WorldWideScience

Sample records for superconducting sc state

  1. Mechanical, electronic, optical, thermodynamic properties and superconductivity of ScGa3

    Science.gov (United States)

    Parvin, F.; Hossain, M. A.; Ali, M. S.; Islam, A. K. M. A.

    2015-01-01

    The rare occurrence of type-I superconductivity in binary system ScGa3 has experimentally been shown recently. In the present paper we study the electronic, optical, thermodynamic properties and some aspects of superconductivity of this compound using first-principles calculations. The mechanical properties like elastic constants, bulk modulus, shear modulus, Pugh's ductility index, Young's modulus, Poisson's ratio, elastic anisotropy factor, Peierls stress are calculated for the first time. The material is anisotropic and brittle. Electronic band structure, density of states, Fermi surfaces and bonding nature have also been studied. The optical functions are estimated and discussed for the first time. The high reflectivity is found in the ultraviolet regions up to ~13 eV and thus ScGa3 can serve as a possible shielding material for ultraviolet radiation. Thermal effects on some macroscopic properties of ScGa3 are predicted using the quasi-harmonic Debye model and phonon approximation in the temperature and hydrostatic pressure in the ranges of 0-1000 K and 0-40 GPa, respectively. The calculated electron-phonon coupling constant λ=0.52 yields Tc=2.6 K, which is in very good agreement with the experimentally observed value. The value of the coupling constant and the Ginzburg-Landau parameter (κ=0.09) indicate that the compound is a weak-coupled type-I rare binary BCS superconductor.

  2. Mechanical, electronic, optical, thermodynamic properties and superconductivity of ScGa{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Parvin, F. [Department of Physics, Rajshahi University, Rajshahi (Bangladesh); Hossain, M.A. [Department of Physics, Mawlana Bhashani Science and Technology University, Santosh, Tangail 1902 (Bangladesh); Ali, M.S. [Department of Physics, Rajshahi University, Rajshahi (Bangladesh); Islam, A.K.M.A., E-mail: azi46@ru.ac.bd [International Islamic University Chittagong, 154/A College Road, Chittagong 4203 (Bangladesh)

    2015-01-15

    The rare occurrence of type-I superconductivity in binary system ScGa{sub 3} has experimentally been shown recently. In the present paper we study the electronic, optical, thermodynamic properties and some aspects of superconductivity of this compound using first-principles calculations. The mechanical properties like elastic constants, bulk modulus, shear modulus, Pugh's ductility index, Young's modulus, Poisson's ratio, elastic anisotropy factor, Peierls stress are calculated for the first time. The material is anisotropic and brittle. Electronic band structure, density of states, Fermi surfaces and bonding nature have also been studied. The optical functions are estimated and discussed for the first time. The high reflectivity is found in the ultraviolet regions up to ∼13 eV and thus ScGa{sub 3} can serve as a possible shielding material for ultraviolet radiation. Thermal effects on some macroscopic properties of ScGa{sub 3} are predicted using the quasi-harmonic Debye model and phonon approximation in the temperature and hydrostatic pressure in the ranges of 0–1000 K and 0–40 GPa, respectively. The calculated electron–phonon coupling constant λ=0.52 yields T{sub c}=2.6 K, which is in very good agreement with the experimentally observed value. The value of the coupling constant and the Ginzburg–Landau parameter (κ=0.09) indicate that the compound is a weak-coupled type-I rare binary BCS superconductor.

  3. Superconductivity at 3.1 K in the orthorhombic ternary silicide ScRuSi

    Science.gov (United States)

    Ruan, Bin-Bin; Wang, Xiao-Chuan; Yu, Jia; Pan, Bo-Jin; Mu, Qing-Ge; Liu, Tong; Chen, Gen-Fu; Ren, Zhi-An

    2017-02-01

    We report the synthesis, crystal structure, superconductivity and physical property characterizations of the ternary equiatomic compound ScRuSi. Polycrystalline samples of ScRuSi were prepared by an arc-melting method. The as-prepared samples were identified as the orthorhombic Co2P-type o-ScRuSi by powder x-ray diffraction analysis. Electrical resistivity measurements show o-ScRuSi to be a metal which superconducts below a T c of 3.1 K; the upper critical field μ 0 H c2(0) is estimated to be 0.87 T. The magnetization and specific heat measurements confirm the bulk type-II superconductivity in o-ScRuSi, with a specific heat jump within the BCS weak coupling limit. o-ScRuSi is the first Co2P-type superconductor to contain scandium. After annealing at 1273 K for a week, o-ScRuSi transforms into hexagonal Fe2P-type h-ScRuSi, which is a Pauli-paramagnetic metal with no superconductivity observed above 1.8 K.

  4. Two-gap superconductivity in R2Fe3Si5 (R=Lu, Sc and Sc5Ir4Si10

    Directory of Open Access Journals (Sweden)

    Tsuyoshi Tamegai, Yasuyuki Nakajima, Tsuyoshi Nakagawa, Guoji Li and Hisatomo Harima

    2008-01-01

    Full Text Available R2Fe3Si5 (R= Sc, Y, Lu contains nonmagnetic iron and has a relatively high superconducting transition temperature Tc among iron-containing superconductors. An anomalous temperature dependence of specific heat C(T has been reported for polycrystalline samples down to 1 K. We have grown R2Fe3Si5 single crystals, confirmed the anomalous C(T dependence, and found a second drop in specific heat below 1 K. In Lu2Fe3Si5, we can reproduce C(T below Tc, assuming two distinct energy gaps 2Δ 1/kBTc = 4.4 and 2Δ 2/kBTc = 1.1, with nearly equal weights, indicating that Lu2Fe3Si5 is a two-gap superconductor similar to MgB2. Hall coefficient measurements and band structure calculation also support the multiband contributions to the normal-state properties. The specific heat in the Sc2Fe3Si5 single crystals also shows the two-gap feature. R5Ir4Si10 (R = Sc, rare earth is also a superconductor where competition between superconductivity and the charge-density wave is known for rare earths but not for Sc. We have performed detailed specific heat measurements on Sc5Ir4Si10 single crystals and found that C(T deviates slightly from the behavior expected for weak-coupling superconductors. C(T for these superconductors can also be reproduced well by assuming two superconducting gaps.

  5. 超导ECR离子源DECRIS-SC2%Project of the Superconducting ECR Ion Source DECRIS-SC2

    Institute of Scientific and Technical Information of China (English)

    V.V.Bekhterev; V.V.Seleznev; A.Shishov; G.P.Tsvineva; N.YU.Yazvitsky; B.I.Yakovlev; S.L.Bogomolov; V.I.Datskov; V.M.Drobin; S.N.Dmitriev; A.A.Efremov; V.N.Loginov; A.N.Lebedev; H.Malinowski

    2007-01-01

    A new compact version of the"liquid He-free"superconducting Electron Cyclotron Resonance Ion Source,to be used as an injector for the U-400M cyclotron,is presently under construction at the FLNR in collaboration with LHE(JINR).The axial magnetic field of the source is created by the superconducting magnet,and the NdFeB hexapole is used for the radial plasma confinement.The microwave frequency of 14GHz will be used for ECR plasma heating.The DECRIS-SC2 superconducting magnet is designed for the induction of a magnetic field on the axis of the source of up to 1.4T (extraction side) and 1.9T (injection side) at nominal current of 75A.Cooling of the coils is carried out by GM cryocooler with cooling power of 1W at the temperature 4.5K.The basic design features of the superconducting magnet and of the ion source are presented.The main parts of the source are in production.The first beam test of the source is expected in the beginning of 2007.

  6. 1D to 3D dimensional crossover in the superconducting transition of the quasi-one-dimensional carbide superconductor Sc3CoC4.

    Science.gov (United States)

    He, Mingquan; Wong, Chi Ho; Shi, Dian; Tse, Pok Lam; Scheidt, Ernst-Wilhelm; Eickerling, Georg; Scherer, Wolfgang; Sheng, Ping; Lortz, Rolf

    2015-02-25

    The transition metal carbide superconductor Sc(3)CoC(4) may represent a new benchmark system of quasi-one-dimensional (quasi-1D) superconducting behavior. We investigate the superconducting transition of a high-quality single crystalline sample by electrical transport experiments. Our data show that the superconductor goes through a complex dimensional crossover below the onset T(c) of 4.5 K. First, a quasi-1D fluctuating superconducting state with finite resistance forms in the [CoC(4)](∞) ribbons which are embedded in a Sc matrix in this material. At lower temperature, the transversal Josephson or proximity coupling of neighboring ribbons establishes a 3D bulk superconducting state. This dimensional crossover is very similar to Tl(2)Mo(6)Se(6), which for a long time has been regarded as the most appropriate model system of a quasi-1D superconductor. Sc(3)CoC(4) appears to be even more in the 1D limit than Tl(2)Mo(6)Se(6).

  7. Superconductivity

    CERN Document Server

    Poole, Charles P; Farach, Horacio A

    1995-01-01

    Superconductivity covers the nature of the phenomenon of superconductivity. The book discusses the fundamental principles of superconductivity; the essential features of the superconducting state-the phenomena of zero resistance and perfect diamagnetism; and the properties of the various classes of superconductors, including the organics, the buckministerfullerenes, and the precursors to the cuprates. The text also describes superconductivity from the viewpoint of thermodynamics and provides expressions for the free energy; the Ginzburg-Landau and BCS theories; and the structures of the high

  8. Superconductivity in all its states

    CERN Multimedia

    Globe Info

    2011-01-01

    Temporary exhibition at the Saint-Genis-Pouilly Tourist Office. For the 100th anniversary of its discovery, take a plunge into the amazing world of superconductivity. Some materials, when cooled down to extreme temperatures, acquire a remarkable property -  they become superconducting. Superconductivity is a rare example of a quantum effect that can be witnessed on the macroscopic scale and is today at the heart of much research. In laboratories, researchers try to gain a better understanding of its origins, study new superconducting materials, explore the phenomenon at the nanometric scale and pursue their indefatigable search for new applications. Monday to Friday: 09:00 a.m. to 12:00 and 2:30 p.m. to 6:30 p.m. Saturday: 10:00 a.m. to 12:00 noon » Open to all – Admission free For further information: +33 (0)4 50 42 29 37

  9. {sup 27}Al and {sup 45}Sc NMR spectroscopy on ScT{sub 2}Al and Sc(T{sub 0.5}T{sup '}{sub 0.5}){sub 2}Al (T = T{sup '} = Ni, Pd, Pt, Cu, Ag, Au) Heusler phases and superconductivity in Sc(Pd{sub 0.5}Au{sub 0.5}){sub 2}Al

    Energy Technology Data Exchange (ETDEWEB)

    Benndorf, Christopher [Institut fuer Anorganische und Analytische Chemie, Westfaelische Wilhelms-Universitaet Muenster (Germany); Institut fuer Physikalische Chemie, Westfaelische Wilhelms-Universitaet Muenster (Germany); Niehaus, Oliver; Janka, Oliver [Institut fuer Anorganische und Analytische Chemie, Westfaelische Wilhelms-Universitaet Muenster (Germany); Eckert, Hellmut [Institut fuer Physikalische Chemie, Westfaelische Wilhelms-Universitaet Muenster (Germany)

    2015-02-15

    The intermetallic Heusler compounds with ScT{sub 2}Al and Sc(T{sub 0.5}T{sup '}{sub 0.5}){sub 2}Al composition with T = T{sup '} = Ni, Pd, Pt, Cu, Ag, Au were synthesized from the elements by arc melting. They crystallize in the cubic MnCu{sub 2}Al type structure, space group Fm anti 3m. The unit cell parameters were determined by powder X-ray diffraction and the structure of Sc(Pd{sub 0.5}Au{sub 0.5}){sub 2}Al was refined on the basis of single-crystal X-ray diffraction. While the majority of the compounds show Pauli-paramagnetism, ScAu{sub 2}Al and the newly synthesized solid solution Sc(Pd{sub 0.5}Au{sub 0.5}){sub 2}Al exhibit superconductivity with transition temperatures of T{sub C} = 4.4 K and T{sub C} = 3.0(1) K, respectively. The superconducting state of Sc(Pd{sub 0.5}Au{sub 0.5}){sub 2}Al was also investigated by electrical resistivity measurements. All the synthesized compounds were furthermore studied by {sup 27}Al and {sup 45}Sc MAS-NMR spectroscopy. The resonance shifts of the synthesized compounds were determined and in Sc(Pd{sub 1-x}Au{sub x}){sub 2}Al a linear relationship between the resonance shifts and the composition was found. Line broadening effects and enhanced quadrupolar interaction strengths observed in the mixed samples can be attributed to the effect of Pd/Au mixing on the 8c Wyckoff site. The NMR spectroscopic data give no clear evidence for or against Sc/Al site disordering. (Copyright copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  10. Pair density wave superconducting states and statistical mechanics of dimers

    Science.gov (United States)

    Soto Garrido, Rodrigo Andres

    3 we show that the pair-density-wave superconducting state emergent in extended Heisenberg-Hubbard models in two-leg ladders is topological in the presence of an Ising spin symmetry and supports a Majorana zero mode (MZM) at an open boundary and at a junction with a uniform d-wave one-dimensional superconductor. Similarly to a conventional finite-momentum paired state, the order parameter of the PDW state is a charge-2e field with finite momentum. However, the order parameter here is a quartic electron operator and conventional mean-field theory cannot be applied to study this state. We use bosonization to show that the 1D PDW state has a MZM at a boundary. This superconducting state is an exotic topological phase supporting Majorana fermions with finite-momentum pairing fields and charge-4e superconductivity. In chapter 4 we provide a quasi-one-dimensional model which can support a PDW state. The model consists of an array of strongly-interacting one-dimensional systems, where the one-dimensional systems are coupled to each other by local interactions.Within the interchain mean-field theory (MFT), we find several SC states from the model, including a conventional uniform SC state, PDW SC state, and a coexisting phase of the uniform SC and PDW states. In this quasi-1D regime we can treat the strong correlation physics essentially exactly using bosonization methods and the crossover to the 2D system by means of interchain MFT. The resulting critical temperatures of the SC phases generically exhibit a power-law scaling with the coupling constants of the array, instead of the essential singularity found in weak-coupling BCS-type theories. Electronic excitations with an open Fermi surface, which emerge from the electronic Luttinger liquid systems below their crossover temperature to the Fermi liquid, are then coupled to the SC order parameters via the proximity effect. From the Fermi surface thus coupled to the SC order parameters, we calculate the quasiparticle

  11. Superconductivity resulting from antiferromagnetic states

    Energy Technology Data Exchange (ETDEWEB)

    Feng Shi-Ping (Department of Physics, Beijing Normal University (CN))

    1989-09-01

    When the dopping is low enough, the holes obey Bose statistics, Bose-Einstein condensation of these holes may lead to occurance of superconductivity. In this framework, we have calculated some physical quantities, the results are in qualitative agreement with experiments.

  12. The preliminary tests of the superconducting electron cyclotron resonance ion source DECRIS-SC2.

    Science.gov (United States)

    Efremov, A; Bekhterev, V; Bogomolov, S; Drobin, V; Loginov, V; Lebedev, A; Yazvitsky, N; Yakovlev, B

    2012-02-01

    A new compact version of the "liquid He-free" superconducting ECR ion source, to be used as an injector of highly charged heavy ions for the MC-400 cyclotron, is designed and built at the Flerov Laboratory of Nuclear Reactions in collaboration with the Laboratory of High Energy Physics of JINR. The axial magnetic field of the source is created by the superconducting magnet and the NdFeB hexapole is used for the radial plasma confinement. The microwave frequency of 14 GHz is used for ECR plasma heating. During the first tests, the source shows a good enough performance for the production of medium charge state ions. In this paper, we will present the design parameters and the preliminary results with gaseous ions.

  13. The NSF PAARE Projects at SC State

    Science.gov (United States)

    Walter, Donald K.; Brittain, Sean D.; Cash, Jennifer; Hartmann, Dieter; Hinkle, Kenneth H.; Ho, Shirley; Howell, Steve B.; King, Jeremy R.; Leising, Mark D.; Mighell, Kenneth J.; Smith, Daniel M.

    2016-01-01

    We review our progress over the past 7.5 years and the path forward under the NSF program "Partnerships in Astronomy and Astrophysics Research and Education (PAARE)". Our first project, "A Partnership in Observational and Computational Astronomy (POCA)" was a part of the 2008 PAARE cohort which we finished on September 30, 2015. We will summarize the results of those years and look at our way forward under a second PAARE award made in August 2014 (POCA II). Our partnership under the second PAARE award includes South Carolina State University (a Historically Black College/University), Clemson University (a Ph.D. granting institution) as well as individual investigators at NASA Ames and Carnegie Mellon University. Our recent work on variable and peculiar stars, work with the Kepler Observatory and our educational products in cosmology for non-STEM majors will be presented as well as our success with undergraduate and graduate students. We will also discuss how we are sharing resources with Clemson through distance learning and undergraduate research projects. Our support includes NSF awards AST-0750814 and AST-1358913 to South Carolina State University as well as resources and support provided by Clemson University and the National Optical Astronomy Observatory. Support for the Kepler observations is provided by NASA to South Carolina State University under awards NNX11AB82G and NNX13AC24G. Additional details can be found at: http://physics.scsu.edu/paare/

  14. Update on the NSF PAARE Program at SC State

    Science.gov (United States)

    Walter, Donald K.; Ajello, Marco; Brittain, Sean D.; Cash, Jennifer; Hartmann, Dieter; Ho, Shirley; Howell, Steve B.; King, Jeremy R.; Leising, Mark D.; Smith, Daniel M.

    2017-01-01

    We report on results from our NSF PAARE program during Year 2 of the project. Our partnership under this PAARE award includes South Carolina State University (a Historically Black College/University), Clemson University (a Ph.D. granting institution) as well as individual investigators at NASA Ames and Carnegie Mellon University. Our recent work on variable and peculiar stars, work with the Kepler Observatory and our educational products in cosmology for non-STEM majors will be presented. We have successfully piloted sharing our teaching resources by offering an upper-level astrophysics course taught at Clemson via video conferencing , allowing a graduating senior from SC State to take a course not available through his home institution. Additionally, we are working on a memorandum of agreement between the two institutions that will allow for the seamless transfer of an undergraduate from SC State to Clemson’s graduate program in physics and astronomy. Our curriculum work includes new web-based cosmology activities and laboratory experiments. SC State undergraduates are reporting at this conference on their work with the light curves of semiregular variables using Kepler data. Additionally, we are heavily involved in the Citizen CATE Experiment. A PAARE scholarship student from SC State and the PAARE PI traveled to Indonesia for the March 2016 solar eclipse. Their results are also being presented elsewhere at this conference (see Myles McKay’s poster). Support for this work includes our NSF PAARE award AST-1358913 as well as resources and support provided by Clemson University and the National Optical Astronomy Observatory. Additional support has been provided by the South Carolina Space Grant Consortium and from NASA to SC State under awards NNX11AB82G and NNX13AC24G. CATE work has been supported by NASA SMD award NNX16AB92A to the National Solar Observatory. Additional details can be found at: http://physics.scsu.edu

  15. Crossover from a pseudogap state to a superconducting state

    Institute of Scientific and Technical Information of China (English)

    Cao Tian-De

    2010-01-01

    This paper deduces that the particular electronic structure of cuprate superconductors confines Cooper pairs to be first formed in the antinodal region which is far from the Fermi surface, and these pairs are incoherent and result in the pseudogap state. With the change of doping or temperature, some pairs are formed in the nodal region which locates the Fermi surface, and these pairs are coherent and lead to superconductivity. Thus the coexistence of the pseudogap and the superconducting gap is explained when the two kinds of gaps are not all on the Fermi surface. It also shows that the symmetry of the pseudogap and the superconducting gap are determined by the electronic structure, and non-s wave symmetry gap favours the high-temperature superconductivity. Why the high-temperature superconductivity occurs in the metal region near the Mott metal-insulator transition is also explained.

  16. Superconducting State Parameters of Binary Superconductors

    Directory of Open Access Journals (Sweden)

    Aditya M. Vora

    2012-05-01

    Full Text Available A well known pseudopotential is used to investigate the superconducting state parameters viz. electron-phonon coupling strength , Coulomb pseudopotential *, transition temperature ТС, isotope effect exponent  and effective interaction strength N0V for the AgxZn1 – x and AgxAl1 – x binary superconductors theoretically for the first time. We have incorporated here five different types of the local field correction functions to show the effect of exchange and correlation on the aforesaid properties. Very strong influence of the various exchange and correlation functions is concluded from the present study. The comparison with other such experimental values is encouraging, which confirms the applicability of the model potential in explaining the superconducting state parameters of binary mixture.

  17. Theoretical studies of the low-lying states of ScO, ScS, VO, and VS

    Science.gov (United States)

    Bauschlicher, Charles W., Jr.; Langhoff, Stephen R.

    1986-01-01

    Bonding in the low-lying states of ScO, ScS, VO, and VS is theoretically studied. Excellent agreement is obtained with experimental spectroscopic constants for the low-lying states of ScO and VO. The results for VS and ScS show that the bonding in the oxides and sulfides is similar, but that the smaller electronegativity in S leads to a smaller ionic component in the bonding. The computed D0 of the sulfides are about 86 percent of the corresponding oxides, and the low-lying excited states are lower in the sulfides than in the corresponding oxides. The CPF method is shown to be an accurate and cost-effective method for obtaining reliable spectroscopic constants for these systems.

  18. High-pressure superconducting state in hydrogen

    Science.gov (United States)

    Duda, A. M.; Szczȩśniak, R.; Sowińska, M. A.; Kosiacka, A. H.

    2016-10-01

    The paper determines the thermodynamic parameters of the superconducting state in the metallic atomic hydrogen under the pressure at 1 TPa, 1.5 TPa, and 2.5 TPa. The calculations were conducted in the framework of the Eliashberg formalism. It has been shown that the critical temperature is very high (in the range from 301.2 K to 437.3 K), as well as high are the values of the electron effective mass (from 3.43me to 6.88me), where me denotes the electron band mass. The ratio of the low-temperature energy gap to the critical temperature explicitly violates the predictions of the BCS theory: 2 Δ (0) /kB TC ∈ . Additionally, the free energy difference between the superconducting and normal state, the thermodynamic critical field, and the specific heat of the superconducting state have been determined. Due to the significant strong-coupling and retardation effects those quantities cannot be correctly described in the framework of the BCS theory.

  19. Superconducting state parameters of ternary metallic glasses

    Indian Academy of Sciences (India)

    Aditya M Vora

    2011-12-01

    The well-known empty core (EMC) model potential of Ashcroft was used to study the theoretical investigation of the superconducting state parameters (SSP) viz. electron–phonon coupling strength , Coulomb pseudopotential $\\mu^{\\ast}$, transition temperature $T_{C}$, isotope effect exponent and effective interaction strength $N_{O}V$ of some ternary metallic glasses. Most recent local field correction function due to Sarkar et al is used to study the screening influence on the aforesaid properties. Quadratic $T_{C}$ equations have been proposed and found successful. Also, the present findings are found to be in qualitative agreement with other such earlier reported data, which confirms the superconducting phase in the ternary superconductors. The pseudo-alloy-atom (PAA) model was applied for the first time instead of Vegard’s law.

  20. Observation of pseudogap in the normal state of superconducting Mo{sub 3}Sb{sub 7}

    Energy Technology Data Exchange (ETDEWEB)

    Tran, V.H. [Polish Academy of Sciences, Institute of Low Temperature and Structure Research, 50-422 Wroclaw (Poland); Batkova, M.; Batko, I.; Pribulova, Z. [Institute of Experimental Physics, Slovak Academy of Sciences, Watsonova 47, 040 01 Kosice (Slovakia); Bukowski, Z. [Laboratory for Solid State Physics, ETH Zuerich, 8093 Zuerich (Switzerland)

    2010-03-15

    Using electron tunneling spectroscopy, we investigated density of states of Mo{sub 3}Sb{sub 7} in the temperature range 1.7-60 K. The differential conductance dI/dV vs. V curve at 4.2 K shows that an energy pseudogap of 2{delta}{proportional_to} 15(2) meV is formed in the density of states. In the superconducting state, the tunneling spectra exhibit the presence of a BCS-type superconducting gap of {delta}{sub sc} (0) {proportional_to} 0.24 meV. Future investigations of the interplay between superconductivity and possible SDW ordering, and the anisotropic nature of the nesting of the Fermi surface in Mo{sub 3}Sb{sub 7} are highly desired. Tunneling spectra of Mo{sub 3}Sb{sub 7} measured in the normal state (a) and in the superconducting state (b). (Abstract Copyright [2010], Wiley Periodicals, Inc.)

  1. Superconductivity

    CERN Document Server

    Ketterson, John B

    2008-01-01

    Conceived as the definitive reference in a classic and important field of modern physics, this extensive and comprehensive handbook systematically reviews the basic physics, theory and recent advances in the field of superconductivity. Leading researchers, including Nobel laureates, describe the state-of-the-art in conventional and unconventional superconductors at a particularly opportune time, as new experimental techniques and field-theoretical methods have emerged. In addition to full-coverage of novel materials and underlying mechanisms, the handbook reflects continued intense research into electron-phone based superconductivity. Considerable attention is devoted to high-Tc superconductivity, novel superconductivity, including triplet pairing in the ruthenates, novel superconductors, such as heavy-Fermion metals and organic materials, and also granular superconductors. What’s more, several contributions address superconductors with impurities and nanostructured superconductors. Important new results on...

  2. Superconducting properties of the s ±-wave state: Fe-based superconductors

    Science.gov (United States)

    Bang, Yunkyu; Stewart, G. R.

    2017-03-01

    Although the pairing mechanism of Fe-based superconductors (FeSCs) has not yet been settled with consensus with regard to the pairing symmetry and the superconducting (SC) gap function, the vast majority of experiments support the existence of spin-singlet sign-changing s-wave SC gaps on multi-bands ({{s}+/- } -wave state). This multi-band {{s}+/- } -wave state is a very unique gap state per se and displays numerous unexpected novel SC properties, such as a strong reduction of the coherence peak, non-trivial impurity effects, nodal-gap-like nuclear magnetic resonance signals, various Volovik effects in the specific heat (SH) and thermal conductivity, and anomalous scaling behaviors with a SH jump and condensation energy versus T c, etc. In particular, many of these non-trivial SC properties can easily be mistaken as evidence for a nodal-gap state such as a d-wave gap. In this review, we provide detailed explanations of the theoretical principles for the various non-trivial SC properties of the {{s}+/- } -wave pairing state, and then critically compare the theoretical predictions with experiments on FeSCs. This will provide a pedagogical overview of to what extent we can coherently understand the wide range of different experiments on FeSCs within the {{s}+/- } -wave gap model.

  3. Topological superconducting phase and Majorana bound states in Shiba chains

    Science.gov (United States)

    Pientka, Falko; Peng, Yang; Glazman, Leonid; von Oppen, Felix

    2015-12-01

    Chains of magnetic adatoms on a conventional superconducting substrate constitute a promising venue for realizing topological superconductivity and Majorana end states. Here, we give a brief overview over recent attempts to describe these systems theoretically, emphasizing how the topological phase emerges from the physics of individual magnetic impurities and their associated Shiba states.

  4. Superconductivity

    CERN Document Server

    Poole, Charles P; Creswick, Richard J; Prozorov, Ruslan

    2014-01-01

    Superconductivity, Third Edition is an encyclopedic treatment of all aspects of the subject, from classic materials to fullerenes. Emphasis is on balanced coverage, with a comprehensive reference list and significant graphics from all areas of the published literature. Widely used theoretical approaches are explained in detail. Topics of special interest include high temperature superconductors, spectroscopy, critical states, transport properties, and tunneling. This book covers the whole field of superconductivity from both the theoretical and the experimental point of view. This third edition features extensive revisions throughout, and new chapters on second critical field and iron based superconductors.

  5. Evanescent states and nonequilibrium in driven superconducting nanowires

    Science.gov (United States)

    Vercruyssen, N.; Verhagen, T. G. A.; Flokstra, M. G.; Pekola, J. P.; Klapwijk, T. M.

    2012-06-01

    We study the nonlinear response of current transport in a superconducting diffusive nanowire between normal reservoirs. We demonstrate theoretically and experimentally the existence of two different superconducting states appearing when the wire is driven out of equilibrium by an applied bias, called the global and bimodal superconducting states. The different states are identified by using two-probe measurements of the wire, and measurements of the local density of states with tunneling probes. The analysis is performed within the framework of the quasiclassical kinetic equations for diffusive superconductors.

  6. Evanescent states and nonequilibrium in driven superconducting nanowires

    NARCIS (Netherlands)

    Vercruyssen, N.; Verhagen, T.G.A.; Flokstra, M.G.; Pekola, J.P.; Klapwijk, T.M.

    2012-01-01

    We study the nonlinear response of current transport in a superconducting diffusive nanowire between normal reservoirs. We demonstrate theoretically and experimentally the existence of two different superconducting states appearing when the wire is driven out of equilibrium by an applied bias, calle

  7. Ferromagnetism carried by highly delocalized hybrid states in Sc-doped ZnO thin films

    KAUST Repository

    Benali Kanoun, Mohammed

    2012-05-29

    We present first-principles results for Sc-doped ZnOthin films. Neighboring Sc atoms in the surface and/or subsurface layers are found to be coupled ferromagnetically, where only two of the possible configurations induce spin polarization. In the first configuration, the polarization is carried by the Sc d states as expected for transition metaldoping. However, there is a second configuration which is energetically favorable. It is governed by polarized hybrid states of the Zns, O p, and Sc d orbitals. Such highly delocalized states can be an important ingredient for understanding the magnetism of dopedZnOthin films.

  8. Design And Tests Of A Superconducting Magnet With A Cryocooler For The Ion Source Decris-sc

    CERN Document Server

    Datskov, V I; Bekhterev, V V; Bogomolov, S L; Bondarenko, P G; Dmitriev, S N; Drobin, V M; Efremov, A A; Iakovlev, B I; Leporis, M; Malinowski, H; Nikiforov, S A; Paschenko, S V; Seleznev, V V; Shishov, Yu A; Tsvineva, G P; Yazvitsky, N Yu

    2004-01-01

    A superconducting magnet system (SMS) for the multicharged ion source DECRIS-SC was designed and manufactured at the Joint Institute for Nuclear Research. Successful tests of the SMS were conducted in late 2003 - early 2004. The peculiarities of this system are stipulated by using of a cryocooler 1 W in power for the cryostabilization of the magnet, and also by a special configuration of the magnetic field demanded for the source of ions. Four coils ensure induction of a magnetic field on the axes of the source of up to 3T (the mirror ratio of ~6) which considerably extends possibilities of the ion source from the point of view of producing intense highly charged ion beams. The problem of compensating large forces of interaction between the coils and surrounding iron yoke in this magnet has been successfully solved, and a reliable suspension of the magnet in a cryostat realized. For compounding of the windings working in vacuum at indirect cryostabilization prepreg is used. There has been applied a new techno...

  9. Global and local superconductivity in boron-doped granular diamond.

    Science.gov (United States)

    Zhang, Gufei; Turner, Stuart; Ekimov, Evgeny A; Vanacken, Johan; Timmermans, Matias; Samuely, Tomás; Sidorov, Vladimir A; Stishov, Sergei M; Lu, Yinggang; Deloof, Bart; Goderis, Bart; Van Tendeloo, Gustaaf; Van de Vondel, Joris; Moshchalkov, Victor V

    2014-04-02

    Strong granularity-correlated and intragrain modulations of the superconducting order parameter are demonstrated in heavily boron-doped diamond situated not yet in the vicinity of the metal-insulator transition. These modulations at the superconducting state (SC) and at the global normal state (NS) above the resistive superconducting transition, reveal that local Cooper pairing sets in prior to the global phase coherence.

  10. Change of surface critical current in the surface superconductivity and mixed states of superconducting niobium

    Science.gov (United States)

    Aburas, Muhamad; Pautrat, Alain; Bellido, Natalia

    2017-01-01

    A systematic study of irreversible magnetization was performed in bulk niobium after different surface treatments. Starting with smooth surfaces and abrading them, a strong increase of the critical current is observed up to an apparent limiting value. An impressive change of the critical current is also observed in the surface superconductivity (SSC) state, reaching values of the same order of magnitude as in the mixed state. We explain also the observation of strong SSC for magnetic fields perpendicular to large facets in terms of nucleation of superconductivity along bumps of a corrugated surface.

  11. Superconducting cyclotrons at Michigan State University

    Science.gov (United States)

    Blosser, H. G.

    1987-04-01

    This paper describes the status of the three superconducting cyclotrons which are in operation or under construction at the National Superconducting Cyclotron Laboratory. The oldest of these, the K500, has been in operation since September 1982 supporting a national user program in heavy ion nuclear physics. A second large research cyclotron, the K800, is now nearing completion. This cyclotron will accelerate lighter heavy ions to 200 MeV/nuc and heavier particles up to energies given by 1200 Q2/ A MeV/nucleon. The magnet for this cyclotron came into operation in May 1984 and has performed smoothly and reliably in three extended operating periods. At present, K800 construction activity centers on fabrication and installation of the rf system, the extraction system, and the ECR injection line. The third NSCL superconducting cyclotron is a smaller 50 MeV deuteron cyclotron to be used for neutron therapy in the radiation oncology center of a major Detroit hospital (Harper Hospital). Design features of this small, application oriented, cyclotron are described in some detail.

  12. Multistable current states in high-temperature superconducting composites

    Science.gov (United States)

    Romanovskii, V. R.

    2016-09-01

    Conditions for current instabilities that arise in high-temperature superconducting composites with essentially nonlinear dependences of the critical current densities and resistivity on the temperature and magnetic induction have been studied. The analysis has been conducted in terms of zero-dimensional models, which has made it possible to formulate general physical mechanisms behind the formation of currents states in superconducting composites according to the external magnetic field induction, cooling conditions, and the properties of the superconductor and cladding. The possible existence of current and temperature stable steps, as well as stable steps of the electric field strength, in the absence of the superconducting-normal transition, has been demonstrated. Reasons for instabilities under multistable current states have been discussed.

  13. Superconductivity

    CERN Document Server

    Thomas, D B

    1974-01-01

    A short general review is presented of the progress made in applied superconductivity as a result of work performed in connection with the high-energy physics program in Europe. The phenomenon of superconductivity and properties of superconductors of Types I and II are outlined. The main body of the paper deals with the development of niobium-titanium superconducting magnets and of radio-frequency superconducting cavities and accelerating structures. Examples of applications in and for high-energy physics experiments are given, including the large superconducting magnet for the Big European Bubble Chamber, prototype synchrotron magnets for the Super Proton Synchrotron, superconducting d.c. beam line magnets, and superconducting RF cavities for use in various laboratories. (0 refs).

  14. On the control parameters of the quasi-one dimensional superconductivity in Sc{sub 3}CoC{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Eickerling, Georg; Hauf, Christoph; Scheidt, Ernst-Wilhelm; Reichardt, Lena; Schneider, Christian; Scherer, Wolfgang [Institut fuer Physik, Universitaet Augsburg, Universitaetstrasse 1, 86179 Augsburg (Germany); Munoz, Alfonso [Departamento de Fisica Fundamental II, Instituto de Materiales y Nanotecnologia, Universidad de La Laguna, Tenerife (Spain); Lopez-Moreno, Sinhue [Escuela Superior Cd. Sahagun, Universidad Autonoma del Estado de Hidalgo, Carretera Cd. Sahagun-Otumba s/n. 43990, Hidalgo (Mexico); Humberto Romero, Aldo [Physics Department, West Virginia University, Morgantown, West Virginia 26506-6315 (United States); Max Planck Institut fuer Mikrostruktur Physik, Weinberg 2, 06120 Halle (Germany); Porcher, Florence; Andre, Gilles [Laboratoire Leon Brillouin, UMR12 CEA-CNRS, Bat 563 CEA Saclay, 91191 Gif sur Yvette Cedex (France); Poettgen, Rainer [Institut fuer Anorganische und Analytische Chemie, Universitaet Muenster, Corrensstrasse 30, 48149 Muenster (Germany)

    2013-09-15

    Within the series of ternary rare-earth transition metal carbides Sc{sub 3}TC{sub 4} (T = Fe, Co, Ni) only the Co congener displays a structural phase transition at 72 K and an onset of bulk superconductivity at 4.5 K. In this paper we present the results of a detailed analysis of the structural, electronic, and vibrational properties of the low-temperature phase of Sc{sub 3}CoC{sub 4} that represents one of the few well-documented examples of a quasi one-dimensional (1D) superconductor. Variable temperature neutron powder diffraction and low temperature X-ray diffraction experiments were performed in order to confirm the subtle structural distortions during the phase transition. The results of periodic electronic structure calculations indicate, that the structural transition can clearly be identified as a Peierls-type distortion and by a comparison with the isostructural carbide Sc{sub 3}FeC{sub 4} we are able to identify the chemical, electronic, and the vibrational control parameters of the transition. Topological analyses of the electron density distribution and of the valence shell charge concentrations at the cobalt atom finally allow us to directly correlate the changes in the electronic structure due to the Peierls transition in reciprocal space with the according subtle changes in the real space properties of Sc{sub 3}CoC{sub 4}. (Copyright copyright 2013 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  15. Superconductivity and normal state magnetoresistance in superconducting FeSe:Sb

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    We prepared a series of β-FeSe samples with a nominal composition of Fe1.11Se1-xSbx(0≤x≤0.5).The X-ray diffraction,transport and magnetic measurements were performed on these samples to investigate the structure,the superconducting properties and the normal state transport and magnetic properties.Although the X-ray diffraction data suggested that Sb atoms were not incorporated into the β-FeSe phase,the transport data showed observable changes of superconductivity,normal state resistivity and magnetoresistance.This was represented by the increase in the superconducting transition temperature and the upper critical field.Also,for the samples with a low level of Sb content,a clear decrease of the normal state resistivity and a substantial increase of the residual resistance ratio were observed.Furthermore,the samples showed a significant increase of the normal state magnetoresistance that appeared not to follow the Kohler’s rule.The results were discussed in the frame of reduction of excess Fe at interstitial sites of β-FeSe.

  16. Decoherence in Superconducting Qubits from Surface Magnetic States

    Science.gov (United States)

    Hover, David; Sendelbach, Steven; Kittel, Achim; Mueck, Michael; McDermott, Robert

    2008-03-01

    Unpaired spins in amorphous surface oxides can act as a source of decoherence in superconducting and other solid-state qubits. A density of surface spins can give rise to low-frequency magnetic flux noise, which in turn leads to dephasing of the qubit state. In addition, magnetic surface states can couple to high-frequency resonant magnetic fields, and thereby contribute to energy relaxation of the qubit. We present the results of low-frequency measurements of the nonlinear and imaginary spin susceptibility of surface magnetic states in superconducting devices at millikelvin temperatures. In addition, we describe high-frequency magnetic resonance measurements that directly probe the surface spin density of states. We present calculations that connect the measurement results to qubit energy relaxation and dephasing times.

  17. Superconductivity

    Science.gov (United States)

    1989-07-01

    SUPERCONDUCTIVITY HIGH-POWER APPLICATIONS Electric power generation/transmission Energy storage Acoustic projectors Weapon launchers Catapult Ship propulsion • • • Stabilized...temperature superconductive shields could be substantially enhanced by use of high-Tc materials. 27 28 NRAC SUPERCONDUCTIVITY SHIP PROPULSION APPLICATIONS...motor shown in the photograph. As a next step in the evolution of electric-drive ship propulsion technology, DTRC has proposed to scale up the design

  18. The high-temperature modification of ScRuSi - Structure, 29Si and 45Sc solid state NMR spectroscopy

    Science.gov (United States)

    Hoffmann, Rolf-Dieter; Rodewald, Ute Ch.; Haverkamp, Sandra; Benndorf, Christopher; Eckert, Hellmut; Heying, Birgit; Pöttgen, Rainer

    2017-10-01

    A polycrystalline sample of the TiNiSi type low-temperature (LT) modification of ScRuSi was synthesized by arc-melting. Longer annealing in a sealed silica tube (6 weeks at 1270 K) followed by quenching led to the high-temperature (HT) phase. HT-ScRuSi adopts the ZrNiAl structure type: P 6 bar 2 m , a = 688.27(9), c = 336.72(5) pm, wR2 = 0.0861, 260 F2 values, 14 variables. The striking structural building units are regular, tricapped trigonal prisms Si1@Ru3Sc6 and Si2@Ru6Sc3. Both polymorphs have been characterized by 29Si and 45Sc MAS-NMR spectroscopy. The local scandium environments in the two polymorphs are easily distinguished by their electric field gradient tensor values, in agreement with theoretically calculated values.

  19. Population of positive-parity states in Sc53 through one-proton knockout

    Science.gov (United States)

    McDaniel, S.; Gade, A.; Janssens, R. V. F.; Bazin, D.; Brown, B. A.; Campbell, C. M.; Carpenter, M. P.; Cook, J. M.; Deacon, A. N.; Dinca, D.-C.; Freeman, S. J.; Glasmacher, T.; Hansen, P. G.; Kay, B. P.; Mantica, P. F.; Mueller, W. F.; Terry, J. R.; Tostevin, J. A.; Zhu, S.

    2010-02-01

    The one-proton knockout reaction Be9(Ti54,Sc53+γ)X at 72 MeV/nucleon has been measured. The location of the first 3/2- state at 2110(3) keV was confirmed, and new γ-ray transitions were observed at 1111(2), 1273(2), 1539(4), and 2495(5) keV. Large spectroscopic strength to excited states in Sc53 was found and attributed to the knockout of sd-shell protons.

  20. Relaxation of polarized nuclei in superconducting rhodium

    DEFF Research Database (Denmark)

    Knuuttila, T.A.; Tuoriniemi, J.T.; Lefmann, K.

    2000-01-01

    Nuclear spin lattice relaxation rates were measured in normal and superconducting (sc) rhodium with nuclear polarizations up to p = 0.55. This was sufficient to influence the sc state of Rh, whose T, and B-c, are exceptionally low. Because B-c

  1. Probing Andreev bound states in one-atom superconducting contacts

    Energy Technology Data Exchange (ETDEWEB)

    Pothier, Hugues; Janvier, Camille; Tosi, Leandro; Girit, Caglar; Goffman, Marcelo; Esteve, Daniel; Urbina, Cristian [Quantronics Group, SPEC, CEA-Saclay (France)

    2015-07-01

    Superconductors are characterized by a dissipationless current. Since the work of Josephson 50 years ago, it is known that a supercurrent can even flow through tunnel junctions between superconductors. This Josephson effect also occurs through any type of ''weak links'' between superconductors: non-superconducting materials, constrictions,.. A unified understanding of the Josephson effect has emerged from a mesoscopic description of weak links. It relies on the existence of doublets of localized states that have energies below the superconducting gap: the Andreev bound states. I will present experiments performed on the simplest conductor possible, a single-atom contact between superconductors, that illustrate these concepts. The most recent work demonstrates time-domain manipulation of quantum superpositions of Andreev bound states.

  2. Superconducting state parameters of indium-based binary alloys

    Indian Academy of Sciences (India)

    A M Vora; Minal H Patel; P N Gajjar; A R Jani

    2002-05-01

    Our well-recognized pseudopotential is used to investigate the superconducting state parameters viz; electron–phonon coupling strength , Coulomb pseudopotentialµ *, transition temperature c, isotope effective exponent and interaction strength 0 for the In1-Zn and In1-Sn binary alloys. We have incorporated six different types of local field correction functions, proposed by Hartree, Taylor, Vashistha–Singwi, Ichimaru–Utsumi, Farid et al and Sarkar et al to show the effect of exchange and correlation on the aforesaid properties. Very strong influence of the various exchange and correlation functions is concluded from the present study. The comparison with other such theoretical values is encouraging, which confirms the applicability of our model potential in explaining the superconducting state parameters of binary mixture.

  3. Electronic spectrum of the high-temperature superconducting state

    Science.gov (United States)

    Hwu, Y.; Lozzi, L.; Marsi, M.; La Rosa, S.; Winokur, M.; Davis, P.; Onellion, M.; Berger, H.; Gozzo, F.; Levy, F.

    1991-10-01

    Improved experimental conditions permitted an increase in the signal-to-noise ratio of the photoemission spectra for the superconducting state of Bi2Ca2SrCu2O8, taken with high angular and energy resolution. This also revealed a pronounced minimum that separates the two basic features of the spectrum, the narrow quasi-particle excitation peak and the controversial broad band at lower kinetic energies. The minimum is approximately 3-Delta below the Fermi level.

  4. Electronic thermal conductivity in a superconducting vortex state

    Energy Technology Data Exchange (ETDEWEB)

    Adachi, H. [Department of Physics, Okayama University, Tsushima, Okayama 700-8530 (Japan)], E-mail: adachi@itp.phys.ethz.ch; Miranovic, P. [Department of Physics, University of Montenegro, Podgorica 81000 (Montenegro); Ichioka, M.; Machida, K. [Department of Physics, Okayama University, Tsushima, Okayama 700-8530 (Japan)

    2007-10-01

    The longitudinal component of the electronic thermal conductivity {kappa}{sub xx} in a superconducting vortex state is calculated as a function of magnetic field B. Calculations are performed by taking account of the spatial dependence of normal Green's function g, which was neglected in the previous studies using the Brandt-Pesch-Tewordt method. We discuss the possibility of using {kappa}{sub xx}(B) as a probe of the pair potential symmetry.

  5. Electronic thermal conductivity in a superconducting vortex state

    Science.gov (United States)

    Adachi, H.; Miranovic, P.; Ichioka, M.; Machida, K.

    2007-10-01

    The longitudinal component of the electronic thermal conductivity κxx in a superconducting vortex state is calculated as a function of magnetic field B. Calculations are performed by taking account of the spatial dependence of normal Green's function g, which was neglected in the previous studies using the Brandt-Pesch-Tewordt method. We discuss the possibility of using κxx(B) as a probe of the pair potential symmetry.

  6. X-ray photoelectron spectroscopy studies of the electronic structure of superconducting Nb{sub 2}SnC and Nb{sub 2}SC

    Energy Technology Data Exchange (ETDEWEB)

    Romero, M.; Huerta, L.; Akachi, T. [Instituto de Investigaciones en Materiales, Universidad Nacional Autónoma de México, Apartado Postal 70-360, México D.F. 04510 (Mexico); Llamazares, J.L. Sánchez [Instituto Potosino de Investigación Científica y Tecnológica, Camino a la Presa San José 2055, Col. Lomas 4a, San Luis Potosí, S.L.P. 78216 (Mexico); Escamilla, R., E-mail: rauleg@unam.mx [Instituto de Investigaciones en Materiales, Universidad Nacional Autónoma de México, Apartado Postal 70-360, México D.F. 04510 (Mexico)

    2013-12-05

    Highlights: •XPS was used to investigate chemical shift in the Nb{sub 2}SnC and Nb{sub 2}SC compounds. •Valence band of the Nb{sub 2}SnC and Nb{sub 2}SC compounds was studied by XPS. •Positive and negative chemical shift are observed in the Nb{sub 2}SnC and Nb{sub 2}SC. •The charge transfer model can be applicable to the Nb{sub 2}SnC and Nb{sub 2}SC compounds. •The decrease of the N(E{sub F}) of Nb{sub 2}SC respect to Nb{sub 2}SnC explain the decrease of T{sub c}. -- Abstract: X-ray photoelectron spectroscopy (XPS) was used to investigate the binding energies and valence band of the Nb{sub 2}SnC and Nb{sub 2}SC compounds. The Nb 3d{sub 5/2}, Sn 3d{sub 5/2}, S 2p{sub 3/2} and C 1s core levels associated with the chemical states of Nb{sub 2}SnC and Nb{sub 2}SC were identified. The spectra for Nb{sub 2}SnC revealed Nb and Sn oxides on the surface of the sample, mainly Nb{sub 2}O{sub 5} and SnO{sub 2}, while the Nb{sub 2}SC only Nb{sub 2}O{sub 5} oxide. After Ar{sup +} ion etching the intensity of the oxides decreased in both samples. Comparing the Nb 3d, Sn 3d, S 2p and C 1s core levels with metallic Nb, Sn, S and C reference materials, we observed a positive chemical shift for Nb 3d{sub 5/2} and a negative chemical shift for C 1s in both samples. These results suggest that the charge transfer model can be applicable to the Nb{sub 2}SnC and Nb{sub 2}SC compounds. Finally, the decrease in the T{sub c} in the Nb{sub 2}SC compound respect to Nb{sub 2}SnC might be associated to decrease in the density of states N(E{sub F})

  7. Fate of the Superconducting Ground State on the Moyal Plane

    CERN Document Server

    Basu, Prasad; Vaidya, Sachindeo

    2009-01-01

    It is known that Berry curvature of the band structure of certain crystals can lead to effective noncommutativity between spatial coordinates. Using the techniques of twisted quantum field theory, we investigate the question of the formation of a paired state of twisted fermions in such a system. We find that to leading order in the noncommutativity parameter, the gap between the non-interacting ground state and the paired state is {\\it smaller} compared to its commutative counterpart. This suggests that BCS type superconductivity, if present in such systems, is more fragile and easier to disrupt.

