented their findings at the workshop. In the light of a budding international competition in commercializing superconductors, some American scientists interpreted the absence as an attempt to protect proprietary advances. A more pleasant surprise was the attendance of a delegation of six Soviet scientists, although one of the fathers of superconductivity theory, Vitaly Ginzburg of the P.N.Lebedev Institute of Physics in Moscow, who was expected, did not come.

  8. High Tc superconducting small loop antenna

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Z.; Mehler, M.J.; Maclean, T.S.M.; Lancaster, M.J.; Gough, C.E. (Univ. of Birmingham (UK)); Alford, N. (I.C.I. Advanced Materials Div., Runcorn (UK))

    1989-12-01

    The improvement in the radiation efficiency of an electrically small loop antenna is analysed when it is fabricated from a superconductor, and experimental results for a liquid nitrogen cooled, ceramic superconducting loop at 450MHz are presented. (orig.).

  9. Superconducting inductive displacement detection of a microcantilever

    Energy Technology Data Exchange (ETDEWEB)

    Vinante, A., E-mail: anvinante@fbk.eu [Istituto di Fotonica e Nanotecnologie, CNR - Fondazione Bruno Kessler, I-38123 Povo, Trento (Italy)

    2014-07-21

    We demonstrate a superconducting inductive technique to measure the displacement of a micromechanical resonator. In our scheme, a type I superconducting microsphere is attached to the free end of a microcantilever and approached to the loop of a dc Superconducting Quantum Interference Device (SQUID) microsusceptometer. A local magnetic field as low as 100 μT, generated by a field coil concentric to the SQUID, enables detection of the cantilever thermomechanical noise at 4.2 K. The magnetomechanical coupling and the magnetic spring are in good agreement with image method calculations assuming pure Meissner effect. These measurements are relevant to recent proposals of quantum magnetomechanics experiments based on levitating superconducting microparticles.

  10. Superconducting gap structure of FeSe.

    Science.gov (United States)

    Jiao, Lin; Huang, Chien-Lung; Rößler, Sahana; Koz, Cevriye; Rößler, Ulrich K; Schwarz, Ulrich; Wirth, Steffen

    2017-03-07

    The microscopic mechanism governing the zero-resistance flow of current in some iron-based, high-temperature superconducting materials is not well understood up to now. A central issue concerning the investigation of these materials is their superconducting gap symmetry and structure. Here we present a combined study of low-temperature specific heat and scanning tunnelling microscopy measurements on single crystalline FeSe. The results reveal the existence of at least two superconducting gaps which can be represented by a phenomenological two-band model. The analysis of the specific heat suggests significant anisotropy in the gap magnitude with deep gap minima. The tunneling spectra display an overall "U"-shaped gap close to the Fermi level away as well as on top of twin boundaries. These results are compatible with the anisotropic nodeless models describing superconductivity in FeSe.

  11. Simulation of an HTS Synchronous Superconducting Generator

    DEFF Research Database (Denmark)

    In this work we present a simulation of a synchronous generator with superconducting rotor windings. As many other electrical rotating machines, superconducting generators are exposed to ripple fields that could be produced from a wide variety of sources: short circuit, load change, etc. Unlike...... regular conductors, superconductors, experience high losses when exposed to AC fields. Thus, calculation of such losses is relevant for machine design to avoid quenches and increase performance. Superconducting coated conductors are well known to exhibit nonlinear resistivity, thus making the computation...... of heating losses a cumbersome task. Furthermore, the high aspect ratio of the superconducting materials involved adds a penalty in the time required to perform simulations. The chosen strategy for simulation is as follows: A mechanical torque signal together with an electric load is used to drive the finite...

  12. Simulation of an HTS Synchronous Superconducting Generator

    DEFF Research Database (Denmark)

    Rodriguez Zermeno, Victor Manuel; Abrahamsen, Asger Bech; Mijatovic, Nenad

    2012-01-01

    In this work we present a simulation of a synchronous generator with superconducting rotor windings. As many other,electrical rotating machines, superconducting generators are exposed to ripple fields that could be produced from a wide variety of sources: short circuit, load change, mechanical...... torque fluctuations, etc. Unlike regular conductors, superconductors, experience high losses when exposed to AC fields. Thus, calculation of such losses is relevant for machine design to avoid quenches and increase performance. Superconducting coated conductors are well known to exhibit nonlinear...... resistivity, thus making the computation of heating losses a cumbersome task. Furthermore, the high aspect ratio of the superconducting materials involved adds a penalty in the time required to perform simulations. The chosen strategy for simulation is as follows: A mechanical torque signal together...

  13. The first LHC superconducting magnet is unloaded

    CERN Multimedia

    Maximilien Brice

    2005-01-01

    The first superconducting magnet is moved into position using a transfer table. This must be performed with great precision so that the LHC ring is correctly aligned, allowing the beams to travel along the correct paths.

  14. The Establishment of National TC of Superconduction

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    @@ National standardization technical committee of superconduction was established on Aug 26th, 2003. The committee contains 22 experts, of which the percentage of professors and researchers reaches up to 77.3%.

  15. Superconducting quantum circuits theory and application

    Science.gov (United States)

    Deng, Xiuhao

    Superconducting quantum circuit models are widely used to understand superconducting devices. This thesis consists of four studies wherein the superconducting quantum circuit is used to illustrate challenges related to quantum information encoding and processing, quantum simulation, quantum signal detection and amplification. The existence of scalar Aharanov-Bohm phase has been a controversial topic for decades. Scalar AB phase, defined as time integral of electric potential, gives rises to an extra phase factor in wavefunction. We proposed a superconducting quantum Faraday cage to detect temporal interference effect as a consequence of scalar AB phase. Using the superconducting quantum circuit model, the physical system is solved and resulting AB effect is predicted. Further discussion in this chapter shows that treating the experimental apparatus quantum mechanically, spatial scalar AB effect, proposed by Aharanov-Bohm, can't be observed. Either a decoherent interference apparatus is used to observe spatial scalar AB effect, or a quantum Faraday cage is used to observe temporal scalar AB effect. The second study involves protecting a quantum system from losing coherence, which is crucial to any practical quantum computation scheme. We present a theory to encode any qubit, especially superconducting qubits, into a universal quantum degeneracy point (UQDP) where low frequency noise is suppressed significantly. Numerical simulations for superconducting charge qubit using experimental parameters show that its coherence time is prolong by two orders of magnitude using our universal degeneracy point approach. With this improvement, a set of universal quantum gates can be performed at high fidelity without losing too much quantum coherence. Starting in 2004, the use of circuit QED has enabled the manipulation of superconducting qubits with photons. We applied quantum optical approach to model coupled resonators and obtained a four-wave mixing toolbox to operate photons

  16. ISR Superconducting Quadrupole in its cryostat

    CERN Multimedia

    1978-01-01

    The picture shows a superconducting quadrupole for the ISR high luminosity (low beta) insertion in its cryostat during final tests before installation in the ISR.The person is W.Burgess. See also photo 7702690X.

  17. Superfluidity and Superconductivity in Neutron Stars

    Indian Academy of Sciences (India)

    N. Chamel

    2017-09-01

    Neutron stars, the compact stellar remnants of core-collapse supernova explosions, are unique cosmic laboratories for exploring novel phases of matter under extreme conditions. In particular, the occurrence of superfluidity and superconductivity in neutron stars will be briefly reviewed.

  18. Superconducting magnets in physics: problems and prospects

    Energy Technology Data Exchange (ETDEWEB)

    Bronca, G.; Parain, J.

    1974-10-01

    The present status of solutions for the construction of magnets using superconducting windings is given. A review is given of achievements and projects using superconductors for the production of magnetic fields.

  19. Superconducting linear accelerator system for NSC

    Indian Academy of Sciences (India)

    P N Prakash; T S Datta; B P Ajith Kumar; J Antony; P Barua; J Chacko; A Choudhury; G K Chadhari; S Ghosh; S Kar; S A Krishnan; Manoj Kumar; Rajesh Kumar; A Mandal; D S Mathuria; R S Meena; R Mehta; K K Mistri; A Pandey; M V Suresh Babu; B K Sahu; A Sarkar; S S K Sonti; A Rai; S Venkatramanan; J Zacharias; R K Bhowmik; A Roy

    2002-11-01

    This paper reports the construction of a superconducting linear accelerator as a booster to the 15 UD Pelletron accelerator at Nuclear Science Centre, New Delhi. The LINAC will use superconducting niobium quarter wave resonators as the accelerating element. Construction of the linear accelerator has progressed sufficiently. Details of the entire accelerator system including the cryogenics facility, RF electronics development, facilities for fabricating niobium resonators indigenously, and present status of the project are presented.

  20. Electrothermal simulation of superconducting nanowire avalanche photodetectors

    Science.gov (United States)

    Marsili, Francesco; Najafi, Faraz; Herder, Charles; Berggren, Karl K.

    2011-02-01

    We developed an electrothermal model of NbN superconducting nanowire avalanche photodetectors (SNAPs) on sapphire substrates. SNAPs are single-photon detectors consisting of the parallel connection of N superconducting nanowires. We extrapolated the physical constants of the model from experimental data and we simulated the time evolution of the device resistance, temperature and current by solving two coupled electrical and thermal differential equations describing the nanowires. The predictions of the model were in good quantitative agreement with the experimental results.

  1. ZGS roots of superconductivity: People and devices

    Energy Technology Data Exchange (ETDEWEB)

    Pewitt, E.G.

    1994-12-31

    The ZGS community made basic contributions to the applications of superconducting magnets to high energy physics as well as to other technological areas. ZGS personnel pioneered many significant applications until the time the ZGS was shutdown in 1979. After the shutdown, former ZGS personnel developed magnets for new applications in high energy physics, fusion, and industrial uses. The list of superconducting magnet accomplishments of ZGS personnel is impressive.

  2. Stripes and superconductivity in cuprate superconductors

    OpenAIRE

    Tranquada, J. M.

    2005-01-01

    One type of order that has been observed to compete with superconductivity in cuprates involves alternating charge and antiferromagnetic stripes. Recent neutron scattering studies indicate that the magnetic excitation spectrum of a stripe-ordered sample is very similar to that observed in superconducting samples. In fact, it now appears that there may be a universal magnetic spectrum for the cuprates. One likely implication of this universal spectrum is that stripes of a dynamic form are pres...

  3. 13th European Conference on Applied Superconductivity

    CERN Document Server

    2017-01-01

    EUCAS is a worldwide forum for scientists and engineers, and provides an ideal platform to share knowledge and the most recent advances in all areas of applied superconductivity: from large-scale applications to miniature electronics devices, with a traditional focus on advanced materials and conductors. The broad scope is at the same time a challenge and an opportunity to foster novel, inter-disciplinary approaches and promote cross-fertilization among the various fields of applied superconductivity.

  4. Statistic Ensemble Theory of Small Superconducting Grains

    Institute of Scientific and Technical Information of China (English)

    CHEN Zhi-Qian; ZHENG Ren-Rong

    2001-01-01

    We apply the random matrix theory to small metallic grains in different spin states of S = 0, 1/2, 1, 3/2, 2, 5/2, .., and find that there exist theoretical critical level spacings de at which the superconductivity would breakdown. We also find that the higher the spin state, the smaller the critical level spacing, and for the state of S = 0superconducting enhancement actually exists.