  8. Precise Determination of 40Ti Mass by Measuring the 40Sc Isospin Analogue State

    Institute of Scientific and Technical Information of China (English)

    LIU Wei-Ping(柳卫平); E. Roeckl; M. Pfützner; L. Chulkov; A. Piechaczek; R. Raabe; I. Reusen; G. Vancraeynest; A. Wohr; M. Hellstrom2; R. Collatz; J. Benlliure; D. Cortina Gil; F. Farget; H. Grawe; Z. Hu; N. Iwasa

    2001-01-01

    The mass of 40 Ti has been determined by using the isobaric multiplet mass equation method. The experimental data of the 40Tiβ-decay were used to determine the level of the isospin analogue state of 40Sc. The ground-state mass excess and the QEc value for 40 Ti were determined to be -9060 ± 12 keV and 11 466 ± 13keV, respectively.

  9. Superconducting Analogue of the Parafermion Fractional Quantum Hall States

    Directory of Open Access Journals (Sweden)

    Abolhassan Vaezi

    2014-07-01

    Full Text Available Read-Rezayi Z_{k} parafermion wave functions describe ν=2+(k/kM+2 fractional quantum Hall (FQH states. These states support non-Abelian excitations from which protected quantum gates can be designed. However, there is no experimental evidence for these non-Abelian anyons to date. In this paper, we study the ν=2/k FQH-superconductor heterostructure and find the superconducting analogue of the Z_{k} parafermion FQH state. Our main tool is the mapping of the FQH into coupled one-dimensional chains, each with a pair of counterpropagating modes. We show that by inducing intrachain pairing and charge preserving backscattering with identical couplings, the one-dimensional chains flow into gapless Z_{k} parafermions when k<4. By studying the effect of interchain coupling, we show that every parafermion mode becomes massive except for the two outermost ones. Thus, we achieve a fractional topological superconductor whose chiral edge state is described by a Z_{k} parafermion conformal field theory. For instance, we find that a ν=2/3 FQH in proximity to a superconductor produces a Z_{3} parafermion superconducting state. This state is topologically indistinguishable from the non-Abelian part of the ν=12/5 Read-Rezayi state. Both of these systems can host Fibonacci anyons capable of performing universal quantum computation through braiding operations.

  10. Disorder-induced inhomogeneities of the superconducting state close to the superconductor-insulator transition.

    Science.gov (United States)

    Sacépé, B; Chapelier, C; Baturina, T I; Vinokur, V M; Baklanov, M R; Sanquer, M

    2008-10-10

    Scanning tunneling spectroscopy at very low temperatures on homogeneously disordered superconducting titanium nitride thin films reveals strong spatial inhomogeneities of the superconducting gap Delta in the density of states. Upon increasing disorder, we observe suppression of the superconducting critical temperature Tc towards zero, enhancement of spatial fluctuations in Delta, and growth of the Delta/Tc ratio. These findings suggest that local superconductivity survives across the disorder-driven superconductor-insulator transition.

  11. On stability of odd-frequency superconducting state

    Energy Technology Data Exchange (ETDEWEB)

    Lenov, Bmitry [Los Alamos National Laboratory; Martin, Ivar [Los Alamos National Laboratory; Mozyrsky, Dima [Los Alamos National Laboratory

    2008-01-01

    Odd-frequency pairing mechanism has been investigated for several decades. Nevertheless the properties of such superconducting phase as well as its thermodynamic stability have remained unclear. In particular it has been argued by numerous authors that the odd-frequency state is thermodynamically unstable, has an unphysical Meissner effect (at least within the mean-field approximation), and therefore can not exist as a homogeneous phase in equilibrium physical systems. We argue that such a conclusion is incorrect because it relies on an inappropriate assumption that the odd-frequency superconductor can be described by an effective Hamiltonian that breaks the U(l) symmetry. We show that the odd-frequency state can be appropriately formulated within the functional integral representation by using the effective action to describe such a superconducting state within the mean field approximation. We find that the odd-frequency superconductor is thermodynamically stable and exhibits ordinary Meissner effect, and therefore, in principle, it can be realized in equilibrium solid state systems.

  12. Changing the flux flow state in weak pinning superconducting films

    Energy Technology Data Exchange (ETDEWEB)

    Leo, A., E-mail: antoleo@sa.infn.it [Physics Department E.R. Caianiello, University of Salerno, Via Giovanni Paolo II, 132, Stecca 9, I-84084 Fisciano, SA (Italy); CNR-SPIN Salerno, Via Giovanni Paolo II, 132, Stecca 9, I-84084 Fisciano, SA (Italy); Grimaldi, G. [CNR-SPIN Salerno, Via Giovanni Paolo II, 132, Stecca 9, I-84084 Fisciano, SA (Italy); Nigro, A. [Physics Department E.R. Caianiello, University of Salerno, Via Giovanni Paolo II, 132, Stecca 9, I-84084 Fisciano, SA (Italy); CNR-SPIN Salerno, Via Giovanni Paolo II, 132, Stecca 9, I-84084 Fisciano, SA (Italy); Bruno, E.; Priolo, F. [Matis IMM-CNR and Physics-Astronomy Department, Catania University, CT 95123 (Italy); Pace, S. [Physics Department E.R. Caianiello, University of Salerno, Via Giovanni Paolo II, 132, Stecca 9, I-84084 Fisciano, SA (Italy); CNR-SPIN Salerno, Via Giovanni Paolo II, 132, Stecca 9, I-84084 Fisciano, SA (Italy)

    2014-08-15

    Highlights: • We analyzed the effect of light ion irradiation on weak pinning superconductors. • We found the light ion irradiation has a strong impact on current currying stability. • We compared the results to the ones of the case of moderate strong pinning materials. - Abstract: The current carrying dissipative state well above the critical current it is known to be related to the pinning properties of the material and to the microscopic mechanisms of vortex dynamics. Moreover, it has been demonstrated that in low temperature superconducting films exhibiting moderately strong pinning the light ion irradiation has the effect of changing the distribution of the pinning centers without changing their pinning strength and this results into an increase of current stability in the flux flow state. Here we present the results of light ion irradiation on weak pinning superconducting films focusing on the influence of pinning properties of the material in the flux flow state. We realize that the possibility to switch to low dissipations by changing weak pinning is not straightforward.

  13. Generation of Fock states in a superconducting quantum circuit.

    Science.gov (United States)

    Hofheinz, Max; Weig, E M; Ansmann, M; Bialczak, Radoslaw C; Lucero, Erik; Neeley, M; O'Connell, A D; Wang, H; Martinis, John M; Cleland, A N

    2008-07-17

    Spin systems and harmonic oscillators comprise two archetypes in quantum mechanics. The spin-1/2 system, with two quantum energy levels, is essentially the most nonlinear system found in nature, whereas the harmonic oscillator represents the most linear, with an infinite number of evenly spaced quantum levels. A significant difference between these systems is that a two-level spin can be prepared in an arbitrary quantum state using classical excitations, whereas classical excitations applied to an oscillator generate a coherent state, nearly indistinguishable from a classical state. Quantum behaviour in an oscillator is most obvious in Fock states, which are states with specific numbers of energy quanta, but such states are hard to create. Here we demonstrate the controlled generation of multi-photon Fock states in a solid-state system. We use a superconducting phase qubit, which is a close approximation to a two-level spin system, coupled to a microwave resonator, which acts as a harmonic oscillator, to prepare and analyse pure Fock states with up to six photons. We contrast the Fock states with coherent states generated using classical pulses applied directly to the resonator.

  14. Superconductivity in Italian Secondary Schools: the experimentation carried out by Udine University with Supercomet2 (SC2) materials

    Science.gov (United States)

    Michelini, Marisa; Santi, Lorenzo; Viola, Rossana; Corni, Federico

    2008-05-01

    Through a highly interactive tools on CD, which comprises animation and films of demonstrative experiments, and uses modern pedagogical methods, such as collaborative learning and problem solving, the Supercomet 2 Project (SUPERCOnductivity Multimedia Educational Tool phase 2 of the European Union) aims to introduce superconductivity to European high school curriculums. During the first year of the project the following were produced: a CD-ROM with didactic material, a teacher's guide to clarify characteristics and roles of support material (texts, worksheets and computer presentations) and preview didactic courses. During the second year of the project It was: translated the material into the languages of countries participating in the project, experimented the application in high school classes in various parts of Europe, tested the updating course and the teacher's guide with a group of reference teachers. At the end of the first period of experimentation and dissemination were revised and new material was integrated in order to produce a final version at the end of the project. Further integrated proposals have been included with the revised material. In this paper the main characteristics realized during the project will be described.

  15. Unnatural-parity states in {sup 44}{sub 21}Sc{sub 23}

    Energy Technology Data Exchange (ETDEWEB)

    Lach, M.; Styczen, J.; Meczynski, W.; Grebosz, J.; Maj, A.; Zieblinski, M. [Polish Academy of Sciences, Henryk Niewodniczanski Institute of Nuclear Physics, Krakow (Poland); Bednarczyk, P. [Polish Academy of Sciences, Henryk Niewodniczanski Institute of Nuclear Physics, Krakow (Poland); Gesellschaft fuer Schwerionen, Darmstadt (Germany); Bracco, A. [Universita degli Studi di Milano and INFN, Milano (Italy); Merdinger, J.C.; Schulz, N. [Institut de Recherches Subatomiques, Strasbourg (France); Smith, M.B.; Spohr, K.M. [University of Paisley, Paisley, Scotland (United Kingdom)

    2005-07-01

    High-spin states of the {sup 44}Sc nucleus, populated in the 68 MeV {sup 18}O+{sup 30}Si reaction, have been studied in a {gamma}-{gamma}-recoil coincidence experiment. The detailed decay pattern, with various paths and cross-transitions, has been extended up to 9.1 MeV. High-quality DCO and polarization information assign spins and parities for the majority of the observed levels. The negative-parity states are discussed and compared with rotational bands in neighbouring f{sub 7/2}-shell nuclei. (orig.)

  16. Superconductivity and ferromagnetism in nanomaterial NbSe2

    Science.gov (United States)

    Gill, Raminder

    2017-07-01

    Finding of superconductivity (SC) in ultra thin layer of Niobium diselenide (NbSe2) caught the attention of each condensed matter physicist in the era of nanotechnology. The coexistence of SC and magnetism have been a topic of interesting research in solid-state physics since the discovery of superconductivity. Ferromagnetism induced in any compound could destroy superconductivity by disturbing the cooper pairing of electrons of the atoms. The interplay between ferromagnetism (FM) and SC in nanomaterial NBSe2 impressed to study and to know the exact mechanism behind this coexistence which can lead to a very interesting research: superconductivity at room temperature. In this paper, I have theoretically studied the coexistence of SC and FM in NbSe2 and how this material could be useful in finding many high Tc nanomaterials.

  17. Pressure controlled transition into a self-induced topological superconducting surface state

    KAUST Repository

    Zhu, Zhiyong

    2014-02-07

    Ab-initio calculations show a pressure induced trivial-nontrivial-trivial topological phase transition in the normal state of 1T-TiSe2. The pressure range in which the nontrivial phase emerges overlaps with that of the superconducting ground state. Thus, topological superconductivity can be induced in protected surface states by the proximity effect of superconducting bulk states. This kind of self-induced topological surface superconductivity is promising for a realization of Majorana fermions due to the absence of lattice and chemical potential mismatches. For appropriate electron doping, the formation of the topological superconducting surface state in 1T-TiSe 2 becomes accessible to experiments as it can be controlled by pressure.

  18. Superconducting and normal-state properties of novel materials

    Energy Technology Data Exchange (ETDEWEB)

    Crespi, Vincent Henry [Univ. of California, Berkeley, CA (United States)

    1994-09-01

    Interest in solid state physics naturally gravitates towards novel systems such as the copper oxide superconductors or the alkali-doped fullerenes. This paper tackles high temperature superconductivity by extension of the BCS theory for ordinary superconductors, in particular, incorporation of anharmonicity in phonon dynamics and anisotropy in electron-phonon coupling. These refinements can account for many anomalous properties of the cuprates. Phonon anharmonicity is consistent with a small isotope effect at optimal doping and a larger isotope effect in suboptimal systems. Anisotropy in the interaction, a plausible consequence of certain anharmonic models, can circumvent objections to electron-phonon coupling based on transport measurements. Such anisotropy is consistent with gap anisotropy and strong temperature dependence of Hall coefficient. In contrast to cuprates, the doped fullerenes appear understandable within the standard model of single electron band theory and BCS theory. Microscopic parameters derivable from transport and critical field measurements yield a self-consistent picture of a disordered Type-2 BCS superconductor. Isotope effects imply that superconductivity is mediated by carbon phonons opposed to alkali atom vibrations. The novel properties of the fullerenes are generally traceable to their microscopic heterogeneity, being a collection of tightly bound but weakly overlapping molecules. Separation of electronic regimes into weak intermolecular overlap and strong carbon-carbon on-ball bonds yields a superconductor with both a large density of states and a high phonon frequency, properties consistent with a relatively high {Tc}. Disordered nature of intermolecular overlap produces a large residual resistivity and a universal dependence to the Hall coefficient. This disorder is also consistent with the anomalously large carbon isotope effect for heterogeneous isotopic substitution.

  19. RF power upgrade at the superconducting 1.3 GHz CW LINAC “ELBE” with solid state amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Büttig, Hartmut, E-mail: buettig@hzdr.de [Radiation Source ELBE, Helmholtz Zentrum Dresden-Rossendorf (Germany); Arnold, A.; Büchner, A.; Justus, M.; Kuntsch, M.; Lehnert, U.; Michel, P.; Schurig, R.; Staats, G.; Teichert, J. [Radiation Source ELBE, Helmholtz Zentrum Dresden-Rossendorf (Germany)

    2013-03-11

    The RF power for the superconducting 1.3 GHz CW LINAC “ELBE” has been doubled from less than 10 kW to 20 kW per cavity. In January 2012 the four 10 kW klystrons used to drive the four superconducting cavities of the LINAC have been replaced by pairs of 10 kW solid state power amplifiers (SSPA). ELBE is now worldwide the first 1.3 GHz CW LINAC equipped with solid state RF power amplifiers. This technical note details on this project. -- Highlights: ► We report the first installation of 10 kW solid state RF-amplifiers at 1.3 GHz CW LINAC. ► The sc. cavities of “ELBE” are now driven by a pair of 10 kW solid state amplifiers (SSPA). ► The RF-power upgrade allows doubling the electron beam current (CW). ► Advantages of the new RF system are high reliability, easy service and lower costs.

  20. Evidence for an Anti-polar Phase in Normal and Superconducting States in all HTSC

    OpenAIRE

    2010-01-01

    It is strongly argued that high temperature superconductors (HTSC) exhibit an anti-polar phase with a long range order in both normal and superconducting states. This anti-polar phase is directly related to the onset of superconductivity in all HTSC and it is responsible for strong coupling and of two dimensionality aspect of HTSC, as it is described below.

  1. Theoretical determination of lifetimes of metastable states in Sc III and Y III

    CERN Document Server

    Sahoo, B K; Das, B P; Chaudhuri, R K; Mukherjee, D

    2007-01-01

    Lifetimes of the first two metastable states in Sc^{2+} and Y^{2+} are determined using the relativistic coupled-cluster theory. There is a considerable interest in studying the electron correlation effects in these ions as though their electronic configurations are similar to the neutral alkali atoms, their structures are very different from the latter. We have made a comparative study of the correlation trends between the above doubly ionized systems with their corresponding neutral and singly ionized iso-electronic systems. The lifetimes of the excited states of these ions are very important in the field of astrophysics, especially for the study of post-main sequence evolution of the cool giant stars.

  2. Quantum State Transmission in a Superconducting Charge Qubit-Atom Hybrid.

    Science.gov (United States)

    Yu, Deshui; Valado, María Martínez; Hufnagel, Christoph; Kwek, Leong Chuan; Amico, Luigi; Dumke, Rainer

    2016-12-06

    Hybrids consisting of macroscopic superconducting circuits and microscopic components, such as atoms and spins, have the potential of transmitting an arbitrary state between different quantum species, leading to the prospective of high-speed operation and long-time storage of quantum information. Here we propose a novel hybrid structure, where a neutral-atom qubit directly interfaces with a superconducting charge qubit, to implement the qubit-state transmission. The highly-excited Rydberg atom located inside the gate capacitor strongly affects the behavior of Cooper pairs in the box while the atom in the ground state hardly interferes with the superconducting device. In addition, the DC Stark shift of the atomic states significantly depends on the charge-qubit states. By means of the standard spectroscopic techniques and sweeping the gate voltage bias, we show how to transfer an arbitrary quantum state from the superconducting device to the atom and vice versa.

  3. Quantum State Transmission in a Superconducting Charge Qubit-Atom Hybrid

    CERN Document Server

    Yu, Deshui; Hufnagel, Christoph; Kwek, Leong Chuan; Amico, Luigi; Dumke, Rainer

    2016-01-01

    Hybrids consisting of macroscopic superconducting circuits and microscopic components, such as atoms and spins, have the potential of transmitting an arbitrary state between different quantum species, leading to the prospective of high-speed operation and long-time storage of quantum information. Here we propose a novel hybrid structure, where a neutral-atom qubit directly interfaces with a superconducting charge qubit, to implement the qubit-state transmission. The highly-excited Rydberg atom located inside the gate capacitor strongly affects the behavior of Cooper pairs in the box while the atom in the ground state hardly interferes with the superconducting device. In addition, the DC Stark shift of the atomic states significantly depends on the charge-qubit states. By means of the standard spectroscopic techniques and sweeping the gate voltage bias, we show how to transfer an arbitrary quantum state from the superconducting device to the atom and vice versa.

  4. Possible Fulde-Ferrell-Larkin-Ovchinnikov inhomogeneous superconducting state in CeCoIn5

    Indian Academy of Sciences (India)

    R Movshovich; A Bianchi; C Capan; P G Pagliuso; J L Sarrao

    2006-01-01

    We present specific heat and thermal conductivity of the heavy fermion superconductor CeCoIn5 in the vicinity of the superconducting critical field c2, measured with magnetic field in the plane of this quasi-2D compound and at temperatures down to 50 mK. The superconducting phase diagram and the first order nature of the superconducting phase transition at high fields close to a critical field c2 indicate the importance of the Pauli limiting effect in CeCoIn5. In the same range of magnetic field we observe a second specific heat anomaly within the superconducting state, and interpret it as a signature of a Fulde-Ferrell-Larkin-Ovchinnikov (FFLO) inhomogeneous superconducting state. In addition, the thermal conductivity data as a function of field display a kink at a field k below the superconducting critical field, which closely coincides with the low temperature anomaly in specific heat tentatively identified with the appearance of the FFLO superconducting state. The enhancement of thermal conductivity within the FFLO state calls for further theoretical investigations of the real space structure of the order parameter (and in particular, the structure of vortices) and of the thermal transport within the inhomogeneous FFLO state.

  5. Topological states in normal and superconducting p-wave chains

    Energy Technology Data Exchange (ETDEWEB)

    Continentino, Mucio A. [Centro Brasileiro de Pesquisas Físicas, Rua Dr. Xavier Sigaud, 150, Urca 22290-180, Rio de Janeiro, RJ (Brazil); Caldas, Heron [Departamento de Ciências Naturais, Universidade Federal de São João Del Rei, 36301-000, São João Del Rei, MG (Brazil); Nozadze, David; Trivedi, Nandini [Department of Physics, The Ohio State University, Columbus, OH 43210 (United States)

    2014-10-03

    We study a two-band model of fermions in a 1d chain with an antisymmetric hybridization that breaks inversion symmetry. We find that for certain values of its parameters, the sp-chain maps formally into a p-wave superconducting chain, the archetypical 1d system exhibiting Majorana fermions. The eigenspectra, including the existence of zero energy modes in the topological phase, agree for both models. The end states too share several similarities, such as the behavior of the localization length, the non-trivial topological index and robustness to disorder. However, we show that the excitations in the ends of a finite sp chain are conventional fermions though endowed with protected topological properties. Our results are obtained by a scattering approach in a semi-infinite chain with an edge defect treated within the T-matrix approximation. We present exact numerical diagonalization results that extend our analysis to arbitrary parameters and to disordered systems. - Highlights: • Antisymmetric hybridization. • Topological insulator. • Quantum phase transition. • Topological non-trivial phase. • Majorana fermions.

  6. Advanced Control Scenario of High-Performance Steady-State Operation for JT-60 Superconducting Tokamak

    Institute of Scientific and Technical Information of China (English)

    H. Tamai; Y. Kamada; A. Sakasai; S. Ishida; G. Kurita; M. Matsukawa; K. Urata; S. Sakurai; K. Tsuchiya; A. Morioka; Y. M. Miura; K. Kizu

    2004-01-01

    Plasma control on high-βN steady-state operation for JT-60 superconducting modification is discussed. Accessibility to high-βN exceeding the free-boundary limit is investigated with the stabilising wall of reduced-activated ferritic steel and the active feedback control of the in-vessel non-axisymmetric field coils. Taking the merit of superconducting magnet, advanced plasma control for steady-state high performance operation could be expected.

  7. Macroscopic states induced in superconducting media by a transport current under flux creep

    Science.gov (United States)

    Romanovskii, V. R.

    2016-08-01

    The physical features of the formation of macroscopic states of superconducting composites consisting of a superconductor and a coating under flux creep are discussed. It is demonstrated that there exist characteristic electric field strengths depending on the properties of the superconductor, cooling conditions, and characteristics of the stabilizing coating, which affect the intensity of the E-I characteristics of the superconducting composites. Analysis shows that the measurements of the critical properties of superconductors can be accompanied by a nonuniform electric field distribution over the composite cross section and high stable superheating of the superconductor, which do not lead to superconductivity breaking.

  8. Spin-rotation symmetry breaking in the superconducting state of CuxBi2Se3

    Science.gov (United States)

    Matano, K.; Kriener, M.; Segawa, K.; Ando, Y.; Zheng, Guo-Qing

    2016-09-01

    Spontaneous symmetry breaking is an important concept for understanding physics ranging from the elementary particles to states of matter. For example, the superconducting state breaks global gauge symmetry, and unconventional superconductors can break further symmetries. In particular, spin-rotational symmetry is expected to be broken in spin-triplet superconductors. However, experimental evidence for such symmetry breaking has not been conclusively obtained so far in any candidate compounds. Here, using 77Se nuclear magnetic resonance measurements, we show that spin-rotation symmetry is spontaneously broken in the hexagonal plane of the electron-doped topological insulator Cu0.3Bi2Se3 below the superconducting transition temperature Tc = 3.4 K. Our results not only establish spin-triplet superconductivity in this compound, but may also serve to lay a foundation for the research of topological superconductivity.

  9. Absence of State Collapse and Revival in a Superconducting Charge Qubit

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The Hamiltonian of a superconducting charge qubit with a configuration of dc SQUID contains an interaction between the LC oscillator part and charge qubit. This interaction may leads to quantum state collapse and revival which degrades the charge qubits and leads to serious decoherence. An analysis shows that the existing charge qubit parameters do not lead to this phenomenon, which is very good for the superconducting charge qubit.

  10. Fast preparation of W states with superconducting quantum interference devices by using dressed states

    Science.gov (United States)

    Kang, Yi-Hao; Chen, Ye-Hong; Shi, Zhi-Cheng; Song, Jie; Xia, Yan

    2016-11-01

    In this paper, we propose a protocol to prepare W states with superconducting quantum interference devices by using dressed states. Through choosing a set of dressed states suitably, the protocol can be used to accelerate the adiabatic passages while additional couplings are unnecessary. Moreover, we can optimize the evolution of the system with the restraint to the populations of the intermediate states by choosing suitable control parameters. Numerical simulations show that the protocol is robust against the parameter variations and decoherence mechanisms. Furthermore, the protocol is faster and more robust against the dephasing compared with that by the adiabatic passages. As for the Rabi frequencies of pulses designed by the method, they can be expressed by the linear superpositions of Gaussian functions, which does not increase difficulty in the experiments. In addition, the protocol could be controlled and manipulated easily in experiments with a circuit quantum electrodynamics system.

  11. Magnetic-field-induced superconducting state in Zn nanowires driven in the normal state by an electric current.

    Science.gov (United States)

    Chen, Yu; Snyder, S D; Goldman, A M

    2009-09-18

    Four-terminal resistance measurements have been carried out on Zn nanowires formed using electron-beam lithography. When driven resistive by current, these wires reenter the superconducting state upon application of small magnetic fields. The data are qualitatively different from those of previous experiments on superconducting nanowires, which revealed either negative magnetoresistance near T_{c} or high-magnetic-field-enhanced critical currents.

  12. Superconducting doped topological materials

    Energy Technology Data Exchange (ETDEWEB)

    Sasaki, Satoshi, E-mail: sasaki@sanken.osaka-u.ac.jp [Institute of Scientific and Industrial Research, Osaka University, Ibaraki, Osaka 567-0047 (Japan); Mizushima, Takeshi, E-mail: mizushima@mp.es.osaka-u.ac.jp [Department of Materials Engineering Science, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Department of Physics, Okayama University, Okayama 700-8530 (Japan)

    2015-07-15

    Highlights: • Studies on both normal- and SC-state properties of doped topological materials. • Odd-parity pairing systems with the time-reversal-invariance. • Robust superconductivity in the presence of nonmagnetic impurity scattering. • We propose experiments to identify the existence of Majorana fermions in these SCs. - Abstract: Recently, the search for Majorana fermions (MFs) has become one of the most important and exciting issues in condensed matter physics since such an exotic quasiparticle is expected to potentially give rise to unprecedented quantum phenomena whose functional properties will be used to develop future quantum technology. Theoretically, the MFs may reside in various types of topological superconductor materials that is characterized by the topologically protected gapless surface state which are essentially an Andreev bound state. Superconducting doped topological insulators and topological crystalline insulators are promising candidates to harbor the MFs. In this review, we discuss recent progress and understanding on the research of MFs based on time-reversal-invariant superconducting topological materials to deepen our understanding and have a better outlook on both the search for and realization of MFs in these systems. We also discuss some advantages of these bulk systems to realize MFs including remarkable superconducting robustness against nonmagnetic impurities.

  13. State-of-the-art of superconducting magnets

    Energy Technology Data Exchange (ETDEWEB)

    Lubell, M. S.

    1972-09-01

    A survey of the most recent developments in superconducting magnet materials is presented, and complete data on the upper critical field and transition temperature for the NbTi alloy system are given. The overall critical current density of compound conductors is shown for both low and high field commercial superconductors. A tabulation is given of high field and large bore solenoids, comparing design and test data. Comparative data are also given for some nonsolenoidal coils, and details are listed for the systems under construction or design. A criterion is derived for the stable current density attainable in extremely large magnet systems such as those envisioned for fusion reactors: j ∝ (stored energy)-1/6 . The review concludes with summaries concerning the structural materials useful in large magnets and the effects of radiation on superconducting magnets.

  14. Identifying the chiral d-wave superconductivity by Josephson φ0-states

    Science.gov (United States)

    Liu, Jun-Feng; Xu, Yong; Wang, Jun

    2017-01-01

    We propose the Josephson junctions linked by a normal metal between a d + id superconductor and another d + id superconductor, a d-wave superconductor, or a s-wave superconductor for identifying the chiral d + id superconductivity. The time-reversal breaking in the chiral d-wave superconducting state is shown to result in a Josephson φ0-junction state where the current-phase relation is shifted by a phase φ0 from the sinusoidal relation, other than 0 and π. The ground-state phase difference φ0 and the critical current can be used to definitely confirm and read the information about the d + id superconductivity. A smooth evolution from conventional 0-π transitions to tunable φ0-states can be observed by changing the relative magnitude of two types of d-wave components in the d + id pairing. On the other hand, the Josephson junction involving the d + id superconductor is also the simplest model to realize a φ0- junction, which is useful in superconducting electronics and superconducting quantum computation. PMID:28266582

  15. Generation of Entangled States of Multiple Superconducting Quantum Interference Devices in Cavity

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    We propose a scheme for generating the maximally entangled states of many superconducting quantum interference devices (SQUIDs) by using a quantized cavity field and classicalmicrowave pulses in cavity. In the scheme,the maximally entangled states can be generated without requiring the measurement and individual addressing of the SQUIDs.

  16. Microtraps for neutral atoms using superconducting structures in the critical state

    CERN Document Server

    Emmert, Andreas; Brune, Michel; Raimond, Jean-Michel; Haroche, Serge; Nogues, Gilles

    2009-01-01

    Recently demonstrated superconducting atom-chips provide a platform for trapping atoms and coupling them to solid-state quantum systems. Controlling these devices requires a full understanding of the supercurrent distribution in the trapping structures. For type-II superconductors, this distribution is hysteretic in the critical state due to the partial penetration of the magnetic field in the thin superconducting film through pinned vortices. We report here an experimental observation of this memory effect. Our results are in good agreement with the redictions of the Bean model of the critical state without adjustable parameters. The memory effect allows to write and store permanent currents in micron-sized superconducting structures and paves the way towards new types of engineered trapping potentials.

  17. Microtraps for neutral atoms using superconducting structures in the critical state

    Science.gov (United States)

    Emmert, A.; Lupaşcu, A.; Brune, M.; Raimond, J.-M.; Haroche, S.; Nogues, G.

    2009-12-01

    Recently demonstrated superconducting atom chips provide a platform for trapping atoms and coupling them to solid-state quantum systems. Controlling these devices requires a full understanding of the supercurrent distribution in the trapping structures. For type-II superconductors, this distribution is hysteretic in the critical state due to the partial penetration of the magnetic field in the thin superconducting film through pinned vortices. We report here an experimental observation of this memory effect. Our results are in good agreement with the predictions of the Bean model of the critical state without adjustable parameters. The memory effect allows to write and store permanent currents in micron-sized superconducting structures and paves the way toward engineered trapping potentials.

  18. Towards realizing a quantum memory for a superconducting qubit: storage and retrieval of quantum states.

    Science.gov (United States)

    Saito, Shiro; Zhu, Xiaobo; Amsüss, Robert; Matsuzaki, Yuichiro; Kakuyanagi, Kosuke; Shimo-Oka, Takaaki; Mizuochi, Norikazu; Nemoto, Kae; Munro, William J; Semba, Kouichi

    2013-09-06

    We have built a hybrid system composed of a superconducting flux qubit (the processor) and an ensemble of nitrogen-vacancy centers in diamond (the memory) that can be directly coupled to one another, and demonstrated how information can be transferred from the flux qubit to the memory, stored, and subsequently retrieved. We have established the coherence properties of the memory and succeeded in creating an entangled state between the processor and memory, demonstrating how the entangled state's coherence is preserved. Our results are a significant step towards using an electron spin ensemble as a quantum memory for superconducting qubits.

  19. Academic Training - Pulsed SC Magnets

    CERN Multimedia

    Françoise Benz

    2006-01-01

    2005-2006 ACADEMIC TRAINING PROGRAMME LECTURE SERIES 2, 3, June 29, 30, 31 May, 1, 2 June 11:00-12:00 - Auditorium, bldg 500 Pulsed SC Magnets by M. Wilson Lecture 1. Introduction to Superconducting Materials Type 1,2 and high temperature superconductors; their critical temperature, field & current density. Persistent screening currents and the critical state model. Lecture 2. Magnetization and AC Loss How screening currents cause irreversible magnetization and hysteresis loops. Field errors caused by screening currents. Flux jumping. The general formulation of ac loss in terms of magnetization. AC losses caused by screening currents. Lecture 3. Twisted Wires and Cables Filamentary composite wires and the losses caused by coupling currents between filaments, the need for twisting. Why we need cables and how the coupling currents in cables contribute more ac loss. Field errors caused by coupling currents. Lecture 4. AC Losses in Magnets, Cooling and Measurement Summary of all loss mech...

  20. Localized electronic states and the superconducting gap in Bi 2Sr 2CaCu 2O 8+y

    Science.gov (United States)

    Quitmann, C.; Ma, Jian; Kelley, R. J.; Margaritondo, G.; Onellion, M.

    1994-12-01

    Angle-resolved photoemission data taken on some Bi 2Sr 2CaCu 2O 8+y single crystals exhibit the formation of a superconducting gap in the absence of a quasiparticle normal state band. We observe the opening of the superconducting gap in the same regions of the Brillouin zone for which it is observed for samples that do exhibit a quasiparticle normal state. The absence of a dispersing quasiparticle normal state indicates that the normal state electronic states in these samples are almost localized in real space. Our data suggest that two types of carriers can coexist, and contribute to forming a superconducting gap, in these materials.

  1. Effects of disorder on coexistence and competition between superconducting and insulating states

    NARCIS (Netherlands)

    Mostovoy, MV; Marchetti, FM; Simons, BD; Littlewood, PB

    2005-01-01

    We study effects of nonmagnetic impurities on the competition between the superconducting and electron-hole pairing. We show that disorder can result in coexistence of these two types of ordering in a uniform state, even when in clean materials they are mutually exclusive.

  2. Superconducting state of metallic nanoclusters and Josephson tunneling networks

    Energy Technology Data Exchange (ETDEWEB)

    Kresin, Vladimir, E-mail: vzkresin@lbl.gov [Lawrence Berkeley Laboratory, University of California at Berkeley, CA 94720 (United States); Ovchinnikov, Yurii [L. Landau Institute for Theoretical Physics, RAN, Moscow 117334 (Russian Federation)

    2014-11-15

    Highlights: • Specific nanoclusters form a new family of high T{sub c} superconductors. • For an isolated cluster the pairing affects its energy spectrum. • Nano-based Josephson tunneling network can transfer a macroscopic superconducting current at high temperatures. • A.c. tunneling network can be synchronized and radiates as a single junction. - Abstract: Metallic nanoclusters form a new family of high temperature superconductors. In principle, the value of T{sub c} can be raised up to room temperature. In addition, one can observe the Josephson tunneling between two clusters. One can build the nanocluster-based tunneling network capable to transfer a macroscopic supercurrent at high temperatures. Such a network can be synchronized and radiate as single junction.

  3. Mapping Dimensionality and Directionality of Electronic Behavior in CeCoIn5: the Superconducting State

    Science.gov (United States)

    Feldman, Benjamin E.; Gyenis, Andras; Randeria, Mallika T.; Peterson, Gabriel A.; Aynajian, Pegor; Bauer, Eric D.; Yazdani, Ali

    Unconventional superconductors often exhibit anisotropic physical properties that arise from the directional dependence of their order parameters. A prime example is CeCoIn5, a heavy fermion d-wave superconductor with a rich low-temperature phase diagram consisting of competing and coexisting magnetic and superconducting orders. Here we present dilution refrigerator scanning tunneling microscopy of CeCoIn5 cleaved perpendicular to its basal plane. We study superconductivity on the (100) surface, whose normal vector points along the antinode of the superconducting energy gap. The gap magnitude is similar to that observed in the basal plane, with a key difference: it does not exhibit any suppression near step edges. Application of a magnetic field along the [100] direction leads to the formation of anisotropic vortices, and the vortex lattice undergoes a transition at high field before the superconducting state gives way to a pseudogap phase. Our measurements illustrate the directional dependence of the superconducting properties in CeCoIn5, and more generally, demonstrate the utility of imaging d-wave superconductors along their nodal and antinodal directions.

  4. Symmetry phase diagrams of the superconducting ground states induced by correlated hoppings interactions

    Energy Technology Data Exchange (ETDEWEB)

    Samuel Millan, J. [Facultad de Ingenieria, Universidad Autonoma del Carmen, Cd. del Carmen, C.P. 24180, Campeche (Mexico); Perez, Luis A. [Instituto de Fisica, Universidad Nacional Autonoma de Mexico (UNAM), A.P. 20-364, C.P. 01000, Mexico D.F. (Mexico)], E-mail: lperez@fisica.unam.mx; Shelomov, Evgen [Facultad de Ingenieria, Universidad Autonoma del Carmen, Cd. del Carmen, C.P. 24180, Campeche (Mexico); Wang, Chumin [Instituto de Investigaciones en Materiales, UNAM, A.P. 70-360, C.P. 04510, Mexico D.F. (Mexico)

    2007-09-01

    The formation of p- and d-wave superconducting ground states on a square lattice is studied within the BCS formalism and a generalized Hubbard model, in which a second-neighbor correlated hopping ({delta}t{sub 3}) is included in addition to the on site and nearest neighbor repulsions. The triplet superconductivity is obtained when a small distortion of the right angles in the square lattice is introduced. This distortion can be characterized by the difference between the values of {delta}t{sub 3}{sup {+-}} in the x {+-} y directions, i.e., {delta}{sub 3}=({delta}t{sub 3}{sup +}-{delta}t{sub 3}{sup -})/2. The phase diagram is analyzed in the space of the electron density (n) and {delta}{sub 3}. The results show that the p- and d-channel superconductivities are respectively enhanced in the low and high electron density regions.

  5. Monitoring of Spectral Map Changes from Normal State to Superconducting State in High-TC Superconductor Films Using Raman Imaging

    Directory of Open Access Journals (Sweden)

    J. L. González-Solís

    2015-01-01

    Full Text Available We have explored the chemical structure of TlBa2Ca2Cu3O9 high-TC superconductor films with Tl-1223 phase to monitor spectral map changes from normal state to superconducting state using the technique of Raman imaging. Raman images were performed for 12 different temperatures in the 77–293 K range. At room temperature, the Raman images were characterized by a single color but as the temperature dropped a new color appeared and when the temperature of 77 K is reached and the superconducting state is assured, the Raman images were characterized by the red, green, and blue colors. Our study could suggest that the superconducting state emerged around 133 K, in full agreement with those reported in the literature. A cross-checking was done applying principal component analysis (PCA to other sets of Raman spectra of our films measured at different temperatures. PCA result showed that the spectra can be grouped into two temperature ranges, one in the 293–153 K range and the other in the 133–77 K range suggesting that transition to the superconducting state occurred at some temperature around 133 K. This is the first report of preliminary results evaluating the usefulness of Raman imaging in determination of transition temperature of superconductor films.

  6. Novel Materials & Multi-scale Analysis of the Superconducting State in Iron Based Superconductors

    Science.gov (United States)

    Sefat, Athena S.

    2015-03-01

    The understanding of the fundamental nature of a material's superconducting state is of crucial importance, if superconductors are to fulfill their promise for widespread use in energy-related needs. Our research applies multi-scale characterization techniques to study and probe the nuclear, electronic, and magnetic details of single crystals. The importance of such broad investigative work is demonstrated in our recent publication on praseodymium-doped BaFe2As2 for which non-uniform local distortions through isolated Pr atoms do not provide percolation path superconductivity. For CaFe2As2, it is found that large Fermi-surface reconstruction in the non-magnetic phase causes a non-superconducting ground state, while different crystalline domains with varying lattice parameters are identified. For Cu-doped BaFe2As2 it is found that orthorhombic distortion below Ts leads to magnetically ordered state of FeAs planes, hence no superconductivity. Studies of this nature can yield groundbreaking results by demonstrating that many parameters can compete in a bulk material and even be spatially and electronically non-homogenous on nanometers. This work was primarily supported by the U. S. Department of Energy, Office of Science, Basic Energy Sciences, Materials Science and Engineering Division.

  7. Progress report for DOE Award Number SC0008482, Colorado State University

    Energy Technology Data Exchange (ETDEWEB)

    Field, Stuart [Colorado State Univ., Fort Collins, CO (United States)

    2017-01-26

    In this project we proposed to study the real-time dynamics of driven superconducting vortices moving in a periodic potential, using the technique of high-bandwidth scanning Hall probe microscopy to understand the local spatial and temporal characteristics of vortex motion in periodic potentials. During the term of the project we made significant progress towards these goals, but the overall project goal was unfortunately not met. Nonetheless, certain intermediate goals were met, and we believe that even though the project has officially ended we will be able to finish the proposed experiments.

  8. Distributed quantum computation with superconducting qubit via LC circuit using dressed states

    Institute of Scientific and Technical Information of China (English)

    Wu Chao; Fang Mao-Fa; Xiao Xing; Li Yan-Ling; Cao Shuai

    2011-01-01

    A scheme is proposed where two superconducting qubits driven by a classical field interacting separately with two distant LC circuits connected by another LC circuit through mutual inductance, are used for implementing quantum gates. By using dressed states, quantum state transfer and quantum entangling gate can be implemented. With the help of the time-dependent electromagnetic field, any two dressed qubits can be selectively coupled to the data bus (the last LC circuit), then quantum state can be transferred from one dressed qubit to another and multi-mode entangled state can also be formed. As a result, the promising perspectives for quantum information processing of mesoscopic superconducting qubits are obtained and the distributed and scalable quantum computation can be implemented in this scheme.

  9. Raman scattering from a superconductivity-induced bound state in MgB2.

    Science.gov (United States)

    Zeyher, R

    2003-03-14

    It is shown that the sharp peak in the E(2g) Raman spectrum of superconducting MgB2 is due to a bound state caused by the electron-phonon coupling. Our theory explains why this peak appears only in the spectra with E(2g) symmetry and only in the sigma but not the pi bands. The properties of the bound state and the Raman spectrum are investigated, also in the presence of impurity scattering.

  10. Potential benefits of superconductivity to transportation in the United States

    Science.gov (United States)

    Rote, Donald M.; Johnson, Larry R.

    Research in U.S. transportation applications of superconductors is strongly motivated by a number of potential national benefits. These include the reduction of dependence on petroleum-based fuels, energy savings, substantially reduced air and noise pollution, increased customer convenience, and reduced maintenance costs. Current transportation technology offers little flexibility to switch to alternative fuels, and efforts to achieve the other benefits are confounded by growing congestion at airports and on urban roadways. A program has been undertaken to identify possible applications of the emerging superconducting applications to transportation and to evaluate potential national benefits. The current phase of the program will select the most promising applications for a more detailed subsequent study. Transportation modes being examined include highway and industrial vehicles, as well as rail, sea, air transport and pipelines. Three strategies are being considered: (1) replacing present components with those employing superconductors, (2) substituting new combinations of components or systems for present systems, and (3) developing completely new technologies. Distinctions are made between low-, medium-, and near-room-temperature superconductors. The most promising applications include magnetically levitated passenger and freight vehicles; replacement of drive systems in locomotives, self-propelled rail cars, and ships; and electric vehicles inductively coupled to electrified roadways.

  11. Superconducting accelerating structures for very low velocity ion beams

    Directory of Open Access Journals (Sweden)

    J. Xu

    2008-03-01

    Full Text Available This paper presents designs for four types of very-low-velocity superconducting (SC accelerating cavity capable of providing several MV of accelerating potential per cavity, and suitable for particle velocities in the range 0.006Superconducting TEM-class cavities have been widely applied to cw acceleration of ion beams. SC linacs can be formed as an array of independently phased cavities, enabling a variable velocity profile to maximize the output energy for each of a number of different ion species. Several laboratories in the U.S. and Europe are planning exotic beam facilities based on SC linacs. The cavity designs presented here are intended for the front end of such linacs, particularly for the postacceleration of rare isotopes of low charge state. Several types of SC cavities have been developed recently to cover particle velocities above 0.06c. Superconducting four-gap quarter-wave resonators for velocities 0.008<β=v/c<0.05 were developed about two decades ago and have been successfully operated at the ATLAS SC linac at Argonne National Laboratory. Since that time, progress in simulation tools, cavity fabrication, and processing have increased SC cavity gradients by a factor of 3–4. This paper applies these tools to optimize the design of a four-gap quarter-wave resonator for exotic beam facilities and other low-velocity applications.

  12. Photoemission studies of the normal and high-temperature superconducting states

    Science.gov (United States)

    Margaritondo, G.; Onellion, M.

    1996-02-01

    Photoemission has become a most powerful electronic probe of high-TC superconductors. The main present emphasis is on the BCSCO-2212 gap symmetry. After much controversy, a consensus emerges: (1) no symmetric s-waves; (2) the symmetry depends on temperature and doping; (3) the optimal doping data are consistent with dx2-y2 waves; (4) for other dopings, the symmetry is consistent with mixed s and d-waves. The data, though, cannot rule out other hypotheses, specifically asymmetric s-waves. Photoemission also revealed unexpected phenomena, notably for Co-doped BCSCO-2212. By fine-tuning the doping one can replace the room temperature itinerant electronic states with localized states; Tc changes too, but there is still high-TC superconductivity. This indicates that Anderson localization and high-TC superconductivity can coexist.

  13. Superconductivity in the charge-density-wave state of the organic metal α- (BEDT-TTF)2 KHg (SCN)4

    Science.gov (United States)

    Andres, D.; Kartsovnik, M. V.; Biberacher, W.; Neumaier, K.; Schuberth, E.; Müller, H.

    2005-11-01

    The superconducting transition in the layered organic compound α-(BEDT-TTF)2KHg(SCN)4 has been studied in the two hydrostatic pressure regimes where a charge-density wave is either present or completely suppressed. Within the charge-density-wave state the experimental results reveal a network of weakly coupled superconducting regions. This is especially seen in a strong enhancement of the measured critical field and the corresponding positive curvature of its temperature dependence. Further, it is shown that on lowering the pressure into the density-wave state traces of a superconducting phase already start to appear at a much higher temperature.

  14. Emergence of superconductivity from the dynamically heterogeneous insulating state in La(2-x)Sr(x)CuO4.

    Science.gov (United States)

    Shi, Xiaoyan; Logvenov, G; Bollinger, A T; Božović, I; Panagopoulos, C; Popović, Dragana

    2013-01-01

    A central issue for copper oxides is the nature of the insulating ground state at low carrier densities and the emergence of high-temperature superconductivity from that state with doping. Even though this superconductor-insulator transition (SIT) is a zero-temperature transition, measurements are not usually carried out at low temperatures. Here we use magnetoresistance to probe both the insulating state at very low temperatures and the presence of superconducting fluctuations in La(2-x)Sr(x)CuO(4) films, for doping levels that range from the insulator to the superconductor (x  =  0.03-0.08). We observe that the charge glass behaviour, characteristic of the insulating state, is suppressed with doping, but it coexists with superconducting fluctuations that emerge already on the insulating side of the SIT. The unexpected quenching of the superconducting fluctuations by the competing charge order at low temperatures provides a new perspective on the mechanism for the SIT.

  15. Generation of an Entangled State of Two Three-Level Superconducting Quantum Interference Devices in Cavity

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    We propose a scheme for generating a maximally entangled state of two three-level superconducting quantum interference devices (SQUIDs) by using a quantized cavity field and classical microwave pluses in cavity. In this scheme, no quantum information will be transferred from the SQUIDs to the cavity since the cavity field is only virtually excited. Thus, the cavity decay is suppressed during the entanglement generation.