  5. High Temperature Superconducting Maglev Measurement System

    OpenAIRE

    Wang, Jia-Su; Wang, Su-Yu

    2010-01-01

    Three high temperature superconducting (HTS) Maglev measurement systems were successfully developed in the Applied Superconductivity Laboratory (ASCLab) of Southwest Jiaotong University, P. R. China. These systems include liquid nitrogen vessel, Permanent Magnet Guideway (PMG), data collection and processing, mechanical drive and Autocontrol features. This chapter described the three different measuring systems along with their theory of operations and workflow. The SCML-01 HTS Maglev measure...

  6. Superconducting Electric Machines for Ship Propulsion.

    Science.gov (United States)

    1977-02-14

    ship propulsion applications. These concepts evolved from previous work at MIT on superconducting AC machines. The superconducting machines considered were: (1) multipole, low-speed motors, (2) torque compensated motors, (3) high-speed generator, (4) rotating air-gap armature induction motor, (5) thyristor switched AC motors. The first four machine types were studied theoretically while experimental models were constructed of the last two. Preliminary designs were completed...of the five mahcines for an appropriate ship ... propulsion application. In

  7. Experimenting with a Superconducting Levitation Train

    Science.gov (United States)

    Miryala, Santosh; Koblischka, M. R.

    2014-01-01

    The construction and operation of a prototype high-"Tc" superconducting train model is presented. The train is levitated by a melt-processed GdBa[subscript 2]Cu[subscript 3]O[subscript x] (Gd-123) superconducting material over a magnetic rail (track). The oval shaped track is constructed in S-N-S or PM3N configuration arranged on an iron…

  8. A current limiter with superconducting coil for magnetic field shielding

    Science.gov (United States)

    Kaiho, K.; Yamaguchi, H.; Arai, K.; Umeda, M.; Yamaguchi, M.; Kataoka, T.

    2001-05-01

    The magnetic shield type superconducting fault current limiter have been built and successfully tested in ABB corporate research and so on. The device is essentially a transformer in which the secondary winding is the superconducting tube. However, due to the large AC losses and brittleness of the superconducting bulk tube, they have not yet entered market. A current limiter with superconducting coil for the magnetic field shielding is considered. By using the superconducting coil made by the multi-filamentary high Tc superconductor instead of the superconducting bulk tube, the AC losses can be reduced due to the reduced superconductor thickness and the brittleness of the bulk tube can be avoidable. This paper presents a preliminary consideration of the magnetic shield type superconducting fault current limiter with superconducting coil as secondary winding and their AC losses in comparison to that of superconducting bulk in 50 Hz operation.

  9. Accelerator Technology: Magnets, Normal and Superconducting

    CERN Document Server

    Bottura, L

    2013-01-01

    This document is part of Subvolume C 'Accelerators and Colliders' of Volume 21 'Elementary Particles' of Landolt-Börnstein - Group I 'Elementary Particles, Nuclei and Atoms'. It contains the the Section '8.1 Magnets, Normal and Superconducting' of the Chapter '8 Accelerator Technology' with the content: 8.1 Magnets, Normal and Superconducting 8.1.1 Introduction 8.1.2 Normal Conducting Magnets 8.1.2.1 Magnetic Design 8.1.2.2 Coils 8.1.2.3 Yoke 8.1.2.4 Costs 8.1.2.5 Undulators, Wigglers, Permanent Magnets 8.1.2.6 Solenoids 8.1.3 Superconducting Magnets 8.1.3.1 Superconducting Materials 8.1.3.2 Superconducting Cables 8.1.3.3 Stability and Margins, Quench and Protection 8.1.3.4 Magnetization, Coupling and AC Loss 8.1.3.5 Magnetic Design of Superconducting Accelerator Magnets 8.1.3.6 Current Leads 8.1.3.7 Mechanics, Insulation, Cooling and Manufacturing Aspects

  10. Controlling superconductivity by tunable quantum critical points.

    Science.gov (United States)

    Seo, S; Park, E; Bauer, E D; Ronning, F; Kim, J N; Shim, J-H; Thompson, J D; Park, Tuson

    2015-03-04

    The heavy fermion compound CeRhIn5 is a rare example where a quantum critical point, hidden by a dome of superconductivity, has been explicitly revealed and found to have a local nature. The lack of additional examples of local types of quantum critical points associated with superconductivity, however, has made it difficult to unravel the role of quantum fluctuations in forming Cooper pairs. Here, we show the precise control of superconductivity by tunable quantum critical points in CeRhIn5. Slight tin-substitution for indium in CeRhIn5 shifts its antiferromagnetic quantum critical point from 2.3 GPa to 1.3 GPa and induces a residual impurity scattering 300 times larger than that of pure CeRhIn5, which should be sufficient to preclude superconductivity. Nevertheless, superconductivity occurs at the quantum critical point of the tin-doped metal. These results underline that fluctuations from the antiferromagnetic quantum criticality promote unconventional superconductivity in CeRhIn5.

  11. ASC 84: applied superconductivity conference. Final program and abstracts

    Energy Technology Data Exchange (ETDEWEB)

    1984-01-01

    Abstracts are given of presentations covering: superconducting device fabrication; applications of rf superconductivity; conductor stability and losses; detectors and signal processing; fusion magnets; A15 and Nb-Ti conductors; stability, losses, and various conductors; SQUID applications; new applications of superconductivity; advanced conductor materials; high energy physics applications of superconductivity; electronic materials and characterization; general superconducting electronics; ac machinery and new applications; digital devices; fusion and other large scale applications; in-situ and powder process conductors; ac applications; synthesis, properties, and characterization of conductors; superconducting microelectronics. (LEW)

  12. Ac loss measurements on a superconducting transformer for a 25 kA superconducting rectifier

    NARCIS (Netherlands)

    ten Kate, Herman H.J.; Mulders, J.M.; de Reuver, J.L.; van de Klundert, L.J.M.