  16. Magnetic ground state of Ti{sub 1-x}Sc{sub x}Fe{sub 2} system

    Energy Technology Data Exchange (ETDEWEB)

    Saoudi, M.; Deportes, J.; Ouladdiaf, B. E-mail: ouladdiaf@ill.fr

    2001-06-01

    The magnetic ground states of the Laves phases Ti{sub 1-x}Sc{sub x}Fe{sub 2} system have been investigated by means of powder neutron diffraction and magnetisation techniques. For x=0.23, a transition is observed from a collinear ferromagnet along the c-axis to a canted one at T{sub f}=200 K. For x=0.27, 0.3, 0.33, an additional first-order transition is observed at T{sub t1}{approx}120 K accompanied by a large magnetovolume anomaly associated to a jump of the magnetic moment of the Fe atoms at the 2a site. The magnetic moment instability in a frustrated lattice should be considered to interpret this transition, although most of the other magnetic states can be discussed within Moriya's theory for itinerant electron systems with competing ferromagnetic and antiferromagnetic spin fluctuations.

  17. Chiral symmetry breaking, color superconductivity and equation of state at high density a variational approach

    CERN Document Server

    Mishra, H; Mishra, Hiranmaya; Parikh, Jitendra C.

    2001-01-01

    We discuss in this note simultaneous existence of chiral symmetry breakingand color superconductivity at finite temperature and density in aNambu-Jona-Lasinio type model. The methodology involves an explicitconstruction of a variational ground state and minimisation of thethermodynamic potential. There appears to be a phase at finite densities withboth quark antiquark as well as diquark condensates for the "ground" state.Chiral symmetry breaking phase appear to catalyse the threshold for the diquarkcondensates to appear. We also compute the equation of state in this model.

  18. Solid-State Calculation of Crystalline Color Superconductivity

    CERN Document Server

    Cao, Gaoqing; Zhuang, Pengfei

    2015-01-01

    It is generally believed that the inhomogeneous Larkin-Ovchinnikov-Fulde-Ferrell (LOFF) phase appears in a color superconductor when the pairing between different quark flavors is under the circumstances of mismatched Fermi surfaces. However, the real crystal structure of the LOFF phase is still unclear because an exact treatment of 3D crystal structures is rather difficult. In this work we calculate the ground-state energy of the body-centered cubic (BCC) structure for two-flavor pairing by diagonalizing the Hamiltonian matrix in the Bloch space, in analogy to the \\emph{ab initio} calculations in solid-state physics. We develop a computational scheme to overcome the difficulties in diagonalizing huge matrices. Our results show that the BCC structure is energetically more favorable than the 1D modulation in a narrow window around the conventional LOFF-normal phase transition point, which indicates the significance of the higher-order terms in the Ginzburg-Landau approach.

  19. Two types of superconducting domes in unconventional superconductors

    Science.gov (United States)

    Das, Tanmoy; Panagopoulos, Christos

    2016-10-01

    Uncovering the origin of unconventional superconductivity is often plagued by the overwhelming material diversity with varying normal and superconducting (SC) properties. In this article, we deliver a comprehensive study of the SC properties and phase diagrams using multiple tunings (such as disorder, pressure or magnetic field in addition to doping and vice versa) across several families of unconventional superconductors, including the copper-oxides, heavy-fermions, organics and the recently discovered iron-pnictides, iron-chalcogenides, and oxybismuthides. We discover that all these families often possess two types of SC domes, with lower and higher SC transition temperatures T c, both unconventional but with distinct SC and normal states properties. The lower T c dome arises with or without a quantum critical point (QCP), and not always associated with a non-Fermi liquid (NFL) background. On the contrary, the higher-T c dome clearly stems from a NFL or strange metal phase, without an apparent intervening phase transition or a QCP. The two domes appear either fully separated in the phase diagram, or merged into one, or arise independently owing to their respective normal state characteristics. Our findings suggest that a QCP-related mechanism is an unlikely scenario for the NFL phase in these materials, and thereby narrows the possibility towards short-range fluctuations of various degrees of freedom in the momentum and frequency space. We also find that NFL physics may be a generic route to higher-T c superconductivity.

  20. Free energy surfaces in the superconducting mixed state

    Science.gov (United States)

    Finnemore, D. K.; Fang, M. M.; Bansal, N. P.; Farrell, D. E.

    1989-01-01

    The free energy surface for Tl2Ba2Ca2Cu3O1O has been measured as a function of temperature and magnetic field to determine the fundamental thermodynamic properties of the mixed state. The change in free energy, G(H)-G(O), is found to be linear in temperature over a wide range indicating that the specific heat is independent of field.

  1. Heavy-Fermion Superconductivity in the Quadrupole Ordered State of PrV2Al20

    Science.gov (United States)

    Tsujimoto, Masaki; Matsumoto, Yosuke; Tomita, Takahiro; Sakai, Akito; Nakatsuji, Satoru

    2014-12-01

    PrV2Al20 is a rare example of a heavy-fermion system based on strong hybridization between conduction electrons and nonmagnetic quadrupolar moments of the cubic Γ3 ground doublet. Here, we report that a high-quality single crystal of PrV2Al20 exhibits superconductivity at Tc=50 mK in the antiferroquadrupole-ordered state under ambient pressure. The heavy-fermion character of the superconductivity is evident from the specific heat jump of Δ C /T ˜0.3 J /mol K2 and the effective mass m*/m0˜140 estimated from the temperature dependence of the upper critical field. Furthermore, the high-quality single crystals exhibit double transitions at TQ=0.75 K and T*=0.65 K associated with quadrupole and octupole degrees of freedom of the Γ3 doublet. In the ordered state, the specific heat C /T shows a T3 dependence, indicating the gapless mode associated with the quadrupole order, the octupole order, or both. The strong sensitivity to impurity of the superconductivity suggests unconventional character due to significant quadrupolar fluctuations.

  2. Superconducting/magnetic Three-state Nanodevice for Memory and Reading Applications.

    Science.gov (United States)

    del Valle, J; Gomez, A; Gonzalez, E M; Osorio, M R; Granados, D; Vicent, J L

    2015-10-15

    We present a simple nanodevice that can operate in two modes: i) non-volatile three-state memory and ii) reading device. The nanodevice can retain three well defined states -1, 0 and +1 and can operate in a second mode as a sensor for external magnetic fields. The nanodevice is fabricated with an array of ordered triangular-shaped nanomagnets embedded in a superconducting thin film gown on Si substrates. The device runs based on the combination of superconducting vortex ratchet effect (superconducting film) with the out of plane magnetization (nanomagnets). The input signals are ac currents and the output signal are dc voltages. The memory mode is realized without applying a magnetic field and the nanomagnet stray magnetic fields govern the effect. In the sensor mode an external magnetic field is applied. The main characteristic of this mode is that the output signal is null for a precise value of the external magnetic field that only depends on the fabrication characteristics of the nanodevice.

  3. Magnon-phonon coupling and implications for charge-density wave states and superconductivity in cuprates

    Science.gov (United States)

    Struzhkin, Viktor V.; Chen, Xiao-Jia

    2016-10-01

    The mechanism of high-temperature superconductivity of copper oxides (cuprates) remains unsolved puzzle in condensed matter physics. The cuprates represent extremely complicated system, showing fascinating variety of quantum phenomena and rich phase diagram as a function of doping. In the suggested "superconducting glue" mechanisms, phonon and spin excitations are invoked most frequently, and it appears that only spin excitations cover the energy scale required to justify very high transition temperature Tc ˜ 165 K (as in mercury-based triple layer cuprates compressed to 30 GPa). It appears that pressure is quite important variable helping to boost the Tc record by almost 30°. Pressure may be also considered as a clean tuning parameter, helping to understand the underlying balance of various energy scales and ordered states in cuprates. In this paper, a review of mostly our work on cuprates under pressure will be given, with the emphasis on the interactions between phonon and spin excitations. It appears that there is a strong coupling between superexchange interaction and stretching in-plane oxygen vibrations, which may give rise to a variety of complex phenomena, including the charge-density wave state intertwined with superconductivity and attracting a lot of interest recently.

  4. Superconducting and normal-state properties of the noncentrosymmetric superconductor Re6Zr

    Science.gov (United States)

    Mayoh, D. A.; Barker, J. A. T.; Singh, R. P.; Balakrishnan, G.; Paul, D. McK.; Lees, M. R.

    2017-08-01

    We systematically investigate the normal and superconducting properties of noncentrosymmetric Re6Zr using magnetization, heat capacity, and electrical resistivity measurements. Resistivity measurements indicate Re6Zr has poor metallic behavior and is dominated by disorder. Re6Zr undergoes a superconducting transition at Tc=(" close=")10.3 ±0.1 )">6.75 ±0.05 K. Magnetization measurements give a lower critical field, μ0Hc 1=(11.2 ±0.2 )T , which is close to the Pauli limiting field of 12.35 T and which could indicate singlet-triplet mixing. However, low-temperature specific-heat data suggest that Re6Zr is an isotropic, fully gapped s -wave superconductor with enhanced electron-phonon coupling. Unusual flux pinning resulting in a peak effect is observed in the magnetization data, indicating an unconventional vortex state.

  5. Spin-sensitive interference due to Majorana state on the interface between normal and superconducting leads

    Science.gov (United States)

    Barański, J.; Kobiałka, A.; Domański, T.

    2017-02-01

    We investigate the subgap spectrum and transport properties of the quantum dot on the interface between the metallic and superconducting leads and additionally side-coupled to the edge of the topological superconducting (TS) chain, hosting the Majorana quasiparticle. Due to the chiral nature of the Majorana states only one spin component of the quantum dot electrons (say \\uparrow ) is directly affected, however the proximity induced on-dot pairing transmits its influence on the opposite spin as well. We investigate the unique interferometric patterns driven by the Majorana quasiparticle that are different for each spin component. We also address the spin-sensitive interplay with the Kondo effect manifested at the same zero-energy and we come to the conclusion that quantum interferometry can unambiguously identify the Majorana quasiparticle.

  6. Japanese superconducting maglev: Present state and future perspective

    Science.gov (United States)

    Takeda, Hiroshi

    1990-06-01

    Maglev (magnetic levitation vehicle) being developed as a new transportation means running at a speed of 500 km/h has various advantages in safety, mass transportation and less environment polution as well as high-speed. The development of this system is rapidly advancing into the practical stage, that is, the commercial stage of the maglev train as a mass transportation system for intercity high-speed service. This paper describes the present state of research and development as well as future prospects of maglev.

  7. Stationary states and dynamics of superconducting thin films

    DEFF Research Database (Denmark)

    Ögren, Magnus; Sørensen, Mads Peter; Pedersen, Niels Falsig

    of stationary states with the GL equation and with the time-dependent GL equation are given. Moreover we study real time evolution with the so called Schrödinger-GL equation [3]. For simplicity we here present numerical data for a twodimensional rectangular geometry, but we emphasize that our FEM formulation......The Ginzburg-Landau (GL) theory is a celebrated tool for theoretical modelling of superconductors [1]. We elaborate on different partial differential equations (PDEs) and boundary conditions for GL theory, formulated within the finite element method (FEM) [2]. Examples of PDEs for the calculation...

  8. Entangled States in a Single-Qubit Structure with SQUID Coupled with a Super-conducting Resonator

    Institute of Scientific and Technical Information of China (English)

    SONG Jian-Wen; LIANG Bao-Long; HAI Wen-Hua; WANG Ji-Suo; ZHONG Hong-Hua; MENG Xiang-Guo; LUO Xiao-Bing

    2008-01-01

    In this paper, the number-phase quantization scheme of the mesoscopic circuit, which consists of a single-qubit structure with superconducting quantum interference device coupled with a super-conducting resonator, is given. By introducing a unitary matrix and by means of spectral decomposition, the Hamiltonian operator of the system is exactly formulated in compact forms in spin-1/2 notation. The eigenvalues and the eigenstates of the system are investigated. It is found that using this system the entangled states can not only be prepared, but also be manipulated by tuning the magnetic flux through the super-conducting loop.

  9. Resistive current states in wide superconducting films in zero magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Dmitriev, V M [B Verkin Institute for Low Temperature Physics and Engineering, National Academy of Sciences of Ukraine, 61103 Kharkiv (Ukraine); Zolochevskii, I V [B Verkin Institute for Low Temperature Physics and Engineering, National Academy of Sciences of Ukraine, 61103 Kharkiv (Ukraine)

    2006-04-15

    The temperature dependence of the current-voltage characteristics of high-quality thin films of tin from 7 to 50 {mu}m thick are investigated in the absence of an external magnetic field. For the first time, we have experimentally observed phase slip centres (PSCs) and phase slip lines (PSLs) on the same superconducting tin film with known parameters in the temperature intervals corresponding to the mechanisms of their formation and existence. We have shown that the states of a wide film with increasing transport current appear in the following order: the superconducting state for current less than critical; the resistive vortex state for current more than critical, but less than maximum current for the uniform flux flow (instability current); the critical state due to the onset of instability of the steady pattern of viscous motion of the vortices; a vortex-free resistive state with PSLs for current more than instability current, but less than the upper critical current; and the normal state at a current higher than the upper critical current.

  10. Superconducting quantum criticality of topological surface states at three loops

    Science.gov (United States)

    Zerf, Nikolai; Lin, Chien-Hung; Maciejko, Joseph

    2016-11-01

    The semimetal-superconductor quantum phase transition on the two-dimensional (2D) surface of a 3D topological insulator is conjectured to exhibit an emergent N =2 supersymmetry, based on a one-loop renormalization group (RG) analysis in the ɛ expansion. We provide additional support for this conjecture by performing a three-loop RG analysis and showing that the supersymmetric fixed point found at this order survives the extrapolation to 2D. We compute critical exponents to order ɛ3, obtaining the more accurate value ν ≈0.985 for the correlation length exponent and confirming that the fermion and boson anomalous dimensions remain unchanged beyond one loop, as expected from non-renormalization theorems in supersymmetric theories. We further couple the system to a dynamical U(1) gauge field, and argue that the transition becomes fluctuation-induced first order in an appropriate type-I regime. We discuss implications of this result for quantum phase transitions between certain symmetry-preserving correlated surface states of 3D topological insulators.

  11. Anisotropy of normal state and superconducting properties of oxypnictides

    Energy Technology Data Exchange (ETDEWEB)

    Haindl, Silvia; Kidszun, Martin; Kauffmann, Alexander; Kozlova, Nadja; Iida, Kazumasa; Vakaliuk, Oleksii; Panarina, Nadezda; Hess, Christian; Buechner, Bernd [IFW Dresden (Germany); Thersleff, Thomas [IFW Dresden (Germany); The Angstroem Laboratory, Department of Engineering Sciences, Division of Applied Materials Science, Uppsala University (Sweden); Kawaguchi, Takahiko; Ikuta, Hiroshi [Department of Crystalline Materials Science, Nagoya University (Japan); Kampert, Erik; Wosnitza, Joachim [Hochfeld-Magnetlabor Dresden (HLD), Helmholtz-Zentrum Dresden-Rossendorf, Dresden (Germany)

    2013-07-01

    The very large upper critical fields of the oxypnictides complicate the experimental determination of their anisotropy, γ{sub Hc2}, especially at low temperatures. We have applied the anisotropic Ginzburg-Landau scaling on angular-dependent critical-current densities measured for an epitaxially grown La(O{sub 1-x}F{sub x})FeAs thin film. The obtained scaling parameter matches γ{sub H{sub c{sub 2}}} as can be demonstrated by recent magnetotransport measurements in pulsed magnetic fields up to 70 T and down to 2 K. Using the method of critical current scaling H{sub c2}{sup ab} for Nd(O{sub 1-x}F{sub x})FeAs is extrapolated. In addition we discuss normal state electrical transport properties of La(O{sub 1-x}F{sub x})FeAs and Nd(O{sub 1-x}F{sub x})FeAs thin films.

  12. The effects of disorder on the normal state and superconducting properties of Nb3Sn

    Science.gov (United States)

    Mentink, M. G. T.; Dhalle, M. M. J.; Dietderich, D. R.; Godeke, A.; Hellman, F.; ten Kate, H. H. J.

    2017-02-01

    The effect of disorder on the normal state resistivity and the superconducting properties of Nb{}3Sn is explored in a combination of ab initio calculations and microscopic theory. The crystal symmetry is calculated to be preferentially tetragonal at a normal state resistivity below 27.0 ± 1.4 μ {{Ω }}{cm}, and preferentially cubic above this value, which is shown to be consistent with the experimentally observed transition point. The phonon density of states, the Eliashberg spectrum {α }2(ω )F(ω ), the electron-phonon coupling constant, the characteristic frequency, the critical temperature T c, and the upper critical magnetic field at 0 K {H}{{c}2}(0) are calculated over a large normal state resistivity range and shown to be consistent with experimental observations. The high degree of consistency between the calculation results and experimental observations is a strong indication that the calculation approach utilized here, a combination of ab initio calculations and microscopic theory, is a useful tool for understanding the superconducting and normal state properties of Nb{}3Sn.

  13. Superconducting accelerating structures for very low velocity ion beams

    Energy Technology Data Exchange (ETDEWEB)

    Xu, J.; Shepard, K.W.; Ostroumov, P.N.; Fuerst, J.D.; Waldschmidt, G.; /Argonne; Gonin, I.V.; /Fermilab

    2008-01-01

    This paper presents designs for four types of very-low-velocity superconducting accelerating cavity capable of providing several MV of accelerating potential per cavity, and suitable for particle velocities in the range 0.006 < v/c < 0.06. Superconducting TEM-class cavities have been widely applied to CW acceleration of ion beams. SC linacs can be formed as an array of independently-phased cavities, enabling a variable velocity profile to maximize the output energy for each of a number of different ion species. Several laboratories in the US and Europe are planning exotic beam facilities based on SC linacs. The cavity designs presented here are intended for the front-end of such linacs, particularly for the post-acceleration of rare isotopes of low charge state. Several types of SC cavities have been developed recently to cover particle velocities above 0.06c. Superconducting four-gap quarter-wave resonators for velocities 0.008 < {beta} = v/c < 0.05 were developed about two decades ago and have been successfully operated at the ATLAS SC linac at Argonne National Laboratory. Since that time, progress in simulation tools, cavity fabrication and processing have increased SC cavity gradients by a factor of 3-4. This paper applies these tools to optimize the design of a four-gap quarter-wave resonator for exotic beam facilities and other low-velocity applications.

  14. Overscreened Kondo effect, (color) superconductivity and Shiba states in Dirac metals and quark matter

    CERN Document Server

    Kanazawa, Takuya

    2016-01-01

    We study the interplay between the Kondo effect and (color) superconductivity in doped Dirac metals with magnetic impurities and in quark matter with colorful impurities. We first point out that the overscreened Kondo effect arises in the normal state of these systems. Next the (color) superconducting gap is incorporated as a mean field and the phase diagram for a varying gap and temperature is constructed nonperturbatively. A rich phase structure emerges from a competition of effects unique to a multichannel system. The Kondo-screened phase is shown to disappear for a sufficiently large gap. Peculiarity of quark matter due to the confining property of non-Abelian gauge fields is noted. We also investigate the spectrum of sub-gap excited states, called Shiba states. Based on a model calculation and physical reasoning we predict that, as the coupling of the impurity to the bulk is increased, there will be more than one quantum phase transition due to level crossing among overscreened states.

  15. Superconductivity and superconductive electronics

    Science.gov (United States)

    Beasley, M. R.

    1990-12-01

    The Stanford Center for Research on Superconductivity and Superconductive Electronics is currently focused on developing techniques for producing increasingly improved films and multilayers of the high-temperature superconductors, studying their physical properties and using these films and multilayers in device physics studies. In general the thin film synthesis work leads the way. Once a given film or multilayer structure can be made reasonably routinely, the emphasis shifts to studying the physical properties and device physics of these structures and on to the next level of film quality or multilayer complexity. The most advanced thin films synthesis work in the past year has involved developing techniques to deposit a-axis and c-axis YBCO/PBCO superlattices and related structures. The in-situ feature is desirable because no solid state reactions with accompanying changes in volume, morphology, etc., that degrade the quality of the film involved.

  16. Direct observation of a helical magnetic order near the superconducting state of MnP under pressure

    Science.gov (United States)

    Wang, Yishu; Feng, Yejun; Cheng, J.-G.; Rosenbaum, T. F.

    A recent high-pressure electrical transport study of the 3d transition metal compound MnP manifested a complex pressure-temperature phase diagram of different types of magnetism and superconductivity. However, the nature of the high-pressure magnetic phase proximate to the superconducting state was not determined. We use non-resonant X-ray magnetic diffraction to probe the magnetic order in MnP under pressure. We discover incommensurate helical order in a confined region under high pressure, and ascertain the phase boundary through the pressure evolution of the lattice. Although the antiferromagnetic and superconducting phases are separated, there is no signature of a strong first-order phase transition between them. We discuss how our direct observation of a helimagnetic order in MnP helps to better understand aspects of magnetically-mediated superconductivity.

  17. The Use of a Solid State Analog Television Transmitter as a Superconducting Electron Gun Power Amplifier

    Energy Technology Data Exchange (ETDEWEB)

    J.G. Kulpin, K.J. Kleman, R.A. Legg

    2012-07-01

    A solid state analog television transmitter designed for 200 MHz operation is being commissioned as a radio frequency power amplifier on the Wisconsin superconducting electron gun cavity. The amplifier consists of three separate radio frequency power combiner cabinets and one monitor and control cabinet. The transmitter employs rugged field effect transistors built into one kilowatt drawers that are individually hot swappable at maximum continuous power output. The total combined power of the transmitter system is 33 kW at 200 MHz, output through a standard coaxial transmission line. A low level radio frequency system is employed to digitally synthesize the 200 MHz signal and precisely control amplitude and phase.

  18. Induced superconductivity in the surface state of mercury telluride (HgTe)

    Energy Technology Data Exchange (ETDEWEB)

    Maier, Luis; Knott, Daniel; Ames, Christopher; Bruene, Christoph; Leubner, Philipp; Oostinga, Jeroen; Buhmann, Hartmut; Molenkamp, Laurens W. [Physikalisches Institut (EP3), Universitaet Wuerzburg, 97074 Wuerzburg (Germany)

    2012-07-01

    It has been recently shown that the strained epitaxial growth of bulk HgTe layers opens a band gap in the normally semi-metallic material. This means that strained HgTe meets all prerequisites of a topological insulator, i.e. surface states and an insulating bulk, which does not contribute to transport measurements. The interfaces between topological insulators and superconductors are especially interesting due to the possibility of creation and detection of majorana fermions. Our current work is focussing on investigating contacts between strained HgTe and Nb as a superconducting material. First results show proximity effect and multiple sub gap features which are discussed in detail.

  19. Superconducting Hadron Linacs

    CERN Document Server

    Ostroumov, Peter

    2013-01-01

    This article discusses the main building blocks of a superconducting (SC) linac, the choice of SC resonators, their frequencies, accelerating gradients and apertures, focusing structures, practical aspects of cryomodule design, and concepts to minimize the heat load into the cryogenic system. It starts with an overview of design concepts for all types of hadron linacs differentiated by duty cycle (pulsed or continuous wave) or by the type of ion species (protons, H-, and ions) being accelerated. Design concepts are detailed for SC linacs in application to both light ion (proton, deuteron) and heavy ion linacs. The physics design of SC linacs, including transverse and longitudinal lattice designs, matching between different accelerating–focusing lattices, and transition from NC to SC sections, is detailed. Design of high-intensity SC linacs for light ions, methods for the reduction of beam losses, preventing beam halo formation, and the effect of HOMs and errors on beam quality are discussed. Examples are ta...

  20. Effect of Zn impurities on the superconducting state of high Tc cuprates.

    Science.gov (United States)

    Garg, A.; Kanigel, A.; Randeria, M.; Trivedi, N.

    2010-03-01

    We study the effect of Zn impurities on the strongly correlated d-wave superconducting state. We solve the t-t^'-J model in the presence of unitary scatterers, with the no-double-occupancy constraint imposed by Gutzwiller approximation and the disorder-induced inhomogeneity treated within the Bogoliubov-deGennes (BdG) approach. We study the effect of strong correlations on the quasibound states and its interplay with local moment formation. The density of mobile holes is reduced by the presence of unitary scatterers, resulting in a suppression of the superfluid density but a much weaker effect on the superconducting gap. We investigate the effect on spectral properties, such as the suppression of coherence peaks and low energy spectral weight in the density of states and contrast our results with our earlier study [1] that found protected low-energy excitations in the presence of Born scatterers. We compare our results with recent ARPES experiments [2] on Zn-doped Bi2212. [1] A. Garg, M. Randeria, and N. Trivedi, Nature Phys. 4, 762 (2008). [2] A. Kanigel et al., (unpublished).

  1. Magnetic instabilities along the superconducting phase boundary of Nb /Ni multilayers

    Science.gov (United States)

    Joshi, Amish G.; Kryukov, Sergiy A.; De Long, Lance E.; Gonzalez, Elvira M.; Navarro, Elena; Villegas, Javier E.; Vicent, Jose L.

    2007-05-01

    We report vibrating reed and superconducting quantum interference device magnetometer data that exhibit prominent dips or oscillations of the superconducting (SC) onset temperature, ΔTC(H )≈0.01-0.7K, for a [Nb(23nm)/Ni(5nm)]5 multilayer (ML) in dc magnetic fields applied nearly parallel to the ML plane. The vibrating reed data exhibit reproducible structures below TC that may reflect multiple SC transitions, but they are sensitive to ac field amplitude and dc field orientation. This striking behavior poses challenges for theoretical and experimental investigations of interfaces between SC and ferromagnetic layers that involve magnetic pair breaking effects, "pi phase shifts" of the SC order parameter, and exotic ("LOFF") pairing states. Alternatively, the anomalies may mark dynamical instabilities within a confined, strongly anisotropic Abrikosov vortex lattice.

  2. Superconducting Fault Current Limiter optimized design

    Science.gov (United States)

    Tixador, Pascal; Badel, Arnaud

    2015-11-01

    The SuperConducting Fault Current Limiter (SCFCL) appears as one of the most promising SC applications for the electrical grids. Despite its advantages and many successful field experiences the market of SCFCL has difficulties to take off even if the first orders for permanent operation in grids are taken. The analytical design of resistive SCFCL will be discussed with the objective to reduce the quantity of SC conductor (length and section) to be more cost-effective. For that the SC conductor must have a high resistivity in normal state. It can be achieved by using high resistivity alloy for shunt, such as Hastelloy®. One of the most severe constraint is that the SCFCL should operate safely for any faults, especially those with low prospective short-circuit currents. This constraint requires to properly design the thickness of the SC tape in order to limit the hot spot temperature. An operation at 65 K appears as very interesting since it decreases the SC cost at least by a factor 2 with a simple LN2 cryogenics. Taking into account the cost reduction in a near future, the SC conductor cost could be rather low, half a dollar per kV A.

  3. Superconducting Fault Current Limiter optimized design

    Energy Technology Data Exchange (ETDEWEB)

    Tixador, Pascal, E-mail: Pascal.Tixador@grenoble-inp.fr [Univ. Grenoble Alpes, G2Elab – Institut Néel, F-38000 Grenoble (France); CNRS, G2Elab – Institut Néel, F-38000 Grenoble (France); Badel, Arnaud [CNRS, G2Elab – Institut Néel, F-38000 Grenoble (France)

    2015-11-15

    Highlights: • A low cost design of YBCO Fault Current Limiter. • A high resistance conductor for reduced length. • An asymmetrical YBCO conductor (injection and AC losses). • A thickness suitable for non destructive hot spots. - Abstract: The SuperConducting Fault Current Limiter (SCFCL) appears as one of the most promising SC applications for the electrical grids. Despite its advantages and many successful field experiences the market of SCFCL has difficulties to take off even if the first orders for permanent operation in grids are taken. The analytical design of resistive SCFCL will be discussed with the objective to reduce the quantity of SC conductor (length and section) to be more cost-effective. For that the SC conductor must have a high resistivity in normal state. It can be achieved by using high resistivity alloy for shunt, such as Hastelloy®. One of the most severe constraint is that the SCFCL should operate safely for any faults, especially those with low prospective short-circuit currents. This constraint requires to properly design the thickness of the SC tape in order to limit the hot spot temperature. An operation at 65 K appears as very interesting since it decreases the SC cost at least by a factor 2 with a simple LN2 cryogenics. Taking into account the cost reduction in a near future, the SC conductor cost could be rather low, half a dollar per kV A.

  4. Two energy scales and two quasiparticle dynamics in the superconducting state of under-doped cuprates

    Energy Technology Data Exchange (ETDEWEB)

    Le Tacon, M.; Sacuto, A. [Paris-7 Univ., Lab. Mat riaux et Ph nom nes Quantiques (UMR 7162 CNRS), 75 (France); Laboratoire de Physique du Solide, ESPCI, 75 - Paris (France); Georges, A. [Centre de Physique Theorique, Ecole Polytechnique, 91 - Palaiseau (France); Kotliar, G. [Centre de Physique Theorique, Ecole Polytechnique, 91 - Palaiseau (France); Rutgers Univ., Serin Physics Lab. (United States); Gallais, Y. [Columbia Univ. New York, Dept. of Physics and Applied Physics, NY (United States); Colson, D.; Forget, A. [CEA Saclay, Service de Physique de l' Etat Condense, 91 - Gif-sur-Yvette (France)

    2006-07-01

    The superconducting state of under-doped cuprates is often described in terms of a single energy scale, associated with the maximum of the (d-wave) gap. Here, we report on electronic Raman scattering results, which show that the gap function in the under-doped regime is characterized by two energy scales, depending on doping in opposite manners. Their ratios to the maximum critical temperature are found to be universal in cuprates. Our experimental results also reveal two different quasiparticle dynamics in the under-doped superconducting state, associated with two regions of momentum space: nodal regions near the zeros of the gap and anti-nodal regions. While anti-nodal quasiparticles quickly loose coherence as doping is reduced, coherent nodal quasiparticles persist down to low doping levels. A theoretical analysis using a new sum-rule allows us to relate the low-frequency-dependence of the Raman response to the temperature-dependence of the superfluid density, both controlled by nodal excitations. (authors)

  5. Ideal charge-density-wave order in the high-field state of superconducting YBCO

    Science.gov (United States)

    Jang, H.; Lee, W.-S.; Nojiri, H.; Matsuzawa, S.; Yasumura, H.; Nie, L.; Maharaj, A. V.; Gerber, S.; Liu, Y.-J.; Mehta, A.; Bonn, D. A.; Liang, R.; Hardy, W. N.; Burns, C. A.; Islam, Z.; Song, S.; Hastings, J.; Devereaux, T. P.; Shen, Z.-X.; Kivelson, S. A.; Kao, C.-C.; Zhu, D.; Lee, J.-S.

    2016-12-01

    The existence of charge-density-wave (CDW) correlations in cuprate superconductors has now been established. However, the nature of the CDW ground state has remained uncertain because disorder and the presence of superconductivity typically limit the CDW correlation lengths to only a dozen unit cells or less. Here we explore the field-induced 3D CDW correlations in extremely pure detwinned crystals of YBa2Cu3O2 (YBCO) ortho-II and ortho-VIII at magnetic fields in excess of the resistive upper critical field (Hc2Hc2) where superconductivity is heavily suppressed. We observe that the 3D CDW is unidirectional and possesses a long in-plane correlation length as well as significant correlations between neighboring CuO2 planes. It is significant that we observe only a single sharply defined transition at a critical field proportional to Hc2Hc2, given that the field range used in this investigation overlaps with other high-field experiments including quantum oscillation measurements. The correlation volume is at least two to three orders of magnitude larger than that of the zero-field CDW. This is by far the largest CDW correlation volume observed in any cuprate crystal and so is presumably representative of the high-field ground state of an “ideal” disorder-free cuprate.

  6. High-Pressure Study of the Ground- and Superconducting-State Properties of CeAu2Si2

    Science.gov (United States)

    Scheerer, Gernot W.; Giriat, Gaétan; Ren, Zhi; Lapertot, Gérard; Jaccard, Didier

    2017-06-01

    The pressure-temperature phase diagram of the new heavy-fermion superconductor CeAu2Si2 is markedly different from those studied previously. Indeed, superconductivity emerges not on the verge but deep inside the magnetic phase, and mysteriously Tc increases with the strengthening of magnetism. In this context, we have carried out ac calorimetry, resistivity, and thermoelectric power measurements on a CeAu2Si2 single crystal under high pressure. We uncover a strong link between the enhancement of superconductivity and quantum-critical-like features in the normal-state resistivity. Non-Fermi-liquid behavior is observed around the maximum of superconductivity and enhanced scattering rates are observed close to both the emergence and the maximum of superconductivity. Furthermore we observe signatures of pressure- and temperature-driven modifications of the magnetic structure inside the antiferromagnetic phase. A comparison of the features of CeAu2Si2 and its parent compounds CeCu2Si2 and CeCu2Ge2 plotted as function of the unit-cell volume leads us to propose that critical fluctuations of a valence crossover play a crucial role in the superconducting pairing mechanism. Our study illustrates the complex interplay between magnetism, valence fluctuations, and superconductivity.

  7. Evidence for strong-coupling s-wave superconductivity in MgB2: (11)B NMR Study.

    Science.gov (United States)

    Kotegawa, H; Ishida, K; Kitaoka, Y; Muranaka, T; Akimitsu, J

    2001-09-17

    We have investigated a gap structure in a newly discovered superconductor, MgB2, through measurement of the (11)B nuclear spin-lattice relaxation rate, (11)(1/T(1)). (11)(1/T(1)) is proportional to the temperature (T) in the normal state, and decreases exponentially in the superconducting (SC) state, revealing a tiny coherence peak just below T(c). The T dependence of 1/T(1) in the SC state can be accounted for by an s-wave SC model with a large gap size of 2Delta/k(B)T(c) approximately 5 which suggests it is in a strong-coupling regime.

  8. Thin-film superconducting rings in the critical state: the mixed boundary value approach

    Science.gov (United States)

    Brambilla, Roberto; Grilli, Francesco

    2015-02-01

    In this paper, we describe the critical state of a thin superconducting ring (and of a perfectly conducting ring as a limiting case) as a mixed boundary value problem. The disc is characterized by a three-part boundary division of the positive real axis, so this work is an extension of the procedure used in a previous work of ours for describing superconducting discs and strips, which are characterized by a two-part boundary division of the real axis. Here, we present the mathematical tools to solve this kind of problems—the Erdélyi-Kober operators—in a frame that can be immediately used. Contrary to the two-part problems considered in our previous work, three-part problems do not generally have analytical solutions and the numerical work takes on a significant heaviness. Nevertheless, this work is remunerated by three clear advantages: firstly, all the cases are afforded in the same way, without the necessity of any brilliant invention or ability; secondly, in the case of superconducting rings, the penetration of the magnetic field in the internal/external rims is a result of the method itself and does not have to be imposed, as it is commonly done with other methods presented in the literature; thirdly, the method can be extended to investigate even more complex cases (four-part problems). In this paper, we consider the cases of rings in uniform field and with transport current, with or without flux trapping in the hole and the case without net current, corresponding to a cut ring (washer), as used in some SQUID applications.

  9. Impact of eigenvalues on the pseudopotential calculation of superconducting parameters of metals Ga, Cd and In

    Science.gov (United States)

    Yadav, Jayprakash; Rafique, S. M.; Kumari, Shanti

    2009-10-01

    In the present paper some superconducting (SC) state parameters of metals Ga, Cd and In have been studied through Harrison's First Principle [HFP] pseudopotential technique using McMillan's formalism. The impact of choosing two different sets of core energy eigenvalues viz. Herman-Skillman and Clementi (or Experimental) has been studied.

  10. Coupling nitrogen-vacancy centers in diamond to superconducting flux qubits

    DEFF Research Database (Denmark)

    Marcos, D.; Wubs, Martijn; Taylor, J.M.;

    2010-01-01

    We propose a method to achieve coherent coupling between nitrogen-vacancy (NV) centers in diamond and superconducting (SC) flux qubits. The resulting coupling can be used to create a coherent interaction between the spin states of distant NV centers mediated by the flux qubit. Furthermore, the ma...

  11. The first experimental results on laser ion loading into superconducting ECR ion source at RIKEN

    CERN Document Server

    Arzumanyan, G M; Shirkov, G D; Yano, Y

    2002-01-01

    The first experimental results on ions and neutrals injection by means of laser ablation from metal targets into the RIKEN 18 GHz superconducting electron cyclotron resonance ion source (SC ECRIS) are presented. Pulsed aluminium ion currents up to Al sup 8 sup + were generated in the source. The difference in pulse shapes of various charge states of the extracted ion currents is registered

  12. Quasiparticles in the superconducting state of Bi(2)Sr(2)CaCu(2)O(8+delta)

    Science.gov (United States)

    Kaminski; Mesot; Fretwell; Campuzano; Norman; Randeria; Ding; Sato; Takahashi; Mochiku; Kadowaki; Hoechst

    2000-02-21

    Recent improvements in momentum resolution lead to qualitatively new angle-resolved photoemission spectroscopy results on the spectra of Bi(2)Sr(2)CaCu(2)O(8+delta) (Bi2212) along the (pi,pi) direction, where there is a node in the superconducting gap. We now see the intrinsic line shape, which indicates the presence of true quasiparticles at all Fermi momenta in the superconducting state, and lack thereof in the normal state. The region of momentum space probed here is relevant for charge transport, motivating a comparison of our results to conductivity measurements by infrared reflectivity.

  13. Probing the dynamics of Andreev states in a coherent normal/superconducting ring.

    Science.gov (United States)

    Chiodi, F; Ferrier, M; Tikhonov, K; Virtanen, P; Heikkilä, T T; Feigelman, M; Guéron, S; Bouchiat, H

    2011-01-01

    The supercurrent that establishes between two superconductors connected through a normal N mesoscopic link is carried by quasiparticule states localized within the link, the "Andreev bound states (ABS)". Whereas the dc properties of this supercurrent in SNS junctions are now well understood, its dynamical properties are still an unresolved issue. In this letter we probe this dynamics by inductively coupling an NS ring to a multimode superconducting resonator, thereby implementing both a phase bias and current detection at high frequency. Whereas at very low temperatures we essentially measure the phase derivative of the supercurrent, at higher temperature we find a surprisingly strong frequency dependence in the current response of the ring: the ABS do not follow adiabatically the phase modulation. This experiment also illustrates a new tool to probe the fundamental time scales of phase coherent systems that are decoupled from macroscopic normal contacts and thermal baths.

  14. Magnetic impurity induced states in superconducting Bi2Sr2CaCuO8+δ

    Science.gov (United States)

    Choubey, Peayush; Kreisel, Andreas; Berlijn, Tom; Andersen, Brian; Hirschfeld, Peter

    2015-03-01

    We revisit the Ni impurity problem in superconducting Bi2Sr2CaCu2O8+δ (BSCCO-2212) using the Bogoliubov- de Gennes (BdG)-Wannier approach. We solve the self-consistent BdG equations on a square lattice and use first principle-based Wannier function to compute the local density of states (LDOS) with sub-atomic resolution in the vicinity of a magnetic impurity. We find two spin-resolved virtual bound states localized around the impurity position. The spatial LDOS patterns at the resonance energies are found to be in excellent agreement with STM experiment, and can be understood by accounting for the tails of Cu Wannier function.

  15. NMR studies on the new iron arsenide superconductors including the superconducting state

    Energy Technology Data Exchange (ETDEWEB)

    Grafe, Hans-Joachim; Lang, Guillaume; Hammerath, Franziska; Manthey, Katarina; Behr, Guenther; Werner, Jochen; Buechner, Bernd [IFW Dresden, Helmholtzstr. 20, D-01069 Dresden (Germany); Paar, Dalibor [IFW Dresden, Helmholtzstr. 20, D-01069 Dresden (Germany); Dept. of Physics, Faculty of Science, Univ. of Zagreb (Croatia); Curro, Nicholas [Dept. of Physics, Univ. of California, Davis, CA 95616 (United States)

    2009-07-01

    We summarize our Nuclear Magnetic Resonance (NMR) and Nuclear Quadrupole Resonance (NQR) results on the new iron arsenide superconductor LaO{sub 1-x}F{sub x}FeAs in the normal state, and show new NMR data in the superconducting state. Beyond early evidence of nodes and spin-singlet pairing[2], we find evidence of a deviation of the T{sup 3} behaviour of the spin lattice relaxation rate, 1/T{sub 1}, at temperatures significantly below T{sub c}, which would agree with the suggested extended s-wave symmetry. The deviation of the T{sup 3} behaviour is induced by the pair breaking effect of impurities. Different amounts of impurities would lead to different temperature dependences of 1/T{sub 1}, which would allow to differentiate between d-wave and extended s-wave symmetries.

  16. A method of studying the Bogoliubov-de Gennes equations for the superconducting vortex lattice state.

    Science.gov (United States)

    Han, Qiang

    2010-01-27

    In this paper, we present a method to construct the eigenspace of the tight-binding electrons moving on a 2D square lattice with nearest-neighbor hopping in the presence of a perpendicular uniform magnetic field which imposes (quasi-)periodic boundary conditions for the wavefunctions in the magnetic unit cell. Exact unitary transformations are put forward to correlate the discrete eigenvectors of the 2D electrons with those of the Harper equation. The cyclic tridiagonal matrix associated with the Harper equation is then tridiagonalized by another unitary transformation. The obtained truncated eigenbasis is utilized to expand the Bogoliubov-de Gennes equations for the superconducting vortex lattice state, which shows the merit of our method in studying large-sized systems. To test our method, we have applied our results to study the vortex lattice state of an s-wave superconductor.

  17. Quasiparticle entropy in the high-field superconducting phase of CeCoIn(5).

    Science.gov (United States)

    Tokiwa, Y; Bauer, E D; Gegenwart, P

    2012-09-14

    The heavy-fermion superconductor CeCoIn(5) displays an additional transition within its superconducting (SC) state, whose nature is characterized by high-precision studies of the isothermal field dependence of the entropy, derived from combined specific heat and magnetocaloric effect measurements at temperatures T≥100  mK and fields H≤12  T aligned along different directions. For any of these conditions, we do not observe an additional entropy contribution upon tuning at constant temperature by magnetic field from the homogeneous SC into the presumed Fulde-Ferrell-Larkin-Ovchinnikov (FFLO) SC state. By contrast, for H∥[100] a reduction of entropy was found that quantitatively agrees with the expectation for spin-density-wave order without FFLO superconductivity. Our data exclude the formation of a FFLO state in CeCoIn(5) for out-of-plane field directions, where no spin-density-wave order exists.

  18. Topological Crystalline Superconductivity in Locally Noncentrosymmetric Multilayer Superconductors.

    Science.gov (United States)

    Yoshida, Tomohiro; Sigrist, Manfred; Yanase, Youichi

    2015-07-10

    Topological crystalline superconductivity in locally noncentrosymmetric multilayer superconductors (SCs) is proposed. We study the odd-parity pair-density wave (PDW) state induced by the spin-singlet pairing interaction through the spin-orbit coupling. It is shown that the PDW state is a topological crystalline SC protected by a mirror symmetry, although it is topologically trivial according to the classification based on the standard topological periodic table. The topological property of the mirror subsectors is intuitively explained by adiabatically changing the Bogoliubov-de Gennes Hamiltonian. A subsector of the bilayer PDW state reduces to the two-dimensional noncentrosymmetric SC, while a subsector of the trilayer PDW state is topologically equivalent to the spinless p-wave SC. Chiral Majorana edge modes in trilayers can be realized without Cooper pairs in the spin-triplet channel and chemical potential tuning.

  19. Multi-vortex State Induced by Proximity Effects in a Small Superconducting Square

    Science.gov (United States)

    Barba-Ortega, J.; González, J. D.; Sardella, Edson

    2014-11-01

    The influence of the different negative values of the deGennes parameter in the thermodynamic properties of a superconducting infinitely long prism of square cross section area in the presence of a magnetic field is investigated theoretically by solving numerically the nonlinear Ginzburg-Landau equations; is the coherent length at zero temperature. We obtain the vorticity, magnetic induction, Cooper pair density, magnetization and phase of the order parameter as functions of the external applied magnetic field and the parameter. Our results show that a multi-vortex state appear in the sample choosing a convenient value of parameter, even for such small system. Also, we study a superconducting parallelepiped of volume by means of true numerical simulations; is the height of the parallelepiped. We focused our analysis on the way which the magnetization curves approximate from finite to the characteristic curve of . This is the case for which the magnetic field and the order parameter are invariant along -direction. For a superconductor of size we find that the limit below which the system should be considered a real three-dimensional sample when is.

  20. Coherent-state storage and retrieval between superconducting cavities using parametric frequency conversion

    Energy Technology Data Exchange (ETDEWEB)

    Sirois, A. J. [National Institute of Standard and Technology, Boulder, Colorado 80305 (United States); University of Colorado - Boulder, Colorado 80309 (United States); Castellanos-Beltran, M. A.; DeFeo, M. P.; Ranzani, L.; Lecocq, F.; Simmonds, R. W.; Teufel, J. D.; Aumentado, J. [National Institute of Standard and Technology, Boulder, Colorado 80305 (United States)

    2015-04-27

    In superconducting quantum information, machined aluminum superconducting cavities have proven to be a well-controlled, low-dissipation electromagnetic environment for quantum circuits such as qubits. They can possess large internal quality factors, Q{sub int} > 10{sup 8}, and present the possibility of storing quantum information for times far exceeding those of microfabricated circuits. However, in order to be useful as a storage element, these cavities require a fast “read/write” mechanism—in other words, they require tunable coupling between other systems of interest such as other cavity modes and qubits, as well as any associated readout hardware. In this work, we demonstrate these qualities in a simple dual cavity architecture in which a low-Q “readout” mode is parametrically coupled to a high-Q “storage” mode, allowing us to store and retrieve classical information. Specifically, we employ a flux-driven Josephson junction-based coupling scheme to controllably swap coherent states between two cavities, demonstrating full, sequenced control over the coupling rates between modes.

  1. Coupling nitrogen-vacancy centers in diamond to superconducting flux qubits.

    Science.gov (United States)

    Marcos, D; Wubs, M; Taylor, J M; Aguado, R; Lukin, M D; Sørensen, A S

    2010-11-19

    We propose a method to achieve coherent coupling between nitrogen-vacancy (NV) centers in diamond and superconducting (SC) flux qubits. The resulting coupling can be used to create a coherent interaction between the spin states of distant NV centers mediated by the flux qubit. Furthermore, the magnetic coupling can be used to achieve a coherent transfer of quantum information between the flux qubit and an ensemble of NV centers. This enables a long-term memory for a SC quantum processor and possibly an interface between SC qubits and light.

  2. Coupling nitrogen-vacancy centers in diamond to superconducting flux qubits

    DEFF Research Database (Denmark)

    Marcos, D.; Wubs, Martijn; Taylor, J.M.

    2010-01-01

    We propose a method to achieve coherent coupling between nitrogen-vacancy (NV) centers in diamond and superconducting (SC) flux qubits. The resulting coupling can be used to create a coherent interaction between the spin states of distant NV centers mediated by the flux qubit. Furthermore, the ma......, the magnetic coupling can be used to achieve a coherent transfer of quantum information between the flux qubit and an ensemble of NV centers. This enables a long-term memory for a SC quantum processor and possibly an interface between SC qubits and light....