    1984-01-01

    Ac loss measurements have been performed on a superconducting transformer. The transformer is a part of a 25 kA thermally switched superconducting rectifier operating at a frequency of 0.1 Hz. The loss measurements have been automatized by means of a microcomputer sampling four relevant signals and

  13. Design Study of Superconducting Coil of 230 MeV Superconducting Cyclotron

    Institute of Scientific and Technical Information of China (English)

    WANG; Chuan; YIN; Meng; ZHANG; Su-ping; LI; Ming; CUI; Tao; LIN; Jun; LV; Yin-long; GE; Tao; YIN; Zhi-guo; ZHANG; Tian-jue

    2015-01-01

    The superconducting coil system of CYCIAE-230superconducting proton cyclotron consists of two coil windings,cryostat,GM coolers,and the liquid helium condenser(Fig.1),along with multiple thermometers,pressure gauges,liquid level gauges,load cells,a vacuum pump,a

  14. Superconducting materials suitable for magnets

    CERN Document Server

    CERN. Geneva. Audiovisual Unit

    2002-01-01

    The range of materials available for superconducting magnets is steadily expanding, even as the choice of material becomes potentially more complex. When virtually all magnets were cooled by helium at ~2-5 K it was easy to separate the domain of Nb-Ti from those of Nb3Sn applications and very little surprise that more than 90% of all magnets are still made from Nb-Ti. But the development of useful conductors of the Bi-Sr-Ca-Cu-O and YBa2Cu3Ox high temperature superconductors, coupled to the recent discovery of the 39 K superconductor MgB2 and the developing availability of cryocoolers suggests that new classes of higher temperature, medium field magnets based on other than Nb-based conductors could become available in the next 5-10 years. My talks will discuss the essential physics and materials science of these 5 classes of material - Nb-Ti, Nb3Sn, MgB2, Bi-Sr-Ca-Cu-O and YBa2Cu3Ox - in the context of those aspects of their science, properties and fabrication properties, which circumscribe their applications...

  15. Superconducting Coil of Po Dipole

    CERN Multimedia

    1983-01-01

    The Po superconducting dipole was built as a prototype beam transport magnet for the SPS extracted proton beam P0. Its main features were: coil aperture 72 mm, length 5 m, room-temperature yoke, NbTi cable conductor impregnated with solder, nominal field 4.2 T at 4.7 K (87% of critical field). It reached its nominal field without any quench.After this successful test up to its nominal field of 4.2 T, the power was not raised to reach a quench. The magnet was not installed in a beam and had no other further use. Nevertheless its construction provided knowledges and experience which became useful in the design and construction of the LHC magnets. The photo shows a detail of the inner layer winding before superposing the outer layer to form the complete coil of a pole. Worth noticing is the interleaved glass-epoxy sheet (white) with grooved channels for the flow of cooling helium. See also 8211532X.

  16. Free electron laser and superconductivity

    CERN Document Server

    Iwata, A

    2003-01-01

    The lasing of the first free-electron laser (FEL) in the world was successfully carried out in 1977, so the history of FELs as a light source is not so long. But FELs are now utilized for research in many scientific and engineering fields owing to such characteristics as tunability of the wavelength, and short pulse and high peak power, which is difficult utilizing a common light source. Research for industrial applications has also been carried out in some fields, such as life sciences, semiconductors, nano-scale measurement, and others. The task for the industrial use of FEL is the realization of high energy efficiency and high optical power. As a means of promoting realization, the combining of an FEL and superconducting linac is now under development in order to overcome the thermal limitations of normal-conducting linacs. Further, since tuning the wavelength is carried out by changing the magnetic density of the undulator, which is now induced by moving part of the stack of permanent magnets, there is un...

  17. Superconducting magnet system for PERC

    Energy Technology Data Exchange (ETDEWEB)

    Drescher, Carmen [Physikalisches Institut, Universitaet Heidelberg (Germany); Collaboration: PERC-Collaboration

    2012-07-01

    The new PERC (Proton Electron Radiation Channel) instrument will be an extremely bright and versatile source of neutron decay products. It will feed several novel precision experiments of spectra and correlation measurements in neutron decay. Its main component is a more than 11 m long superconducting magnet system. The neutron decay volume is located inside an 8 m long neutron guide in a strong longitudinal magnetic field of 1.5 T. A variable magnetic barrier of 3 T to 6 T serves to precisely limit the phase space of the emerging electrons and protons to control systematic errors on the 10{sup -4}level. The instrument is currently under development and will be installed at the neutron-beamline Mephisto at the FRM II, Garching. In this talk we give an overview on the special characteristics and advantages of PERC's field design. We show that with our design we can prevent magnetic traps in magnetic field and achieve a clean separation of neutrons and decay-products.

  18. Design of Tunable Superconducting Metamaterials

    Science.gov (United States)

    Trepanier, Melissa; Zhang, Daimeng; Anlage, Steven

    2013-03-01

    Our goal is to create a superconducting metamaterial utilizing deep sub-wavelength meta-atoms with a quickly-tunable index of refraction. To accomplish this we will combine two different materials: an array of rf SQUIDs (with tunable effective permeability) and an array of thin wires interrupted by Josephson junctions (with tunable effective permittivity). These materials have been designed to maximize tunablility in the range easily measured via X-band, Ku-band, and K-band waveguides. Various sizes of rf SQUIDs were designed to be non-hysteretic, be sufficiently insensitive to noise, and to have resonant frequencies ranging from 6.5 - 22 GHz. The wire array was designed so that the inductance of the Josephson junctions can completely cancel the geometric and kinetic inductance of the wires, giving rise to strong tunability. We will present the design considerations and simulation results for this new class of metamaterials. This work is supported by the NSF-GOALI program through grant # ECCS-1158644, and CNAM.

  19. TESLA superconducting RF cavity development

    Energy Technology Data Exchange (ETDEWEB)

    Koepke, K. [Fermi National Accelerator Lab., Batavia, IL (United States); TESLA Collaboration

    1995-05-01

    The TESLA collaboration has made steady progress since its first official meeting at Cornell in 1990. The infrastructure necessary to assemble and test superconducting rf cavities has been installed at the TESLA Test Facility (TTF) at DESY. 5-cell, 1.3 GHz cavities have been fabricated and have reached accelerating fields of 25 MV/m. Full sized 9-cell copper cavities of TESLA geometry have been measured to verify the higher order modes present and to evaluate HOM coupling designs. The design of the TESLA 9-cell cavity has been finalized and industry has started delivery. Two prototype 9-cell niobium cavities in their first tests have reached accelerating fields of 10 MV/m and 15 MV/m in a vertical dewar after high peak power (HPP) conditioning. The first 12 m TESLA cryomodule that will house 8 9-cell cavities is scheduled to be delivered in Spring 1995. A design report for the TTF is in progress. The TTF test linac is scheduled to be commissioned in 1996/1997. (orig.).

  20. Superconductivity in Fe-chalcogenides

    Energy Technology Data Exchange (ETDEWEB)

    Chang, C.C.; Chen, T.K. [Institute of Physics, Academia Sinica, Taipei, Taiwan (China); Lee, W.C. [Department of Physics, Applied Physics, and Astronomy, Binghamton University – SUNY (United States); Lin, P.H. [National Synchrotron Research Center, Hsinchu, Taiwan (China); Wang, M.J. [Institute of Astrophysics and Astronomy, Academia Sinica, Taipei, Taiwan (China); Wen, Y.C. [Institute of Physics, Academia Sinica, Taipei, Taiwan (China); Wu, P.M. [Deparment of Applied Physics and Geballe Laboratory for Advanced Materials, Stanford University, Stanford, CA (United States); Wu, M.K., E-mail: mkwu@mail.ndhu.edu.tw [Institute of Physics, Academia Sinica, Taipei, Taiwan (China); National Donghwa University, Hualien, Taiwan (China)

    2015-07-15

    FeSe, which has the simplest crystal structure among the Fe based superconductors, and related chalcogenide superconductors are ideal candidates for investigating the detailed mechanism of the iron-based superconductors. Here, we summarize recent studies on the Fe-chalcogenides, with the goal to address some unresolved questions such as what is the influence of chemical stoichiometry on the phase diagram, what is the exact parent phase of FeSe system, and why can T{sub c}s be so dramatically enhanced in FeSe based superconductors? Recent developments in novel synthesis to prepare chalcogenide crystals, nano-materials and thin films allow the community to begin to address these issues. Then we review physical properties of the Fe chalcogenides, specifically focusing on optical properties, scanning tunneling spectroscopy and angle-resolved photoemission spectroscopy (ARPES) results. These measurements along with recent theories provide a framework for better understanding the origin of superconductivity in FeSe and Fe-chalcogenides.

  1. Brookhaven superconducting cable test facility

    Energy Technology Data Exchange (ETDEWEB)

    Forsyth, E.B.; Gibbs, R.J.

    1976-08-17

    Construction has started on an outdoor testing station for flexible ac superconducting power transmission cables. It is intended to serve as an intermediate step between laboratory-scale experiments and qualification testing of prototype-scale cables. The permanent equipment includes a 500 W supercritical helium refrigerator using a screw compressor and multistage turbine expanders. Helium storage for 250,000 cu ft of helium at 250 psi is provided. Initially, the cables will be tested in a horizontal cryostat some 250 ft long. High-voltage 60 Hz tests will be performed with the cable in a series resonant mode with a maximum line to ground capability of 240 kV, this is adequate for a 138 kV system design. Impulse testing up to about 650 kV is planned. The cable conductor will be energized by current transformers, initially at about 4 kA and later up to fault levels of 40 kA. The refrigerator is now at the site and testing on a dummy load will commence in the Fall of 1976. The cryostat will be installed in 1977 followed about a year later by the first cable tests.

  2. Economical Aspects of Superconducting Cable

    Science.gov (United States)

    Ohya, Masayoshi

    High-temperature superconducting (HTS) cables are expected to resolve technical problems with power grids because they put large-capacity, low-loss power transmission into a compact package. One problem is replacing old 275-kV oil filled (OF) cables with cross-linked polyethylene insulated vinyl sheath cables (XLPE cables). This is difficult because XLPE cable has a lower transmission capacity than OF cable. In addition, the high concentration of public infrastructure underground makes it extremely difficult to build new ones. However, if 66-kV HTS cables can be installed inside existing underground conduits and can achieve a power capacity equivalent to conventional 275-kV cables, construction costs could be significantly reduced. Moreover, if XLPE cables are used for a 1,000 MVA-class transmission line, then three circuits of nine 275-kV single-core cables would be required, which would incur a transmission loss of 90 W/m/cct. Three circuits of three 66-kV Three-in-One HTS cables, however, with an AC loss of 1 W/m/ph@3 kA, heat invasion of 2 W/m, and cooling system efficiency of 0.1, would reduce transmission loss to less than three-fifths that of XLPE cables.