  3. Controllable Quantum States Mesoscopic Superconductivity and Spintronics (MS+S2006)

    Science.gov (United States)

    Takayanagi, Hideaki; Nitta, Junsaku; Nakano, Hayato

    2008-10-01

    Josephson effect in diffusive d-wave junctions / T. Yokoyama. Quantum dissipation due to the zero energy bound states in high-T[symbol] superconductor junctions / Shiro Kawabata. Spin-polarized heat transport in ferromagnet/unconventional superconductor junctions / T. Yokoyama. Little-Parks oscillations in chiral p-wave superconducting rings / Mitsuaki Takigawa. Theoretical study of synergy effect between proximity effect and Andreev interface resonant states in triplet p-wave superconductors / Yasunari Tanuma. Theory of proximity effect in unconventional superconductor junctions / Y. Tanaka -- Quantum information. Analyzing the effectiveness of the quantum repeater / Kenichiro Furuta. Architecture-dependent execution time of Shor's algorithm / Rodney Van Meter -- Quantum dots and Kondo effects. Coulomb blockade properties of 4-gated quantum dot / Shinichi Amaha. Order-N electronic structure calculation of n-type GaAs quantum dots / Shintaro Nomura. Transport through double-dots coupled to normal and superconducting leads / Yoichi Tanaka. A study of the quantum dot in application to terahertz single photon counting / Vladimir Antonov. Electron transport through laterally coupled double quantum dots / T. Kubo. Dephasing in Kondo systems: comparison between theory and experiment / F. Mallet. Kondo effect in quantum dots coupled with noncollinear ferromagnetic leads / Daisuke Matsubayashi. Non-crossing approximation study of multi-orbital Kondo effect in quantum dot systems / Tomoko Kita. Theoretical study of electronic states and spin operation in coupled quantum dots / Mikio Eto. Spin correlation in a double quantum dot-quantum wire coupled system / S. Sasaki. Kondo-assisted transport through a multiorbital quantum dot / Rui Sakano. Spin decay in a quantum dot coupled to a quantum point contact / Massoud Borhani -- Quantum wires, low-dimensional electrons. Control of the electron density and electric field with front and back gates / Masumi Yamaguchi. Effect of the array

  4. Microwave characterization of normal and superconducting states of MOCVD made YBCO tapes

    Science.gov (United States)

    Wosik, Jarek; Krupka, Jerzy; Qin, Kuang; Ketharnath, Dhivya; Galstyan, Eduard; Selvamanickam, Venkat

    2017-03-01

    We have used a microwave, non-contact, non-destructive, dielectric resonator (DR) technique to characterize complex conductivity of different quality YBCO/Hastelloy tapes for the purpose of exploring such a technique as a potential quality control method for fabrication of YBCO tapes. The tapes were deposited at different temperatures on Hastelloy-supported oxide buffer layers using the MOCVD technique. The buffer stack consisted of aluminum oxide (Al2O3), yttrium oxide (Y2O3), and textured ion beam assisted deposition-MgO and LaMnO3 layers. Two dielectric resonators (DRs), the single post DR, consisting of high-permittivity barium zirconium titanate ceramic operating at 13 GHz in quasi-TE01δ mode, and the rod DR, consisting of rutile single crystal disk operating at 9.4 GHz in-TE011 mode, were designed to meet sensitivity requirements for characterization of conductivity of the superconductor at normal and superconducting states, respectively. For calculations of complex conductivity from experimental data of Q-factor and resonant frequency shift, a commercial electromagnetic simulator HFSS, based on finite elements analysis, was used. The theoretical Q-factor and resonant frequency on conductivity functions obtained from full wave numerical simulations of microwave fields were matched with the experimental data to determine conductivity of the YBCO tapes in both normal and superconducting states. In addition, for comparison purposes, 280 nm thick high-quality YBCO epitaxial film deposited on a dielectric substrate was also characterized, including frequency dependence of the complex conductivity. Discussion about feasibility of using DR microwave techniques as a quality control tool via measurements of conductivity versus temperature slope of the YBCO/Hastelloy tape in normal state is included. Also, microwave conductivity values of Hastelloy substrate as a function of temperature are reported.

  5. Advanced fusion technologies developed for JT-60 superconducting tokamak

    Science.gov (United States)

    Sakasai, A.; Ishida, S.; Matsukawa, M.; Akino, N.; Ando, T.; Arai, T.; Ezato, K.; Hamada, K.; Ichige, H.; Isono, T.; Kaminaga, A.; Kato, T.; Kawano, K.; Kikuchi, M.; Kizu, K.; Koizumi, N.; Kudo, Y.; Kurita, G.; Masaki, K.; Matsui, K.; Miura, Y. M.; Miya, N.; Miyo, Y.; Morioka, A.; Nakajima, H.; Nunoya, Y.; Oikawa, A.; Okuno, K.; Sakurai, S.; Sasajima, T.; Satoh, K.; Shimizu, K.; Takeji, S.; Takenaga, K.; Tamai, H.; Taniguchi, M.; Tobita, K.; Tsuchiya, K.; Urata, K.; Yagyu, J.

    2004-02-01

    Modification of JT-60 as a full superconducting tokamak (JT-60SC) is planned. The objectives of the JT-60SC programme are to establish scientific and technological bases for steady-state operation of high performance plasmas and utilization of reduced-activation materials in an economically and environmentally attractive DEMO reactor. Advanced fusion technologies relevant to the DEMO reactor have been developed for the superconducting magnet technology and plasma facing components of the JT-60SC design. To achieve a high current density in a superconducting strand, Nb3Al strands with a high copper ratio of 4 have been newly developed for the toroidal field coils (TFCs) of JT-60SC. The R&D to demonstrate the applicability of the Nb3Al conductor to TFCs by a react-and-wind technique has been carried out using a full-size Nb3Al conductor. A full-size NbTi conductor with low ac loss using Ni-coated strands has been successfully developed. A forced cooling divertor component with high heat transfer using screw tubes has been developed for the first time. The heat removal performance of the carbon fibre composite target was successfully demonstrated on an electron beam irradiation stand.

  6. Properties of superconductivity on a density wave background with small ungapped Fermi surface parts

    Science.gov (United States)

    Grigoriev, P. D.

    2008-06-01

    We investigate the properties and the microscopic structure of superconductivity (SC) coexisting and sharing the common conducting band with density wave (DW). Such coexistence may take place when the nesting of the Fermi surface (FS) is not perfect, and in the DW state some quasiparticle states remain on the Fermi level and lead to the Cooper instability. The dispersion of such quasiparticle states strongly differs from that without DW, and so do the properties of SC on the DW background. The upper critical field Hc2 in such a SC state increases as the system approaches the critical pressure, where the ungapped quasiparticles and superconductivity just appear, and it may considerably exceed the usual Hc2 value without DW. The spin-density wave (SDW) background strongly suppresses the singlet SC pairing, while it does not affect so much the triplet SC transition temperature. The results obtained explain the experimental observations in layered organic metals (TMTSF)2PF6 and α-(BEDT-TTF)2KHg(SCN)4 , where SC appears in the DW states under pressure and shows many unusual properties.

  7. Localized electronic states and photoemission superconducting condensate in Bi 2Sr 2CaCu 2O 8+x

    Science.gov (United States)

    Ma, Jian; Quitmann, C.; Kelley, R. J.; Margaritondo, G.; Onellion, M.

    1995-04-01

    We present the first detailed angle-resolved photoemission evidence that there are two types of carriers that contribute to the photoe-mission superconducting condensate in Bi 2Sr 2CaCu 2O 8+x. Our data indicate that both itinerant and somewhat localized normal state carriers can contribute to the formation of Cooper pairs.

  8. Neutron irradiation damage effect on superconducting and normal state properties of the YBa 2Cu 3O 7 system

    Science.gov (United States)

    Przysłupski, P.; Wiśniewski, A.; Koleśnik, S.; Dobrowolski, W.; Pajączkowska, A.; Pytel, K.; Pytel, B.

    1988-06-01

    Effect of irradiation by fast neutrons on superconducting and normal state properties of the YBa 2Cu 3O 7 samples is presented. Transport measurements showed a degradation of all superconducting parameters, especially the transport critical current density. Critical current densities obtained from magnetization data exhibited a substantial increase / about 15 times at 77 K and H = 10 kOe/ after the irradiation with the fluence in the range 2.4·10 17 ÷ 8.7 · 10 17 n/cm 2. Such an anomalous bahavior is explained in terms of neutron created defects at intergrain regions and improved intragrain pinning.

  9. First results from solid state neutral particle analyzer on experimental advanced superconducting tokamak

    Science.gov (United States)

    Zhang, J. Z.; Zhu, Y. B.; Zhao, J. L.; Wan, B. N.; Li, J. G.; Heidbrink, W. W.

    2016-11-01

    Full function integrated, compact solid state neutral particle analyzers (ssNPA) based on absolute extreme ultraviolet silicon photodiode have been successfully implemented on the experimental advanced superconducting tokamak to measure energetic particle. The ssNPA system has been operated in advanced current mode with fast temporal and spatial resolution capabilities, with both active and passive charge exchange measurements. It is found that the ssNPA flux signals are increased substantially with neutral beam injection (NBI). The horizontal active array responds to modulated NBI beam promptly, while weaker change is presented on passive array. Compared to near-perpendicular beam, near-tangential beam brings more passive ssNPA flux and a broader profile, while no clear difference is observed on active ssNPA flux and its profile. Significantly enhanced intensities on some ssNPA channels have been observed during ion cyclotron resonant heating.

  10. Critical state model for magneto-elastic problem of thin superconducting disks

    Science.gov (United States)

    Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2013-07-01

    The magneto-elastic problem of a thin superconducting disk in a perpendicular magnetic field is analyzed with field-dependent critical current. We calculate numerically the body force distribution and discuss the field dependence of Jc on the magneto-elastic behavior during field ascent and descent for three critical state models: Bean, Kim, and exponential models. The results show that when considering a field dependence of Jc, the flux and remagnetization fronts have a larger moving speed towards the center of a disk relative to the Bean model. Simultaneously, the most dangerous stage of possible cracking for the disk will arrive early in the field decreasing stage. The magnetostriction loops are also presented during a full cycle of the applied field. It is interesting that the calculated magnetostriction loops for the Kim and exponential models are quite similar to the corresponding magnetostriction curves at low and high temperatures measured in the experiment.

  11. Superconducting material development

    Science.gov (United States)

    1987-09-01

    A superconducting compound was developed that showed a transition to a zero-resistance state at 65 C, or 338 K. The superconducting material, which is an oxide based on strontium, barium, yttrium, and copper, continued in the zero-resistance state similar to superconductivity for 10 days at room temperature in the air. It was also noted that measurements of the material allowed it to observe a nonlinear characteristic curve between current and voltage at 65 C, which is another indication of superconductivity. The research results of the laboratory experiment with the superconducting material will be published in the August edition of the Japanese Journal of Applied Physics.

  12. Superconductivity on the density-wave background with soliton-wall structure

    Science.gov (United States)

    Grigoriev, P. D.

    2009-03-01

    Superconductivity (SC) may microscopically coexist with density wave (DW) when the nesting of the Fermi surface (FS) is not perfect. There are, at least, two possible microscopic structures of a DW state with quasi-particle states remaining on the Fermi level and leading to the Cooper instability: (i) the soliton-wall phase and (ii) the small ungapped FS pockets. The dispersion of such quasi-particle states strongly differs from that without DW, and so do the properties of SC on the DW background. The upper critical field H in such an SC state strongly increases as the system approaches the critical pressure, where SC first appears. H may considerably exceed its typical value without DW and has unusual upward curvature as function of temperature. The results obtained explain the experimental observations in layered organic superconductors (TMTSF)2PF6 and α-(BEDT-TTF)2KHg(SCN)4.

  13. Effect of hybridization and dispersion of quasiparticles on the coexistent state of superconductivity and antiferromagnetism in Ni2B2C

    Indian Academy of Sciences (India)

    B K Sahoo; B N Panda

    2011-10-01

    The effect of hybridization of conduction electrons and f-level on superconductivity (SC) and antiferromagnetism (AFM) in the coexistent phase of rare-earth nickel borocarbide superconductors (Ni2B2C) is reported. The Hamiltonian of the system is a mean field one and has been solved by writing equations of motion for the single-particle Green functions. It is assumed that superconductivity arises due to BCS pairing mechanism in the presence of antiferromagnetism in nickel lattices of Ni2B2 plane. The expressions for superconducting and antiferromagnetic order parameters are derived using double time electron Green functions. The quasiparticle energy bands are plotted and the nature of band dispersion of the quasiparticles is studied.

  14. Preparation of Schrödinger cat states of a cavity field via coupling to a superconducting charge qubit

    Science.gov (United States)

    Freitas, Dagoberto S.; Nemes, M. C.

    2014-05-01

    We extend the approach in Ref. 5 [Y.-X. Liu, L. F. Wei and F. Nori, Phys. Rev. A 71 (2005) 063820] for preparing superposition states of a cavity field interacting with a superconducting charge qubit. We study effects of the nonlinearity on the creation of such states. We show that the main contribution of nonlinear effects is to shorten the time necessary to build the superposition.

  15. Superconductivity, Mott-Hubbard states, and molecular orbital order in intercalated fullerides

    CERN Document Server

    Iwasa, Y

    2003-01-01

    This article reviews the current status of chemically doped fullerene superconductors and related compounds, with particular focus on Mott-Hubbard states and the role of molecular orbital degeneracy. Alkaline-earth metal fullerides produce superconductors of several kinds, all of which have states with higher valence than (C sub 6 sub 0) sup 6 sup - , where the second lowest unoccupied molecular orbital (the LUMO + 1 state) is filled. Alkali-metal-doped fullerides, on the other hand, afford superconductors only at the stoichiometry A sub 3 C sub 6 sub 0 (A denotes alkali metal) and in basically fcc structures. The metallicity and superconductivity of A sub 3 C sub 6 sub 0 compounds are destroyed either by reduction of the crystal symmetry or by change in the valence of C sub 6 sub 0. This difference is attributed to the narrower bandwidth in the A sub 3 C sub 6 sub 0 system, causing electronic instability in Jahn-Teller insulators and Mott-Hubbard insulators. The latter metal-insulator transition is driven by...

  16. Bound state, phase separation and superconductivity in presence of Rashba spin-orbit coupling

    Science.gov (United States)

    Kapri, Priyadarshini; Basu, Saurabh

    2017-06-01

    We have investigated the phase diagram for the t - J model at low electronic densities in presence of Rashba spin-orbit coupling (RSOC). We have rigorously derived a bound state criterion which arises out of a competition between the kinetic energy of the electrons and the exchange coupling between them. Further, we have obtained that the phase diagram consists of three phases, namely, a gas of electrons, a gas of bound pairs, and a fully phase separated state. Subsequently an extension of the pairing scenario is done at finite densities by solving a BCS gap equation. Finite superconducting correlations are observed for J values much lower than that required for the formation of a single bound pair, thereby indicating that pairing in a many particle environment requires weaker interaction strengths than that in the dilute case. We have further obtained that the RSOC increases the transition temperature for a p-wave pairing state, while it diminishes the same for an s-wave pairing correlations.

  17. Undoped high-Tc superconductivity in T'-La1.8Eu0.2CuO4+δ revealed by 63,65Cu and 139La NMR: Bulk superconductivity and antiferromagnetic fluctuations

    Science.gov (United States)

    Fukazawa, Hideto; Ishiyama, Seiya; Goto, Masato; Kanamaru, Shuhei; Ohashi, Kohki; Kawamata, Takayuki; Adachi, Tadashi; Hirata, Michihiro; Sasaki, Takahiko; Koike, Yoji; Kohori, Yoh

    2017-10-01

    We performed 63,65Cu and 139La NMR measurements of T'-La1.8Eu0.2CuO4+δ (T'-LECO) with the Nd2CuO4-type structure (so-called T'-structure). As a result, we detected the 63,65Cu NMR signal under finite magnetic fields and found superconductivity without antiferromagnetic (AF) order only in the reduced T'-LECO, where excess apical oxygen atoms are properly removed. This indicates that the intrinsic ground state of the ideal T'-LECO is a paramagnetic and superconducting (SC) state. Below Tc, the Knight shift was found to rapidly decrease, which indicates the emergence of bulk superconductivity due to spin-singlet Cooper pairs in the reduced T'-LECO. In the SC state of the reduced T'-LECO, moreover, a characteristic temperature dependence of the spin-lattice relaxation rate 1/T1 was observed, which implies the existence of nodal lines in the SC gap. These findings suggest that the superconductivity in the reduced T'-LECO probably has d-wave symmetry. In the normal state of the reduced T'-LECO, on the other hand, AF fluctuations were found to exist from the temperature dependence of 1/T1T, though no clear pseudogap behavior was observed. This suggests that the AF correlation plays a key role in the superconductivity of undoped high-Tc cuprate superconductors with the T'-structure.

  18. Impact of pseudogap on photoinduced superconducting phase transition in underdoped Bi2212

    Energy Technology Data Exchange (ETDEWEB)

    Toda, Y., E-mail: toda@eng.hokudai.ac.jp [Department of Applied Physics, Hokkaido University, Sapporo 060-8628 (Japan); Mertelj, T.; Kusar, P. [Complex Matter Department, Jozef Stefan Institute, Jamova 39, Ljubljana SI-1000 (Slovenia); Kurosawa, T.; Oda, M.; Ido, M. [Department of Physics, Hokkaido University, Sapporo 060-0810 (Japan); Mihailovic, D. [Complex Matter Department, Jozef Stefan Institute, Jamova 39, Ljubljana SI-1000 (Slovenia)

    2013-10-15

    Highlights: • QP dynamics of UD-Bi2212 in the photoinduced phase transition was investigated by pump-probe spectroscopy. • The pump fluence dependence of the QP dynamics shows a delay of the SC recovery. • The observed delay time is comparable to a recovery time of PG, suggesting a role of PG responsible for the SC formation. -- Abstract: We report nonequilibrium quasiparticle (QP) dynamics in underdoped Bi2212 crystals using ultrafast optical spectroscopy, which allows to analyze the dynamics associated with the superconducting (SC) and psuedogap (PG) QPs independently. In the saturation condition of the SC component, where the SC condensate is fully destroyed within the photoexcited volume, we found a delay of the SC state recovery associated with a transient normal state. The delay increases linearly with increasing the pump fluence. The QP dynamics also shows a contribution of the PG component, whose magnitude at the start of the SC state recovery was almost constant at various pump fluences, suggesting a critical level of PG order before the SC condensate can recover.

  19. Preparation and characterization of Sc doped MgB2 wires

    DEFF Research Database (Denmark)

    Grivel, Jean-Claude; Burdusel, M.

    2016-01-01

    The in-situ technique was used to manufacture scandium (Sc) doped MgB2 wires in a composite Cu–Nb sheath. After reaction at 700 °C, at most 1 at.% Mg was replaced by Sc in the MgB2 phase, without significant influence on its superconducting transition temperature. For higher Sc concentrations...

  20. On the theory of the current states in the superconducting junctions (in Ukrainian)

    Science.gov (United States)

    Svidzynsky, A.; Viligursky, O.; Biruk, O.; Rakutsky, A.

    The set of the quasiclassical equations for the superconducting junctions has been built by the expansion of the Green's functions on the basis of the even and odd solutions of the one-particle Schrödinger equation. %It's %shown that the quasiclassical Green's functions, built in such manner, Obtained solutions for the quasiclassical Green's functions have a symmetric asymptotic behaviour in the depth of the superconductor. Superconducting current in the point-- and in the asymmetric SNINS--junctions is calculated.

  1. CaFeAs2: A staggered intercalation of quantum spin Hall and high-temperature superconductivity

    Science.gov (United States)

    Wu, Xianxin; Qin, Shengshan; Liang, Yi; Le, Congcong; Fan, Heng; Hu, Jiangping

    2015-02-01

    We predict that CaFeAs2, a newly discovered iron-based high-temperature (Tc) superconductor, is a staggered intercalation compound that integrates topological quantum spin Hall (QSH) and superconductivity (SC). CaFeAs2 has a structure with staggered CaAs and FeAs layers. While the FeAs layers are known to be responsible for high Tc superconductivity, we show that with spin orbital coupling each CaAs layer is a Z2 topologically nontrivial two-dimensional QSH insulator and the bulk is a three-dimensional weak topological insulator. In the superconducting state, the edge states in the CaAs layer are natural one-dimensional topological superconductors. The staggered intercalation of QSH and SC provides us a unique opportunity to realize and explore physics, such as Majorana modes and Majorana fermion chains.

  2. Fundamentals of Superconducting Nanoelectronics

    CERN Document Server

    Sidorenko, Anatolie

    2011-01-01

    This book demonstrates how the new phenomena in superconductivity on the nanometer scale (FFLO state, triplet superconductivity, Crossed Andreev Reflection, synchronized generation etc.) serve as the basis for the invention and development of novel nanoelectronic devices and systems. It demonstrates how rather complex ideas and theoretical models, like odd-pairing, non-uniform superconducting state, pi-shift etc., adequately describe the processes in real superconducting nanostructues and novel devices based on them. The book is useful for a broad audience of readers, researchers, engineers, P

  3. Anomalous magnetic fluctuations in superconducting Sr2RuO4 revealed by 101Ru nuclear spin-spin relaxation

    Science.gov (United States)

    Manago, Masahiro; Yamanaka, Takayoshi; Ishida, Kenji; Mao, Zhiqiang; Maeno, Yoshiteru

    2016-10-01

    We carried out 101Ru nuclear quadrupole resonance (NQR) measurement on superconducting (SC) Sr2RuO4 under zero magnetic field (H =0 ) and found that the nuclear spin-spin relaxation rate 1 /T2 is enhanced in the SC state. The 1 /T2 measurement in the SC state under H =0 is effective for detecting slow magnetic fluctuations parallel to the quantized axis of the nuclear spin. Our results indicate that low-energy magnetic fluctuations perpendicular to the RuO2 plane emerge when the superconductivity sets in, which is consistent with the previous 17O-NQR result that the nuclear spin-lattice relaxation rate 1 /T1 of the in-plane O site exhibits anomalous behavior in the SC state. The enhancement of the magnetic fluctuations in the SC state is unusual and suggests that the fluctuations are related to the unconventional SC pairing. We suggest that this phenomenon is a consequence of the spin degrees of freedom of the spin-triplet pairing.

  4. Superconducting optical modulator

    Science.gov (United States)

    Bunt, Patricia S.; Ference, Thomas G.; Puzey, Kenneth A.; Tanner, David B.; Tache, Nacira; Varhue, Walter J.

    2000-12-01

    An optical modulator based on the physical properties of high temperature superconductors has been fabricated and tested. The modulator was constructed form a film of Yttrium Barium Copper Oxide (YBCO) grown on undoped silicon with a buffer layer of Yttria Stabilized Zirconia. Standard lithographic procedures were used to pattern the superconducting film into a micro bridge. Optical modulation was achieved by passing IR light through the composite structure normal to the micro bridge and switching the superconducting film in the bridge region between the superconducting and non-superconducting states. In the superconducting state, IR light reflects from the superconducting film surface. When a critical current is passed through the micro bridge, it causes the film in this region to switch to the non-superconducting state allowing IR light to pass through it. Superconducting materials have the potential to switch between these two states at speeds up to 1 picosecond using electrical current. Presently, fiber optic transmission capacity is limited by the rate at which optical data can be modulated. The superconducting modulator, when combined with other components, may have the potential to increase the transmission capacity of fiber optic lines.

  5. Field-dependent critical state of high-Tc superconducting strip simultaneously exposed to transport current and perpendicular magnetic field

    Science.gov (United States)

    Xue, Cun; He, An; Yong, Huadong; Zhou, Youhe

    2013-12-01

    We present an exact analytical approach for arbitrary field-dependent critical state of high-Tc superconducting strip with transport current. The sheet current and flux-density profiles are derived by solving the integral equations, which agree with experiments quite well. For small transport current, the approximate explicit expressions of sheet current, flux-density and penetration depth for the Kim model are derived based on the mean value theorem for integration. We also extend the results to the field-dependent critical state of superconducting strip in the simultaneous presence of applied field and transport current. The sheet current distributions calculated by the Kim model agree with experiments better than that by the Bean model. Moreover, the lines in the Ia-Ba plane for the Kim model are not monotonic, which is quite different from that the Bean model. The results reveal that the maximum transport current in thin superconducting strip will decrease with increasing applied field which vanishes for the Bean model. The results of this paper are useful to calculate ac susceptibility and ac loss.

  6. Field-dependent critical state of high-Tc superconducting strip simultaneously exposed to transport current and perpendicular magnetic field

    Directory of Open Access Journals (Sweden)

    Cun Xue

    2013-12-01

    Full Text Available We present an exact analytical approach for arbitrary field-dependent critical state of high-Tc superconducting strip with transport current. The sheet current and flux-density profiles are derived by solving the integral equations, which agree with experiments quite well. For small transport current, the approximate explicit expressions of sheet current, flux-density and penetration depth for the Kim model are derived based on the mean value theorem for integration. We also extend the results to the field-dependent critical state of superconducting strip in the simultaneous presence of applied field and transport current. The sheet current distributions calculated by the Kim model agree with experiments better than that by the Bean model. Moreover, the lines in the Ia-Ba plane for the Kim model are not monotonic, which is quite different from that the Bean model. The results reveal that the maximum transport current in thin superconducting strip will decrease with increasing applied field which vanishes for the Bean model. The results of this paper are useful to calculate ac susceptibility and ac loss.

  7. Field-dependent critical state of high-Tc superconducting strip simultaneously exposed to transport current and perpendicular magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Xue, Cun; He, An; Yong, Huadong; Zhou, Youhe, E-mail: zhouyh@lzu.edu.cn [Key Laboratory of Mechanics on Disaster and Environment in Western China attached to the Ministry of Education of China, and Department of Mechanics and Engineering Sciences, College of Civil Engineering and Mechanics, Lanzhou University, Lanzhou, Gansu 730000 (China)

    2013-12-15

    We present an exact analytical approach for arbitrary field-dependent critical state of high-T{sub c} superconducting strip with transport current. The sheet current and flux-density profiles are derived by solving the integral equations, which agree with experiments quite well. For small transport current, the approximate explicit expressions of sheet current, flux-density and penetration depth for the Kim model are derived based on the mean value theorem for integration. We also extend the results to the field-dependent critical state of superconducting strip in the simultaneous presence of applied field and transport current. The sheet current distributions calculated by the Kim model agree with experiments better than that by the Bean model. Moreover, the lines in the I{sub a}-B{sub a} plane for the Kim model are not monotonic, which is quite different from that the Bean model. The results reveal that the maximum transport current in thin superconducting strip will decrease with increasing applied field which vanishes for the Bean model. The results of this paper are useful to calculate ac susceptibility and ac loss.

  8. Probing the density of states of two-level tunneling systems in silicon oxide films using superconducting lumped element resonators

    Energy Technology Data Exchange (ETDEWEB)

    Skacel, S. T. [Physikalisches Institut, Karlsruher Institut für Technologie, Wolfgang-Gaede-Straße 1, D-76131 Karlsruhe (Germany); Institut für Mikro- und Nanoelektronische Systeme, Karlsruher Institut für Technologie, Hertzstraße 16, D-76187 Karlsruhe (Germany); Kaiser, Ch.; Wuensch, S.; Siegel, M. [Institut für Mikro- und Nanoelektronische Systeme, Karlsruher Institut für Technologie, Hertzstraße 16, D-76187 Karlsruhe (Germany); Rotzinger, H.; Lukashenko, A.; Jerger, M.; Weiss, G. [Physikalisches Institut, Karlsruher Institut für Technologie, Wolfgang-Gaede-Straße 1, D-76131 Karlsruhe (Germany); Ustinov, A. V. [Physikalisches Institut, Karlsruher Institut für Technologie, Wolfgang-Gaede-Straße 1, D-76131 Karlsruhe (Germany); Russian Quantum Center, 100 Novaya St., Skolkovo, Moscow Region 143025 (Russian Federation)

    2015-01-12

    We have investigated dielectric losses in amorphous silicon oxide (a-SiO) thin films under operating conditions of superconducting qubits (mK temperatures and low microwave powers). For this purpose, we have developed a broadband measurement setup employing multiplexed lumped element resonators using a broadband power combiner and a low-noise amplifier. The measured temperature and power dependences of the dielectric losses are in good agreement with those predicted for atomic two-level tunneling systems (TLS). By measuring the losses at different frequencies, we found that the TLS density of states is energy dependent. This had not been seen previously in loss measurements. These results contribute to a better understanding of decoherence effects in superconducting qubits and suggest a possibility to minimize TLS-related decoherence by reducing the qubit operation frequency.

  9. Quantum state transfer and controlled-phase gate on one-dimensional superconducting resonators assisted by a quantum bus.

    Science.gov (United States)

    Hua, Ming; Tao, Ming-Jie; Deng, Fu-Guo

    2016-02-24

    We propose a quantum processor for the scalable quantum computation on microwave photons in distant one-dimensional superconducting resonators. It is composed of a common resonator R acting as a quantum bus and some distant resonators rj coupled to the bus in different positions assisted by superconducting quantum interferometer devices (SQUID), different from previous processors. R is coupled to one transmon qutrit, and the coupling strengths between rj and R can be fully tuned by the external flux through the SQUID. To show the processor can be used to achieve universal quantum computation effectively, we present a scheme to complete the high-fidelity quantum state transfer between two distant microwave-photon resonators and another one for the high-fidelity controlled-phase gate on them. By using the technique for catching and releasing the microwave photons from resonators, our processor may play an important role in quantum communication as well.

  10. Evidence for two coupled subsystems in the superconducting state of La2-xSrxCuO4

    Science.gov (United States)

    Rast, S.; Schneider, M. L.; Onellion, M.; Zeng, X. H.; Si, Weidong; Xi, X. X.; Abrecht, M.; Ariosa, D.; Pavuna, D.; Ren, Y. H.; Lüpke, G.; Perakis, I.

    2001-12-01

    We used a pump-probe technique to measure the transient change of optical reflectivity of both La2-xSrxCuO4, of various dopings, and slightly underdoped YBa2Cu3O7-x and NdBa2Cu3O7-x thin films. For the La2-xSrxCuO4 films, our data demonstrate the coexistence, in the superconducting state, of two coupled subsystems with different relaxation times and different contributions to the optical reflectivity. One subsystem is associated with the superconducting phase. By contrast, the data from YBa2Cu3O7-x and NdBa2Cu3O7-x shows that the coupling between the two subsystems is weak or absent.

  11. Frontiers in Superconducting Materials

    CERN Document Server

    Narlikar, Anant V

    2005-01-01

    Frontiers in Superconducting Materials gives a state-of-the-art report of the most important topics of the current research in superconductive materials and related phenomena. It comprises 30 chapters written by renowned international experts in the field. It is of central interest to researchers and specialists in Physics and Materials Science, both in academic and industrial research, as well as advanced students. It also addresses electronic and electrical engineers. Even non-specialists interested in superconductivity might find some useful answers.

  12. High-Temperature Superconductivity

    Science.gov (United States)

    Tanaka, Shoji

    2006-12-01

    A general review on high-temperature superconductivity was made. After prehistoric view and the process of discovery were stated, the special features of high-temperature superconductors were explained from the materials side and the physical properties side. The present status on applications of high-temperature superconductors were explained on superconducting tapes, electric power cables, magnets for maglev trains, electric motors, superconducting quantum interference device (SQUID) and single flux quantum (SFQ) devices and circuits.

  13. Geometry and magnetic-state induced phenomena in S/F nanohybrids: unusual flux pinning effects and bistable superconductivity

    Science.gov (United States)

    Villegas, Javier E.

    2009-03-01

    Superconducting/Ferromagnetic (S/F) hybrids exhibit a plethora of induced effects and novel physical properties, due to the interplay between the competing S and F orders. We will show a few examples of those, in a series of experiments on a simple hybrid system: a S thin film with an array of F nanodots. Changing the array geometry, the nanodots size or their magnetic-state allows to investigate a large variety of physical phenomena. We will focus on two of them: flux pinning effects and stray-magnetic-field induced manipulation of superconductivity. We will firstly consider geometry induced effects; in particular, we will compare the pinning properties of periodic, quasiperiodic, and fractal arrays [1]. Secondly, we will discuss the effects induced by particular nanodot magnetic-states. We will show experiments on the interaction between flux quanta and nanodot magnetic vortices, which can be used to obtain switchable flux pinning potentials [2]. Finally, we will describe an experiment in which the magnetic reversal events of the nanodot magnetic vortices are imprinted into the transport properties of a superconducting thin film [3]. This yields a very unusual hysteretic magnetoresistance. This effect is induced by the stray magnetic fields from the nanodots, which drive the superconducting-to-normal transition of the hybrid depending on the magnetic history. [4pt] [1] J.E. Villegas et al., Phys. Rev. Lett. 97, 027002 (2006). [0pt] [2] J.E. Villegas et al., Phys. Rev. B 77, 134510 (2008). [0pt] [3] J.E. Villegas et al., Phys. Rev. Lett. 99, 227001 (2007).

  14. Superconducting and normal state properties of heavily hole-doped diamond synthesized at high pressure

    Directory of Open Access Journals (Sweden)

    V.A. Sidorov, E.A. Ekimov, A.V. Rakhmanina, S.M. Stishov, E.D. Bauer and J.D. Thompson

    2006-01-01

    Full Text Available Diamonds, synthesized at high pressures and high temperatures in the presence of boron, are heavily hole-doped by incorporation of boron into the diamond lattice. These diamonds become superconducting below Tc=2–9 K. Synthesis in the systems B-C and B4C-C at P=9 GPa and T=2500–2800 K result in formation of polycrystalline carbonado-like material, whereas synthesis from B-C-H gives small single crystals and intergrowth plates. Dense superconducting bodies can be prepared by compacting these single crystal particles at P=8 GPa and T=1800 K. Specific heat and resistivity measurements in magnetic fields prove the bulk nature of superconductivity in all pressure-synthesized samples and provide a consistent set of materials parameters that favor a conventional weak-coupling electron–phonon interpretation of the superconducting mechanism at high hole doping. Schottky barrier tunneling conductance spectra, obtained with contacts fabricated at the surface of these hole-doped diamonds, indicate the appearance of superconducting gap below Tc.

  15. Applied superconductivity

    CERN Document Server

    Newhouse, Vernon L

    1975-01-01

    Applied Superconductivity, Volume II, is part of a two-volume series on applied superconductivity. The first volume dealt with electronic applications and radiation detection, and contains a chapter on liquid helium refrigeration. The present volume discusses magnets, electromechanical applications, accelerators, and microwave and rf devices. The book opens with a chapter on high-field superconducting magnets, covering applications and magnet design. Subsequent chapters discuss superconductive machinery such as superconductive bearings and motors; rf superconducting devices; and future prospec

  16. Activities on RF superconductivity at DESY

    Energy Technology Data Exchange (ETDEWEB)

    Matheisen, A. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); TESLA Collaboration

    1996-01-01

    At DESY the HERA electron storage ring is supplied with normal and superconducting cavities. The superconducting system transfers up to 1 MW klystron power to the beam. Experiences are reported on luminosity and machine study runs. Since 1993 one major activity in the field of RF superconducting cavities is the installation of the TESLA Test Facility. Set-up of hardware and first tests of s.c. resonators are presented. (R.P.). 11 refs.

  17. Optical Probe of the Superconducting Normal Mixed State in a Magnetic Penetration Thermometer

    Science.gov (United States)

    Stevenson, T. R.; Balvin, M. A.; Bandler, S. R.; Denis, K. L.; Lee, S. -J.; Nagler, P. C.; Smith, S. J.

    2016-01-01

    Using ultraviolet photon pulses, we have probed the internal behavior of a molybdenum-gold Magnetic Penetration Thermometer (MPT) that we designed for x-ray microcalorimetry. In this low-temperature detector, the diamagnetic response of a superconducting MoAu bilayer is used to sense temperature changes in response to absorbed photons. We have previously described an approximate model that explains the high responsivity of the detector to temperature changes as a consequence of a Meissner transition of the molybdenum-gold film in the magnetic field applied by the superconducting circuit used to bias the detector. We compare measurements of MPT heat capacity and thermal conductance, derived from UV photon pulse data, to our model predictions for the thermodynamic properties of the sensor and for the electron cooling obtained by quasiparticle recombination. Our data on electron cooling power is also relevant to the operation of other superconducting detectors, such as Microwave Kinetic Inductance Detectors.

  18. Induced spin-triplet pairing in the coexistence state of antiferromagnetism and singlet superconductivity: Collective modes and microscopic properties

    Science.gov (United States)

    Almeida, D. E.; Fernandes, R. M.; Miranda, E.

    2017-07-01

    The close interplay between superconductivity and antiferromagnetism in several quantum materials can lead to the appearance of an unusual thermodynamic state in which both orders coexist microscopically, despite their competing nature. A hallmark of this coexistence state is the emergence of a spin-triplet superconducting gap component, called a π triplet, which is spatially modulated by the antiferromagnetic wave vector, reminiscent of a pair density wave. In this paper, we investigate the impact of these π -triplet degrees of freedom on the phase diagram of a system with competing antiferromagnetic and superconducting orders. Although we focus on a microscopic two-band model that has been widely employed in studies of iron pnictides, most of our results follow from a Ginzburg-Landau analysis, and as such should be applicable to other systems of interest, such as cuprates and heavy fermion materials. The Ginzburg-Landau functional reveals not only that the π -triplet gap amplitude couples trilinearly with the singlet gap amplitude and the staggered magnetization magnitude but also that the π -triplet d -vector couples linearly with the magnetization direction. While in the mean-field level this coupling forces the d -vector to align parallel or antiparallel to the magnetization, in the fluctuation regime it promotes two additional collective modes—a Goldstone mode related to the precession of the d -vector around the magnetization and a massive mode, related to the relative angle between the two vectors, which is nearly degenerate with a Leggett-like mode associated with the phase difference between the singlet and triplet gaps. We also investigate the impact of magnetic fluctuations on the superconducting-antiferromagnetic phase diagram, showing that due to their coupling with the π -triplet order parameter the coexistence region is enhanced. This effect stems from the fact that the π -triplet degrees of freedom promote an effective attraction between

  19. Thin-film superconducting resonator tunable to the ground-state hyperfine splitting of $^{87}$Rb

    CERN Document Server

    Kim, Z; Hoffman, J E; Grover, J A; Voigt, K D; Cooper, B K; Ballard, C J; Palmer, B S; Hafezi, M; Taylor, J M; Anderson, J R; Dragt, A J; Lobb, C J; Orozco, L A; Rolston, S L; Wellstood, F C

    2011-01-01

    We describe a thin-film superconducting Nb microwave resonator, tunable to within 0.3 ppm of the hyperfine splitting of $^{87}$Rb at $f_{Rb}=6.834683$ GHz. We coarsely tuned the resonator using electron-beam lithography, decreasing the resonance frequency from 6.8637 GHz to 6.8278 GHz. For \\emph{in situ} fine tuning at 15 mK, the resonator inductance was varied using a piezoelectric stage to move a superconducting pin above the resonator. We found a maximum frequency shift of about 8.7 kHz per 60-nm piezoelectric step and a tuning range of 18 MHz.

  20. Superconducting states in frustrating t-J model. A model connecting high-T sub c cuprates, organic conductors and Na sub x CoO sub 2

    CERN Document Server

    Ogata, M

    2003-01-01

    A two-dimensional t-J model on a frustrating lattice is studied using mean-field variational theories with Gutzwiller approximation. We find that a superconducting state with broken time-reversal symmetry (d+id state) is realized in the parameter region close to the triangular lattice. The frustration enlarges the region of superconductivity when t 0 for electron doping. We also discuss SU(2) degeneracy at half-filling. The d + id state probably corresponds to the spin gap state at half-filling.

  1. Superconducting states in strongly correlated systems with nonstandard quasiparticles and real space pairing: an unconventional Fermi-liquid limit

    Directory of Open Access Journals (Sweden)

    J. Spałek

    2010-01-01

    Full Text Available We use the concept of generalized (almost localized Fermi Liquid composed of nonstandard quasiparticles with spin-dependence effective masses and the effective field induced by electron correlations. This Fermi liquid is obtained within the so-called statistically-consistent Gutzwiller approximation (SGA proposed recently [cf. J. Jędrak et al., arXiv: 1008.0021] and describes electronic states of the correlated quantum liquid. Particular emphasis is put on real space pairing driven by the electronic correlations, the Fulde-Ferrell state of the heavy-fermion liquid, and the d-wave superconducting state of high temperature curate superconductors in the overdoped limit. The appropriate phase diagrams are discussed showing in particular the limits of stability of the Bardeen-Cooper-Schrieffer (BCS type of state.

  2. Nodal quasiparticle lifetime in the superconducting state of Bi(2)Sr(2)CaCu(2)O(8+delta)

    Science.gov (United States)

    Corson; Orenstein; Oh; O'Donnell; Eckstein

    2000-09-18

    We have measured the complex conductivity sigma of a Bi(2)Sr(2)CaCu(2)O(8+delta) thin film between 0.2 and 0.8 THz. We find sigma in the superconducting state to be well described as the sum of contributions from quasiparticles, condensate, and order parameter fluctuations which draw 30% of the spectral weight from the condensate. An analysis based on this decomposition yields a quasiparticle scattering rate on the order of k(B)T/Planck's over 2pi for temperatures below T(c).

  3. Features of pseudogap and superconductivity states of YBa sub 2 Cu sub 3 O sub 7 sub - sub x

    CERN Document Server

    Misochko, O V; Dekorsy, T; Helm, M

    2002-01-01

    The relaxation dynamics of the lattice and low-energy quasi-particles of the YBa sub 2 Cu sub 3 O sub 7 sub - sub x superconductor is studied through the light reflection method within the wide temperature range. It is shown that for T > T sub c there exist two areas of temperature with qualitatively and quantitatively different excitation dynamics and the transition between these areas is of the hysteresis character. It is established also, that the character of the change in the relaxation dynamics of the charge carriers in the superconducting state indicates the anisotropic gap with zeroes on the Fermi surface

  4. Overview of data acquisition and central control system of steady state superconducting Tokamak (SST-1)

    Energy Technology Data Exchange (ETDEWEB)

    Pradhan, S., E-mail: pradhan@ipr.res.in; Mahajan, K.; Gulati, H.K.; Sharma, M.; Kumar, A.; Patel, K.; Masand, H.; Mansuri, I.; Dhongde, J.; Bhandarkar, M.; Chudasama, H.

    2016-11-15

    Highlights: • The paper gives overview on SST-1 data acquisition and central control system and future upgrade plans. • The lossless PXI based data acquisition of SST-1 is capable of acquiring around 130 channels with sampling frequency ranging from 10 KHz to 1 MHz sampling frequency. • Design, architecture and technologies used for central control system (CCS) of SST-1. • Functions performed by CCS. - Abstract: Steady State Superconducting Tokamak (SST-1) has been commissioned successfully and has been carrying out limiter assisted ohmic plasma experiments since the beginning of 2014 achieving a maximum plasma current of 75 kA at a central field of 1.5 T and the plasma duration ∼500 ms. In near future, SST-1 looks forward to carrying out elongated plasma experiments and stretching plasma pulses beyond 1 s. The data acquisition and central control system (CCS) for SST-1 are distributed, modular, hierarchical and scalable in nature The CCS has been indigenously designed, developed, implemented, tested and validated for the operation of SST-1. The CCS has been built using well proven technologies like Redhat Linux, vxWorks RTOS for deterministic control, FPGA based hardware implementation, Ethernet, fiber optics backbone for network, DSP for real-time computation & Reflective memory for high-speed data transfer etc. CCS in SST-1 controls & monitors various heterogeneous SST-1 subsystems dispersed in the same campus. The CCS consists of machine control system, basic plasma control system, GPS time synchronization system, storage area network (SAN) for centralize data storage, SST-1 networking system, real-time networks, SST-1 control room infrastructure and many other supportive systems. Machine Control System (MCS) is a multithreaded event driven system running on Linux based servers, where each thread of the software communicates to a unique subsystem for monitoring and control from SST-1 central control room through network programming. The CCS hardware

  5. Vortex-glass transformation within the surface superconducting state of β-phase Mo1-x Re x alloys

    Science.gov (United States)

    Sundar, Shyam; Chattopadhyay, M. K.; Sharath Chandra, L. S.; Rawat, R.; Roy, S. B.

    2017-02-01

    We have performed an experimental study on the temperature dependence of electrical resistivity ρ(T) and heat capacity C(T) of the Mo{}1-xRe x (x=0.20,0.25) alloy superconductors in different magnetic fields. In the presence of applied magnetic field, the electrical resistivity of these alloys goes to zero at a temperature well above the bulk superconducting transition temperature obtained with the help of heat capacity measurements in the same magnetic field. Our study indicates the presence of a surface superconducting state in these alloys, where the flux lines are pinned in the surface sheath of the superconductor. The configuration of the flux lines (two-dimensional pancake-like) in the surface sheath is understood in the realm of the flux-spot model. Experimental evidence in support of the surface mixed-state state or ‘Kulik vortex-state’ and the occurrence of a vortex-liquid to vortex-glass transition is presented.

  6. Tests of the nuclear equation of state and superfluid and superconducting gaps using the Cassiopeia A neutron star

    CERN Document Server

    Ho, Wynn C G; Heinke, Craig O; Potekhin, Alexander Y

    2014-01-01

    The observed rapid cooling of the Cassiopeia A neutron star can be interpreted as being caused by neutron and proton transitions from normal to superfluid and superconducting states in the stellar core. Here we present two new Chandra ACIS-S Graded observations of this neutron star and measurements of the neutron star mass M and radius R found from consistent fitting of both the X-ray spectra and cooling behavior. This comparison is only possible for individual nuclear equations of state. We test phenomenological superfluid and superconducting gap models which mimic many of the known theoretical models against the cooling behavior. Our best-fit solution to the Cassiopeia A data is one in which the (M,R) = (1.43 Msun,12.6 km) neutron star is built with the BSk21 equation of state, strong proton superconductor and moderate neutron triplet superfluid gap models, and a pure iron envelope or a thin carbon layer on top of an iron envelope, although there are still large observational and theoretical uncertainties.

  7. Steady-state thermal studies on the HIE-ISOLDE high-$\\beta$ superconducting cavities

    CERN Document Server

    Alberty, L

    2013-01-01

    The activity of the High Intensity and Energy ISOLDE (HIE-ISOLDE) project aims to construct a superconducting linac based on 101.28 MHz niobium sputtered Quarter Wave Resonators (QWRs). For this, several prototypes of superconducting cavities are currently being developed at CERN using OFE copper as substrate material for Niobium film coating. Two main concepts are currently under development: one consists of rolled, machined, deepdrawed and welded parts; the other is based on machined parts which are put together using electron beam welding. This study presents the results of simulations carried out in order to assess the thermal performance of different designs. The interest for such analysis was raised up before launching the manufacture of the first industrial series, since both rolled and bulk approaches seemed possible.

  8. Power system stabilization by superconducting magnetic energy storage with solid-state phase shifter

    Energy Technology Data Exchange (ETDEWEB)

    Mitani, Y.; Uranaka, T.; Tsuji, K. [Osaka Univ., Suita, Osaka (Japan). Dept. of Electrical Engineering

    1995-08-01

    In this paper, a new configuration of power system controller with a combination of superconducting magnetic energy storage and phase shifter, is proposed to improve the stability of a long distance bulk power transmission system. A power system stabilizing control scheme is also proposed. A related simulation shows that the proposed controller is effective for enhancement of power system stability independent of the location of controller in a long distance bulk power transmission system.