  3. Exotic Magnetic Orders and Their Interplay with Superconductivity

    DEFF Research Database (Denmark)

    Christensen, Morten Holm

    Superconductivity represents one of the most important scientific discoveries of the 20th century. The practical applications are numerous ranging from clean energy storage and MRI machines to quantum computers. However, the low temperatures required for superconductivity prohibits many practical...

  4. Superconducting gap anomaly in heavy fermion systems

    Indian Academy of Sciences (India)

    G C Rout; M S Ojha; S N Behera

    2008-04-01

    The heavy fermion system (HFS) is described by the periodic Anderson model (PAM), treating the Coulomb correlation between the -electrons in the mean-field Hartree-Fock approximation. Superconductivity is introduced by a BCS-type pairing term among the conduction electrons. Within this approximation the equation for the superconducting gap is derived, which depends on the effective position of the energy level of the -electrons relative to the Fermi level. The latter in turn depends on the occupation probability f of the -electrons. The gap equation is solved self-consistently with the equation for f; and their temperature dependences are studied for different positions of the bare -electron energy level, with respect to the Fermi level. The dependence of the superconducting gap on the hybridization leads to a re-entrant behaviour with increasing strength. The induced pairing between the -electrons and the pairing of mixed conduction and -electrons due to hybridization are also determined. The temperature dependence of the hybridization parameter, which characterizes the number of electrons with mixed character and represents the number of heavy electrons is studied. This number is shown to be small. The quasi-particle density of states (DOS) shows the existence of a pseudo-gap due to superconductivity and the signature of a hybridization gap at the Fermi level. For the choice of the model parameters, the DOS shows that the HFS is a metal and undergoes a transition to the gap-less superconducting state.

  5. Superconductivity Bordering Rashba Type Topological Transition

    Science.gov (United States)

    Jin, M. L.; Sun, F.; Xing, L. Y.; Zhang, S. J.; Feng, S. M.; Kong, P. P.; Li, W. M.; Wang, X. C.; Zhu, J. L.; Long, Y. W.; Bai, H. Y.; Gu, C. Z.; Yu, R. C.; Yang, W. G.; Shen, G. Y.; Zhao, Y. S.; Mao, H. K.; Jin, C. Q.

    2017-01-01

    Strong spin orbital interaction (SOI) can induce unique quantum phenomena such as topological insulators, the Rashba effect, or p-wave superconductivity. Combining these three quantum phenomena into a single compound has important scientific implications. Here we report experimental observations of consecutive quantum phase transitions from a Rashba type topological trivial phase to topological insulator state then further proceeding to superconductivity in a SOI compound BiTeI tuned via pressures. The electrical resistivity measurement with V shape change signals the transition from a Rashba type topological trivial to a topological insulator phase at 2 GPa, which is caused by an energy gap close then reopen with band inverse. Superconducting transition appears at 8 GPa with a critical temperature TC of 5.3 K. Structure refinements indicate that the consecutive phase transitions are correlated to the changes in the Bi-Te bond and bond angle as function of pressures. The Hall Effect measurements reveal an intimate relationship between superconductivity and the unusual change in carrier density that points to possible unconventional superconductivity.

  6. Superconductivity in alkali-metal-doped picene.

    Science.gov (United States)

    Mitsuhashi, Ryoji; Suzuki, Yuta; Yamanari, Yusuke; Mitamura, Hiroki; Kambe, Takashi; Ikeda, Naoshi; Okamoto, Hideki; Fujiwara, Akihiko; Yamaji, Minoru; Kawasaki, Naoko; Maniwa, Yutaka; Kubozono, Yoshihiro

    2010-03-04

    Efforts to identify and develop new superconducting materials continue apace, motivated by both fundamental science and the prospects for application. For example, several new superconducting material systems have been developed in the recent past, including calcium-intercalated graphite compounds, boron-doped diamond and-most prominently-iron arsenides such as LaO(1-x)F(x)FeAs (ref. 3). In the case of organic superconductors, however, no new material system with a high superconducting transition temperature (T(c)) has been discovered in the past decade. Here we report that intercalating an alkali metal into picene, a wide-bandgap semiconducting solid hydrocarbon, produces metallic behaviour and superconductivity. Solid potassium-intercalated picene (K(x)picene) shows T(c) values of 7 K and 18 K, depending on the metal content. The drop of magnetization in K(x)picene solids at the transition temperature is sharp (<2 K), similar to the behaviour of Ca-intercalated graphite. The T(c) of 18 K is comparable to that of K-intercalated C(60) (ref. 4). This discovery of superconductivity in K(x)picene shows that organic hydrocarbons are promising candidates for improved T(c) values.

  7. Superconductivity Bordering Rashba Type Topological Transition

    Energy Technology Data Exchange (ETDEWEB)

    Jin, M. L.; Sun, F.; Xing, L. Y.; Zhang, S. J.; Feng, S. M.; Kong, P. P.; Li, W. M.; Wang, X. C.; Zhu, J. L.; Long, Y. W.; Bai, H. Y.; Gu, C. Z.; Yu, R. C.; Yang, W. G.; Shen, G. Y.; Zhao, Y. S.; Mao, H. K.; Jin, C. Q.