  9. Quasiparticle state density on the surface of superconducting thin films of MgB{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Bobba, F [Groupe de Physique des Solides, UMR75-88 au CNRS, Universities Paris 6 et 7, Paris (France); Roditchev, D [Groupe de Physique des Solides, UMR75-88 au CNRS, Universities Paris 6 et 7, Paris (France); Lamy, R [Groupe de Physique des Solides, UMR75-88 au CNRS, Universities Paris 6 et 7, Paris (France); Choi, E-M [NCRICS, Department of Physics, Pohang University, Pohang (Korea, Republic of); Kim, H-J [NCRICS, Department of Physics, Pohang University, Pohang (Korea, Republic of); Kang, W N [NCRICS, Department of Physics, Pohang University, Pohang (Korea, Republic of); Ferrando, V [Department of Physics, University of Genoa, Genoa (Italy); Ferdeghini, C [Department of Physics, University of Genoa, Genoa (Italy); Giubileo, F [Department of Physics, University of Salerno, Salerno (Italy); Sacks, W [Groupe de Physique des Solides, UMR75-88 au CNRS, Universities Paris 6 et 7, Paris (France); Lee, S-I [NCRICS, Department of Physics, Pohang University, Pohang (Korea, Republic of); Klein, J [Groupe de Physique des Solides, UMR75-88 au CNRS, Universities Paris 6 et 7, Paris (France); Cucolo, A M [Department of Physics, University of Salerno, Salerno (Italy)

    2003-02-01

    High-speed scanning tunnelling spectroscopy (STS) was used at low temperature to study the quasiparticle excitation spectrum on the surface of c-axis-oriented superconducting thin films of MgB{sub 2}. The tunnelling spectra measured on as-grown films were compared with those acquired on chemically etched samples. In most cases the STS reveals only one small superconducting gap to be present in the tunnelling spectra, consistent with c-axis tunnelling and the particular electronic band structure of MgB{sub 2}. We found that the etching leads to the enhancement of the gap energy by 25% from 2.2 {+-} 0.3 meV to 2.8 {+-} 0.3 meV, and to the modification of the temperature dependence of the superconducting gap which, in both cases, has clearly a non-BCS shape. We argue that the modification of the electronic structure at the surface of the material due to the etching is responsible for these changes and discuss the possible origins of the effect.

  10. Adiabatic passage for one-step generation of n-qubit Greenberger-Horne-Zeilinger states of superconducting qubits via quantum Zeno dynamics

    Science.gov (United States)

    Wu, Jin-Lei; Song, Chong; Xu, Jing; Yu, Lin; Ji, Xin; Zhang, Shou

    2016-09-01

    An efficient scheme is proposed for generating n-qubit Greenberger-Horne-Zeilinger states of n superconducting qubits separated by (n-1) coplanar waveguide resonators capacitively via adiabatic passage with the help of quantum Zeno dynamics in one step. In the scheme, it is not necessary to precisely control the time of the whole operation and the Rabi frequencies of classical fields because of the introduction of adiabatic passage. The numerical simulations for three-qubit Greenberger-Horne-Zeilinger state show that the scheme is insensitive to the dissipation of the resonators and the energy relaxation of the superconducting qubits. The three-qubit Greenberger-Horne-Zeilinger state can be deterministically generated with comparatively high fidelity in the current experimental conditions, though the scheme is somewhat sensitive to the dephasing of superconducting qubits.

  11. Non-BCS superconducting state in yttrium hydride at a record low value of the external pressure

    Science.gov (United States)

    Jarosik, Marcin W.; Szczȩśniak, Radosław; Wrona, Izabela A.; Kostrzewa, Małgorzata

    2017-01-01

    The ab initio calculations suggest that YH3 compound is a superconductor with the maximum value of the critical temperature (TC) for the record low external pressure equal to 17.7 GPa. Due to the high value of the electron-phonon coupling constant, the thermodynamic properties of the superconducting state in YH3 have been determined in the framework of the Eliashberg formalism. It has been shown that TC changes in the range from 45.91K to 27.29 K, for the value of the Coulomb pseudopotential μ⋆ ∈ . The parameters of the superconducting phase differ significantly from the values predicted by the BCS theory due to the significant strong-coupling and retardation effects: kBTC /ωln ∈ , where ωln denotes the logarithmic phonon frequency. In particular, the dimensionless ratios: RΔ = 2 Δ (0) /kBTC , RC = Δ C (TC) /CN (TC) and RH =TCCN (TC) /HC2(0) take the following values: RΔ ∈ , RC ∈ and RH ∈ . The symbol Δ represents the order parameter, Δ C is the specific heat jump, CN is the specific heat of the normal state, and HC is the thermodynamic critical field.

  12. State of the art of superconducting fault current limiters and their application to the electric power system

    Science.gov (United States)

    Morandi, Antonio

    2013-01-01

    Modern electric power systems are becoming more and more complex in order to meet new needs. Nowadays a high power quality is mandatory and there is the need to integrate increasing amounts of on-site generation. All this translates in more sophisticated electric network with intrinsically high short circuit rate. This network is vulnerable in case of fault and special protection apparatus and procedures needs to be developed in order to avoid costly or even irreversible damage. A superconducting fault current limiter (SFCL) is a device with a negligible impedance in normal operating conditions that reliably switches to a high impedance state in case of extra-current. Such a device is able to increase the short circuit power of an electric network and to contemporarily eliminate the hazard during the fault. It can be regarded as a key component for future electric power systems. In this paper the state of the art of superconducting fault current limiters mature for applications is briefly resumed and the potential impact of this device on the paradigm of design and operation of power systems is analyzed. In particular the use of the FCL as a mean to allow more interconnection of MV bus-bars as well an increased immunity with respect to the voltage disturbances induced by critical customer is discussed. The possibility to integrate more distributed generation in the distribution grid is also considered.

  13. Current-induced destruction of type I superconductivity: The role of the one- and two-dimensional mixed state

    Science.gov (United States)

    Robin, D.; Rinderer, L.; Posada, E.

    1982-02-01

    New experimental and theoretical results on the current-induced phase transition in cylindrical wires (tin) are presented: The London model for the intermediate state of current-carrying superconductors has been modified, taking into account magnetoresistance, and has been extended to hollow cylinders. Evidence for the one- and two-dimensional mixed state first proposed by Landau has been obtained from the study of the quasistatic voltage-current curves of solid and hollow cylindrical specimens, respectively. The kinetic phenomena during the current-induced destruction of superconductivity in solid cylindrical wires have previously been studied by Posada and Rinderer, but only measurements on hollow wires of high purity presented in this paper confirm the isothermal electromagnetic theory of Rothen and Bestgen for a current-induced phase transition. For currents close to Silsbee's critical current, in pure specimens as well as for impure specimens, for any current above the critical, the dynamic destruction of superconductivity in wires is no longer isothermal. For these cases the nonisothermal theory of Posada and Rinderer has been extended to the case of hollow cylinders and successfully compared with experiments.

  14. Solid state reaction synthesis and photoluminescence properties of Dy{sup 3+} doped Ca{sub 3}Sc{sub 2}Si{sub 3}O{sub 12} phosphor

    Energy Technology Data Exchange (ETDEWEB)

    Long, Qiang; Wang, Chuang; Li, Yanyan; Ding, Jianyan; Wang, Xicheng; Wang, Yuhua, E-mail: wyh@lzu.edu.cn

    2015-11-15

    Highlights: • Ca{sub 3−x}Sc{sub 2}Si{sub 3}O{sub 12}:xDy{sup 3+} (0.01 ≤ x ≤ 0.03) was successfully synthesized under a reducing atmosphere. • The thermal stability of the Ca{sub 2.975}Sc{sub 2}Si{sub 3}O{sub 12}:0.025Dy{sup 3+} is superior to commercial phosphors in theory and experiment. • The optimal chromaticity coordinates of Ca{sub 3}Sc{sub 2}Si{sub 3}O{sub 12}:Dy{sup 3+} is (x = 0.3425, y = 0.3343) upon 350 nm excitation. - Abstract: The white emission phosphor Ca{sub 3}Sc{sub 2}Si{sub 3}O{sub 12}:Dy{sup 3+} was synthesized by the solid-state reaction. Phase analysis and characteristic luminescence properties are investigated by X-ray diffraction and photoluminescence spectra measurement. Ca{sub 3}Sc{sub 2}Si{sub 3}O{sub 12}:Dy{sup 3+} phosphor shows strong absorption in 350–410 nm region and exhibits white emission with CIE chromaticity coordinates of (0.3425, 0.3343). Its emission intensity at 250 °C remained 74% of that measured at room temperature. Moreover, the activation energy is also calculated through the Arrhenius equation. The result shows that the thermostability of Ca{sub 3}Sc{sub 2}Si{sub 3}O{sub 12}:Dy{sup 3+} is superior than that of commercial phosphor Ca{sub 3}Sc{sub 2}Si{sub 3}O{sub 12}:Ce{sup 3+}. The outstanding luminescent properties indicate that Ca{sub 3}Sc{sub 2}Si{sub 3}O{sub 12}:Dy{sup 3+} could be a potential white light emission phosphor.

  15. Anisotropy of superconducting critical fields of {alpha}-(BEDT-TTF){sub 2}KHg(SCN){sub 4} under pressure

    Energy Technology Data Exchange (ETDEWEB)

    Jakob, S.; Neumaier, K.; Biberacher, W.; Kartsovnik, M. [Walther-Meissner-Inst., Garching (Germany)

    2007-07-01

    Our previous studies of the ''magnetic field - pressure - temperature'' phase diagram of the layered organic conductor {alpha}-(BEDT-TTF){sub 2}KHg(SCN){sub 4} have revealed an interesting interplay between a charge density wave (CDW) and a superconducting (SC) state. At a critical pressure of 2.5 kbar the CDW state is completely suppressed and a sharp transition into a SC state is observed below 100 mK. For pressures below 2.5 kbar there is a coexistence of the superconducting and CDW state, but this is likely a spatially inhomogenous state. The neighbouring of a CDW and SC state is an interesting situation and rises questions about the nature of the superconductivity. We have therefore investigated the anisotropy of the critical fields at a pressure slightly above the critical one. The experiments were performed in a dilution refrigerator down to 25 mK. Two-axes rotation of the magnetic field allowed the exact determination of the anisotropy parallel and perpendicular to the layers, but also the inplane anisotropy. (orig.)

  16. Two-dimensional topological superconducting phases emerged from d-wave superconductors in proximity to antiferromagnets

    Science.gov (United States)

    Zhu, Guo-Yi; Wang, Ziqiang; Zhang, Guang-Ming

    2017-05-01

    Motivated by the recent observations of nodeless superconductivity in the monolayer CuO2 grown on the Bi2Sr2CaCu2O8+δ substrates, we study the two-dimensional superconducting (SC) phases described by the two-dimensional t\\text-J model in proximity to an antiferromagnetic (AF) insulator. We found that i) the nodal d-wave SC state can be driven via a continuous transition into a nodeless d-wave pairing state by the proximity-induced AF field. ii) The energetically favorable pairing states in the strong field regime have extended s-wave symmetry and can be nodal or nodeless. iii) Between the pure d-wave and s-wave paired phases, there emerge two topologically distinct SC phases with (s+\\text{i}d) symmetry, i.e., the weak and strong pairing phases, and the weak pairing phase is found to be a Z 2 topological superconductor protected by valley symmetry, exhibiting robust gapless nonchiral edge modes. These findings strongly suggest that the high-T c superconductors in proximity to antiferromagnets can realize fully gapped symmetry-protected topological SC.

  17. Transition between different quantum states in a mesoscopic system: The superconducting ring

    Energy Technology Data Exchange (ETDEWEB)

    Horane, E.M. [Instituto Balseiro, Universidad Nacional de Cuyo and Comision Nacional de Energia Atomica, 8400 Bariloche (Argentina); Castro, J.I. [Departamento Fisico-Quimica, Facultad Filosofia Humanidades y Artes, Universidad Nacional de San Juan, San Juan (Argentina); Buscaglia, G.C.; Lopez, A. [Instituto Balseiro, and Centro Atomico Bariloche, Universidad Nacional de Cuyo and Comision Nacional de Energia Atomica, 8400 Bariloche (Argentina)

    1996-04-01

    We investigate the thermodynamic properties of a superconducting ring, both analytically and numerically, relying upon the Ginzburg-Landau theory. We find that modulated solutions for the order parameter play a role in describing the thermodynamic transitions between consecutive modes of uniform order parameter, associated with different quantum numbers. Exact expressions for these solutions are given in terms of elliptic functions. We identify the family of energy extrema which, being saddle points of the energy in the functional space of the distributions of the order parameter, represent the energy barrier to be overcome for transitions between different solutions. {copyright} {ital 1996 The American Physical Society.}

  18. Point contact characteristics of NbSe{sub 3} in the superconducting state

    Energy Technology Data Exchange (ETDEWEB)

    Escudero, R. [Instituto de Investigaciones en Materiales, Universidad Nacional, Autonoma de Mexico, Mexico, DF (Mexico); Briggs, A.; Monceau, P. [Centre de Recherches sur les Tres Basses Temperatures, CNRS, BP 166X, Grenoble (France)

    2001-07-23

    A study of the electronic properties of NbSe{sub 3} using NbSe{sub 3}-NbSe{sub 3} junctions has been made. Structures in the current against voltage curves and in the differential resistance against voltage curves were observed and studied as functions of temperature between 8 K and 0.4 K and magnetic field up to 1 T. Analysis of the data shows that the pressure applied at the contact is sufficient to make NbSe{sub 3} superconducting. (author)

  19. SC Power leads and cables - Nominal Current Test Performance of 2 kA-Class High-Tc Superconducting Cable Conductors and Its Implications for Cooling Systems for Utility Cables

    DEFF Research Database (Denmark)

    Willen, D. W. A; Daumling, M.; Rasmussen, C. N.

    2000-01-01

    at high currents. The critical currents of these conductors are in the range of 1-3 kA, and ac losses smaller than 1 W/m are measured at 2 kArms. AC currents with peak values exceeding the dc critical currents are applied. Increased losses, in excess of the expected magnitization losses are observed when...... individual layers in the cables saturate. The loss-contributions from other components of the cable system are discussed,and the implications for the cooling apparatus for superconducting utility cables are determined....

  20. Superconducting transistor

    Science.gov (United States)

    Gray, Kenneth E.

    1979-01-01

    A superconducting transistor is formed by disposing three thin films of superconducting material in a planar parallel arrangement and insulating the films from each other by layers of insulating oxides to form two tunnel junctions. One junction is biased above twice the superconducting energy gap and the other is biased at less than twice the superconducting energy gap. Injection of quasiparticles into the center film by one junction provides a current gain in the second junction.

  1. Knowledge insufficient: the management of haemoglobin SC disease.

    Science.gov (United States)

    Pecker, Lydia H; Schaefer, Beverly A; Luchtman-Jones, Lori

    2017-02-01

    Although haemoglobin SC (HbSC) accounts for 30% of sickle cell disease (SCD) in the United States and United Kingdom, evidence-based guidelines for genotype specific management are lacking. The unique pathology of HbSC disease is complex, characterized by erythrocyte dehydration, intracellular sickling and increased blood viscosity. The evaluation and treatment of patients with HbSC is largely inferred from studies of SCD consisting mostly of haemoglobin SS (HbSS) patients. These studies are underpowered to allow definitive conclusions about HbSC. We review the pathophysiology of HbSC disease, including known and potential differences between HbSS and HbSC, and highlight knowledge gaps in HbSC disease management. Clinical and translational research is needed to develop targeted treatments and to validate management recommendations for efficacy, safety and impact on quality of life for people with HbSC. © 2016 John Wiley & Sons Ltd.

  2. S-C Mylonites

    NARCIS (Netherlands)

    Lister, G.S.; Snoke, A.W.

    1984-01-01

    Two types of foliations are commonly developed in mylonites and mylonitic rocks: (a) S-surfaces related to the accumulation of finite strain and (b) C-surfaces related to displacement discontinuities or zones of relatively high shear strain. There are two types of S-C mylonites. Type I S-C mylonites

  3. Conservation State of Mural Paintings from a Historic House in Florianópolis-SC, Brazil. A Multidisciplinary Approach

    Directory of Open Access Journals (Sweden)

    Márcia Regina ESCORTEGANHA

    2013-03-01

    Full Text Available The scientific approach to conservation and monitoring of mural paintings executed in a historic house with an eclectic style of the twentieth century, located in Florianópolis, Santa Catarina, Brazil, is an example of interdisciplinary collaboration between conservators, historians, and scientists in planning and development actions for preventive maintenance as well as interventions of restoration. The mural paintings are recognized worldwide as an architectural element and property, which records the representations of the cultural landscape of an age. In this context, the painting technique found in this house and its state of conservation were investigated by evaluation of pigmented surfaces and then by optical and spectroscopic (IR and EDX techniques. These results were crucial for the record of the characteristic painting present in this building, showing a period marked by intense urban renewal in Brazilian cities.

  4. Resolving surface chemical states in XPS analysis of first row transition metals, oxides and hydroxides: Sc, Ti, V, Cu and Zn

    Energy Technology Data Exchange (ETDEWEB)

    Biesinger, Mark C., E-mail: biesingr@uwo.ca [Surface Science Western, University of Western Ontario, University of Western Ontario Research Park, Room LL31, 999 Collip Circle, London, Ontario, N6G 0J3 (Canada); ACeSSS (Applied Centre for Structural and Synchrotron Studies), University of South Australia, Mawson Lakes, SA 5095 (Australia); Lau, Leo W.M. [Surface Science Western, University of Western Ontario, University of Western Ontario Research Park, Room LL31, 999 Collip Circle, London, Ontario, N6G 0J3 (Canada); Department of Chemistry, University of Western Ontario, London, Ontario, N6A 5B7 (Canada); Gerson, Andrea R.; Smart, Roger St.C. [ACeSSS (Applied Centre for Structural and Synchrotron Studies), University of South Australia, Mawson Lakes, SA 5095 (Australia)

    2010-11-15

    Chemical state X-ray photoelectron spectroscopic analysis of first row transition metals and their oxides and hydroxides is challenging due to the complexity of the 2p spectra resulting from peak asymmetries, complex multiplet splitting, shake-up and plasmon loss structure, and uncertain, overlapping binding energies. A review of current literature shows that all values necessary for reproducible, quantitative chemical state analysis are usually not provided. This paper reports a more consistent, practical and effective approach to curve-fitting the various chemical states in a variety of Sc, Ti, V, Cu and Zn metals, oxides and hydroxides. The curve-fitting procedures proposed are based on a combination of (1) standard spectra from quality reference samples, (2) a survey of appropriate literature databases and/or a compilation of the literature references, and (3) specific literature references where fitting procedures are available. Binding energies, full-width at half maximum (FWHM) values, spin-orbit splitting values, asymmetric peak-shape fitting parameters, and, for Cu and Zn, Auger parameters values are presented. The quantification procedure for Cu species details the use of the shake-up satellites for Cu(II)-containing compounds and the exact binding energies of the Cu(0) and Cu(I) peaks. The use of the modified Auger parameter for Cu and Zn species allows for corroborating evidence when there is uncertainty in the binding energy assignment. These procedures can remove uncertainties in analysis of surface states in nano-particles, corrosion, catalysis and surface-engineered materials.

  5. Theoretical Study of Interplay Between Superconductivity and Itinerant Ferromagnetism

    Directory of Open Access Journals (Sweden)

    Subhra Kakani

    2014-08-01

    Full Text Available Following Green’s function technique and equation of motion method, the coexistence of superconductivity (SC and itinerant ferromagnetism (FM is investigated in a single band homogenous system. Self consistent equations for SC and FM order parameters, Δ and m or I respectively are derived. It is shown that there generally exists a coexistent (Δ ≠ 0, and m or I ≠ 0 solutions to the coupled equations of the order parameter in the, temperature range 0 < T < min(TC, TFM, where TC and TFM are respectively the superconducting and ferromagnetic transition temperatures. Expressions for specific heat, density of states, free energy and critical field are derived. The specific heat has linear temperature dependence as opposed to the exponential decrease in the BCS theory. The density of states for a finite m increases as opposed to that of a ferromagnetic metal. Free energy study reveals that FMSC state has lowest energy than the normal FM state and therefore realized at low enough temperature .Effect of small external field is also studied. The theory is applied to explain the observations in uranium based intermetallics systems UCoGe and UIr. The agreement between theory and experiments is quite encouraging.

  6. Spin-orbit-coupled superconductivity.

    Science.gov (United States)

    Lo, Shun-Tsung; Lin, Shih-Wei; Wang, Yi-Ting; Lin, Sheng-Di; Liang, C-T

    2014-06-25

    Superconductivity and spin-orbit (SO) interaction have been two separate emerging fields until very recently that the correlation between them seemed to be observed. However, previous experiments concerning SO coupling are performed far beyond the superconducting state and thus a direct demonstration of how SO coupling affects superconductivity remains elusive. Here we investigate the SO coupling in the critical region of superconducting transition on Al nanofilms, in which the strength of disorder and spin relaxation by SO coupling are changed by varying the film thickness. At temperatures T sufficiently above the superconducting critical temperature T(c), clear signature of SO coupling reveals itself in showing a magneto-resistivity peak. When T superconductivity. By studying such magneto-resistivity peaks under different strength of spin relaxation, we highlight the important effects of SO interaction on superconductivity.

  7. SHRUBBY TREE COMPONENT OF RIPARIAN CORRIDORS IN RESTORATION AND NATURAL REMAINING AREAS OF MATRIX FORESTRY, RIO NEGRINHO, SC STATE

    Directory of Open Access Journals (Sweden)

    Eliziane Carla Scariot

    2014-06-01

    Full Text Available http://dx.doi.org/10.5902/1980509814578The aim of this study was to analyze the shrubby tree component in riparian corridors in restoration process and natural remainders in a matrix forestry. We identified the richness, diversity, dispersal and pollination syndromes of the individuals and estimate the floristic similarity. The study was conducted at the producing farm of Pinus spp. wood Santa Alice, located in Rio Negrinho city, Santa Catarina state, Brazil. We adopted the center-quarter method for survey the shrubby tree component in four sample groups: CA (advanced stage of riparian corridors vegetation, CR (riparian corridors in restoration, MA (advanced stage of natural remaining, MI (intermediate stage of natural remaining. We found the highest richness and diversity index in MA and CR. Regarding the number of individuals, the dispersal and pollination syndromes predominant in all sample groups were zoochory and zoophilia. CR and CA had the highest percentage of floristic similarity while MA and MI did not form clusters. The sample group CR has composition, richness and diversity more similar to CA. This indicates that the restoration of riparian zones has conditions to rescue the components and the interactions of an ecological community.

  8. Anisotropic superconducting gap and elongated vortices with Caroli-De Gennes-Matricon states in the new superconductor Ta4Pd3Te16.

    Science.gov (United States)

    Du, Zengyi; Fang, Delong; Wang, Zhenyu; Li, Yufeng; Du, Guan; Yang, Huan; Zhu, Xiyu; Wen, Hai-Hu

    2015-01-01

    The superconducting state is formed by the condensation of a large number of Cooper pairs. The normal state electronic properties can give significant influence on the superconducting state. For usual type-II superconductors, the vortices are cylinder like with a round cross-section. For many two dimensional superconductors, such as Cuprates, albeit the in-plane anisotropy, the vortices generally have a round shape. In this paper we report results based on the scanning tunnelling microscopy/spectroscopy measurements on a newly discovered superconductor Ta4Pd3Te16. The chain-like conducting channels of PdTe2 in Ta4Pd3Te16 make a significant anisotropy of the in-plane Fermi velocity. We suggest at least one anisotropic superconducting gap with gap minima or possible node exists in this multiband system. In addition, elongated vortices are observed with an anisotropy of ξ||b/ξ&bottom⊥b ≈ 2.5. Clear Caroli-de Gennes-Matricon states are also observed within the vortex cores. Our results will initiate the study on the elongated vortices and superconducting mechanism in the new superconductor Ta4Pd3Te16.

  9. Probing the TLS density of states in thin a-SiO films using superconducting lumped element resonators

    Energy Technology Data Exchange (ETDEWEB)

    Skacel, Sebastian T. [Physikalisches Institut, Karlsruher Institut fuer Technologie, Wolfgang-Gaede-Strasse 1, D-76131 Karlsruhe (Germany); Institut fuer Mikro- und Nanoelektronische Systeme, Karlsruher Institut fuer Technologie, Hertzstrasse 16, D-76187 Karlsruhe (Germany); Kaiser, Christoph [Institut fuer Mikro- und Nanoelektronische Systeme, Karlsruher Institut fuer Technologie, Hertzstrasse 16, D-76187 Karlsruhe (Germany); Wuensch, Stefan; Siegel, Michael [Institut fuer Mikro- und Nanoelektronische Systeme, Karlsruher Institut fuer Technologie, Hertzstrasse 16, D-76187 Karlsruhe (Germany); Center for Functional Nanostructures, Karlsruher Institut fuer Technologie, Wolfgang-Gaede-Strasse 1a, D-76128 Karlsruhe (Germany); Rotzinger, Hannes; Lukashenko, Oleksandr; Jerger, Markus [Physikalisches Institut, Karlsruher Institut fuer Technologie, Wolfgang-Gaede-Strasse 1, D-76131 Karlsruhe (Germany); Weiss, Georg; Ustinov, Alexey V. [Physikalisches Institut, Karlsruher Institut fuer Technologie, Wolfgang-Gaede-Strasse 1, D-76131 Karlsruhe (Germany); Center for Functional Nanostructures, Karlsruher Institut fuer Technologie, Wolfgang-Gaede-Strasse 1a, D-76128 Karlsruhe (Germany)

    2013-07-01

    In the context of low-loss materials needed for superconducting qubits, we investigated the dielectric loss in the volume of a-SiO thin films at mK temperatures and single photon power levels. Our broadband measurement setup employs multiplexed lumped element resonators as well as suitable power combiner and low noise amplifier. This enables measurements on all resonators to be carried out in one cool down cycle. The results are in good agreement with the temperature and power dependence of the dielectric losses predicted for atomic two-level tunneling systems (TLSs). We find indication that the TLS density of states increases with frequency, which had not been seen in previous loss measurements.

  10. High-efficiency WSi superconducting nanowire single-photon detectors for quantum state engineering in the near infrared

    CERN Document Server

    Jeannic, H Le; Cavaillès, A; Marsili, F; Shaw, M D; Huang, K; Morin, O; Nam, S W; Laurat, J

    2016-01-01

    We report on high-efficiency superconducting nanowire single-photon detectors based on amorphous WSi and optimized at 1064 nm. At an operating temperature of 1.8 K, we demonstrated a 93% system detection efficiency at this wavelength with a dark noise of a few counts per second. Combined with cavity-enhanced spontaneous parametric down-conversion, this fiber-coupled detector enabled us to generate narrowband single photons with a heralding efficiency greater than 90% and a high spectral brightness of $0.6\\times10^4$ photons/(s$\\cdot$mW$\\cdot$MHz). Beyond single-photon generation at large rate, such high-efficiency detectors open the path to efficient multiple-photon heralding and complex quantum state engineering.

  11. Pressure induced superconductivity on the border of magnetic order in MnP.

    Science.gov (United States)

    Cheng, J-G; Matsubayashi, K; Wu, W; Sun, J P; Lin, F K; Luo, J L; Uwatoko, Y

    2015-03-20

    We report the discovery of superconductivity on the border of long-range magnetic order in the itinerant-electron helimagnet MnP via the application of high pressure. Superconductivity with T(sc)≈1  K emerges and exists merely near the critical pressure P(c)≈8  GPa, where the long-range magnetic order just vanishes. The present finding makes MnP the first Mn-based superconductor. The close proximity of superconductivity to a magnetic instability suggests an unconventional pairing mechanism. Moreover, the detailed analysis of the normal-state transport properties evidenced non-Fermi-liquid behavior and the dramatic enhancement of the quasiparticle effective mass near P(c) associated with the magnetic quantum fluctuations.

  12. 75As NQR and NMR Studies on the Superconducting State of Ca10Pt4As8(Fe1-xPtxAs)10

    Science.gov (United States)

    Kobayashi, Yoshiaki; Iida, Takefumi; Suzuki, Kazunori; Kawamata, Takayuki; Itoh, Masayuki; Sato, Masatoshi

    2014-01-01

    75As NQR and NMR measurements of Ca10Pt4As8(Fe1-xPtxAs)10 with the superconducting transition temperature Tc = 33.4 K have been carried out. The observed 75As NQR spectra can be divided into those from As sites in (Fe1-xPtx)As and PtAs2 layers. From the NQR spectra of 75As in the (Fe1-xPtxAs) layers, x is found to be ~20%, indicating that the superconductivity is robust against nonmagnetic impurities. This contradicts the existence of the sign reversal of the order parameter in the system. The 75As nuclear spin-lattice relaxation rates 1/T1's from the (Fe1-xPtx)As and PtAs2 layers indicate that the PtAs2 layers are in a nonmetallic state and do not contribute to the occurrence of the superconductivity.

  13. Normal-state charge dynamics in doped BaFe2As2: Roles of doping and necessary ingredients for superconductivity

    Science.gov (United States)

    Nakajima, M.; Ishida, S.; Tanaka, T.; Kihou, K.; Tomioka, Y.; Saito, T.; Lee, C. H.; Fukazawa, H.; Kohori, Y.; Kakeshita, T.; Iyo, A.; Ito, T.; Eisaki, H.; Uchida, S.

    2014-01-01

    In high-transition-temperature superconducting cuprates and iron arsenides, chemical doping plays an important role in inducing superconductivity. Whereas in the cuprate case, the dominant role of doping is to inject charge carriers, the role for the iron arsenides is complex owing to carrier multiplicity and the diversity of doping. Here, we present a comparative study of the in-plane resistivity and the optical spectrum of doped BaFe2As2, which allows for separation of coherent (itinerant) and incoherent (highly dissipative) charge dynamics. The coherence of the system is controlled by doping, and the doping evolution of the charge dynamics exhibits a distinct difference between electron and hole doping. It is found in common with any type of doping that superconductivity with high transition temperature emerges when the normal-state charge dynamics maintains incoherence and when the resistivity associated with the coherent channel exhibits dominant temperature-linear dependence. PMID:25077444

  14. Structural state of relaxor ferroelectrics PbSc0.5Ta0.5O3 and PbSc0.5Nb0.5O3 at high pressures up to 30 GPa

    Science.gov (United States)

    Maier, B. J.; Waeselmann, N.; Mihailova, B.; Angel, R. J.; Ederer, C.; Paulmann, C.; Gospodinov, M.; Friedrich, A.; Bismayer, U.

    2011-11-01

    The pressure-induced structural changes in perovskite-type (ABO3) Pb-based relaxor ferroelectrics are studied on the basis of in situ single-crystal synchrotron x-ray diffraction and Raman scattering experiments on PbSc0.5Ta0.5O3 and PbSc0.5Nb0.5O3 conducted under hydrostatic conditions up to 30 GPa. Complementary density functional theory calculations have been performed to compare the stability of various atomic configurations for both compounds at high pressures. By combining the experimental and theoretical results, the following sequence of structural transformations is proposed. At a characteristic pressure p1 the mesoscopic polar order is violated and a local antipolar order of Pb atoms as well as quasidynamical long-range order of antiphase octahedral tilts is developed. These structural changes facilitate the occurrence of a continuous phase transition at pc1>p1 from cubic to a nonpolar rhombohedral structure comprising antiphase octahedral tilts of equal magnitude (a-a-a-). At a characteristic pressure p2>pc1 the octahedral tilts around the cubic [100], [010], and [001] directions become different from each other on the mesoscopic scale. The latter precedes a second phase transition at pc2, which involves long-range order of Pb antipolar displacements along cubic [uv0] directions and a compatible mixed tilt system (a+b-b-) or long-range ordered antiphase tilts with unequal magnitudes (a0b-b-) without Pb displacement ordering. The phase-transition pattern at pc2 depends on the fine-scale degree of chemical B-site order in the structure.

  15. Blowpipe Mineralogy for Physics/Environment: Highest-Possible-Tc SC Quest; BOTH PERMANENT FOREVER Carb-IDES SOLID-State Sequestration AND Drought(s)-Elimination

    Science.gov (United States)

    Segler, Kurt; Williams, W.; Siegel, E.

    2010-03-01

    Detailed are old blowpipe[Kraus,Hunt,Ramsdell, Mineralogy (1936)] new applications:charcoal-block reduction of borates to yield (``N-NW'' of MgB2) Overhauser-[PR 35,1,411(1987); Intl.J.Mod.Phys.1,2 & 4,927(1987)]-``land'' predicted high-EST- POSSIBLE Tc SC ˜ ``LiD2''; very-early: Siegel[Phys.Stat.Sol.(a) 11,45(1972);Semiconductors & Insulators 5: 39,47,62(1979)] carb- IDES SOLID-state phase-TRANSITIONED CHEMICALLY-REDOX"-REACTED STABLE PERMANENT LONG-term STRATEGY, NOT ``CO2" BUT NON-gas Carbon-``ELEMENT"-sequestration: PROFITABLE MARKETABLE SALEABLE VALUABLE USEFUL ``Grab and Sell" TRUMPS ``cap and trade"!!!; Mott alloying/vertical metal-insulator transitions in ``borax-(GLASS)- beads"; and very-early Siegel [3rd Intl.Conf.Alt.Energy,Hemi- sphere/Springer(1980)-vol.5/p.459] ``FLYING-WATER" ``Hindenberg- effect"(H2-UP;H2O-DOWN) via H2-maximal-Archimedes-buoyancy ``chemical-rain-in-piplines", only via Siegel GMR enabled diffusive-magnetoresistance(DMR)enabled Siegel proprietary ``magnetic-H-valve": Renewables-H2-H2O purposely flexible versatile agile scaleable retrofitable integrated operating- system for PERMANENT drought(s)-elimination FOREVER!!!

  16. Superconductivity and symmetry breaking

    Energy Technology Data Exchange (ETDEWEB)

    Sarasua, L.G., E-mail: sarasua@fisica.edu.uy [Instituto de Fisica, Facultad de Ciencias, Universidad de la Republica, Montevideo (Uruguay)

    2012-02-15

    In the present work we consider the relation between superconductivity and spontaneous gauge symmetry breaking (SGBS). We show that ODLRO does not require in principle SBGS, even in the presence of particle number fluctuations, by examining exact solutions of a fermionic pairing model. The criteria become equivalent if a symmetry breaking field is allowed, which can be attributed to the interaction with the environment. However, superconducting states without SBGS are not forbidden.

  17. Three-flavor color superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Malekzadeh, H.

    2007-12-15

    I investigate some of the inert phases in three-flavor, spin-zero color-superconducting quark matter: the CFL phase (the analogue of the B phase in superfluid {sup 3}He), the A and A{sup *} phases, and the 2SC and sSC phases. I compute the pressure of these phases with and without the neutrality condition. Without the neutrality condition, after the CFL phase the sSC phase is the dominant phase. However, including the neutrality condition, the CFL phase is again the energetically favored phase except for a small region of intermediate densities where the 2SC/A{sup *} phase is favored. It is shown that the 2SC phase is identical to the A{sup *} phase up to a color rotation. In addition, I calculate the self-energies and the spectral densities of longitudinal and transverse gluons at zero temperature in color-superconducting quark matter in the CFL phase. I find a collective excitation, a plasmon, at energies smaller than two times the gap parameter and momenta smaller than about eight times the gap. The dispersion relation of this mode exhibits a minimum at some nonzero value of momentum, indicating a van Hove singularity. (orig.)

  18. Current limiting level-time characteristic of a superconducting fault current limiter

    Science.gov (United States)

    Tang, Y. J.; Yokomizu, Y.; Hayakawa, N.; Matsumura, T.; Okubo, H.; Kito, Y.

    A model superconducting fault current limiter (SE-FCL) has been developed. The adopted superconducting cable is composed of six strands insulated from each other. The current limiting level of the SC-FCL is measured under two types of overcurrent, a sinusoidal and an inrush current. The results show that the current limiting level of the SC-FCL Iq increases with an increase in the rate of rise of the overcurrent. By introducing a new parameter of time-to-quench tf, it is found that Iq increases with decreasing tf. This feature is taken as a current limiting level-time characteristic i.e. the Iq- tf characteristic. The existence of the Iq- tf characteristic found in the SC-FCL is qualitatively explained by measuring current distribution among the six strands. The superconducting cable is driven to the normal state strand by strand. Some delay in time is found from the quench of the first strand to that of the last and this is recognized as an Iq- tf characteristic in its current limiting performance.

  19. The long way to steady state fusion plasmas - the superconducting stellarator device Wendelstein 7-X

    CERN Document Server

    CERN. Geneva

    2016-01-01

    The stable generation of high temperature Hydrogen plasmas (ion and electron temperature in the range 10-20 keV) is the basis for the use of nuclear fusion to generate heat and thereby electric power. The most promising path is to use strong, toroidal, twisted magnetic fields to confine the electrically charged plasma particles in order to avoid heat losses to the cold, solid wall elements. Two magnetic confinement concepts have been proven to be most suitable: (a) the tokamak and (b) the stellarator. The stellarator creates the magnetic field by external coils only, the tokamak by combining the externally created field with the magnetic field generated by a strong current in the plasma. “Wendelstein 7-X” is the name of a large superconducting stellarator that went successfully into operation after 15 years of construction. With 30 m3 plasma volume, 3 T magnetic field on axis, and 10 MW micro wave heating power, Hydrogen plasmas are generated that allow one to establish a scientific basis for the extrapol...

  20. Heat Capacity and Thermal Conductance Measurements of a Superconducting-Normal Mixed State by Detection of Single 3 eV Photons in a Magnetic Penetration Thermometer

    Science.gov (United States)

    Stevenson, T. R.; Balvin, M. A.; Bandler, S. R.; Denis, K. L.; Lee, S.-J.; Nagler, P. C.; Smith, S. J.

    2015-01-01

    We report on measurements of the detected signal pulses in a molybdenum-gold Magnetic Penetration Thermometer (MPT) in response to absorption of one or more 3 eV photons. We designed and used this MPT sensor for x-ray microcalorimetry. In this device, the diamagnetic response of a superconducting MoAu bilayer is used to sense temperature changes in response to absorbed photons, and responsivity is enhanced by a Meissner transition in which the magnetic flux penetrating the sensor changes rapidly to minimize free energy in a mixed superconducting normal state. We have previously reported on use of our MPT to study a thermal phonon energy loss to the substrate when absorbing x-rays. We now describe results of extracting heat capacity C and thermal conductance G values from pulse height and decay time of MPT pulses generated by 3 eV photons. The variation in C and G at temperatures near the Meissner transition temperature (set by an internal magnetic bias field) allow us to probe the behavior in superconducting normal mixed state of the condensation energy and the electron cooling power resulting from quasi-particle recombination and phonon emission. The information gained on electron cooling power is also relevant to the operation of other superconducting detectors, such as Microwave Kinetic Inductance Detectors.

  1. Superconductivity fundamentals and applications

    CERN Document Server

    Buckel, Werner

    2004-01-01

    This is the second English edition of what has become one of the definitive works on superconductivity in German -- currently in its sixth edition. Comprehensive and easy to understand, this introductory text is written especially with the non-specialist in mind. The authors, both long-term experts in this field, present the fundamental considerations without the need for extensive mathematics, describing the various phenomena connected with the superconducting state, with liberal insertion of experimental facts and examples for modern applications. While all fields of superconducting phenomena are dealt with in detail, this new edition pays particular attention to the groundbreaking discovery of magnesium diboride and the current developments in this field. In addition, a new chapter provides an overview of the elements, alloys and compounds where superconductivity has been observed in experiments, together with their major characteristics. The chapter on technical applications has been considerably expanded...

  2. Mass measurement of 56Sc reveals a small A=56 odd-even mass staggering, implying a cooler accreted neutron star crust

    CERN Document Server

    Meisel, Z; Ahn, S; Bazin, D; Brown, B A; Browne, J; Carpino, J F; Chung, H; Cole, A L; Cyburt, R H; Estradé, A; Famiano, M; Gade, A; Langer, C; Matoš, M; Mittig, W; Montes, F; Morrissey, D J; Pereira, J; Schatz, H; Schatz, J; Scott, M; Shapira, D; Smith, K; Stevens, J; Tan, W; Tarasov, O; Towers, S; Wimmer, K; Winkelbauer, J R; Yurkon, J; Zegers, R G T

    2015-01-01

    We present the mass excesses of 52-57Sc, obtained from recent time-of-flight nuclear mass measurements at the National Superconducting Cyclotron Laboratory at Michigan State University. The masses of 56Sc and 57Sc were determined for the first time with atomic mass excesses of -24.85(59)(+0 -54) MeV and -21.0(1.3) MeV, respectively, where the asymmetric uncertainty for 56Sc was included due to possible contamination from a long-lived isomer. The 56Sc mass indicates a small odd-even mass staggering in the A = 56 mass-chain towards the neutron drip line, significantly deviating from trends predicted by the global FRDM mass model and favoring trends predicted by the UNEDF0 and UNEDF1 density functional calculations. Together with new shell-model calculations of the electron-capture strength function of 56Sc, our results strongly reduce uncertainties in model calculations of the heating and cooling at the 56Ti electron-capture layer in the outer crust of accreting neutron stars. We found that, in contrast to prev...

  3. Emergent Higgsless Superconductivity

    Directory of Open Access Journals (Sweden)

    Cristina Diamantini M.

    2017-01-01

    Full Text Available We present a new Higgsless model of superconductivity, inspired from anyon superconductivity but P- and T-invariant and generalizable to any dimension. While the original anyon superconductivity mechanism was based on incompressible quantum Hall fluids as average field states, our mechanism involves topological insulators as average field states. In D space dimensions it involves a (D-1-form fictitious pseudovector gauge field which originates from the condensation of topological defects in compact lowenergy effective BF theories. There is no massive Higgs scalar as there is no local order parameter. When electromagnetism is switched on, the photon acquires mass by the topological BF mechanism. Although the charge of the gapless mode (2 and the topological order (4 are the same as those of the standard Higgs model, the two models of superconductivity are clearly different since the origins of the gap, reflected in the high-energy sectors are totally different. In 2D thi! s type of superconductivity is explicitly realized as global superconductivity in Josephson junction arrays. In 3D this model predicts a possible phase transition from topological insulators to Higgsless superconductors.

  4. Recent developments in superconducting materials including ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Tachikawa, Kyoji

    1987-06-01

    This report describes the history of superconduction starting in 1911, when the superconducting phenomenon was first observed in murcury, until the recent discovery of superconducting materials with high critical temperatures. After outlining the BCS theory, basic characteristics are discussed including the critical temperature, magnetic field and current density to be reached for realizing the superconducting state. Various techniques for practical superconducting materials are discussed, including methods for producing extra fine multiconductor wires from such superconducting alloys as Nb-Ti, intermetallic Nb/sub 3/Sn compound and V/sub 3/Ga, as well as methods for producing wires of Nb/sub 3/Al, Nb/sub 3/(Al, Ge) and Nb/sub 3/Ge such as continuous melt quenching, electron beam irradiation, laser beam irradiation and chemical evaporation. Characteristics of superconducting ceramics are described, along with their applications including superconducting magnets and superconducting elements. (15 figs, 1 tab, 19 refs)

  5. Scattering states of a vortex in the proximity-induced superconducting state at the interface of a topological insulator and an s -wave superconductor

    Science.gov (United States)

    Durst, Adam C.

    2016-02-01

    We consider an isolated vortex in the two-dimensional proximity-induced superconducting state formed at the interface of a three-dimensional strong topological insulator (TI) and an s -wave superconductor. Prior calculations of the bound states of this system famously revealed a zero-energy state that is its own conjugate, a Majorana fermion bound to the vortex core. We calculate, not the bound states, but the scattering states of this system, and ask how the spin-momentum-locked massless Dirac form of the single-particle Hamiltonian, inherited from the TI surface, affects the cross section for scattering Bogoliubov quasiparticles from the vortex. As in the case of an ordinary superconductor, this is a two-channel problem with the vortex mixing particlelike and holelike excitations. As in the ordinary case, the same-channel differential cross section diverges in the forward direction due to the Aharonov-Bohm effect, resulting in an infinite total cross section but finite transport and skew cross sections. We calculate the transport and skew cross sections numerically, via a partial wave analysis, as a function of both quasiparticle excitation energy and chemical potential. Novel effects emerge as particlelike or holelike excitations are tuned through the Dirac point.

  6. Designing quantum-information-processing superconducting qubit circuits that exhibit lasing and other atomic-physics-like phenomena on a chip

    Science.gov (United States)

    Nori, Franco

    2008-03-01

    Superconducting (SC) circuits can behave like atoms making transitions between a few energy levels. Such circuits can test quantum mechanics at macroscopic scales and be used to conduct atomic-physics experiments on a silicon chip. This talk overviews a few of our theoretical studies on SC circuits and quantum information processing (QIP) including: SC qubits for single photon generation and for lasing; controllable couplings among qubits; how to increase the coherence time of qubits using a capacitor in parallel to one of the qubit junctions; hybrid circuits involving both charge and flux qubits; testing Bell's inequality in SC circuits; generation of GHZ states; quantum tomography in SC circuits; preparation of macroscopic quantum superposition states of a cavity field via coupling to a SC qubit; generation of nonclassical photon states using a SC qubit in a microcavity; scalable quantum computing with SC qubits; and information processing with SC qubits in a microwave field. Controllable couplings between qubits can be achieved either directly or indirectly. This can be done with and without coupler circuits, and with and without data-buses like EM fields in cavities (e.g., we will describe both the variable-frequency magnetic flux approach and also a generalized double-resonance approach that we introduced). It is also possible to ``turn a quantum bug into a feature'' by using microscopic defects as qubits, and the macroscopic junction as a controller of it. We have also studied ways to implement radically different approaches to QIP by using ``cluster states'' in SC circuits. For a general overview of this field, see, J.Q. You and F. Nori, Phys. Today 58 (11), 42 (2005)

  7. Gap distributions and spatial variation of electronic states in superconducting and pseudogap states of Bi{sub 2}Sr{sub 2}Ca{sub 2}CuO{sub 8+{delta}}

    Energy Technology Data Exchange (ETDEWEB)

    Gomes, K.K.; Pasupathy, A.; Pushp, A. [Department of Physics, Joseph Henry Laboratories, Princeton University, Princeton, NJ 08544 (United States); Ono, S.; Ando, Y. [Central Research Institute of Electric Power Industry, Komae, Tokyo 201-8511 (Japan); Yazdani, A. [Department of Physics, Joseph Henry Laboratories, Princeton University, Princeton, NJ 08544 (United States)], E-mail: yazdani@princeton.edu

    2007-09-01

    High-resolution scanning tunneling microscopy has been used to study the tunneling density of states in lightly underdoped samples of the high-T{sub c} superconductor Bi{sub 2}Sr{sub 2}Ca{sub 2}CuO{sub 8+{delta}} in both the superconducting and pseudogap states. We demonstrate that the tunneling gaps observed in these two states have identical spatial distributions and correlation lengths. This observation suggests that the two gaps, and hence the two phenomena, cannot have a competing origin. In addition, we present measurements that show that in contrast to the superconducting state, in which low energy quasi-particles are homogenous in real space, the states near the Fermi level are spatially inhomogeneous in the pseudogap state. The variation of the low-energy electronic states is spatially correlated with local changes in the pseudogap.

  8. Superconducting and normal state properties of the systems La1 -xMxPt4Ge12 (M = Ce ,Th )

    Science.gov (United States)

    Huang, K.; Yazici, D.; White, B. D.; Jeon, I.; Breindel, A. J.; Pouse, N.; Maple, M. B.

    2016-09-01

    Electrical resistivity, magnetization, and specific heat measurements were performed on polycrystalline samples of the filled-skutterudite systems La1 -xMxPt4Ge12(M =Ce and Th ) . Superconductivity in LaPt4Ge12 was quickly suppressed with Ce substitution and no evidence for superconductivity was found down to 1.1 K for x >0.2 . Temperature-dependent specific heat data at low temperatures for La1 -xCexPt4Ge12 show a change from power-law to exponential behavior, which may be an indication for multiband superconductivity in LaPt4Ge12 . A similar crossover was observed in the Pr1 -xCexPt4Ge12 system. However, the suppression rates of the superconducting transition temperatures Tc(x ) in the two systems are quite disparate, indicating a difference in the nature of superconductivity, which is conventional in LaPt4Ge12 and unconventional in PrPt4Ge12 . In comparison, a nearly linear and smooth evolution of Tc with increasing Th was observed in the La1 -xThxPt4Ge12 system, with no change of the superconducting energy gap in the temperature dependence of the specific heat, suggesting similar types of superconductivity in both the LaPt4Ge12 and ThPt4Ge12 compounds.

  9. Superconductivity in graphite intercalation compounds

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Robert P. [Cavendish Laboratory, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Weller, Thomas E.; Howard, Christopher A. [Department of Physics & Astronomy, University College of London, Gower Street, London WCIE 6BT (United Kingdom); Dean, Mark P.M. [Department of Condensed Matter Physics and Materials Science, Brookhaven National Laboratory, Upton, NY 11973 (United States); Rahnejat, Kaveh C. [Department of Physics & Astronomy, University College of London, Gower Street, London WCIE 6BT (United Kingdom); Saxena, Siddharth S. [Cavendish Laboratory, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Ellerby, Mark, E-mail: mark.ellerby@ucl.ac.uk [Department of Physics & Astronomy, University College of London, Gower Street, London WCIE 6BT (United Kingdom)

    2015-07-15

    Highlights: • Historical background of graphite intercalates. • Superconductivity in graphite intercalates and its place in the field of superconductivity. • Recent developments. • Relevant modeling of superconductivity in graphite intercalates. • Interpretations that pertain and questions that remain. - Abstract: The field of superconductivity in the class of materials known as graphite intercalation compounds has a history dating back to the 1960s (Dresselhaus and Dresselhaus, 1981; Enoki et al., 2003). This paper recontextualizes the field in light of the discovery of superconductivity in CaC{sub 6} and YbC{sub 6} in 2005. In what follows, we outline the crystal structure and electronic structure of these and related compounds. We go on to experiments addressing the superconducting energy gap, lattice dynamics, pressure dependence, and how these relate to theoretical studies. The bulk of the evidence strongly supports a BCS superconducting state. However, important questions remain regarding which electronic states and phonon modes are most important for superconductivity, and whether current theoretical techniques can fully describe the dependence of the superconducting transition temperature on pressure and chemical composition.

  10. Microwave spectroscopy evidence of superconducting pairing in the magnetic-field-induced metallic state of InO(x) films at zero temperature.

    Science.gov (United States)

    Liu, Wei; Pan, LiDong; Wen, Jiajia; Kim, Minsoo; Sambandamurthy, G; Armitage, N P

    2013-08-09

    We investigate the field-tuned quantum phase transition in a 2D low-disorder amorphous InO(x) film in the frequency range of 0.05 to 16 GHz employing microwave spectroscopy. In the zero-temperature limit, the ac data are consistent with a scenario where this transition is from a superconductor to a metal instead of a direct transition to an insulator. The intervening metallic phase is unusual with a small but finite resistance that is much smaller than the normal state sheet resistance at the lowest measured temperatures. Moreover, it exhibits a superconducting response on short length and time scales while global superconductivity is destroyed. We present evidence that the true quantum critical point of this 2D superconductor metal transition is located at a field B(sm) far below the conventionally defined critical field B(cross) where different isotherms of magnetoresistance cross each other. The superfluid stiffness in the low-frequency limit and the superconducting fluctuation frequency from opposite sides of the transition both vanish at B≈B(sm). The lack of evidence for finite-frequency superfluid stiffness surviving B(cross) signifies that B(cross) is a crossover above which superconducting fluctuations make a vanishing contribution to dc and ac measurements.

  11. Microwave Spectroscopy Evidence of Superconducting Pairing in the Magnetic-Field-Induced Metallic State of InOx Films at Zero Temperature

    Science.gov (United States)

    Liu, Wei; Pan, LiDong; Wen, Jiajia; Kim, Minsoo; Sambandamurthy, G.; Armitage, N. P.

    2013-08-01

    We investigate the field-tuned quantum phase transition in a 2D low-disorder amorphous InOx film in the frequency range of 0.05 to 16 GHz employing microwave spectroscopy. In the zero-temperature limit, the ac data are consistent with a scenario where this transition is from a superconductor to a metal instead of a direct transition to an insulator. The intervening metallic phase is unusual with a small but finite resistance that is much smaller than the normal state sheet resistance at the lowest measured temperatures. Moreover, it exhibits a superconducting response on short length and time scales while global superconductivity is destroyed. We present evidence that the true quantum critical point of this 2D superconductor metal transition is located at a field Bsm far below the conventionally defined critical field Bcross where different isotherms of magnetoresistance cross each other. The superfluid stiffness in the low-frequency limit and the superconducting fluctuation frequency from opposite sides of the transition both vanish at B≈Bsm. The lack of evidence for finite-frequency superfluid stiffness surviving Bcross signifies that Bcross is a crossover above which superconducting fluctuations make a vanishing contribution to dc and ac measurements.

  12. Superconducting electronics

    NARCIS (Netherlands)

    Rogalla, Horst

    1994-01-01

    During the last decades superconducting electronics has been the most prominent area of research for small scale applications of superconductivity. It has experienced quite a stormy development, from individual low frequency devices to devices with high integration density and pico second switching

  13. An experimental superconducting helical undulator

    Energy Technology Data Exchange (ETDEWEB)

    Caspi, S.; Taylor, C. [Lawrence Berkeley Lab., CA (United States)

    1995-12-31

    Improvements in the technology of superconducting magnets for high energy physics and recent advancements in SC materials with the artificial pinning centers (APC){sup 2}, have made a bifilar helical SC device an attractive candidate for a single-pass free electron laser (FEL){sup 3}. Initial studies have suggested that a 6.5 mm inner diameter helical device, with a 27 mm period, can generate a central field of 2-2.5 Tesla. Additional studies have also suggested that with a stored energy of 300 J/m, such a device can be made self-protecting in the event of a quench. However, since the most critical area associated with high current density SC magnets is connected with quenching and training, a short experimental device will have to be built and tested. In this paper we discuss technical issues relevant to the construction of such a device, including a conceptual design, fields, and forces.

  14. On the non-superconducting state in the phase diagram of Na{sub x}CoO{sub 2}.yH{sub 2}O

    Energy Technology Data Exchange (ETDEWEB)

    Sato, Masatoshi, E-mail: e43247a@nucc.cc.nagoya-u.ac.j [Department of Physics, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8602 (Japan); JST, TRIP, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8602 (Japan); Kobayashi, Yoshiaki [Department of Physics, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8602 (Japan); JST, TRIP, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8602 (Japan); Moyoshi, Taketo [Department of Physics, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8602 (Japan)

    2010-12-15

    For the understanding of the superconducting state of Na{sub x}CoO{sub 2}.yH{sub 2}O (x {approx} 0.3), we have carried out various kinds of experimental studies. Among results of these studies, we show here data of the specific heats, frequency-dependent ac-magnetic susceptibility and {sup 59}Co-NQR and {sup 2}D NMR and argue what electronic state is realized in the nonsuperconducting phase, which appears in the T-3{nu}{sub Q} phase diagram of this system, {nu}{sub Q} being the Co-NQR quadrupole frequency. The transition observed in this phase at {approx}7 K is not due to a magnetic ordering but possibly due to a charge ordering or the CDW formation. Slightly below this transition temperature, the system exhibit glassy behavior. The results indicate that the superconducting phase cannot necessarily be considered to be located near the magnetic phase.

  15. Induced superconductivity in the topological surface state of mercury telluride (HgTe)

    Energy Technology Data Exchange (ETDEWEB)

    Maier, Luis; Grimm, Manuel; Schueffelgen, Peter; Knott, Daniel; Ames, Christopher; Bruene, Christoph; Leubner, Philipp; Oostinga, Jeroen; Buhmann, Hartmut; Molenkamp, Laurens W. [Physikalisches Institut (EP3), Universitaet Wuerzburg, 97074 Wuerzburg (Germany)

    2013-07-01

    It has been recently demonstrated, that a strained grown layer of of HgTe is a 3D topological insulator (TI) exhibiting a single family of Dirac cone states at its surface. Since the bulk has nearly no carriers left, the transport through these structures is strongly dominated by the surface states. Because of the prediction of creation of Majorana bound states we are looking at a superconductor-TI interface. This talk presents our results on highly transparent S-TI-S junctions where we observe unusual behaviour in the Josephson current. Preliminary results of this project are published.

  16. Thermodynamic signature of a magnetic-field-driven phase transition within the superconducting state of an underdoped cuprate

    Science.gov (United States)

    Kemper, J. B.; Vafek, O.; Betts, J. B.; Balakirev, F. F.; Hardy, W. N.; Liang, Ruixing; Bonn, D. A.; Boebinger, G. S.

    2016-01-01

    More than a quarter century after the discovery of the high-temperature superconductor (HTS) YBa2Cu3O6+δ (YBCO; ref. ), studies continue to uncover complexity in its phase diagram. In addition to HTS and the pseudogap, there is growing evidence for multiple phases with boundaries which are functions of temperature (T), doping (p) and magnetic field. Here we report the low-temperature electronic specific heat (Celec) of YBa2Cu3O6.43 and YBa2Cu3O6.47 (p = 0.076 and 0.084) up to a magnetic field (H) of 34.5 T, a poorly understood region of the underdoped H-T-p phase space. We observe two regimes in the low-temperature limit: below a characteristic magnetic field H' ~ 12-15 T, Celec/T obeys an expected H1/2 behaviour; however, near H' there is a sharp inflection followed by a linear-in-H behaviour. H' rests deep within the superconducting phase and, thus, the linear-in-H behaviour is observed in the zero-resistance regime. In the limit of zero temperature, Celec/T is proportional to the zero-energy electronic density of states. At one of our dopings, the inflection is sharp only at lowest temperatures, and we thus conclude that this inflection is evidence of a magnetic-field-driven quantum phase transition.

  17. Order, disorder, and tunable gaps in the spectrum of Andreev bound states in a multiterminal superconducting device

    Science.gov (United States)

    Yokoyama, Tomohiro; Reutlinger, Johannes; Belzig, Wolfgang; Nazarov, Yuli V.

    2017-01-01

    We consider the spectrum of Andreev bound states (ABSs) in an exemplary four-terminal superconducting structure where four chaotic cavities are connected by quantum point contacts to the terminals and to each other forming a ring. We nickname the resulting device 4T-ring. Such a tunable device can be realized in a 2D electron gas-superconductor or a graphene-based hybrid structure. We concentrate on the limit of a short structure and large conductance of the point contacts where there are many ABS in the device forming a quasicontinuous spectrum. The energies of the ABS can be tuned by changing the superconducting phases of the terminals. We observe the opening and closing of gaps in the spectrum upon changing the phases. This concerns the usual proximity gap that separates the levels from zero energy as well as less usual "smile" gaps that split the levels of the quasicontinuous spectrum. We demonstrate a remarkable crossover in the overall spectrum that occurs upon changing the ratio of conductances of the inner and outer point contacts. At big values of the ratio (closed limit), the levels exhibit a generic behavior expected for the spectrum of a disordered system manifesting level repulsion and Brownian "motion" upon changing the phases. At small values of the ratio (open limit), the levels are squeezed into narrow bunches separated by wide smile gaps. Each bunch consists of almost degenerate ABS formed by Andreev reflection between two adjacent terminals. We study in detail the properties of the spectrum in the limit of a small ratio, paying special attention to the crossings of bunches. We distinguish two types of crossings: (i) with a regular phase dependence of the levels and (ii) crossings where the Brownian motion of the levels leads to an apparently irregular phase dependence. We work out a perturbation theory that explains the observations both at a detailed level of random scattering in the device and at a phenomenological level of positively defined

  18. Investigation of Precursor Superconducting State in YBa2Cu3O7-δ through In-Plane Optical Spectroscopy

    Science.gov (United States)

    Lee, Kegan; Kamiya, Keisuke; Nakajima, Masamichi; Miyasaka, Shigeki; Tajima, Setsuko

    2017-02-01

    A precursor of superconductivity has been searched in the in-plane optical spectra of underdoped YBa2Cu3Oy, in which the previous c-axis optical spectra showed the presence of superconducting carriers at a temperature far above Tc [Uykur et al., https://doi.org/10.1103/PhysRevLett.112.127003" xlink:type="simple">Phys. Rev. Lett. 112, 127003 (2014)][Dubroka et al., https://doi.org/10.1103/PhysRevLett.106.047006" xlink:type="simple">Phys. Rev. Lett. 106, 047006 (2011)]. By carefully subtracting the normal component from the imaginary part of conductivity σ2(ω), we found a clear in-plane response of superconducting condensate at the temperature consistent with the c-axis optical data. This confirms that the precursory superconductivity developing with decreasing doping level is an intrinsic phenomenon in the cuprates.

  19. Development of superconducting power devices in Europe

    Science.gov (United States)

    Tixador, Pascal

    2010-11-01

    Europe celebrated last year (2008) the 100-year anniversary of the first liquefaction of helium by H. Kammerling Onnes in Leiden. It led to the discovery of superconductivity in 1911. Europe is still active in the development of superconducting (SC) devices. The discovery of high critical temperature materials in 1986, again in Europe, has opened a lot of opportunities for SC devices by broking the 4 K cryogenic bottleneck. Electric networks experience deep changes due to the emergence of dispersed generation (renewable among other) and to the advances in ICT (Information Communication Technologies). The networks of the future will be “smart grids”. Superconductivity will offer “smart” devices for these grids like FCL (Fault Current Limiter) or VLI (Very Low Inductance) cable and would certainly play an important part. Superconductivity also will participate to the required sustainable development by lowering the losses and enhancing the mass specific powers. Different SC projects in Europe will be presented (Cable, FCL, SMES, Flywheel and Electrical Machine) but the description is not exhaustive. Nexans has commercialized the first two FCLs without public funds in the European grid (UK and Germany). The Amsterdam HTS cable is an exciting challenge in term of losses for long SC cables. European companies (Nexans, Air Liquide, Siemens, Converteam, …) are also very active for projects outside Europe (LIPA, DOE FCL, …).

  20. SC tuning fork

    CERN Multimedia

    The tuning fork used to modulate the radiofrequency system of the synchro cyclotron (SC) from 1957 to 1973. This piece is an unused spare part. The SC was the 1st accelerator built at CERN. It operated from August 1957 until it was closed down at the end of 1990. In the SC the magnetic field did not change with time, and the particles were accelerated in successive pulses by a radiofrequency voltage of some 20kV which varied in frequency as they spiraled outwards towards the extraction radius. The frequency varied from 30MHz to about 17Mz in each pulse. The tuning fork vibrated at 55MHz in vacuum in an enclosure which formed a variable capacitor in the tuning circuit of the RF system, allowing the RF to vary over the appropriate range to accelerate protons from the centre of the macine up to 600Mev at extraction radius. In operation the tips of the tuning fork blade had an amplitude of movement of over 1 cm. The SC accelerator underwent extensive improvements from 1973 to 1975, including the installation of a...

  1. SC2 dee

    CERN Multimedia

    1974-01-01

    Checking the positioning of the dee before its introduction into the vacuum chamber of SC2. The dee is mounted on a large cover plate which also carries the dee liner and the pump manifold. The dummy dee is fixed to the pole faces within the vacuum chamber.

  2. Superconductivity in doped Dirac semimetals

    Science.gov (United States)

    Hashimoto, Tatsuki; Kobayashi, Shingo; Tanaka, Yukio; Sato, Masatoshi

    2016-07-01

    We theoretically study intrinsic superconductivity in doped Dirac semimetals. Dirac semimetals host bulk Dirac points, which are formed by doubly degenerate bands, so the Hamiltonian is described by a 4 ×4 matrix and six types of k -independent pair potentials are allowed by the Fermi-Dirac statistics. We show that the unique spin-orbit coupling leads to characteristic superconducting gap structures and d vectors on the Fermi surface and the electron-electron interaction between intra and interorbitals gives a novel phase diagram of superconductivity. It is found that when the interorbital attraction is dominant, an unconventional superconducting state with point nodes appears. To verify the experimental signature of possible superconducting states, we calculate the temperature dependence of bulk physical properties such as electronic specific heat and spin susceptibility and surface state. In the unconventional superconducting phase, either dispersive or flat Andreev bound states appear between point nodes, which leads to double peaks or a single peak in the surface density of states, respectively. As a result, possible superconducting states can be distinguished by combining bulk and surface measurements.

  3. Realization of the Greenberg-Horne (ghz) State and Swap Gate with Superconducting Quantum-Interference Devices in a Cavity via Adiabatic Passage

    Science.gov (United States)

    Zheng, An-Shou; Cheng, Yong-Jin; Liu, Ji-Bing; Li, Tie-Ping

    We propose an alternative scheme to prepare the Greenberg-Horne-Zeilinger (GHZ) state and realize a SWAP gate by using Superconducting Quantum-interference devices (SQUIDs) coupled to a cavity. The present scheme, based on the adiabatic evolution of dark state, constitutes a decoherence-free method in the sense that spontaneous emission and cavity damping are avoided. Besides, the standard GHZ state can be directly obtained without measurement or any auxiliary SQUIDs and the construction of the SWAP gate does not require a composition of elementary gates from a universal set. Thus the procedure is simplified and decoherence is greatly suppressed.

  4. Ubiquitous presence of odd-frequency pairing state in superconducting junctions

    NARCIS (Netherlands)

    Golubov, A.A.; Tanaka, Y.; Kashiwaya, S.; Ueda, M.

    2007-01-01

    We predict generation of the odd-frequency pairing state near interfaces in conventional even-frequency superconductors. Using the quasiclassical Green's function formalism, we show that the pair amplitude can be decomposed into even and odd-frequency components. We demonstrate that, quite generally

  5. Superconductivity on the density-wave background with soliton-wall structure

    Energy Technology Data Exchange (ETDEWEB)

    Grigoriev, P.D. [L. D. Landau Institute for Theoretical Physics, Chernogolovka 142432 (Russian Federation)], E-mail: grigorev@itp.ac.ru

    2009-03-01

    Superconductivity (SC) may microscopically coexist with density wave (DW) when the nesting of the Fermi surface (FS) is not perfect. There are, at least, two possible microscopic structures of a DW state with quasi-particle states remaining on the Fermi level and leading to the Cooper instability: (i) the soliton-wall phase and (ii) the small ungapped FS pockets. The dispersion of such quasi-particle states strongly differs from that without DW, and so do the properties of SC on the DW background. The upper critical field H{sub c2} in such an SC state strongly increases as the system approaches the critical pressure, where SC first appears. H{sub c2} may considerably exceed its typical value without DW and has unusual upward curvature as function of temperature. The results obtained explain the experimental observations in layered organic superconductors (TMTSF){sub 2}PF{sub 6} and {alpha}-(BEDT-TTF){sub 2}KHg(SCN){sub 4}.

  6. RVB states in doped band insulators from Coulomb forces: theory and a case study of superconductivity in BiS2 layers

    Science.gov (United States)

    Baskaran, G.

    2016-12-01

    Doped band insulators, HfNCl, WO3, diamond, Bi2Se3, BiS2 families, STO/LAO interface, gate doped SrTiO3, MoS2 and so on are unusual superconductors. With an aim to build a general theory for superconductivity in doped band insulators, we focus on the BiS2 family which was discovered by Mizuguchi et al in 2012. While maximum Tc is only ˜11 K in {{LaO}}1-{{x}}{{{F}}}{{x}}{{BiS}}2, a number of experimental results are puzzling and anomalous in the sense that they resemble high T c and unconventional superconductors. Using a two orbital model of Usui, Suzuki and Kuroki, we show that the uniform low density free Fermi sea in {{LaO}}{0,5}{{{F}}}0.5{{BiS}}2 is unstable towards formation of the next nearest neighbor Bi-S-Bi diagonal valence bond (charged -2e Cooper pair) and their Wigner crystallization. Instability to this novel state of matter is caused by unscreened nearest neighbor coulomb repulsions (V ˜ 1 eV) and a hopping pattern with sulfur mediated diagonal next nearest neighbor Bi-S-Bi hopping t’ ˜ 0.88 eV, as well as larger than nearest neighbor Bi-Bi hopping, t ˜ 0.16 eV. Wigner crystals of Cooper pairs quantum melt for doping around x = 0.5 and stabilize certain resonating valence bond states and superconductivity. We study a few variational RVB states and suggest that BiS2 family members are latent high Tc superconductors, but challenged by competing orders and the fragile nature of many body states sustained by unscreened Coulomb forces. One of our superconducting states has d XY symmetry and a gap. We also predict a 2d Bose metal or vortex liquid normal state, as charged -2e valence bonds survive in the normal state.

  7. Spatially resolved quasiparticle tunneling spectra in the vortex state of optimally hole-doped YBa2Cu3Ox (Y-123)

    Science.gov (United States)

    Grinolds, M. S.; Beyer, A. D.; Teague, M. L.; Yeh, N.-C.

    2008-03-01

    We report cryogenic scanning tunneling spectroscopic (STS) studies of superconducting single crystalline Y-123 (Tc = 93 K) as a function of magnetic field. We study and model the influence of competing orders (COs), which coexist with superconductivity (SC), on the quasiparticle (QP) excitation spectra. The spatial dependence of the QP tunneling spectra is probed via STS to quantify the presence and spatial extent of SC and CO. Zero-field spatial maps of the QP spectra (100x100 nm^2) in Y-123 exhibit long-range spatial homogeneity of SCSC = 23±1 meV) associated with the spectral coherence peaks and the presence of CO (VCO = 33±2 meV) that gives rise to the spectral satellite features at δeff = [(δSC)^2+(VCO)^2]^1/2. Conductance maps of the Y-123 in finite fields demonstrate spatially varying spectra consistent with the periodicity a0 of the vortex lattice, with pseudogap (PG) like features at ˜VCO inside the vortex core and SC gap features remaining at ˜δSC outside the vortex core. Moreover, conductance histograms of the vortex state reveal that the ratio of the areas associated with δSC and VCO is comparable to (a0/ξab)^2, (ξab: in-plane SC coherence length). These results therefore suggest the important role of COs in the cuprate QP excitations. This work is supported by NSF Grant DMR-0405088.

  8. Effect of Al and Ca co-doping, in the presence of Te, in superconducting YBCO whiskers growth.

    Science.gov (United States)

    Pascale, Lise; Truccato, Marco; Operti, Lorenza; Agostino, Angelo

    2016-10-01

    High-Tc superconducting cuprates (HTSC) such as YBa2Cu3O7 - x (YBCO) are promising candidates for solid-state THz applications based on stacks of intrinsic Josephson junctions (IJJs) with atomic thickness. In view of future exploitation of IJJs, high-quality superconducting YBCO tape-like single crystals (whiskers) have been synthesized from Ca-Al-doped precursors in the presence of Te. The main aim of this paper is to determine the importance of the simultaneous use of Al, Te and Ca in promoting YBCO whiskers growth with good superconducting properties (Tc = 79-84 K). Further, single-crystal X-ray diffraction (SC-XRD) refinements of tetragonal YBCO whiskers (P4/mmm) are reported to fill the literature lack of YBCO structure investigations. All the as-grown whiskers have also been investigated by means of X-ray powder diffraction (XRPD), scanning electron microscopy (SEM) and energy dispersive X-ray spectroscopy (EDS). Our results demonstrate that the interplay of Ca, Te and Al elements is clearly necessary in order to obtain superconducting YBCO whiskers. The data obtained from SC-XRD analyses confirm the highly crystalline nature of the whiskers grown. Ca and Al enter the structure by replacing the Y and the octahedral coordinated Cu1 site, respectively, as in other similar orthorhombic compounds, while Te does not enter the structure of whiskers but its presence in the precursor is essential to the growth of the crystals.

  9. Charge ordering phenomena and superconductivity in underdoped cuprates

    Energy Technology Data Exchange (ETDEWEB)

    Tassini, Leonardo [Bayerische Akademie der Wissenschaften, Muenchen (Germany). Lehrstuhl E23 fuer Technische Physik

    2008-01-16

    In this thesis electronic properties of two prototypical copper-oxygen superconductors were studied with Raman scattering. The underdoped regime including the onset point of superconductivity p{sub sc1} was investigated. Evidence of quasi one-dimensional (1D) dynamical stripes was found. The 1D structures have a universal preferential orientation along the diagonals of the CuO{sub 2} planes below p{sub sc1}. At p{sub sc1}, lattice and electron dynamics change discontinuously. The results show that charge ordering drives the transition at p{sub sc1} and that the maximal transition temperature to superconductivity at optimal doping T{sub c}{sup MAX} depends on the type of ordering at p{sub sc1}. (orig.)

  10. Intercalated Nanocomposites Based on High-Temperature Superconducting Ceramics and Their Properties

    Directory of Open Access Journals (Sweden)

    Sevan Davtyan

    2009-12-01

    Full Text Available High temperature superconducting (SC nanocomposites based on SC ceramics and various polymeric binders were prepared. Regardless of the size of the ceramics’ grains, the increase of their amount leads to an increase of resistance to rupture and modulus and a decrease in limiting deformation, whereas an increase in the average ceramic grain size worsens resistance properties. The SC, thermo-chemical, mechanical and dynamic-mechanical properties of the samples were investigated. Superconducting properties of the polymer ceramic nanocomposites are explained by intercalation of macromolecule fragments into the interstitial layer of the ceramics’ grains. This phenomenon leads to a change in the morphological structure of the superconducting nanocomposites.

  11. Coupled superconducting flux qubits

    NARCIS (Netherlands)

    Plantenberg, J.H.

    2007-01-01

    This thesis presents results of theoretical and experimental work on superconducting persistent-current quantum bits. These qubits offer an attractive route towards scalable solid-state quantum computing. The focus of this work is on the gradiometer flux qubit which has a special geometric design, t

  12. Coupled superconducting flux qubits

    NARCIS (Netherlands)

    Plantenberg, J.H.

    2007-01-01

    This thesis presents results of theoretical and experimental work on superconducting persistent-current quantum bits. These qubits offer an attractive route towards scalable solid-state quantum computing. The focus of this work is on the gradiometer flux qubit which has a special geometric design, t

  13. High Resolution Polar Kerr Effect Measurements of Sr2RuO4: Evidence for Broken Time Reversal Symmetry in the Superconducting State

    Energy Technology Data Exchange (ETDEWEB)

    Xia, Jing

    2010-04-05

    Polar Kerr effect in the spin-triplet superconductor Sr{sub 2}RuO{sub 4} was measured with high precision using a Sagnac interferometer with a zero-area Sagnac loop. We observed non-zero Kerr rotations as big as 65 nanorad appearing below T{sub c} in large domains. Our results imply a broken time reversal symmetry state in the superconducting state of Sr{sub 2}RuO{sub 4}, similar to {sup 3}He-A.

  14. Preparation of Greenberger-Horne-Zeilinger entangled states with multiple superconducting quantum-interference device qubits or atoms in cavity QED

    Science.gov (United States)

    Yang, Chui-Ping; Han, Siyuan

    2004-12-01

    A scheme is proposed for generating Greenberger-Horne-Zeilinger (GHZ) entangled states of multiple superconducting quantum-interference device (SQUID) qubits by the use of a microwave cavity. The scheme operates essentially by creating a single photon through an auxiliary SQUID built in the cavity and performing a joint multiqubit phase shift with assistance of the cavity photon. It is shown that entanglement can be generated using this method, deterministic and independent of the number of SQUID qubits. In addition, we show that the present method can be applied to preparing many atoms in a GHZ entangled state, with tolerance to energy relaxation during the operation.

  15. Superconductivity in a chiral nanotube

    Science.gov (United States)

    Qin, F.; Shi, W.; Ideue, T.; Yoshida, M.; Zak, A.; Tenne, R.; Kikitsu, T.; Inoue, D.; Hashizume, D.; Iwasa, Y.

    2017-02-01

    Chirality of materials are known to affect optical, magnetic and electric properties, causing a variety of nontrivial phenomena such as circular dichiroism for chiral molecules, magnetic Skyrmions in chiral magnets and nonreciprocal carrier transport in chiral conductors. On the other hand, effect of chirality on superconducting transport has not been known. Here we report the nonreciprocity of superconductivity--unambiguous evidence of superconductivity reflecting chiral structure in which the forward and backward supercurrent flows are not equivalent because of inversion symmetry breaking. Such superconductivity is realized via ionic gating in individual chiral nanotubes of tungsten disulfide. The nonreciprocal signal is significantly enhanced in the superconducting state, being associated with unprecedented quantum Little-Parks oscillations originating from the interference of supercurrent along the circumference of the nanotube. The present results indicate that the nonreciprocity is a viable approach toward the superconductors with chiral or noncentrosymmetric structures.

  16. Field-induced magnetic phases in the normal and superconducting states of ErNi2B2C

    DEFF Research Database (Denmark)

    Jensen, A.; Toft, K.N.; Abrahamsen, A.B.;

    2004-01-01

    We present a comprehensive neutron-diffraction study of the magnetic structures of ErNi2B2C in the presence of a magnetic field applied along [010], [110], or [001]. In zero field, the antiferromagnetic structure is transversely polarized with Qapproximate to0.55a* and the moments along the b...... no hysteresis and stays stable up to a field close to the upper critical field of superconductivity, when the field is applied along [010]. Except for this possible effect, the influences of the superconducting electrons on the magnetic structures are not directly visible. Another peculiarity is that Q rotates...

  17. Preparation and characterization of Sc doped MgB2 wires

    Science.gov (United States)

    Grivel, J.-C.; Burdusel, M.

    2016-09-01

    The in-situ technique was used to manufacture scandium (Sc) doped MgB2 wires in a composite Cu-Nb sheath. After reaction at 700 °C, at most 1 at.% Mg was replaced by Sc in the MgB2 phase, without significant influence on its superconducting transition temperature. For higher Sc concentrations in the nominal composition, the formation of Sc-rich impurity phases was evidenced by SEM/EDS observations. The critical current density and accommodation field of the wires are weakly dependant on the Sc content. It is believed that these effects are related more to modifications of the thermal behaviour of the precursor powders revealed by DTA measurements than to actual doping. The best performance was obtained in a wire with Mg:Sc = 0.995_0.005 atomic ratio.

  18. Reassessment of the electronic state, magnetism, and superconductivity in high-Tc cuprates with the Nd2CuO4 structure

    Science.gov (United States)

    Naito, Michio; Krockenberger, Yoshiharu; Ikeda, Ai; Yamamoto, Hideki

    2016-04-01

    The electronic phase diagram of the cuprates remains enigmatic and is still a key ingredient to understand the mechanism of high-Tc superconductivity. It has been believed for a long time that parent compounds of cuprates were universally antiferromagnetic Mott insulators (charge-transfer insulators) and that high-Tc superconductivity would develop upon doping holes or electrons in a Mott-Hubbard insulator ("doped Mott-insulator scenario"). However, our recent discovery of superconductivity in the parent compounds of square-planar cuprates with the Nd2CuO4 (T') structure and the revised electronic phase diagram in T' cuprates urged a serious reassessment to the above scenario. In this review, we present the main results derived from our synthesis and experiments on T' cuprates in the undoped or heavily underdoped regime over 20 years, including material issues and basic physics. The key material issue is how to remove excess oxygen ions at the apical site without introducing oxygen vacancies in the CuO2 planes. In order to put this into practice, the basic knowledge of complex solid-state chemistry in T' cuprates is required, which is also included in this review.

  19. Distinct superconducting states in the pressure-induced metallic structures of the nominal semimetal Bi[subscript 4]Te[subscript 3

    Energy Technology Data Exchange (ETDEWEB)

    Jeffries, J.R.; Sharma, A.L. Lima; Sharma, P.A.; Spataru, C.D.; McCall, S.K.; Sugar, J.D.; Weir, S.T.; Vohra, Y.K. (Sandia); (LLNL); (UAB)

    2011-11-07

    The end members, Bi and Bi{sub 2}Te{sub 3}, of the infinitely adaptive (Bi{sub 2})m(Bi{sub 2}Te{sub 3}){sub n} series of compounds have not only been revealed to be topological insulators under the appropriate conditions, but have also been shown to be superconductors under pressure, suggesting the potential for bulk superconductor-topological-insulator interfaces and associated quantum computing applications. Herein, we report the pressure-dependent evolution of the structure and electrical transport of the nominal semimetal Bi4Te{sub 3}, a member of the (Bi{sub 2})m(Bi{sub 2}Te{sub 3}){sub n} series. Under pressure, Bi4Te{sub 3} undergoes several structural phase transformations, ultimately yielding a metallic body-centered-cubic structure exhibiting superconductivity with a maximum T{sub c} = 8.4 K at 16.2 GPa. The occurrence of structure-dependent superconductivity in Bi{sub 4}Te{sub 3} is remarkably similar to the end members of the (Bi{sub 2})m(Bi{sub 2}Te{sub 3}){sub n} series, intimating a convergence to high-pressure universal behavior that may expose the subtle variations that lead to the topological insulating and superconducting states in these systems.

  20. Hybrid superconducting neutron detectors

    Energy Technology Data Exchange (ETDEWEB)

    Merlo, V.; Lucci, M.; Ottaviani, I. [Dipartimento di Fisica, Università Tor Vergata, Via della Ricerca Scientifica, I-00133 Roma (Italy); Salvato, M.; Cirillo, M. [Dipartimento di Fisica, Università Tor Vergata, Via della Ricerca Scientifica, I-00133 Roma (Italy); CNR SPIN Salerno, Università di Salerno, Via Giovanni Paolo II, n.132, 84084 Fisciano (Italy); Scherillo, A. [Science and Technology Facility Council, ISIS Facility Chilton, Didcot, Oxfordshire OX11 0QX (United Kingdom); Celentano, G. [ENEA Frascati Research Centre, Via. E. Fermi 45, 00044 Frascati (Italy); Pietropaolo, A., E-mail: antonino.pietropaolo@enea.it [ENEA Frascati Research Centre, Via. E. Fermi 45, 00044 Frascati (Italy); Mediterranean Institute of Fundamental Physics, Via Appia Nuova 31, 00040 Marino, Roma (Italy)

    2015-03-16

    A neutron detection concept is presented that is based on superconductive niobium (Nb) strips coated by a boron (B) layer. The working principle of the detector relies on the nuclear reaction, {sup 10}B + n → α + {sup 7}Li, with α and Li ions generating a hot spot on the current-biased Nb strip which in turn induces a superconducting-normal state transition. The latter is recognized as a voltage signal which is the evidence of the incident neutron. The above described detection principle has been experimentally assessed and verified by irradiating the samples with a pulsed neutron beam at the ISIS spallation neutron source (UK). It is found that the boron coated superconducting strips, kept at a temperature T = 8 K and current-biased below the critical current I{sub c}, are driven into the normal state upon thermal neutron irradiation. As a result of the transition, voltage pulses in excess of 40 mV are measured while the bias current can be properly modulated to bring the strip back to the superconducting state, thus resetting the detector. Measurements on the counting rate of the device are presented and the basic physical features of the detector are discussed.

  1. Reassessment of the electronic state, magnetism, and superconductivity in high-T{sub c} cuprates with the Nd{sub 2}CuO{sub 4} structure

    Energy Technology Data Exchange (ETDEWEB)

    Naito, Michio, E-mail: minaito@cc.tuat.ac.jp [Department of Applied Physics, Tokyo University of Agriculture and Technology, Naka-cho 2-24-16, Koganei, Tokyo 184-8588 (Japan); Krockenberger, Yoshiharu; Ikeda, Ai; Yamamoto, Hideki [NTT Basic Research Laboratories, NTT Corporation, 3-1 Morinosato-Wakamiya, Atsugi, Kanagawa 243-0198 (Japan)

    2016-04-15

    Highlights: • The 30-year history of “electron-doped” cuprates is reviewed, including basic physics and material issues. • Undoped cuprates with the Nd{sub 2}CuO{sub 4} (T’) structure are superconducting with T{sub c} over 30 K. • Electron doping by Ce in T’-RE{sub 2}CuO{sub 4} lowers T{sub c} and the highest T{sub c} is obtained at no doping. - Abstract: The electronic phase diagram of the cuprates remains enigmatic and is still a key ingredient to understand the mechanism of high-T{sub c} superconductivity. It has been believed for a long time that parent compounds of cuprates were universally antiferromagnetic Mott insulators (charge-transfer insulators) and that high-T{sub c} superconductivity would develop upon doping holes or electrons in a Mott–Hubbard insulator (“doped Mott-insulator scenario”). However, our recent discovery of superconductivity in the parent compounds of square-planar cuprates with the Nd{sub 2}CuO{sub 4} (T’) structure and the revised electronic phase diagram in T’ cuprates urged a serious reassessment to the above scenario. In this review, we present the main results derived from our synthesis and experiments on T’ cuprates in the undoped or heavily underdoped regime over 20 years, including material issues and basic physics. The key material issue is how to remove excess oxygen ions at the apical site without introducing oxygen vacancies in the CuO{sub 2} planes. In order to put this into practice, the basic knowledge of complex solid-state chemistry in T’ cuprates is required, which is also included in this review.

  2. Ripple Field AC Losses in 10-MW Wind Turbine Generators With a MgB2 Superconducting Field Winding

    DEFF Research Database (Denmark)

    Liu, Dong; Polinder, Henk; Magnusson, Niklas

    2016-01-01

    Superconducting (SC) synchronous generators are proposed as a promising candidate for 10-20-MW direct-drive wind turbines because they can have low weights and small sizes. A common way of designing an SC machine is to use SC wires with high current-carrying capability in the dc field winding...

  3. Quasiparticle relaxation dynamics in spin-density-wave and superconducting SmFeAsO1-xFx single crystals

    Science.gov (United States)

    Mertelj, T.; Kusar, P.; Kabanov, V. V.; Stojchevska, L.; Zhigadlo, N. D.; Katrych, S.; Bukowski, Z.; Karpinski, J.; Weyeneth, S.; Mihailovic, D.

    2010-06-01

    We investigate the quasiparticle (QP) relaxation and low-energy electronic structure in undoped SmFeAsO and near-optimally doped SmFeAsO0.8F0.2 single crystals-exhibiting spin-density wave (SDW) ordering and superconductivity, respectively-using pump-probe femtosecond spectroscopy. In the undoped single crystals a single relaxation process is observed, showing a remarkable critical slowing down of the QP relaxation dynamics at the SDW transition temperature TSDW≃125K . In the superconducting (SC) crystals multiple relaxation processes are present with distinct SC-state quasiparticle recombination dynamics exhibiting a BCS-like T -dependent superconducting gap, and a pseudogap (PG)-like feature with an onset above 180 K indicating the existence of a pseudogap of magnitude 2ΔPG≃120meV above Tc . From the pump-photon energy dependence we conclude that the SC state and PG relaxation channels are independent, implying the presence of two separate electronic subsystems. We discuss the data in terms of spatial inhomogeneity and multiband scenarios, finding that the latter is more consistent with the present data.

  4. Induced spectral gap and pairing correlations from superconducting proximity effect

    Science.gov (United States)

    Chiu, Ching-Kai; Cole, William S.; Das Sarma, S.

    2016-09-01

    We theoretically consider superconducting proximity effect, using the Bogoliubov-de Gennes (BdG) theory, in heterostructure sandwich-type geometries involving a normal s -wave superconductor and a nonsuperconducting material with the proximity effect being driven by Cooper pairs tunneling from the superconducting slab to the nonsuperconducting slab. Applications of the superconducting proximity effect may rely on an induced spectral gap or induced pairing correlations without any spectral gap. We clarify that in a nonsuperconducting material the induced spectral gap and pairing correlations are independent physical quantities arising from the proximity effect. This is a crucial issue in proposals to create topological superconductivity through the proximity effect. Heterostructures of three-dimensional topological insulator (TI) slabs on conventional s -wave superconductor (SC) substrates provide a platform, with proximity-induced topological superconductivity expected to be observed on the "naked" top surface of a thin TI slab. We theoretically study the induced superconducting gap on this naked surface. In addition, we compare against the induced spectral gap in heterostructures of SC with a normal metal or a semiconductor with strong spin-orbit coupling and a Zeeman splitting potential (another promising platform for topological superconductivity). We find that for any model for the non-SC metal (including metallic TI) the induced spectral gap on the naked surface decays as L-3 as the thickness (L ) of the non-SC slab is increased in contrast to the slower 1 /L decay of the pairing correlations. Our distinction between proximity-induced spectral gap (with its faster spatial decay) and pairing correlation (with its slower spatial decay) has important implications for the currently active search for topological superconductivity and Majorana fermions in various superconducting heterostructures.

  5. Electronic inhomogeneities in the superconducting phase of CaFe1.96Ni0.04As2 single crystals

    Science.gov (United States)

    Dutta, Anirban; Kumar, Neeraj; Thamizhavel, A.; Gupta, Anjan K.

    2015-02-01

    Superconductivity in CaFe2-xNixAs2 emerges in close proximity to an antiferromagnetic (AFM) ordered parent state and the AFM phase overlaps with superconducting (SC) phase for a small range of x-values. We present scanning tunneling microscopy and spectroscopy study of an underdoped CaFe2-xNixAs2 single crystal in the vicinity of the boundary of the two phases. Both resistivity and magnetic susceptibility measurements show a superconducting TC of 15 K and from later we deduce a superconducting fraction of 1.2%. Topographic images show reasonably flat surface with signatures of atomic resolution. Spectra between 120 K and 20 K are spatially homogeneous and show signatures of spin density wave (SDW) gap. Below TC, spectra show significant spatial inhomogeneity with a depression in density of states in±5 meV energy range. Inhomogeneity reduces significantly as the temperature goes above TC and disappears completely far above TC. These observations are discussed in terms of an inhomogeneous electronic phase that may exist due to the vicinity of this composition to the SC dome boundary on the underdoped side of the phase diagram.

  6. Broken bond symmetry assists stripe pinning in superconducting La2-xSrxCuO4

    Science.gov (United States)

    Tranquada, John; Jacobsen, H.; Zaliznyak, I. A.; Huecker, M.; Gu, G. D.; Savici, A. T.; Winn, B.; Chang, S.

    There has been evidence for quite some time for some degree of charge and spin stripe order in La2-xSrxCuO4 (LSCO). This has been a bit surprising as the crystal structure is supposed to lack the anisotropic Cu-O bonds that lead to robust stripe pinning in La2-xBaxCuO4. Using neutron scattering measurements on the HYSPEC instrument at the Spallation Neutron Source, we have discovered evidence for broken bond symmetry and strong associated lattice fluctuations in an LSCO crystal with x = 0 . 07. The broken bond symmetry occurs within the orthorhombic phase. We also observe quasielastic incommensurate spin excitations that coexist with the bulk superconductivity, suggesting some degree of pair-density-wave order in the superconducting state. Work at BNL supported by Office of Basic Energy Sciences, US DOE, under Contract No. DE-SC00112704.

  7. Superconductivity in highly disordered dense carbon disulfide.

    Science.gov (United States)

    Dias, Ranga P; Yoo, Choong-Shik; Struzhkin, Viktor V; Kim, Minseob; Muramatsu, Takaki; Matsuoka, Takahiro; Ohishi, Yasuo; Sinogeikin, Stanislav

    2013-07-16

    High pressure plays an increasingly important role in both understanding superconductivity and the development of new superconducting materials. New superconductors were found in metallic and metal oxide systems at high pressure. However, because of the filled close-shell configuration, the superconductivity in molecular systems has been limited to charge-transferred salts and metal-doped carbon species with relatively low superconducting transition temperatures. Here, we report the low-temperature superconducting phase observed in diamagnetic carbon disulfide under high pressure. The superconductivity arises from a highly disordered extended state (CS4 phase or phase III[CS4]) at ~6.2 K over a broad pressure range from 50 to 172 GPa. Based on the X-ray scattering data, we suggest that the local structural change from a tetrahedral to an octahedral configuration is responsible for the observed superconductivity.

  8. Phase slips in superconducting weak links

    Energy Technology Data Exchange (ETDEWEB)

    Kimmel, Gregory; Glatz, Andreas; Aranson, Igor S.

    2017-01-01

    Superconducting vortices and phase slips are primary mechanisms of dissipation in superconducting, superfluid, and cold-atom systems. While the dynamics of vortices is fairly well described, phase slips occurring in quasi-one- dimensional superconducting wires still elude understanding. The main reason is that phase slips are strongly nonlinear time-dependent phenomena that cannot be cast in terms of small perturbations of the superconducting state. Here we study phase slips occurring in superconducting weak links. Thanks to partial suppression of superconductivity in weak links, we employ a weakly nonlinear approximation for dynamic phase slips. This approximation is not valid for homogeneous superconducting wires and slabs. Using the numerical solution of the time-dependent Ginzburg-Landau equation and bifurcation analysis of stationary solutions, we show that the onset of phase slips occurs via an infinite period bifurcation, which is manifested in a specific voltage-current dependence. Our analytical results are in good agreement with simulations.

  9. Antiferromagnetic hedgehogs with superconducting cores

    Energy Technology Data Exchange (ETDEWEB)

    Goldbart, P.M.; Sheehy, D.E. [Department of Physics and Materials Research Laboratory, University of Illinois at Urbana-Champaign, Urbana, Illinois 61801 (United States)

    1998-09-01

    Excitations of the antiferromagnetic state that resemble antiferromagnetic hedgehogs at large distances but are predominantly superconducting inside a core region are discussed within the context of Zhang{close_quote}s SO(5)-symmetry-based approach to the physics of high-temperature superconducting materials. Nonsingular, in contrast with their hedgehog cousins in pure antiferromagnetism, these texture excitations are what hedgehogs become when the antiferromagnetic order parameter is permitted to {open_quotes}escape{close_quotes} into superconducting directions. The structure of such excitations is determined in a simple setting, and a number of their experimental implications are examined. {copyright} {ital 1998} {ital The American Physical Society}

  10. Hybridization and suppression of the superconductivity in CeFeAsO1-y. Pressure and temperature dependences of the electronic structure

    Energy Technology Data Exchange (ETDEWEB)

    Yamaoka, Hitoshi [Inst. of Physical and Chemical Research (RIKEN), Wako (Japan); Jarrige, Ignace [Japan Atomic Energy Agency (JAEA), Hyogo (Japan); Ikeda-Ohno, Atsushi [Japan Atomic Energy Agency (JAEA), Hyogo (Japan); Tsutsui, Satoshi [Japan Synchrotron Radiation Research Inst., Hyogo (Japan); Lin, Jung-Fu [Univ. of Texas, Austin, TX (United States); Takeshita, Nao [National Inst. of Advanced Industrial Science adn Technology (AIST), Ibaraki (Japan); Transformative Research-Project on Iron Pnictides (TRIP), Tokyo (Japan); Miyazawa, Kiichi [National Inst. of Advanced Industrial Science adn Technology (AIST), Ibaraki (Japan); Transformative Research-Project on Iron Pnictides (TRIP), Tokyo (Japan); Tokyo Univ. of Science, Chiba (Japan); Iyo, Akira [National Inst. of Advanced Industrial Science adn Technology (AIST), Ibaraki (Japan); Transformative Research-Project on Iron Pnictides (TRIP), Tokyo (Japan); Tokyo Univ. of Science, Chiba (Japan); Kito, Hijiri [National Inst. of Advanced Industrial Science adn Technology (AIST), Ibaraki (Japan); Transformative Research-Project on Iron Pnictides (TRIP), Tokyo (Japan); Eisaki, Hiroshi [National Inst. of Advanced Industrial Science adn Technology (AIST), Ibaraki (Japan); Transformative Research-Project on Iron Pnictides (TRIP), Tokyo (Japan); Hiraoka, Nozomu [National Synchrotron Radiation Research Center, Hsinchu (Taiwan); Ishii, Hirofumi [National Synchrotron Radiation Research Center, Hsinchu (Taiwan); Tsuei, Ku-Ding [National Synchrotron Radiation Research Center, Hsinchu (Taiwan)

    2010-09-23

    Pressure and temperature dependence of the electronic structure of superconducting (SC) CeFeAsO1-y and non-SC CeFeAsO1-y have been investigated using two complementary hard x-ray spectroscopic probes at the Ce L3 edge, partial fluorescence yield x-ray absorption spectroscopy and resonant x-ray emission spectroscopy. With increasing pressure, the ratio between the intensity of the peak related to the f0 (Ce4+ ) state and that of the f1 (Ce3+ ) state, I(f0)/I(f1 ), is found to increase continuously for both compounds, indicating a continuous increase in the Ce valence. The valence of non-SC CeFeAsO1-y is found to be slightly higher than that of SC CeFeAsO1-y in the entire pressure and temperature ranges of this study. The valence of CeFeAsO1-y around 6 GPa, where the superconductivity breaks down, is estimated to be ~3.0 , but no change in the valence is observed upon cooling. The dependence of the interatomic distances on the concentration of oxygen vacancies is studied via extended absorption fine structure spectroscopy.