    2017-01-04

    Strong spin orbital interaction (SOI) can induce unique quantum phenomena such as topological insulators, the Rashba effect, or p-wave superconductivity. Combining these three quantum phenomena into a single compound has important scientific implications. Here we report experimental observations of consecutive quantum phase transitions from a Rashba type topological trivial phase to topological insulator state then further proceeding to superconductivity in a SOI compound BiTeI tuned via pressures. The electrical resistivity measurement with V shape change signals the transition from a Rashba type topological trivial to a topological insulator phase at 2 GPa, which is caused by an energy gap close then reopen with band inverse. Superconducting transition appears at 8 GPa with a critical temperature TC of 5.3 K. Structure refinements indicate that the consecutive phase transitions are correlated to the changes in the Bi–Te bond and bond angle as function of pressures. The Hall Effect measurements reveal an intimate relationship between superconductivity and the unusual change in carrier density that points to possible unconventional superconductivity.

  8. Overview of Superconductivity and Challenges in Applications

    Science.gov (United States)

    Flükiger, Rene

    2012-01-01

    Considerable progress has been achieved during the last few decades in the various fields of applied superconductivity, while the related low temperature technology has reached a high level. Magnetic resonance imaging (MRI) and nuclear magnetic resonance (NMR) are so far the most successful applications, with tens of thousands of units worldwide, but high potential can also be recognized in the energy sector, with high energy cables, transformers, motors, generators for wind turbines, fault current limiters and devices for magnetic energy storage. A large number of magnet and cable prototypes have been constructed, showing in all cases high reliability. Large projects involving the construction of magnets, solenoids as well as dipoles and quadrupoles are described in the present book. A very large project, the LHC, is currently in operation, demonstrating that superconductivity is a reliable technology, even in a device of unprecedented high complexity. A project of similar complexity is ITER, a fusion device that is presently under construction. This article starts with a brief historical introduction to superconductivity as a phenomenon, and some fundamental properties necessary for the understanding of the technical behavior of superconductors are described. The introduction of superconductivity in the industrial cycle faces many challenges, first for the properties of the base elements, e.g. the wires, tapes and thin films, then for the various applied devices, where a number of new difficulties had to be resolved. A variety of industrial applications in energy, medicine and communications are briefly presented, showing how superconductivity is now entering the market.

  9. Exotic Magnetic Orders and Their Interplay with Superconductivity

    DEFF Research Database (Denmark)

    Christensen, Morten Holm

    applications. The more recent discovery of high-temperature superconductors, with superconducting transition temperatures above 100~K, has led to the hope that superconductivity at room-temperature might be achievable, although a complete theoretical understanding of the high-temperature superconductors......Superconductivity represents one of the most important scientific discoveries of the 20th century. The practical applications are numerous ranging from clean energy storage and MRI machines to quantum computers. However, the low temperatures required for superconductivity prohibits many practical...

  10. Global and local superconductivity in boron-doped granular diamond.

    Science.gov (United States)

    Zhang, Gufei; Turner, Stuart; Ekimov, Evgeny A; Vanacken, Johan; Timmermans, Matias; Samuely, Tomás; Sidorov, Vladimir A; Stishov, Sergei M; Lu, Yinggang; Deloof, Bart; Goderis, Bart; Van Tendeloo, Gustaaf; Van de Vondel, Joris; Moshchalkov, Victor V

    2014-04-02

    Strong granularity-correlated and intragrain modulations of the superconducting order parameter are demonstrated in heavily boron-doped diamond situated not yet in the vicinity of the metal-insulator transition. These modulations at the superconducting state (SC) and at the global normal state (NS) above the resistive superconducting transition, reveal that local Cooper pairing sets in prior to the global phase coherence.

  11. The advantages and challenges of superconducting magnets in particle therapy

    Science.gov (United States)

    Gerbershagen, Alexander; Calzolaio, Ciro; Meer, David; Sanfilippo, Stéphane; Schippers, Marco

    2016-08-01

    This paper provides an overview of the current developments in superconducting magnets for applications in proton and ion therapy. It summarizes the benefits and challenges regarding the utilization of these magnets in accelerating systems (e.g. superconducting cyclotrons) and gantries. The paper also provides examples of currently used superconducting particle therapy systems and proposed designs.

  12. Superconducting Dome in a Gate-Tuned Band Insulator

    NARCIS (Netherlands)

    Ye, J. T.; Zhang, Y. J.; Akashi, R.; Bahramy, M. S.; Arita, R.; Iwasa, Y.

    2012-01-01

    A dome-shaped superconducting region appears in the phase diagrams of many unconventional superconductors. In doped band insulators, however, reaching optimal superconductivity by the fine-tuning of carriers has seldom been seen. We report the observation of a superconducting dome in the temperature

  13. Development and testing of a 50 KA, pulsed superconducting cable

    Energy Technology Data Exchange (ETDEWEB)

    Wollan; DeClerc, J.; Hamilton, W.; Zeitlin, B.

    1983-05-01

    Prototype cables for 7.5 T, pulsed field application in tokamak poloidal field coils have been designed, fabricated, and evaluated. Successful fabrication of a 10 m superconducting sample represents the largest superconducting cable ever made. Details of the fabrication, the problems expected and encountered, and the solutions to those problems are discussed. Results of stability measurements on the superconducting prototype also are presented.

  14. A superconducting large-angle magnetic suspension

    Science.gov (United States)

    Downer, James R.; Anastas, George V., Jr.; Bushko, Dariusz A.; Flynn, Frederick J.; Goldie, James H.; Gondhalekar, Vijay; Hawkey, Timothy J.; Hockney, Richard L.; Torti, Richard P.

    1992-01-01

    SatCon Technology Corporation has completed a Small Business Innovation Research (SBIR) Phase 2 program to develop a Superconducting Large-Angle Magnetic Suspension (LAMS) for the NASA Langley Research Center. The Superconducting LAMS was a hardware demonstration of the control technology required to develop an advanced momentum exchange effector. The Phase 2 research was directed toward the demonstration for the key technology required for the advanced concept CMG, the controller. The Phase 2 hardware consists of a superconducting solenoid ('source coils') suspended within an array of nonsuperconducting coils ('control coils'), a five-degree-of-freedom positioning sensing system, switching power amplifiers, and a digital control system. The results demonstrated the feasibility of suspending the source coil. Gimballing (pointing the axis of the source coil) was demonstrated over a limited range. With further development of the rotation sensing system, enhanced angular freedom should be possible.

  15. Topological superconductivity in bilayer Rashba system.

    Science.gov (United States)

    Nakosai, Sho; Tanaka, Yukio; Nagaosa, Naoto

    2012-04-06

    We theoretically study a possible topological superconductivity in the interacting two layers of Rashba systems, which can be fabricated by the heterostructures of semiconductors and oxides. The hybridization, which induces the gap in the single particle dispersion, and the electron-electron interaction between the two layers leads to the novel phase diagram of the superconductivity. It is found that the topological superconductivity without breaking time-reversal symmetry is realized when (i) the Fermi energy is within the hybridization gap, and (ii) the interlayer interaction is repulsive, both of which can be satisfied in realistic systems. Edge channels are studied in a tight-binding model numerically, and the several predictions on experiments are also given.

  16. Method for Producing Substrates for Superconducting Layers

    DEFF Research Database (Denmark)

    2015-01-01

    There is provided a method for producing a substrate suitable for supporting an elongated superconducting element, wherein one or more elongated strips of masking material are placed on a solid element (202) so as to form one or more exposed elongated areas being delimited on one or two sides...... by elongated strip of masking material, and placing filling material on the solid element so that each exposed elongated area within the one or more exposed elongated areas is covered by a portion of filling material (318a-c) where each portion of filling material also covers at least a portion of the adjacent...... the portion of filling material and the solid element. The method may further comprise placing buffer material (640) and or superconducting material (642, 644, 646)) on the substrate, so as to provide a superconducting structure (601) with reduced AC losses....

  17. Superconducting homopolar motor and conductor development

    Science.gov (United States)

    Gubser, Donald U.

    1996-10-01

    The U.S. Navy has been developing superconducting homopolar motors for ship applications since 1969; a successful at-sea demonstration of the first motor, using NbTi wire for the magnet, was achieved in the early 1980s. Recently, this same motor was used as a test bed to demonstrate progress in high-critical-temperature superconducting magnet technology using bismuth-strontium- calcium-copper-oxide (BSCCO) compounds. In the fall of 1995, this motor achieved a performance of 124 kW operating at a temperature of 4.2 K and 91 kW while operating at 28 K. Future tests are scheduled using new magnets with conductors of both the 2223 and the 2212 BSCCO phases. This article describes the advantages of superconducting propulsion and recent progress in the development of BSCCO conductors for use in Navy power systems.

  18. International Workshop on Novel Mechanisms of Superconductivity

    CERN Document Server

    Wolf, Stuart A; Novel superconductivity

    1987-01-01

    The Novel Mechanisms of Superconductivity Conference was initially conceived in the early part of 1986 as a small, 2-1/2 day workshop of 40-70 scientists, both theorists and experimentalists interested in exploring the possible evidence for exotic, non phononic superconductivity. Of course, the historic discoveries of high temperature oxide superconductors by Bednorz and Mftller and the subsequent enhancements by the Houston/Alabama groups made such a small conference impractical. The conference necessarily had to expand, 2-1/2 days became 4-1/2 days and superconductivity in the high Tc oxides became the largest single topic in the workshop. In fact, this conference became the first major conference on this topic and thus, these proceedings are also the first maj or publication. However, heavy fermion, organic and low carrier concentration superconductors remained a very important part of this workshop and articles by the leaders in these fields are included in these proceedings. Ultimately the work...

  19. Applied superconductivity handbook on devices and applications

    CERN Document Server

    2015-01-01

    This wide-ranging presentation of applied superconductivity, from fundamentals and materials right up to the latest applications, is an essential reference for physicists and engineers in academic research as well as in the field. Readers looking for a systematic overview on superconducting materials will expand their knowledge and understanding of both low and high Tc superconductors, including organic and magnetic materials. Technology, preparation and characterization are covered for several geometries, but the main benefit of this work lies in its broad coverage of significant applications in power engineering or passive devices, such as filter and antenna or magnetic shields. The reader will also find information on superconducting magnets for diverse applications in mechanical engineering, particle physics, fusion research, medicine and biomagnetism, as well as materials processing. SQUIDS and their usage in medicine or geophysics are thoroughly covered as are applications in quantum metrology, and, las...

  20. Deterministic phase slips in mesoscopic superconducting rings

    Science.gov (United States)

    Petković, I.; Lollo, A.; Glazman, L. I.; Harris, J. G. E.

    2016-11-01

    The properties of one-dimensional superconductors are strongly influenced by topological fluctuations of the order parameter, known as phase slips, which cause the decay of persistent current in superconducting rings and the appearance of resistance in superconducting wires. Despite extensive work, quantitative studies of phase slips have been limited by uncertainty regarding the order parameter's free-energy landscape. Here we show detailed agreement between measurements of the persistent current in isolated flux-biased rings and Ginzburg-Landau theory over a wide range of temperature, magnetic field and ring size; this agreement provides a quantitative picture of the free-energy landscape. We also demonstrate that phase slips occur deterministically as the barrier separating two competing order parameter configurations vanishes. These results will enable studies of quantum and thermal phase slips in a well-characterized system and will provide access to outstanding questions regarding the nature of one-dimensional superconductivity.