  11. The coloring problem in the solid-state metal boride carbide ScB{sub 2}C{sub 2}. A theoretical analysis

    Energy Technology Data Exchange (ETDEWEB)

    Lassoued, Souheila [Universite de Rennes, Ecole Nationale Superieure de Chimie, UMR 6226 CNRS (France). Inst. des Sciences Chimiques; Universite Kasdi Merbah-Ouargla (Algeria). Faculte des Mathematiques et des Sciences de la Matiere; Boucher, Benoit [Universite de Rennes, Ecole Nationale Superieure de Chimie, UMR 6226 CNRS (France). Inst. des Sciences Chimiques; Max-Planck-Institut fuer Chemische Physik Fester Stoffe, Dresden (Germany); Boutarfaia, Ahmed [Universite Kasdi Merbah-Ouargla (Algeria). Faculte des Mathematiques et des Sciences de la Matiere; Gautier, Regis; Halet, Jean-Francois [Universite de Rennes, Ecole Nationale Superieure de Chimie, UMR 6226 CNRS (France). Inst. des Sciences Chimiques

    2016-08-01

    The electronic properties of the layered ternary metal boride carbide ScB{sub 2}C{sub 2}, the structure of which consists of B/C layers made of fused five- and seven-membered rings alternating with scandium sheets, are analyzed. In particular, the respective positions of the B and C atoms (the so-called coloring problem) are tackled using density functional theory, quantum theory of atoms in molecules, and electron localizability indicator calculations. Results reveal that (i) the most stable coloring minimizes the number of B-B and C-C contacts and maximizes the number of boron atoms in the heptagons, (ii) the compound is metallic in character, and (iii) rather important covalent bonding occurs between the metallic sheets and the boron-carbon network.

  12. Antiferromagnetism, charge density wave, and d-wave superconductivity in the extended t-J-U model: role of intersite Coulomb interaction and a critical overview of renormalized mean field theory.

    Science.gov (United States)

    Abram, M; Zegrodnik, M; Spałek, J

    2017-09-13

    In the first part of the paper, we study the stability of antiferromagnetic (AF), charge density wave (CDW), and superconducting (SC) states within the t-J-U-V model of strongly correlated electrons by using the statistically consistent Gutzwiller approximation (SGA). We concentrate on the role of the intersite Coulomb interaction term V in stabilizing the CDW phase. In particular, we show that the charge ordering appears only above a critical value of V in a limited hole-doping range δ. The effect of the V term on SC and AF phases is that a strong interaction suppresses SC, whereas the AF order is not significantly influenced by its presence. In the second part, separate calculations for the case of a pure SC phase have been carried out within an extended approach (the diagrammatic expansion for the Gutzwiller wave function, DE-GWF) in order to analyze the influence of the intersite Coulomb repulsion on the SC phase with the higher-order corrections included beyond the SGA method. The upper concentration for the SC disappearance decreases with increasing V, bringing the results closer to experiment. In appendices A and B we discuss the ambiguity connected with the choice of the Gutzwiller renormalization factors within the renormalized mean filed theory when either AF or CDW orders are considered. At the end, we overview briefly the possible extensions of the current models to put descriptions of the SC, AF, and CDW states on equal footing.

  13. Antiferromagnetism, charge density wave, and d-wave superconductivity in the extended t-J-U model: role of intersite Coulomb interaction and a critical overview of renormalized mean field theory

    Science.gov (United States)

    Abram, M.; Zegrodnik, M.; Spałek, J.

    2017-09-01

    In the first part of the paper, we study the stability of antiferromagnetic (AF), charge density wave (CDW), and superconducting (SC) states within the t-J-U-V model of strongly correlated electrons by using the statistically consistent Gutzwiller approximation (SGA). We concentrate on the role of the intersite Coulomb interaction term V in stabilizing the CDW phase. In particular, we show that the charge ordering appears only above a critical value of V in a limited hole-doping range δ. The effect of the V term on SC and AF phases is that a strong interaction suppresses SC, whereas the AF order is not significantly influenced by its presence. In the second part, separate calculations for the case of a pure SC phase have been carried out within an extended approach (the diagrammatic expansion for the Gutzwiller wave function, DE-GWF) in order to analyze the influence of the intersite Coulomb repulsion on the SC phase with the higher-order corrections included beyond the SGA method. The upper concentration for the SC disappearance decreases with increasing V, bringing the results closer to experiment. In appendices A and B we discuss the ambiguity connected with the choice of the Gutzwiller renormalization factors within the renormalized mean filed theory when either AF or CDW orders are considered. At the end, we overview briefly the possible extensions of the current models to put descriptions of the SC, AF, and CDW states on equal footing.

  14. Superconductivity in Layered Organic Metals

    Directory of Open Access Journals (Sweden)

    Jochen Wosnitza

    2012-04-01

    Full Text Available In this short review, I will give an overview on the current understanding of the superconductivity in quasi-two-dimensional organic metals. Thereby, I will focus on charge-transfer salts based on bis(ethylenedithiotetrathiafulvalene (BEDT-TTF or ET for short. In these materials, strong electronic correlations are clearly evident, resulting in unique phase diagrams. The layered crystallographic structure leads to highly anisotropic electronic as well as superconducting properties. The corresponding very high orbital critical field for in-plane magnetic-field alignment allows for the occurrence of the Fulde–Ferrell– Larkin–Ovchinnikov state as evidenced by thermodynamic measurements. The experimental picture on the nature of the superconducting state is still controversial with evidence both for unconventional as well as for BCS-like superconductivity.

  15. Quasiparticle spin relaxation with superconducting velocity-tunable state in GaAs(100) quantum wells in proximity to s -wave superconductor

    Science.gov (United States)

    Yu, T.; Wu, M. W.

    2016-11-01

    We investigate the quasiparticle spin relaxation with superconducting-velocity-tunable state in GaAs (100) quantum wells in proximity to an s -wave superconductor. We first present the influence of the supercurrent on the quasiparticle state in GaAs (100) quantum wells, which can be tuned by the superconducting velocity. Rich features such as the suppressed Cooper pairings, large quasiparticle density and nonmonotonically tunable momentum current can be realized by varying the superconducting velocity. In the degenerate regime, the quasiparticle Fermi surface is composed by two arcs, referred to as Fermi arcs, which are contributed by the electron- and holelike branches. The D'yakonov-Perel' spin relaxation is then explored, and intriguing physics is revealed when the Fermi arc emerges. Specifically, when the order parameter tends to zero, it is found that the branch-mixing scattering is forbidden in the quasielectron band. When the condensation process associated with the annihilation of the quasielectron and quasihole is slow, this indicates that the electron- and holelike Fermi arcs in the quasielectron band are independent. The open structure of the Fermi arc leads to the nonzero angular average of the effective magnetic field due to the spin-orbit coupling, which acts as an effective Zeeman field. This Zeeman field leads to spin oscillations even in the strong-scattering regime. Moreover, in the strong-scattering regime, we show that the open structure of the Fermi arc also leads to the insensitiveness of the spin relaxation to the momentum scattering, in contrast to the conventional motional narrowing situation. Nevertheless, with a finite order parameter, the branch-mixing scattering can be triggered, opening the interbranch spin relaxation channel, which is dominant in the strong-scattering regime. In contrast to the situation with an extremely small order parameter, due to the interbranch channel, the spin oscillations vanish and the spin relaxation

  16. Superconducting Microelectronics.

    Science.gov (United States)

    Henry, Richard W.

    1984-01-01

    Discusses superconducting microelectronics based on the Josephson effect and its advantages over conventional integrated circuits in speed and sensitivity. Considers present uses in standards laboratories (voltage) and in measuring weak magnetic fields. Also considers future applications in superfast computer circuitry using Superconducting…

  17. Time-resolved photoexcitation of the superconducting two-gap state in MgB2 thin films.

    Science.gov (United States)

    Xu, Y; Khafizov, M; Satrapinsky, L; Kús, P; Plecenik, A; Sobolewski, Roman

    2003-11-01

    Femtosecond pump-probe studies show that carrier dynamics in MgB2 films is governed by the sub-ps electron-phonon (e-ph) relaxation present at all temperatures, the few-ps e-ph process well pronounced below 70 K, and the sub-ns superconducting relaxation below T(c). The amplitude of the superconducting component versus temperature follows the superposition of the isotropic dirty gap and the three-dimensional pi gap dependences, closing at two different T(c) values. The time constant of the few-ps relaxation exhibits a double divergence at temperatures corresponding to the T(c)'s of the two gaps.

  18. Steady state heat transfer experimental studies of LHC superconducting cables operating in cryogenic environment of superfluid helium

    CERN Document Server

    Santandrea, Dario; Tuccillo, Raffaele; Granieri, Pier Paolo

    The heat management is a basic and fundamental aspect of the superconducting magnets used in the CERN Large Hadron Collider. Indeed, the coil temperature must be kept below the critical value, despite the heat which can be generated or deposited in the magnet during the normal operations. Therefore, this thesis work aims at determining the heating power which can be extracted from the superconducting cables of the LHC, specially through their electrical insulation which represents the main thermal barrier. An experimental measurement campaign in superfluid helium bath was performed on several samples reproducting the main LHC magnets. The heating power was generated in the sample by Joule heating and the temperature increase was measured by means of Cernox bare chip and thermocouples. An innovative instrumentation technique which also includes the in-situ calibration of the thermocouples was developed. A thorough uncertainty analysis on the overall measurement chain concluded the experimental setup. The prese...

  19. Superconductivity in domains with corners

    DEFF Research Database (Denmark)

    Bonnaillie-Noel, Virginie; Fournais, Søren

    2007-01-01

    We study the two-dimensional Ginzburg-Landau functional in a domain with corners for exterior magnetic field strengths near the critical field where the transition from the superconducting to the normal state occurs. We discuss and clarify the definition of this field and obtain a complete...... asymptotic expansion for it in the large $\\kappa$ regime. Furthermore, we discuss nucleation of superconductivity at the boundary....

  20. Disbursement of $65 million to the State of Texas for construction of a Regional Medical Technology Center at the former Superconducting Super Collider Site, Waxahachie, Texas

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-05-01

    As part of a settlement agreement between the US DOE and the State of Texas, DOE proposes to transfer $65 million of federal funds to the Texas National Research Laboratory Commission (TNLRC) for construction of the Regional Medical Technology Center (RMTC) to be located in Ellis County, Texas. The RMTC would be a state-of-the-art medical facility for proton cancer therapy, operated by the State of Texas in conjunction with the University of Texas Southwestern Medical Center. The RMTC would use the linear accelerator assets of the recently terminated DOE Superconducting Super Collider Project to accelerate protons to high energies for the treatment of cancer patients. The current design provides for treatment areas, examination rooms, support laboratories, diagnostic imaging equipment, and office space as well as the accelerators (linac and synchrotron) and beam steering and shaping components. The potential environmental consequences of the proposed action are expected to be minor.

  1. Entangled microwaves as a resource for entangling spatially separate solid-state qubits: Superconducting qubits, nitrogen-vacancy centers, and magnetic molecules

    Science.gov (United States)

    Gómez, Angela Viviana; Rodríguez, Ferney Javier; Quiroga, Luis; García-Ripoll, Juan José

    2016-06-01

    Quantum correlations present in a broadband two-line squeezed microwave state can induce entanglement in a spatially separated bipartite system consisting of either two single qubits or two-qubit ensembles. By using an appropriate master equation for a bipartite quantum system in contact with two separate but entangled baths, the generating entanglement process in spatially separated quantum systems is thoroughly characterized. Decoherence thermal effects on the entanglement transfer are also discussed. Our results provide evidence that this entanglement transfer by dissipation is feasible, yielding to a steady-state amount of entanglement in the bipartite quantum system which can be optimized for a wide range of realistic physical systems that include state-of-the-art experiments with nitrogen-vacancy centers in diamond, superconducting qubits, or even magnetic molecules embedded in a crystalline matrix.

  2. Meissner effect in superconducting microtraps

    Energy Technology Data Exchange (ETDEWEB)

    Cano, Daniel

    2009-04-30

    This thesis investigates the impact of the Meissner effect on magnetic microtraps for ultracold atoms near superconducting microstructures. This task has been accomplished both theoretically and experimentally. The Meissner effect distorts the magnetic fields near superconducting surfaces, thus altering the parameters of magnetic microtraps. Both computer simulations and experimental measurements demonstrate that the Meissner effect shortens the distance between the magnetic microtrap and the superconducting surface, reduces the magnetic-field gradients and dramatically lowers the trap depth. A novel numerical method for calculating magnetic fields in atom chips with superconducting microstructures has been developed. This numerical method overcomes the geometrical limitations of other calculation techniques and can solve superconducting microstructures of arbitrary geometry. The numerical method has been used to calculate the parameters of magnetic microtraps in computer-simulated chips containing thin-film wires. Simulations were carried out for both the superconducting and the normal-conducting state, and the differences between the two cases were analyzed. Computer simulations have been contrasted with experimental measurements. The experimental apparatus generates a magnetic microtrap for ultracold Rubidium atoms near a superconducting Niobium wire of circular cross section. The design and construction of the apparatus has met the challenge of integrating the techniques for producing atomic quantum gases with the techniques for cooling solid bodies to cryogenic temperatures. By monitoring the position of the atom cloud, one can observe how the Meissner effect influences the magnetic microtrap. (orig.)

  3. Electronic state and superconductivity of YBa2Cu3-xO7-y (M=Al,Zn and Sn) systems

    Science.gov (United States)

    Zhao, Y.; Zhang, Q. R.; Zhang, H.

    1990-01-01

    A series of YBa2Cu(3-x)MxO(7-y) (M=Al,Zn and Sn) single phase samples were prepared, and the measurements of the crystal structure, oxygen content, electric resistivity, thermoelectric power, Mossbauer spectrum, XPS and superconductivity were performed. The experimental results of X ray powder diffraction, Mossbauer spectrum and oxygen content show that the Zn(2+) and the Al(3+) occupy the Cu(2) site in Cu-O planes and the Cu(1) site in Cu-O chains respectively, but the Sn(4+) occupies both the Cu(1) sites. As regards the properties in superconducting state, both the Zn(2+) and the Al(3+) depress T(sub c) strongly, but the Sn(4+) does not. As for the electronic transport properties in normal state, the system doped by Al(3+) displays a rapid increase of resistivity and some electron localization-like effects, and the thermoelectric power enhances obviously; the series contained Zn(2+) almost shows no changes of electric resistivity but the sign of the thermoelectric power is reversed. Other results are given and briefly discussed.

  4. Magnetoresistance oscillations and the half-flux-quantum state in doubly-connected superconducting cylinders of Sr2RuO4

    Science.gov (United States)

    Cai, Xinxin

    Sr2RuO4, the only layered perovskite known to become superconducting without the presence of Cu, was predicted to be an odd-parity, spin-triplet superconductor shortly after its superconductivity was discovered in 1994. Sr2RuO4 was found to feature exotic vortex physics including half-flux quanta trapped in doubly connected samples and the formation of vortex lattices at low fields. In this dissertation, I present low-temperature magnetoresistance oscillation measurements on micronsized, doubly connected cylinders of Sr2RuO4 to explore the free energy modulation of the half-flux quantum state, inspired by the Little-Parks experiment, following a similar path taken in the original experiments for the establishment of fluoxid quantization. We fabricated transport devices of micron-sized superconducting cylinders of Sr2RuO4 on mechanically exfoliated single crystals. We carried out magnetoresistance oscillation measurements over a wide range of temperatures and magnetic fields for various samples. Magnetoresistance oscillations with an unexpected large amplitude were observed, suggesting a vortex-crossing origin of the magnetoresistance oscillations rather than a conventional Little-Parks effect. In thin-wall cylinders of Sr2RuO4, a large number of pronounced quantum oscillations with a conventional period of the full-flux-quantum were found. For cylinders with a thick wall, two distinct periods of oscillations were found in high- and low-field regimes, respectively, providing insight into the unconventional vortex physics in Sr2RuO4. No evidence for half-flux-quantum resistance oscillations were identified in any sample measured without the presence of an in-plane field. We demonstrated the tunability of the free energy of the superconducting Sr2RuO4 cylinders using various parameters, including an in-plane magnetic field, the measurement current, and structural factors. Distinct dips on magnetoresistance peaks were found, which we argue to be related to the

  5. Comparing superconducting and permanent magnets for magnetic refrigeration

    DEFF Research Database (Denmark)

    Bjørk, Rasmus; Nielsen, Kaspar Kirstein; Bahl, C. R. H.

    2016-01-01

    We compare the cost of a high temperature superconducting (SC) tape-based solenoidwith a permanent magnet (PM) Halbach cylinder for magnetic refrigeration.Assuming a five liter active magnetic regenerator volume, the price of each type ofmagnet is determined as a function of aspect ratio of the r......We compare the cost of a high temperature superconducting (SC) tape-based solenoidwith a permanent magnet (PM) Halbach cylinder for magnetic refrigeration.Assuming a five liter active magnetic regenerator volume, the price of each type ofmagnet is determined as a function of aspect ratio...

  6. Stability of superconducting La Sr cuprate in hydrothermal NaF solutions at elevated temperatures and pressures

    Energy Technology Data Exchange (ETDEWEB)

    Korytkova, E.N.; Nesterchuk, N.I.; Pivovarova, L.N. [and others

    1992-04-20

    The successful application of hydrothermal treatment for raising the stability of the superconducting (SC) oxide of the composition La{sub 1.8}Sr{sub 0.2}CuO{sub 4-{delta}} (LSCO), demonstrated earlier, stimulates further development of studies in this field. Selection of chemical reagents the action of which on the crystal structure of the oxide strengthens it is most significant. The literature contains information on the stabilizing action of fluoride ions on the structure of HTSC compounds inserted in oxygen positions of crystal lattices during annealing of Sc cuprates in gaseous NF{sub 3}, NH{sub 4}F, NH{sub 5}F{sub 2}. The possibility of replacing oxygen ions by fluoride ions exists owing to the same electron configuration of their external layers and almost the same ionic radii. Since their electronegativities and degrees of oxidation are different, it may be inferred that even partial replacement of oxygen by fluorine would have a significant influence on the state of the structure of the SC oxide and possibly on the SC properties. In the light of this, hydrothermal treatment of SC oxide with solutions of fluorides, and in particular with NaF solution at an elevated temperature and especially at a high pressure, i.e., under conditions favorable for insertion of fluoride ions into the crystal structure of the cuprate, seemed to be appropriate. 7 refs., 5 figs.

  7. Helical superconducting black holes.

    Science.gov (United States)

    Donos, Aristomenis; Gauntlett, Jerome P

    2012-05-25

    We construct novel static, asymptotically five-dimensional anti-de Sitter black hole solutions with Bianchi type-VII(0) symmetry that are holographically dual to superconducting phases in four spacetime dimensions with a helical p-wave order. We calculate the precise temperature dependence of the pitch of the helical order. At zero temperature the black holes have a vanishing entropy and approach domain wall solutions that reveal homogenous, nonisotropic dual ground states with an emergent scaling symmetry.

  8. Recent advances in fullerene superconductivity

    CERN Document Server

    Margadonna, S

    2002-01-01

    Superconducting transition temperatures in bulk chemically intercalated fulleride salts reach 33 K at ambient pressure and in hole-doped C sub 6 sub 0 derivatives in field-effect-transistor (FET) configurations, they reach 117 K. These advances pose important challenges for our understanding of high-temperature superconductivity in these highly correlated organic metals. Here we review the structures and properties of intercalated fullerides, paying particular attention to the correlation between superconductivity and interfullerene separation, orientational order/disorder, valence state, orbital degeneracy, low-symmetry distortions, and metal-C sub 6 sub 0 interactions. The metal-insulator transition at large interfullerene separations is discussed in detail. An overview is also given of the exploding field of gate-induced superconductivity of fullerenes in FET electronic devices.

  9. Color superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Wilczek, F. [Institute for Advanced Study, Princeton, NJ (United States)

    1997-09-22

    The asymptotic freedom of QCD suggests that at high density - where one forms a Fermi surface at very high momenta - weak coupling methods apply. These methods suggest that chiral symmetry is restored and that an instability toward color triplet condensation (color superconductivity) sets in. Here I attempt, using variational methods, to estimate these effects more precisely. Highlights include demonstration of a negative pressure in the uniform density chiral broken phase for any non-zero condensation, which we take as evidence for the philosophy of the MIT bag model; and demonstration that the color gap is substantial - several tens of MeV - even at modest densities. Since the superconductivity is in a pseudoscalar channel, parity is spontaneously broken.

  10. SUPERCONDUCTING PHOTOCATHODES.

    Energy Technology Data Exchange (ETDEWEB)

    SMEDLEY, J.; RAO, T.; WARREN, J.; SEKUTOWICZ, LANGNER, J.; STRZYZEWSKI, P.; LEFFERS, R.; LIPSKI, A.

    2005-10-09

    We present the results of our investigation of lead and niobium as suitable photocathode materials for superconducting RF injectors. Quantum efficiencies (QE) have been measured for a range of incident photon energies and a variety of cathode preparation methods, including various lead plating techniques on a niobium substrate. The effects of operating at ambient and cryogenic temperatures and different vacuum levels on the cathode QE have also been studied.

  11. Vol. 33 - Compact State-Space Models for Complex Superconducting Radio-Frequency Structures Based on Model Order Reduction and Concatenation Methods

    CERN Document Server

    Flisgen, Thomas

    2015-01-01

    The modeling of large chains of superconducting cavities with couplers is a challeng- ing task in computational electrical engineering. The direct numerical treatment of these structures can easily lead to problems with more than ten million degrees of freedom. Problems of this complexity are typically solved with the help of parallel programs running on supercomputing infrastructures. However, these infrastructures are expensive to purchase, to operate, and to maintain. The aim of this thesis is to introduce and to validate an approach which allows for modeling large structures on a standard workstation. The novel technique is called State-Space Concatena- tions and is based on the decomposition of the complete structure into individual segments. The radio-frequency properties of the generated segments are described by a set of state-space equations which either emerge from analytical considera- tions or from numerical discretization schemes. The model order of these equations is reduced...

  12. Spin dynamics in the metallic state of the high T{sub c} superconducting system YBa{sub 2}Cu{sub 3}O{sub 6+x}

    Energy Technology Data Exchange (ETDEWEB)

    Bourges, P.; Sidis, Y. [Laboratoire Leon Brillouin (LLB) - Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France); Regnault, L.P.; Henry, J.Y.; Burlet, P. [CEA Centre d`Etudes de Grenoble, 38 (France). Dept. de Recherche Fondamentale sur la Matiere Condensee; Vettier, C. [European Synchrotron Research Facility, 38 -Grenoble (France)

    1994-12-31

    The spin dynamics in single-crystals of YBa{sub 2}Cu{sub 3}O{sub 6+x} has been successfully investigated, by inelastic neutron scattering (INS) experiments, as a function of temperature in the metallic state over the whole doping range from the weakly-doped to the heavily-doped and the over-doped regimes. Dynamical AF-correlations persist in all the metallic states. The imaginary part of the magnetic susceptibility, {chi}{sup ``}, consists of two contributions which have different doping and temperature dependences. At low temperature, {chi}{sup ``} exhibits an energy gap in any superconducting samples which becomes much weaker close to the insulating-metallic transition. To emphasize the characteristic features of the spin dynamics in YBCO, INS results obtained elsewhere are compared with the experiments. Several theoretical approaches, which intend to describe the energy lineshape of the dynamical magnetic susceptibility, are also discussed. (authors). 6 figs., 51 refs.

  13. Substitution effects on superconducting and normal state properties in (Mo1-xTx)3Sb7, where T = Ru and Fe

    Science.gov (United States)

    Tran, V. H.

    2016-12-01

    The effects of Ru- and Fe-doping on the physical properties of Mo3Sb7 were studied by measuring ac-susceptibility, dc-magnetization, electrical resistivity and specific heat. It is found that single-phased (Mo{}1-xRu x )3Sb7 and (Mo{}1-xFe x )3Sb7 samples are obtained for the concentrations x ≤slant 0.1. In this concentration range, the lattice parameter shrinks with increasing dopant content. The substitution effects on the superconducting and normal state properties are completely different between two investigated systems. In the Ru-based solid solution alloys, the substitution enhances the superconducting parameters T c and H c2 and also benefits the spin-gap opening at {T}* ˜ 50 K. In contrast, in the Fe-substituted samples, there is a depression of both T c and H c2, accompanied by vanishing spin-gap and low-dimensional magnetic correlation. The substitution of the Mo atoms by Ru and Fe atoms suppresses the cubic-tetragonal distortion, but presumably favours the magnetic field to induce a magnetic order below T *.

  14. Anisotropic superconducting and normal state magnetic properties of single crystals of RNi*2*B*2*C compounds (R = Y, Gd, Dy, Ho, Er, and Tm)

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Beongki [Iowa State Univ., Ames, IA (United States)

    1995-09-26

    The interaction of superconductivity with magnetism has been one of the most interesting and important phenomena in solid state physics since the 1950`s when small amounts of magnetic impurities were incorporated in superconductors. The discovery of the magnetic superconductors RNi2B2C (R = rare earth, Y) offers a new system to study this interaction. The wide ranges of superconducting transition (Tc) and antiferromagnetic (AF) ordering temperatures (TN) (0 K ≤ Tc ≤ 16 K, 0 K ≤ TN ≤ 20 K) give a good opportunity to observe a variety of interesting phenomena. Single crystals of high quality with appropriate size and mass are crucial in examining the anisotropic intrinsic properties. Single crystals have been grown successfully by an unusual high temperature flux method and characterized thoroughly by X-ray, electrical transport, magnetization, neutron scattering, scanning electron microscopy, and other measurements.

  15. Investigation of the superconducting and normal state properties of the filled-skutterudite system PrPt4Ge12 via chemical substitution

    Science.gov (United States)

    Jeon, Inho; Huang, Kevin; Yazici, Duygu; Kanchanavatee, Noravee; White, Benjamin D.; Jang, Sooyoung; Pouse, Naveen; Maple, M. Brian; Ho, Pei-Chun

    We report a systematic chemical substitution study on the unconventional superconductor system PrPt4Ge12, which Sb ions are substituted for Ge. Polycrystalline samples of PrPt4Ge12-x Sbx up to x = 5 were synthesized and investigated by means of x-ray diffraction, electrical resistivity, magnetic susceptibility, and specific heat measurements. We observed a suppression of superconductivity with increasing Sb substitutions and evidence for a weak ``rattling'' mode associated with the Pr ions, characterized by a value of ΘE ~ 60 K. As part of a systematic study of the effect of various elemental substitutions on the properties of PrPt4Ge12, measurements of the superconducting and normal state properties of the Pr1-xEuxPt4Ge12 system are currently being performed. This work was supported by the U. S. Department of Energy, Office of Basic Energy Sciences, Division of Materials Sciences and Engineering under Grant No. DE-FG02-04-ER46105 (characterization and physical properties measurements), and the National Science Foundation under Grant No. DMR 1206553 (low-temperature measurements).

  16. Optical signature of sub-gap absorption in the superconducting state of Ba(Fe1-x Cox)2 As 2

    Science.gov (United States)

    Nagel, Urmas; Rõõm, T.; Lobo, R. P. S. M.; Dai, Y. M.; Carbotte, J.; Timusk, T.; Colson, D.

    2011-03-01

    The optical conductivity of Ba(Fe 0.92 Co 0.08)2 As 2 shows a clear signature of the superconducting gap, but a simple s -wave description fails in accounting for the low frequency response. This task is achieved by introducing an extra Drude peak in the superconducting state representing sub-gap absorption, other than thermally broken pairs. This extra peak and the coexisting s -wave response respect the total sum rule indicating a common origin for the carriers. We discuss the possible origins for this absorption as (i) quasiparticles due to pair-breaking from interband impurity scattering in a two band s+/- gap symmetry model, which includes (ii) the possible existence of impurity levels within an isotropic gap model; or (iii) an indication that one of the bands in is highly anisotropic. The results are published in Phys. Rev B vol 82, 100506(R) (2010). Work in Tallinn was supported by the Estonian Ministry of Education and Research (SF0690029s09) and Estonian Science Foundation (ETF7011, ETF8170).

  17. Neutral LOFF state and chromomagnetic instability in two-flavor dense QCD

    CERN Document Server

    Gorbar, E V; Miransky, V A; Hashimoto, Michio

    2006-01-01

    In two-flavor dense quark matter, we describe the dynamics in the single plane wave Larkin--Ovchinnikov--Fulde--Ferrell (LOFF) state satisfying the color and electric neutrality conditions. We find that because the neutral LOFF state itself suffers from a chromomagnetic instability in the whole region where it coexists with the (gapped/gapless) two-flavor superconducting (2SC/g2SC) phases, it cannot cure this instability in those phases. This is unlike the recently revealed gluonic phase which seems can resolve this problem.

  18. Design and comparative analysis of 10 MW class superconducting wind power generators according to different types of superconducting wires

    Energy Technology Data Exchange (ETDEWEB)

    Sung, Hae-Jin, E-mail: haejin90@changwon.ac.kr [Changwon National University, 55306 Sarim-dong, Changwon 641-773 (Korea, Republic of); Kim, Gyeong-Hun; Kim, Kwangmin; Park, Minwon [Changwon National University, 55306 Sarim-dong, Changwon 641-773 (Korea, Republic of); Yu, In-Keun, E-mail: yuik@changwon.ac.kr [Changwon National University, 55306 Sarim-dong, Changwon 641-773 (Korea, Republic of); Kim, Jong-Yul [Korea Electrotechnology Research Institute, Changwon 641-120 (Korea, Republic of)

    2013-11-15

    Highlights: •10 MW SC wind power generators are designed using different types of SC wires. •SCSGs using YBCO and Bi-2223 wires are optimized by the modified Taguchi method. •The results demonstrate a proper type of SC wire for the optimal design of SCSG. -- Abstract: Wind turbine concepts can be classified into the geared type and the gearless type. The gearless type wind turbine is more attractive due to advantages of simplified drive train and increased energy yield, and higher reliability because the gearbox is omitted. In addition, this type resolves the weight issue of the wind turbine with the light weight of gearbox. However, because of the low speed operation, this type has disadvantage such as the large diameter and heavy weight of generator. Super-Conducting (SC) wind power generator can reduce the weight and volume of a wind power system. Properties of superconducting wire are very different from each company. This paper considers the design and comparative analysis of 10 MW class SC wind power generators according to different types of SC wires. Super-Conducting Synchronous Generators (SCSGs) using YBCO and Bi-2223 wires are optimized by an optimal method. The magnetic characteristics of the SCSGs are investigated using the finite elements method program. The optimized specifications of the SCSGs are discussed in detail, and the optimization processes can be used effectively to develop large scale wind power generation systems.

  19. Surface superconductivity in thin cylindrical Bi nanowire.

    Science.gov (United States)

    Tian, Mingliang; Wang, Jian; Ning, Wei; Mallouk, Thomas E; Chan, Moses H W

    2015-03-11

    The physical origin and the nature of superconductivity in nanostructured Bi remains puzzling. Here, we report transport measurements of individual cylindrical single-crystal Bi nanowires, 20 and 32 nm in diameter. In contrast to nonsuperconducting Bi nanoribbons with two flat surfaces, cylindrical Bi nanowires show superconductivity below 1.3 K. However, their superconducting critical magnetic fields decrease with their diameter, which is the opposite of the expected behavior for thin superconducting wires. Quasiperiodic oscillations of magnetoresistance were observed in perpendicular fields but were not seen in the parallel orientation. These results can be understood by a model of surface superconductivity with an enhanced surface-to-bulk volume in small diameter wires, where the superconductivity originates from the strained surface states of the nanowires due to the surface curvature-induced stress.

  20. Hybrid Superconducting Neutron Detectors

    CERN Document Server

    Merlo, V; Cirillo, M; Lucci, M; Ottaviani, I; Scherillo, A; Celentano, G; Pietropaolo, A

    2014-01-01

    A new neutron detection concept is presented that is based on superconductive niobium (Nb) strips coated by a boron (B) layer. The working principle of the detector relies on the nuclear reaction 10B+n $\\rightarrow$ $\\alpha$+ 7Li , with $\\alpha$ and Li ions generating a hot spot on the current-biased Nb strip which in turn induces a superconducting-normal state transition. The latter is recognized as a voltage signal which is the evidence of the incident neutron. The above described detection principle has been experimentally assessed and verified by irradiating the samples with a pulsed neutron beam at the ISIS spallation neutron source (UK). It is found that the boron coated superconducting strips, kept at a temperature T = 8 K and current-biased below the critical current Ic, are driven into the normal state upon thermal neutron irradiation. As a result of the transition, voltage pulses in excess of 40 mV are measured while the bias current can be properly modulated to bring the strip back to the supercond...

  1. Statistical mechanics of superconductivity

    CERN Document Server

    Kita, Takafumi

    2015-01-01

    This book provides a theoretical, step-by-step comprehensive explanation of superconductivity for undergraduate and graduate students who have completed elementary courses on thermodynamics and quantum mechanics. To this end, it adopts the unique approach of starting with the statistical mechanics of quantum ideal gases and successively adding and clarifying elements and techniques indispensible for understanding it. They include the spin-statistics theorem, second quantization, density matrices, the Bloch–De Dominicis theorem, the variational principle in statistical mechanics, attractive interaction, and bound states. Ample examples of their usage are also provided in terms of topics from advanced statistical mechanics such as two-particle correlations of quantum ideal gases, derivation of the Hartree–Fock equations, and Landau’s Fermi-liquid theory, among others. With these preliminaries, the fundamental mean-field equations of superconductivity are derived with maximum mathematical clarity based on ...

  2. Tunable superconducting nanoinductors

    Energy Technology Data Exchange (ETDEWEB)

    Annunziata, Anthony J; Santavicca, Daniel F; Frunzio, Luigi; Rooks, Michael J; Prober, Daniel E [Department of Applied Physics, Yale University, New Haven, CT 06511 (United States); Catelani, Gianluigi [Department of Physics, Yale University, New Haven, CT 06511 (United States); Frydman, Aviad, E-mail: anthony.annunziata@yale.edu, E-mail: daniel.prober@yale.edu [Department of Physics, Bar-Ilan University, Ramat Gan 52900 (Israel)

    2010-11-05

    We characterize inductors fabricated from ultra-thin, approximately 100 nm wide strips of niobium (Nb) and niobium nitride (NbN). These nanowires have a large kinetic inductance in the superconducting state. The kinetic inductance scales linearly with the nanowire length, with a typical value of 1 nH {mu}m{sup -1} for NbN and 44 pH {mu}m{sup -1} for Nb at a temperature of 2.5 K. We measure the temperature and current dependence of the kinetic inductance and compare our results to theoretical predictions. We also simulate the self-resonant frequencies of these nanowires in a compact meander geometry. These nanowire inductive elements have applications in a variety of microwave frequency superconducting circuits.

  3. Color-symmetric superconductivity in a phenomenological QCD model

    DEFF Research Database (Denmark)

    Bohr, Henrik; Providencia, C.; Providencia, J. da

    2009-01-01

    In this paper, we construct a theory of the NJL type where superconductivity is present, and yet the superconducting state remains, in the average, color symmetric. This shows that the present approach to color superconductivity is consistent with color singletness. Indeed, quarks are free...... in the deconfined phase, but the deconfined phase itself is believed to be a color singlet. The usual description of the color superconducting state violates color singletness. On the other hand, the color superconducting state here proposed is color symmetric in the sense that an arbitrary color rotation leads...

  4. 金属小粒子超导电性研究%Superconductivity of Different Spin- States in Ultrasmall Metallic Grains

    Institute of Scientific and Technical Information of China (English)

    郑仁蓉; 陈志静

    2001-01-01

    Abstract We study the different spin - states of Sz = 0, 1/2, 1,3/2,2, 5/2,… of different ultrasmall metallic grains which observe the rules in Gauss orthogonal ensemble by the theory of statistic ensembles, and find there exist critical level spacings dc/△ (0) = 13.81,1.85,0.81,0.50, 0. 36, 0. 28, … , at which the superconductivity would vanish. We also find that the higher the spin - state, the smaller the critical level spacing, and for the state of Sz = 0 there actually exists the superconducting enhancement.%摘要用统计系综理论对遵从高斯正交系综的所有金属小粒子的不同自旋态Sz=0,1/2,1,3/2,2, 5/2…进行了研究.发现以上各态均存在临界能间距dc/△(0)=13.81,1.85,0.81,0.50,0.36,0.28….随着粒子尺寸的减小,其超导电性终究会消失;金属小粒子的自旋态越高,临界能间距dc越小.对自旋Sz=0的态,确实存在超导增强效应.

  5. Status of RF superconductivity at Argonne

    Energy Technology Data Exchange (ETDEWEB)

    Shepard, K.W.

    1989-01-01

    Development of a superconducting (SC) slow-wave structures began at Argonne National Laboratory (ANL) in 1971, and led to the first SC heavy-ion linac (ATLAS - the Argonne Tandem-Linac Accelerating System), which began regularly scheduled operation in 1978. To date, more than 40,000 hours of bean-on target operating time has been accumulated with ATLAS. The Physics Division at ANL has continued to develop SC RF technology for accelerating heavy-ions, with the result that the SC linac has, up to the present, has been in an almost continuous process of upgrade and expansion. It should be noted that this has been accomplished while at the same time maintaining a vigorous operating schedule in support of the nuclear and atomic physics research programs of the division. In 1987, the Engineering Physics Division at ANL began development of SC RF components for the acceleration of high-brightness proton and deuterium beams. This work has included the evaluation of RF properties of high-{Tc} oxide superconductors, both for the above and for other applications. The two divisions collaborated while they worked on several applications of RF SC, and also worked to develop the technology generally. 11 refs., 6 figs.

  6. Interaction between ionic lattices and superconducting condensates

    OpenAIRE

    2007-01-01

    The interaction of the ionic lattice with the superconducting condensate is treated in terms of the electrostatic force in superconductors. It is shown that this force is similar but not identical to the force suggested by the volume difference of the normal and superconducting states. The BCS theory shows larger deviations than the two-fluid model.

  7. Nonequilibrium steady states and transient dynamics of conventional superconductors under phonon driving

    Science.gov (United States)

    Murakami, Yuta; Tsuji, Naoto; Eckstein, Martin; Werner, Philipp

    2017-07-01

    We perform a systematic analysis of the influence of phonon driving on the superconducting Holstein model coupled to heat baths by studying both the transient dynamics and the nonequilibrium steady state (NESS) in the weak and strong electron-phonon coupling regimes. Our study is based on the nonequilibrium dynamical mean-field theory, and for the NESS we present a Floquet formulation adapted to electron-phonon systems. The analysis of the phonon propagator suggests that the effective attractive interaction can be strongly enhanced in a parametric resonant regime because of the Floquet side bands of phonons. While this may be expected to enhance the superconductivity (SC), our fully self-consistent calculations, which include the effects of heating and nonthermal distributions, show that the parametric phonon driving generically results in a suppression or complete melting of the SC order. In the strong coupling regime, the NESS always shows a suppression of the SC gap, the SC order parameter, and the superfluid density as a result of the driving, and this tendency is most prominent at the parametric resonance. Using the real-time nonequilibrium DMFT formalism, we also study the dynamics towards the NESS, which shows that the heating effect dominates the transient dynamics, and SC is weakened by the external driving, in particular at the parametric resonance. In the weak coupling regime, we find that the SC fluctuations above the transition temperature are generally weakened under the driving. The strongest suppression occurs again around the parametric resonances because of the efficient energy absorption.

  8. Superconducting and mechanical properties of the bulk Bi(pb)SCCO system prepared via solid state and ammonium nitrate precipitation methods

    Science.gov (United States)

    Safran, S.; Kılıçarslan, E.; Ozturk, H.; Alp, M.; Akdogan, M.; Asikuzun, E.; Ozturk, O.; Kılıç, A.

    2015-09-01

    We have investigated the effect of preparation method on superconducting and mechanical properties of Bi(Pb)-2223 bulk samples using Bi1.85Pb0.35Sr2Ca2Cu3O10±y stoichiometry. Solid-state reaction and ammonium nitrate precipitation methods have been used for fabrication of the bulk samples. In addition, the effect of annealing time on BSCCO samples have been studied. Structural, electrical, magnetic and microhardness analyses of samples are performed by the X-ray powder diffraction (XRD), the Scanning Electron Microscopy (SEM), DC resistivity, AC susceptibility and Vickers microhardness test. The critical transition temperature, phase purity, surface morphology and crystallinity of the prepared bulk samples are compared with each other. Elasticity (E), brittleness (Bi), fracture toughness (KIC) and yield strength (Y) values are also determined according to annealing time, applied load and production parameters of materials.

  9. Development of density-functional theory for a plasmon-assisted superconducting state: application to lithium under high pressures.

    Science.gov (United States)

    Akashi, Ryosuke; Arita, Ryotaro

    2013-08-02

    We extend the density-functional theory for superconductors (SCDFT) to take account of the dynamical structure of the screened Coulomb interaction. We construct an exchange-correlation kernel in the SCDFT gap equation on the basis of the random-phase approximation, where electronic collective excitations such as plasmons are properly treated. Through an application to fcc lithium under high pressures, we demonstrate that our new kernel gives higher transition temperatures (T(c)) when the plasmon and phonon cooperatively mediate pairing and it improves the agreement between the calculated and experimentally observed T(c). The present formalism opens the door to nonempirical studies on unconventional electron mechanisms of superconductivity based on density-functional theory.

  10. Size-dependent superconducting state of individual nanosized Pb islands grown on Si(111) by tunneling spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Liu Jiepeng; Wu Xuefeng; Ming Fangfei; Zhang Xieqiu; Wang Kedong; Xiao Xudong [Department of Physics, Chinese University of Hong Kong, Shatin, NT (Hong Kong); Wang Bing, E-mail: xdxiao@phy.cuhk.edu.hk [Hefei National Laboratory for Physical Sciences at Microscales, University of Science and Technology of China, Hefei, Anhui 230026 (China)

    2011-07-06

    By measuring the temperature-dependent tunneling spectroscopy of a set of flat-top Pb islands from 3.2 to 15 K, the limiting size of a nine-monolayer-thick Pb island with superconductivity above 3.2 K was determined to be {approx} 30 nm{sup 2}, in good agreement with the Anderson criterion. Further analysis indicates that the zero-temperature energy gap decreases significantly faster than the transition temperature when the Pb island size approaches this limit. This leads to a decrease of 2{Delta}(0)/k{sub B}T{sub C} from 4.5 to 3.3, thus showing that the Pb island superconductors undergo a change from strong to weak electron-phonon coupling.

  11. Monitor of SC beam profiles

    CERN Multimedia

    1977-01-01

    A high-resolution secondary emission grid for the measurement of SC beam profiles. Modern techniques of metal-ceramic bonding, developed for micro-electronics, have been used in its construction. (See Annual Report 1977 p. 105 Fig. 12.)

  12. First coil for the SC

    CERN Multimedia

    CERN PhotoLab

    1955-01-01

    The coils for the SC magnet were stored in the large hangar of the Cointrin Airport (to make sure that they would be available before snow and ice would block the roads and canals from Belgium, where they were built).

  13. Multiple superconducting states induced by pressure in Mo3Sb7

    Energy Technology Data Exchange (ETDEWEB)

    Feng, Yejun; Wang, Yishu; Palmer, A.; Li, Ling; Silevitch, D. M.; Calder, S.; Rosenbaum, T. F.

    2017-03-01

    Tuning competing ordering mechanisms with hydrostatic pressure in the 4 d intermetallic compound Mo 3 Sb 7 reveals an intricate interplay of structure, magnetism, and superconductivity. Synchrotron x-ray diffraction and magnetic susceptibility measurements, both employing diamond anvil cell technologies, link a first-order structural phase transition to a doubling of the superconducting transition temperature. In contrast to the spin-dimer picture for Mo 3 Sb 7 , we deduce from x-ray absorption near-edge structure and dc magnetization measurements at ambient pressure that Mo 3 Sb 7 should possess only very small, itinerant magnetic moments. The pressure evolution of the superconducting transition temperature strongly suggests its enhancement is due to a difference in the phonon density-of-states with changed crystal symmetry.

  14. Inelastic neutron scattering study of spin excitations in the superconducting state of high temperature superconductors; Etude par diffusion inelastique de neutrons des excitations de spin dans la phase supraconductrice des supraconducteurs a haute temperature

    Energy Technology Data Exchange (ETDEWEB)

    Sidis, Y.; Pailhes, St.; Fauque, B.; Bourges, Ph. [CEA Saclay, Lab. Leon Brillouin, CNRS, 91 - Gif-sur-Yvette (France); Hinkov, V.; Ulrich, C.; Keimer, B. [Max-Planck-Institut fur Fertkorperforschung, Stuttgart (Germany); Capogna, L.; Ivanov, A. [Institut Laue-Langevin, 38 - Grenoble (France); Regnault, L.P. [CEA Grenoble, Dept. de Recherche Fondamentale sur la Matiere Condensee, 38 (France)

    2007-09-15

    Inelastic neutron scattering is a powerful technique that can measure magnetic correlations in a large momentum and energy range. In strongly correlated electronic systems, where spin, orbital, lattice and charge degrees of freedom are entangled, it is currently used to study the magnetic properties and shed light on their role in the appearance of the exotic electronic properties, such as unconventional superconductivity. In this article, we focus on the observation by inelastic neutron scattering technique of unconventional spin triplet collective modes in the superconducting state of high temperature superconducting cuprates and its interplay with anomalies in the charge excitation spectrum. The triplet spin mode is interpreted as a spin exciton, within a spin band model. Alternative scenarios based on localized or dual (itinerant localized) models are also mentioned. (authors)

  15. Superconducting fault current-limiter with variable shunt impedance

    Science.gov (United States)

    Llambes, Juan Carlos H; Xiong, Xuming

    2013-11-19

    A superconducting fault current-limiter is provided, including a superconducting element configured to resistively or inductively limit a fault current, and one or more variable-impedance shunts electrically coupled in parallel with the superconducting element. The variable-impedance shunt(s) is configured to present a first impedance during a superconducting state of the superconducting element and a second impedance during a normal resistive state of the superconducting element. The superconducting element transitions from the superconducting state to the normal resistive state responsive to the fault current, and responsive thereto, the variable-impedance shunt(s) transitions from the first to the second impedance. The second impedance of the variable-impedance shunt(s) is a lower impedance than the first impedance, which facilitates current flow through the variable-impedance shunt(s) during a recovery transition of the superconducting element from the normal resistive state to the superconducting state, and thus, facilitates recovery of the superconducting element under load.

  16. Comparing superconducting and permanent magnets for magnetic refrigeration

    Directory of Open Access Journals (Sweden)

    R. Bjørk

    2016-05-01

    Full Text Available We compare the cost of a high temperature superconducting (SC tape-based solenoid with a permanent magnet (PM Halbach cylinder for magnetic refrigeration. Assuming a five liter active magnetic regenerator volume, the price of each type of magnet is determined as a function of aspect ratio of the regenerator and desired internal magnetic field. It is shown that to produce a 1 T internal field in the regenerator a permanent magnet of hundreds of kilograms is needed or an area of superconducting tape of tens of square meters. The cost of cooling the SC solenoid is shown to be a small fraction of the cost of the SC tape. Assuming a cost of the SC tape of 6000 $/m2 and a price of the permanent magnet of 100 $/kg, the superconducting solenoid is shown to be a factor of 0.3-3 times more expensive than the permanent magnet, for a desired field from 0.5-1.75 T and the geometrical aspect ratio of the regenerator. This factor decreases for increasing field strength, indicating that the superconducting solenoid could be suitable for high field, large cooling power applications.

  17. III-V compound SC for optoelectronic devices

    Directory of Open Access Journals (Sweden)

    Sudha Mokkapati

    2009-04-01

    Full Text Available III-V compound semiconductors (SC have played a crucial role in the development of optoelectronic devices for a broad range of applications. Major applications of InP or GaAs based III-V compound SC are devices for optical fiber communications, infrared and visible LEDs/LDs and high efficiency solar cells. GaN based compounds are extremely important for short wavelength light emitters used in solid state lighting systems. We review the important device applications of various III-V compound SC materials.

  18. The Future of Superconducting Technology for Particle Accelerators

    CERN Document Server

    Yamamoto, Akira

    2015-01-01

    Introduction: - Colliders constructed and operated - Future High Energy Colliders under Study - Superconducting Phases and Applications - Possible Choices among SC Materials Superconducting Magnets and the Future - Advances in SC Magnets for Accelerators - Nb3Sn for realizing Higher Field - NbTi to Nb3Sn for realizing High Field (> 10 T) - HL-LHC as a critical milestone for the Future of Acc. Magnet Technology - Nb3Sn Superconducting Magnets (> 11 T)and MgB2 SC Links for HL-LHC - HL-LHC, 11T Dipole Magnet - Nb3Sn Quadrupole (MQXF) at IR - Future Circular Collider Study - Conductor development (1998-2008) - Nb3Sn conductor program - 16 T Dipole Options and R&D sharing - Design Study and Develoment for SppC in China - High-Field Superconductor and Magnets - HTS Block Coil R&D for 20 T - Canted Cosine Theta (CCT) Coil suitable with Brittle HTS Conductor - A topic at KEK: S-KEKB IRQs just integrated w/ BELLE-II ! Superconducting RF and the Future - Superconducting Phases and Applications - Poss...

  19. Superconducting spin valves based on epitaxial Fe/V-hybrid thin film heterostructures

    Energy Technology Data Exchange (ETDEWEB)

    Nowak, Gregor

    2010-12-10

    screening layers to suppress the stray field effect, the concentration of the ferromagnetic component in the alloy should be high enough to avoid the generation of non-magnetic/paramagnetic layers. Paramagnetic layers induce pair breaking, thus reducing the quantum-mechanical transparency T{sub F} for the Cooper pair wave function at the FM/SC interface. 3. Ferromagnetic alloys should be chosen as to achieve a better band structure match between the ferromagnetic component and the superconductor. Thereby, T{sub F} will be increased, augmenting the SSV effect. 4. The distance between FM1 and FM2, i.e. the thickness of the superconductor d{sub S}, should be of the order of the Cooper pair coherence length ξ{sub S} ∼ d{sub S}. Ideally, (ξ{sub S})/(d{sub S}) ∼ 1 or larger (see 125), since then the Cooper pair wave function is most effectively influenced by both magnetic layers FM1 and FM2. In the AFM/FM/SC/FM heterostructures, which we prepared according to these guidelines, we could observe satisfying switching characteristics, and SSV effects up to ΔT{sub S} = 20 mK. In this study we have verified the magnetic and superconducting properties of the unusual sample containing a [Fe(2ML)/V(180ML)] superlattice by means of conventional SQUID magnetometry as well as polarized neutron scattering (PNR) method. In the PNR we found a magnetic splitting in the PNR curves for the normal and superconducting state of the sample. Further we found weak indications for a reduction of the magnetic splitting beyond the error bars in the superconducting state compared to the normal conducting state of the sample, what can be considered as a weak indication of the Inverse Proximity effect. However, the measured spin asymmetry difference of the magnetic splitting between the superconducting and normal conducting state of the sample is not clear enough to give an unambiguous answer on the presence or absence of the inverse proximity effect.

  20. Superconducting correlations above Tc in the pseudogap state of Bi2Sr2CaCu2O8 +δ cuprates revealed by angular-dependent magnetotunneling

    Science.gov (United States)

    Jacobs, Th.; Katterwe, S. O.; Krasnov, V. M.

    2016-12-01

    We present an angular-dependent magnetotunneling technique, which facilitates unambiguous separation of superconducting (supporting circulating screening currents) and nonsuperconducting (not supporting screening currents) contributions to the pseudogap phenomenon in layered Bi2Sr2CaCu2O8 +δ cuprates. Our data indicate persistence of superconducting correlations at temperatures up to 1.5 Tc in a form of both phase and amplitude fluctuations of the superconducting order parameter. However, despite a profound fluctuations region, only a small fraction of the pseudogap spectrum is caused by superconducting correlations, while the dominating part comes from a competing nonsuperconducting order, which does not support circulating orbital currents.

  1. Itinerant Ferromagnetism and Superconductivity

    OpenAIRE

    Karchev, Naoum

    2004-01-01

    Superconductivity has again become a challenge following the discovery of unconventional superconductivity. Resistance-free currents have been observed in heavy-fermion materials, organic conductors and copper oxides. The discovery of superconductivity in a single crystal of $UGe_2$, $ZrZn_2$ and $URhGe$ revived the interest in the coexistence of superconductivity and ferromagnetism. The experiments indicate that: i)The superconductivity is confined to the ferromagnetic phase. ii)The ferromag...

  2. 100 years of superconductivity

    CERN Document Server

    Rogalla, Horst

    2011-01-01

    Even a hundred years after its discovery, superconductivity continues to bring us new surprises, from superconducting magnets used in MRI to quantum detectors in electronics. 100 Years of Superconductivity presents a comprehensive collection of topics on nearly all the subdisciplines of superconductivity. Tracing the historical developments in superconductivity, the book includes contributions from many pioneers who are responsible for important steps forward in the field.The text first discusses interesting stories of the discovery and gradual progress of theory and experimentation. Emphasizi

  3. Statistic Ensemble Theory of Small Superconducting Grains

    Institute of Scientific and Technical Information of China (English)

    CHEN Zhi-Qian; ZHENG Ren-Rong

    2001-01-01

    We apply the random matrix theory to small metallic grains in different spin states of S = 0, 1/2, 1, 3/2, 2, 5/2, .., and find that there exist theoretical critical level spacings de at which the superconductivity would breakdown. We also find that the higher the spin state, the smaller the critical level spacing, and for the state of S = 0superconducting enhancement actually exists.

  4. Current knowledge on population studies on five continental molluscs (Mollusca, Gastropoda et Bivalvia of Santa Catarina State (SC, Central Southern Brazil region

    Directory of Open Access Journals (Sweden)

    A. Ignacio Agudo-Padrón

    2011-03-01

    Full Text Available Although still very scarce, available knowledge on population studies on continental (land and freshwatermolluscs in the territory of Santa Catarina State is shortly analyzed and discussed. Based on the IUCN“Restricted Distribution” criterion, a total of 54 nominal species, including 31 terrestrial gastropods, 15freshwater gastropods and 8 limnic bivalves, were considered strong candidates as threatened taxa. Out of allthese endangered species, only 5 limnic forms (2 gastropods and 3 bivalves were previously analysed, in someway, at population level.

  5. Topological superconductivity induced by ferromagnetic metal chains

    Science.gov (United States)

    Li, Jian; Chen, Hua; Drozdov, Ilya K.; Yazdani, A.; Bernevig, B. Andrei; MacDonald, A. H.

    2014-12-01

    Recent experiments have provided evidence that one-dimensional (1D) topological superconductivity can be realized experimentally by placing transition-metal atoms that form a ferromagnetic chain on a superconducting substrate. We address some properties of this type of system by using a Slater-Koster tight-binding model to account for important features of the electronic structure of the transition-metal chains on the superconducting substrate. We predict that topological superconductivity is nearly universal when ferromagnetic transition-metal chains form straight lines on superconducting substrates and that it is possible for more complex chain structures. When the chain is weakly coupled to the substrate and is longer than superconducting coherence lengths, its proximity-induced superconducting gap is ˜Δ ESO/J where Δ is the s -wave pair potential on the chain, ESO is the spin-orbit splitting energy induced in the normal chain state bands by hybridization with the superconducting substrate, and J is the exchange splitting of the ferromagnetic chain d bands. Because of the topological character of the 1D superconducting state, Majorana end modes appear within the gaps of finite length chains. We find, in agreement with the experiment, that when the chain and substrate orbitals are strongly hybridized, Majorana end modes are substantially reduced in amplitude when separated from the chain end by less than the coherence length defined by the p -wave superconducting gap. We conclude that Pb is a particularly favorable substrate material for ferromagnetic chain topological superconductivity because it provides both strong s -wave pairing and strong Rashba spin-orbit coupling, but that there is an opportunity to optimize properties by varying the atomic composition and structure of the chain. Finally, we note that in the absence of disorder, a new chain magnetic symmetry, one that is also present in the crystalline topological insulators, can stabilize multiple

  6. Magnetic properties of the Sc-H system

    Energy Technology Data Exchange (ETDEWEB)

    Volkenshtein, N.V.; Galoshina, E.V. (AN SSSR, Sverdlovsk. Ural' skij Nauchnyj Tsentr); Kost, M.E. (AN SSSR, Moscow. Inst. Obshchej i Neorganicheskoj Khimii); Shubina, T.S. (Ural' skij Gosudarstvennyj Univ., Sverdlovsk (USSR))

    1983-05-01

    The magnetic susceptibility in the ..cap alpha..-phase region of the Sc-H system and in scandium hydrides ScH/sub 2/ is investigated. The temperature dependence of the susceptibility was measured from liquid-helium temperature to room temperature in a magnetic field of 10 kOe. The influence of hydrogenation and of band structure parameters (density of states at the Fermi level, spin-relaxation time, and Fermi energy) on the susceptibility is shown and discussed.

  7. Highly responsive ground state of PbTaSe2: Structural phase transition and evolution of superconductivity under pressure

    Science.gov (United States)

    Kaluarachchi, Udhara S.; Deng, Yuhang; Besser, Matthew F.; Sun, Kewei; Zhou, Lin; Nguyen, Manh Cuong; Yuan, Zhujun; Zhang, Chenglong; Schilling, James S.; Kramer, Matthew J.; Jia, Shuang; Wang, Cai-Zhuang; Ho, Kai-Ming; Canfield, Paul C.; Bud'ko, Sergey L.

    2017-06-01

    Transport and magnetic studies of PbTaSe2 under pressure suggest the existence of two superconducting phases with the low temperature phase boundary at ˜0.25 GPa that is defined by a very sharp, first order, phase transition. The first order phase transition line can be followed via pressure dependent resistivity measurements, and is found to be near 0.12 GPa near room temperature. Transmission electron microscopy and x-ray diffraction at elevated temperatures confirm that this first order phase transition is structural and occurs at ambient pressure near ˜425 K. The new, high temperature/high pressure phase has a similar crystal structure and slightly lower unit cell volume relative to the ambient pressure, room temperature structure. Based on first-principles calculations this structure is suggested to be obtained by shifting the Pb atoms from the 1 a to 1 e Wyckoff position without changing the positions of Ta and Se atoms. PbTaSe2 has an exceptionally pressure sensitive, structural phase transition with Δ Ts/Δ P ≈-1400 K/GPa near room temperature, and ≈-1700 K/GPa near 4 K. This first order transition causes a ˜1 K (˜25 % ) steplike decrease in Tc as pressure is increased through 0.25 GPa.

  8. Application of PC-SAFT and cubic equations of state for the correlation of solubility of some pharmaceutical and statin drugs in SC-CO2

    Directory of Open Access Journals (Sweden)

    Abdallah El Hadj. A.

    2013-01-01

    Full Text Available In this work, the solubilities of some anti-inflammatory (nabumetone, phenylbutazone and salicylamide and statin drugs (fluvastatin, atorvastatin, lovastatin, simvastatin and rosuvastatin were correlated using the Perturbed-Chain Statistical Associating Fluid Theory (PC-SAFT with one-parameter mixing rule and commonly used cubic equations of state Peng-Robinson (PR and Soave-Redlich-Kwong (SRK combining with van-der Waals-1 parameter (VDW1 and van-der Waals-2 parameters (VDW2 mixing rules. The experimental data for studied compounds were taken from literature at temperature and pressure in ranges (308-348 K and (100-360 bar respectively. The critical properties required for the correlation with PR and SRK were estimated using Gani and Noonalol contribution group methods whereas, PC-SAFT pure-component parameters; segment number (m, segment diameter (σ and energy parameter (ε/k have been estimated by tihic’s group contribution method for nabumetone. For phenylbutazone and salicylamide those parameters were determined using a linear correlation. For statin drugs, PC-SAFT parameters were fitted to solubility data, and binary interaction parameters (kij and lij have been obtained by fitting the experimental data. The result was found to be in good agreement with the experimental data and showed that PC-SAFT approach can be used to model solid-SCF equilibrium with better correlation accuracy than cubic equations of state.

  9. Superconductivity from correlated hopping

    CERN Document Server

    Batista, C D; Aligia, A A

    1995-01-01

    We consider a chain described by a next-nearest-neighbor hopping combined with a nearest-neighbor spin flip. In two dimensions this three-body term arises from a mapping of the three-band Hubbard model for CuO$_2$ planes to a generalized $t-J$ model and for large O-O hopping favors resonance-valence-bond superconductivity of predominantly $d$-wave symmetry. Solving the ground state and low-energy excitations by analytical and numerical methods we find that the chain is a Luther-Emery liquid with correlation exponent $K_{\\rho} = (2-n)^2/2$, where $n$ is the particle density.

  10. Superconducting Electronic Film Structures

    Science.gov (United States)

    1991-02-14

    cubic, yttria stabilized, zirconia (YSZ) single crystals with (100) orientation and ao = 0.512 to 0.516 nm. Films were magnetron-sputtered... Crown by Solid-State and Vapor-Phase Epitaxy," IEEE Trans. Uagn. 25(2), 2538 (1989). 6. J. H. Kang, R. T. Kampwirth, and K. E. Gray, "Superconductivity...summarized in Fig. 1, are too high for SrTiO3 or yttria- stabilized zirconia (YSZ) to be used in rf applications. MgO, LaAIO 3 , and LaGaO3 have a tan 6

  11. High field superconducting magnets

    Science.gov (United States)

    Hait, Thomas P. (Inventor); Shirron, Peter J. (Inventor)

    2011-01-01

    A superconducting magnet includes an insulating layer disposed about the surface of a mandrel; a superconducting wire wound in adjacent turns about the mandrel to form the superconducting magnet, wherein the superconducting wire is in thermal communication with the mandrel, and the superconducting magnet has a field-to-current ratio equal to or greater than 1.1 Tesla per Ampere; a thermally conductive potting material configured to fill interstices between the adjacent turns, wherein the thermally conductive potting material and the superconducting wire provide a path for dissipation of heat; and a voltage limiting device disposed across each end of the superconducting wire, wherein the voltage limiting device is configured to prevent a voltage excursion across the superconducting wire during quench of the superconducting magnet.

  12. Nonlinear diffusion and superconducting hysteresis

    Energy Technology Data Exchange (ETDEWEB)

    Mayergoyz, I.D. [Univ. of Maryland, College Park, MD (United States)

    1996-12-31

    Nonlinear diffusion of electromagnetic fields in superconductors with ideal and gradual resistive transitions is studied. Analytical results obtained for linear and nonlinear polarizations of electromagnetic fields are reported. These results lead to various extensions of the critical state model for superconducting hysteresis.

  13. "First stone" ceremony for the SC : authorities in the audience. From right: Sir Ben Lockspeiser, President of the CERN Council, Felix Bloch, Francois Perreard, President of the Council of State of the canton of Geneva, C.J. Bakker and A.Pennetta

    CERN Multimedia

    1955-01-01

    "First stone" ceremony for the SC : authorities in the audience. From right: Sir Ben Lockspeiser, President of the CERN Council, Felix Bloch, Francois Perreard, President of the Council of State of the canton of Geneva, C.J. Bakker and A.Pennetta

  14. Superconductivity, antiferromagnetism, and neutron scattering

    Energy Technology Data Exchange (ETDEWEB)

    Tranquada, John M., E-mail: jtran@bnl.gov; Xu, Guangyong; Zaliznyak, Igor A.

    2014-01-15

    High-temperature superconductivity in both the copper-oxide and the iron–pnictide/chalcogenide systems occurs in close proximity to antiferromagnetically ordered states. Neutron scattering has been an essential technique for characterizing the spin correlations in the antiferromagnetic phases and for demonstrating how the spin fluctuations persist in the superconductors. While the nature of the spin correlations in the superconductors remains controversial, the neutron scattering measurements of magnetic excitations over broad ranges of energy and momentum transfers provide important constraints on the theoretical options. We present an overview of the neutron scattering work on high-temperature superconductors and discuss some of the outstanding issues. - Highlights: • High-temperature superconductivity is closely associated with antiferromagnetism. • Antiferromagnetic spin fluctuations coexist with the superconductivity. • Neutron scattering is essential for characterising the full spectrum of spin excitations.

  15. Domain wall description of superconductivity

    CERN Document Server

    Brito, F A; Silva, J C M

    2012-01-01

    In the present work we shall address the issue of electrical conductivity in superconductors in the perspective of superconducting domain wall solutions in the realm of field theory. We take our set up made out of a dynamical complex scalar field coupled to gauge field to be responsible for superconductivity and an extra scalar real field that plays the role of superconducting domain walls. The temperature of the system is interpreted as the parameter to move type I to type II domain walls. Alternatively, this means that the domain wall surface is suffering an acceleration as one goes from one type to another. On the other hand, changing from type I to type II state means a formation of a condensate what is in perfect sense of lowering the temperature around the superconductor. One can think of this scenario as an analog of holographic scenarios where this set up is replaced by a black hole near the domain wall.

  16. Theory of superconductivity

    CERN Document Server

    Crisan, Mircea

    1989-01-01

    This book discusses the most important aspects of the theory. The phenomenological model is followed by the microscopic theory of superconductivity, in which modern formalism of the many-body theory is used to treat most important problems such as superconducting alloys, coexistence of superconductivity with the magnetic order, and superconductivity in quasi-one-dimensional systems. It concludes with a discussion on models for exotic and high temperature superconductivity. Its main aim is to review, as complete as possible, the theory of superconductivity from classical models and methods up t

  17. The metallofullerene field-induced single-ion magnet HoSc2 N@C80.

    Science.gov (United States)

    Dreiser, Jan; Westerström, Rasmus; Zhang, Yang; Popov, Alexey A; Dunsch, Lothar; Krämer, Karl; Liu, Shi-Xia; Decurtins, Silvio; Greber, Thomas

    2014-10-13

    The low-temperature magnetic properties of the endohedral metallofullerene HoSc2 N@C80 have been studied by superconducting quantum interference device (SQUID) magnetometry. Alternating current (ac) susceptibility measurements reveal that this molecule exhibits slow relaxation of magnetization in a small applied field with timescales in the order of milliseconds. The equilibrium magnetic properties of HoSc2 N@C80 indicate strong magnetic anisotropy. The large differences in magnetization relaxation times between the present compound and the previously investigated DySc2 N@C80 are discussed. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Superconductivity in LiFeAs probed with quasiparticle interference

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Zhixiang; Nag, Pranab Kumar; Baumann, Danny; Kappenberger, Rhea [Leibniz Institute for Solid State and Materials Research Dresden, IFW Dresden (Germany); Wurmehl, Sabine [Leibniz Institute for Solid State and Materials Research Dresden, IFW Dresden (Germany); Institute for Solid State Physics, TU Dresden (Germany); Buechner, Bernd [Leibniz Institute for Solid State and Materials Research Dresden, IFW Dresden (Germany); Institute for Solid State Physics, TU Dresden (Germany); Center for Transport and Devices, TU Dresden (Germany); Hess, Christian [Leibniz Institute for Solid State and Materials Research Dresden, IFW Dresden (Germany); Center for Transport and Devices, TU Dresden (Germany)

    2016-07-01

    In spite of many theoretical and experimental efforts on studying the superconductivity of iron-based high temperature superconductors, the puzzle about LiFeAs's superconducting mechanism and pairing symmetry are still not clear. Here we want to present our low temperature scanning tunneling microscopy results on probing the superconductivity of LiFeAs. By taking conductance spectroscopic maps for both the superconducting state and normal state, we identify the scatterings due to the electron and hole bands close to the Fermi level. We observe a strong indication that the superconducting behavior in the hole bands are important for the formation of superconductivity in LiFeAs. Our results may also shine light on understanding the superconductivity in other iron pnictide superconductors.

  19. Structural analysis and magmatism characterization of the Major Gercino shear zone, Santa Catarina State, Brazil; Analise estrutural e caracterizacao do magmatismo da zona de cisalhamento Major Gercino, SC

    Energy Technology Data Exchange (ETDEWEB)

    Passarelli, Claudia Regina

    1996-12-31

    This work describes the geometric and kinematic characteristics of the Major Gercino Shear Zone (MGSZ) in the Canelinha-Garcia area. This shear zone is one of the major lineaments that affect all southern Brazilian precambrian terrains. In Santa Catarina State, it separates, along its whole extension, the supracrustal rocks of the Brusque belt (northern part) from the Granitoid belt (southern). This zone is characterized by a regional NE trend and a dextral sense of movement where ductile-brittle structures predominate. The MGSZ is composed of two mylonitic belts separated by granitoid rocks probably associated to the development of the shear zone. Both shear zones show cataclastic to ultra mylonitic rocks, but mylonites and protomylonites conditions at high strain rate. The calc-alkaline granitoids present in the area can be grouped in two granitoid associations with meta to peraluminous affinities. The Rolador Granitoid Association is characterized by grayish porphyritic biotite-monzogranites and the Fernandes Granitoid Association by coarsed-grained to porphyritic pinkish amphibole-syenogranites. The U-Pb and Rb-Sr ages range from 670 to 590 Ma with the Sr{sup 87} / Sr{sup 86} initial ratios suggesting a crustal contribution in the generation of these rocks. The importance of the pure shear component is also emphasized by the results of the Fry method. Many z axes of the strain ellipses are at high angle to the shear foliation. Symmetric porphyroclasts also corroborate this hypothesis. The micaceous minerals formed during the shear development indicate K-Ar ages around 555 {+-} 15 Ma. Brittle reactivations of the shear zone have been placed by K-Ar in fine-fraction materials at Triassic time (215 {+-} 15 Ma.) 220 refs., 107 figs., 18 tabs., 4 maps

  20. Superconductivity: The persistence of pairs

    Energy Technology Data Exchange (ETDEWEB)

    Edelman, Alex; Littlewood, Peter

    2015-05-20

    Superconductivity stems from a weak attraction between electrons that causes them to form bound pairs and behave much like bosons. These so-called Cooper pairs are phase coherent, which leads to the astonishing properties of zero electrical resistance and magnetic flux expulsion typical of superconducting materials. This coherent state may be qualitatively understood within the Bose–Einstein condensate (BEC) model, which predicts that a gas of interacting bosons will become unstable below a critical temperature and condense into a phase of matter with a macroscopic, coherent population in the lowest energy state, as happens in 4He or cold atomic gases. The successful theory proposed by Bardeen, Cooper and Schrieffer (BCS) predicts that at the superconducting transition temperature Tc, electrons simultaneously form pairs and condense, with no sign of pairing above Tc. Theorists have long surmised that the BCS and BEC models are opposite limits of a single theory and that strong interactions or low density can, in principle, drive the system to a paired state at a temperature Tpair higher than Tc, making the transition to the superconducting state BEC-like (Fig. 1). Yet most superconductors to date are reasonably well described by BCS theory or its extensions, and there has been scant evidence in electronic materials for the existence of pairing independent of the full superconducting state (though an active debate rages over the cuprate superconductors). Writing in Nature, Jeremy Levy and colleagues have now used ingenious nanostructured devices to provide evidence for electron pairing1. Perhaps surprisingly, the material they have studied is a venerable, yet enigmatic, low-temperature superconductor, SrTiO3.

  1. Ordinary and triplet superconducting spin valve effect in Fe/Pb based systems

    Energy Technology Data Exchange (ETDEWEB)

    Leksin, Pavel; Schumann, Joachim; Krupskaya, Yulia; Kataev, Vladislav; Hess, Christian; Schmidt, Oliver; Buechner, Bernd [Leibniz Institute for Solid State and Materials Research IFW Dresden (Germany); Garifyanov, Nadir; Garifullin, Ilgiz [Zavoisky Physical-Technical Institute of RAS, Kazan (Russian Federation); Fominov, Yakov [L. D. Landau Institute for Theoretical Physics of RAS, Moscow (Russian Federation)

    2015-07-01

    We report on experimental evidence for the occurrence of the long range triplet correlations (LRTC) of the superconducting (SC) condensate in the spin-valve heterostructures CoO{sub x}/Fe1/Cu/Fe2/Pb. The LRTC generation in this layer sequence is accompanied by a T{sub c} suppression near the orthogonal mutual orientation of the Fe1 and Fe2 layers' magnetization. This T{sub c} drop reaches its maximum of 60mK at the Fe2 layer thickness d{sub Fe2} = 0.6 nm and falls down when d{sub Fe2} is increased. The modification of the Fe/Pb interface by using a thin Cu layer between Fe and Pb layers reduces the SC transition width without preventing the interaction between Pb and Fe2 layers. The dependence of the SSVE magnitude on Fe1 layer thickness d{sub Fe1} reveals maximum of the effect when d{sub Fe1} and d{sub Fe2} are equal and the d{sub Fe2} value is minimal. Using the optimal d{sub Fe1}, d{sub Fe2} and the intermediate Cu layer we realized almost full switching from normal to SC state due to SSVE.

  2. Suppression of multipacting in high power RF couplers operating with superconducting cavities

    Science.gov (United States)

    Ostroumov, P. N.; Kazakov, S.; Morris, D.; Larter, T.; Plastun, A. S.; Popielarski, J.; Wei, J.; Xu, T.

    2017-06-01

    Capacitive input couplers based on a 50 Ω coaxial transmission line are frequently used to transmit RF power to superconducting (SC) resonators operating in CW mode. It is well known that coaxial transmission lines are prone to multipacting phenomenon in a wide range of RF power level and operating frequency. The Facility for Rare Isotope Beams (FRIB) being constructed at Michigan State University includes two types of quarter wave SC resonators (QWR) operating at 80.5 MHz and two types of half wave SC resonators (HWR) operating at 322 MHz. As was reported in ref. [1] a capacitive input coupler used with HWRs was experiencing strong multipacting that resulted in a long conditioning time prior the cavity testing at design levels of accelerating fields. We have developed an insert into 50 Ω coaxial transmission line that provides opportunity to bias the RF coupler antenna and protect the amplifier from the bias potential in the case of breakdown in DC isolation. Two of such devices have been built and are currently used for the off-line testing of 8 HWRs installed in the cryomodule.

  3. Sample of superconducting wiring (Niobium Titanium)

    CERN Multimedia

    About NbTi cable: The cable consists of 36 strands of superconducting wire, each strand has a diameter of 0.825 mm and houses 6300 superconducting filaments of niobium-titanium (Nb-Ti, a superconducting alloy). Each filament has a diameter of about 0.006 mm, i.e. 10 times smaller than a typical human hair. The filaments are embedded in a high-purity copper matrix. Copper is a normal conducting material. The filaments are in the superconductive state when the temperature is below about -263ºC (10.15 K). When the filaments leave the superconductive state, the copper acts as conductor transports the electrical current. Each strand of The NbTi cable (at superconducting state) has a current density of up to above 2000 A/mm2 at 9 T and -271ºC (2.15 K). A cable transport a current of about 13000 A at 10 T and -271ºC (2.15 K). About LHC superconducting wiring: The high magnetic fields needed for the LHC can only be reached using superconductors. At very low temperatures, superconductors have no electrical resista...

  4. Sample of superconducting wiring (Niobium Titanium)

    CERN Multimedia

    About NbTi cable: The cable consists of 36 strands of superconducting wire, each strand has a diameter of 0.825 mm and houses 6300 superconducting filaments of niobium-titanium (Nb-Ti, a superconducting alloy). Each filament has a diameter of about 0.006 mm, i.e. 10 times smaller than a typical human hair. The filaments are embedded in a high-purity copper matrix. Copper is a normal conducting material. The filaments are in the superconductive state when the temperature is below about -263ºC (10.15 K). When the filaments leave the superconductive state, the copper acts as conductor transports the electrical current. Each strand of The NbTi cable (at superconducting state) has a current density of up to above 2000 A/mm2 at 9 T and -271ºC (2.15 K). A cable transport a current of about 13000 A at 10 T and -271ºC (2.15 K). About LHC superconducting wiring: The high magnetic fields needed for the LHC can only be reached using superconductors. At very low temperatures, superconductors have no electrical resistan...

  5. Ternary silicides ScIr{sub 4}Si{sub 2} and RERh{sub 4}Si{sub 2} (RE = Sc, Y, Tb-Lu) and quaternary derivatives RERh{sub 4}Si{sub 2-x}Sn{sub x} (RE = Y, Nd, Sm, Gd-Lu) - structure, chemical bonding, and solid state NMR spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Vosswinkel, Daniel; Benndorf, Christopher; Poettgen, Rainer [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Eckert, Hellmut [Muenster Univ. (Germany). Inst. fuer Physikalische Chemie; Sao Paulo Univ., Sao Carlos (Brazil). Inst. of Physics; Matar, Samir F. [Bordeaux Univ., CNRS, ICMCB, UPR 9048, Pessac (France)

    2016-11-01

    The silicides ScIr{sub 4}Si{sub 2} and RERh{sub 4}Si{sub 2} (RE = Sc, Y, Tb-Lu) and silicide stannides RERh{sub 4}Si{sub 2-x}Sn{sub x}(RE = Y, Nd, Sm, Gd-Lu) were synthesized from the elements by arc-melting and subsequent annealing. The new compounds crystallize with the orthorhombic YRh{sub 4}Ge{sub 2} type structure, space group Pnma. They were characterized by X-ray powder patterns and several structures were refined from single crystal X-ray diffractometer data. The main structural motifs of this series of silicides are tricapped trigonal prisms formed by the transition metal and rare earth atoms. One of the two crystallographically independent silicon sites allows for formation of solid solutions with tin, exemplarily studied for ErRh{sub 4}Si{sub 2-x}Sn{sub x}. Electronic structure calculations reveal strong covalent Rh-Si bonding as the main stability factor. Multinuclear ({sup 29}Si, {sup 45}Sc, and {sup 89}Y) magic-angle spinning (MAS) NMR spectra of the structure representatives with diamagnetic rare-earth elements (Sc, Y, Lu) are found to be consistent with the crystallographic data and specifically confirm the selective substitution of Sn in the Si2 sites in the quaternary compounds YRh{sub 4}SiSn and LuRh{sub 4}SiSn.

  6. Validação dos sistemas de alerta Machardy e Colpam 40® para previsão da requeima do tomateiro em Caçador, SC Validation of the warning systems MacHardy and Colpam 40® to forecast late blight in tomato from Caçador municipality, Santa Catarina state (SC Brazil

    Directory of Open Access Journals (Sweden)

    Walter Ferreira Becker

    2010-09-01

    Full Text Available Foram validados dois sistemas de alerta na requeima do tomateiro, no município de Caçador-SC em dois ciclos de cultivo. No primeiro ciclo, os métodos de MacHardy modificado e Colpam 40®, este com valor de severidade acumulado da doença (VS igual a 10, como alerta para a pulverização de fungicidas de contato e comparados ao sistema convencional de calendário no híbrido Carmen e na cultivar Santa Clara. Em relação ao convencional, a indicação de pulverizações pelos sistemas de alerta permitiu uma redução na aplicação de fungicidas de 33,3% e 48,1%, pelos métodos de MacHardy modificado e Colpam 40®, respectivamente. A produtividade foi maior no híbrido Carmen do que na cv. S. Clara, mas em cada um destes materiais não houve diferença entre os sistemas de alerta e o convencional. Na cv. Carmen não houve diferença no controle da requeima na comparação do sistema convencional com o Colpam 40®. No segundo ciclo, usou-se o híbrido Carmen e os sistemas de alerta McHardy e Colpam 40 ® este com VS igual a 8 e 10 comparando-os ao sistema convencional. Não houve diferença na produtividade entre os tratamentos. Em relação ao número de pulverizações houve redução de 42,8% e 60,7% para VS igual a 8 e 10, respectivamente, com o sistema de alerta do Colpam 40® e de 39,2% com o de McHardy. Na avaliação da requeima, não houve diferença entre os tratamentos, exceto para o maior VS de alerta monitorado segundo o Colpam 40® cuja intensidade da doença foi maior. Este trabalho demonstrou que o uso destes dois sistemas de alerta da requeima, MacHardy e Colpam 40, poderiam ser ferramentas úteis para os produtores de tomate na tomada de decisão da pulverização em tomate na região de Caçador, SC.Two warning systems for late blight in tomato were evaluated in two growing seasons in Caçador Municipality, Santa Catarina State (SC, Brazil. In the first growing season, as warming for fungicide spraying in late blight control

  7. Energy dependence of deformation parameters in the SC(p,p') SC reaction

    Energy Technology Data Exchange (ETDEWEB)

    Jones, K.W.; Glashausser, C.; de Swiniarski, R.; Nanda, S.; Carey, T.A.; Cornelius, W.; Moss, J.M.; McClelland, J.B.; Comfort, J.R.; Escudie, J.

    1986-01-01

    Values of deformation parameters have been extracted from macroscopic coupled-channels analyses of inelastic proton scattering to the first 2 , 3 , and 4 states of SC over the energy range from 200 to 700 MeV. The apparent deformations are almost unchanged over this energy interval; they agree also with nucleon scattering data at much lower energies and at 800 MeV and 1 GeV.

  8. Color-Neutral Superconducting Quark Matter

    CERN Document Server

    Steiner, A W; Prakash, M; Steiner, Andrew W.; Reddy, Sanjay; Prakash, Madappa

    2002-01-01

    We investigate the consequences of enforcing local color neutrality on the color superconducting phases of quark matter by utilizing the Nambu-Jona-Lasinio model supplemented by diquark and the t'Hooft six-fermion interactions. In neutrino free matter at zero temperature, color neutrality guarantees that the number densities of $u, d, {\\rm and} s$ quarks in the Color-Flavor-Locked (CFL) phase will be equal even with physical current quark masses. Electric charge neutrality follows as a consequence and without the presence of electrons. In contrast, electric charge neutrality in the less symmetric 2-flavor superconducting (2SC) phase with $ud$ pairing requires more electrons than the normal quark phase. The free energy density cost of enforcing color and electric charge neutrality in the CFL phase is lower than that in the 2SC phase, which favors the formation of the CFL phase. With increasing temperature and neutrino content, an unlocking transition occurs from the CFL phase to the 2SC phase with the order of...

  9. Rotary condenser for SC2

    CERN Multimedia

    1975-01-01

    During 1975 the SC2 performance was improved among other things by redesigning some of the elements of the ROTCO (Annual Report 1975, p. 55). The photo shows an interior wiew of the housing of the rotary condenser and of the sixteen sets of shaped stator blades.

  10. Investigation of the superconducting gap structure in κ-(BEDT-TTF)2Cu(NCS)2 and κ-(BEDT-TTF)2Cu[N(CN)2]Br by means of thermal-conductivity measurements

    Science.gov (United States)

    Kühlmorgen, S.; Schönemann, R.; Green, E. L.; Müller, J.; Wosnitza, J.

    2017-10-01

    We report temperature-dependent thermal-conductivity, κ, measurements on the layered quasi-two-dimensional organic superconductors κ-(BEDT-TTF)2Cu(NCS)2 and κ-(BEDT-TTF)2Cu[N(CN)2]Br down to 160 mK. The results for κ-(BEDT-TTF)2Cu(NCS)2 may be consistent with a nodal superconducting (SC) gap structure as indicated by a non-negligible remnant linear contribution when κ/T \\propto T2 is extrapolated to T = 0 . For κ-(BEDT-TTF)2Cu[N(CN)2]Br, contrary to expectations, higher κ values are observed in the superconducting regime as compared to the normal, high-field state evidencing a dominant phonon contribution to κ in the superconducting state. The strong increase of κ in the normal state below T c for both samples indicates strong electron–phonon scattering. Our results highlight the need for thermal-conductivity measurements performed down to significantly lower temperatures to determine the symmetry of the SC gap.

  11. Experimental hysteretic loss for a series of superconducting filamentary NbTi wires and a field dependent critical state model. Final technical report 2 Oct 1972--31 Dec 1974

    Energy Technology Data Exchange (ETDEWEB)

    Ohmer, M.C.; Wollan, J.J.; Lawson, L.O.

    1975-07-01

    This report summarizes the Air Force superconducting wire applications, the goals of future superconducting materials development, the state of the art theories of ac loss in superconductors, and the results of hysteretic loss measurements on a series of niobium--titanium multifilamentary wires. Expressions were developed for magnetization and hysteretic loss for half cycle and full cycle for rod geometries for a critical state model with critical current inversely proportional to field. Bulk effects with surface like character are discussed along with surface shielding fields and the demagnetizing factor. The loss expressions of various models are compared to experimental loss. Universal loss curves constructed from experimental loss curves by appropriate normalization are obtained and used to predict loss accurately. (GRA)

  12. Simple Superconducting "Permanent" Electromagnet

    Science.gov (United States)

    Israelson, Ulf E.; Strayer, Donald M.

    1992-01-01

    Proposed short tube of high-temperature-superconducting material like YBa2Cu3O7 acts as strong electromagnet that flows as long as magnetic field remains below critical value and temperature of cylinder maintained sufficiently below superconducting-transition temperature. Design exploits maximally anisotropy of high-temperature-superconducting material.

  13. Basic principle of superconductivity

    OpenAIRE

    De Cao, Tian

    2007-01-01

    The basic principle of superconductivity is suggested in this paper. There have been two vital wrong suggestions on the basic principle, one is the relation between superconductivity and the Bose-Einstein condensation (BEC), and another is the relation between superconductivity and pseudogap.

  14. Characterization of superconducting multilayers samples

    CERN Document Server

    Antoine, C Z; Berry, S; Bouat, S; Jacquot, J F; Villegier, J C; Lamura, G; Gurevich, A

    2009-01-01

    Best RF bulk niobium accelerating cavities have nearly reached their ultimate limits at rf equatorial magnetic field H  200 mT close to the thermodynamic critical field Hc. In 2006 Gurevich proposed to use nanoscale layers of superconducting materials with high values of Hc > HcNb for magnetic shielding of bulk niobium to increase the breakdown magnetic field inside SC RF cavities [1]. Depositing good quality layers inside a whole cavity is rather difficult but we have sputtered high quality samples by applying the technique used for the preparation of superconducting electronics circuits and characterized these samples by X-ray reflectivity, dc resistivity (PPMS) and dc magnetization (SQUID). Dc magnetization curves of a 250 nm thick Nb film have been measured, with and without a magnetron sputtered coating of a single or multiple stack of 15 nm MgO and 25 nm NbN layers. The Nb samples with/without the coating clearly exhibit different behaviors. Because SQUID measurements are influenced by edge an...

  15. DC superconducting fault current limiter

    Science.gov (United States)

    Tixador, P.; Villard, C.; Cointe, Y.

    2006-03-01

    There is a lack of satisfying solutions for fault currents using conventional technologies, especially in DC networks, where a superconducting fault current limiter could play a very important part. DC networks bring a lot of advantages when compared to traditional AC ones, in particular within the context of the liberalization of the electric market. Under normal operation in a DC network, the losses in the superconducting element are nearly zero and only a small, i.e. a low cost, refrigeration system is then required. The absence of zero crossing of a DC fault current favourably accelerates the normal zone propagation. The very high current slope at the time of the short circuit in a DC grid is another favourable parameter. The material used for the experiments is YBCO deposited on Al2O3 as well as YBCO coated conductors. The DC limitation experiments are compared to AC ones at different frequencies (50-2000 Hz). Careful attention is paid to the quench homogenization, which is one of the key issues for an SC FCL. The University of Geneva has proposed constrictions. We have investigated an operating temperature higher than 77 K. As for YBCO bulk, an operation closer to the critical temperature brings a highly improved homogeneity in the electric field development. The material can then absorb large energies without degradation. We present tests at various temperatures. These promising results are to be confirmed over long lengths.

  16. Proximity induced ferromagnetism, superconductivity, and finite-size effects on the surface and edge states of topological insulator nanostructures

    OpenAIRE

    Sengupta, Parijat; Kubis, Tillmann; Tan, Yaohua; Klimeck, Gerhard

    2014-01-01

    Bi$_{2}$Te$_{3}$ and Bi$_{2}$Se$_{3}$ are well known 3D-topological insulators. Films made of these materials exhibit metal-like surface states with a Dirac dispersion and possess high mobility. The high mobility metal-like surface states can serve as channel material for TI-based field effect transistors. While such a transistor offers superior terminal characteristics, they suffer from an inherent zero band gap problem. The absence of a band gap for the surface states prevents an easy turn-...

  17. Superconducting and mechanical properties of the bulk Bi(pb)SCCO system prepared via solid state and ammonium nitrate precipitation methods

    Energy Technology Data Exchange (ETDEWEB)

    Safran, S., E-mail: safran@science.ankara.edu.tr [Ankara University, Faculty of Science, Department of Physics, Tandoğan, Ankara 06100 (Turkey); Center of Excellence for Superconductivity Research, 50 Year Campus, Golbaşı, Ankara (Turkey); Kılıçarslan, E.; Ozturk, H. [Ankara University, Faculty of Science, Department of Physics, Tandoğan, Ankara 06100 (Turkey); Center of Excellence for Superconductivity Research, 50 Year Campus, Golbaşı, Ankara (Turkey); Alp, M. [Center of Excellence for Superconductivity Research, 50 Year Campus, Golbaşı, Ankara (Turkey); Akdogan, M. [Center of Excellence for Superconductivity Research, 50 Year Campus, Golbaşı, Ankara (Turkey); Abant İzzet Baysal University, Department of Physics, Bolu (Turkey); Asikuzun, E.; Ozturk, O. [Kastamonu University, Department of Physics, Kastamonu (Turkey); Kastamonu University, Research and Application Center, Kastamonu (Turkey); Kılıç, A. [Ankara University, Faculty of Science, Department of Physics, Tandoğan, Ankara 06100 (Turkey); Center of Excellence for Superconductivity Research, 50 Year Campus, Golbaşı, Ankara (Turkey)

    2015-09-01

    We have investigated the effect of preparation method on superconducting and mechanical properties of Bi(Pb)-2223 bulk samples using Bi{sub 1.85}Pb{sub 0.35}Sr{sub 2}Ca{sub 2}Cu{sub 3}O{sub 10±y} stoichiometry. Solid-state reaction and ammonium nitrate precipitation methods have been used for fabrication of the bulk samples. In addition, the effect of annealing time on BSCCO samples have been studied. Structural, electrical, magnetic and microhardness analyses of samples are performed by the X-ray powder diffraction (XRD), the Scanning Electron Microscopy (SEM), DC resistivity, AC susceptibility and Vickers microhardness test. The critical transition temperature, phase purity, surface morphology and crystallinity of the prepared bulk samples are compared with each other. Elasticity (E), brittleness (B{sub i}), fracture toughness (K{sub IC}) and yield strength (Y) values are also determined according to annealing time, applied load and production parameters of materials.

  18. Two anionically derivatized scandium oxoselenates(IV): ScF[SeO3] and Sc2O2[SeO3

    Science.gov (United States)

    Greiner, Stefan; Chou, Sheng-Chun; Schleid, Thomas

    2017-02-01

    Scandium fluoride oxoselenate(IV) ScF[SeO3] and scandium oxide oxoselenate(IV) Sc2O2[SeO3] could be synthesized through solid-state reactions. ScF[SeO3] was obtained phase-pure, by reacting mixtures of Sc2O3, ScF3 and SeO2 (molar ratio: 1:1:3) together with CsBr as fluxing agent in corundum crucibles embedded into evacuated glassy silica ampoules after firing at 700 °C for seven days. Sc2O2[SeO3] first emerged as by-product during the attempts to synthesize ScCl[SeO3] following aforementioned synthesis route and could later be reproduced from appropriate Sc2O3/SeO3 mixtures. ScF[SeO3] crystallizes monoclinically in space group P21/m with a=406.43(2), b =661.09(4), c=632.35(4) pm, β=93.298(3)° and Z=2. Sc2O2[SeO3] also crystallizes in the monoclinic system, but in space group P21/n with a=786.02(6), b=527.98(4), c=1086.11(8) pm, β=108.672(3)° for Z=4. The crystal structures of both compounds are strongly influenced by the stereochemically active lone pairs of the ψ1-tetrahedral [SeO3]2- anions. They also show partial structures, where the derivatizing F- or O2- anions play an important role. For ScF[SeO3] chains of the composition 2+ ∞ 1[FSc2/2] form from connected [FSc2]5+ dumbbells, while [OSc3]7+ pyramids and [OSc4]10+ tetrahedra units are condensed to layers according to 2+ ∞ 2[O2Sc2 ] in Sc2O2[SeO3].

  19. Aspects of Color Superconductivity

    CERN Document Server

    Hong, D K

    2001-01-01

    I discuss some aspects of recent developments in color superconductivity in high density quark matter. I calculate the Cooper pair gap and the critical points at high density, where magnetic gluons are not screened. The ground state of high density QCD with three light flavors is shown to be a color-flavor locking state, which can be mapped into the low-density hadronic phase. The meson mass at the CFL superconductor is also calculated. The CFL color superconductor is bosonized, where the Fermi sea is identified as a $Q$-matter and the gapped quarks as topological excitations, called superqualitons, of mesons. Finally, as an application of color supercoductivity, I discuss the neutrino interactions in the CFL color superconductor.

  20. Superconductivity of columbium

    Energy Technology Data Exchange (ETDEWEB)

    Cook, D.B.; Zemansky, M.W.; Boorse, H.A.

    1950-11-15

    Isothermal critical magnetic field curves and zero field transitions for several annealed specimens of columbium have been measured by an a.c. mutual inductance method at temperatures from 5.1 deg K to the zero field transition temperature. The H-T curve was found to fit the usual parabolic relationship H = H{sub 0}(1-T(2)/T(2){sub 0}) with H{sub 0} = 8250 oersteds and T{sub 0} = 8.65 deg K. The initial slope of the curve was 1910 oersteds/deg. The electronic specific heat in the normal state calculated from the thermodynamic equations is 0.0375T and the approximate Debye characteristic temperature in the superconducting state, 67 deg K. Results on a different grade of columbium with a tantalum impurity of 0.4 percent, according to neutron scattering measurements, were in agreement, with the data obtained from columbium of 0.2 percent maximum tantalum impurity.

  1. Microstructure and superconducting properties of MgB{sub 2} films prepared by solid state reaction of multilayer precursors of the elements

    Energy Technology Data Exchange (ETDEWEB)

    Kugler, B. [Max Planck Institute for Intelligent Systems, Heisenbergstr, 3, D-70569 Stuttgart (Germany); Aalen University, Beethovenstr, 1, D-73430 Aalen (Germany); Stahl, C.; Treiber, S. [Max Planck Institute for Intelligent Systems, Heisenbergstr, 3, D-70569 Stuttgart (Germany); Soltan, S. [Max Planck Institute for Solid State Research, Heisenbergstr, 1, D-70569 Stuttgart (Germany); Physics Department, Faculty of Science, Helwan University,11792-Cairo (Egypt); Haug, S.; Schuetz, G. [Max Planck Institute for Intelligent Systems, Heisenbergstr, 3, D-70569 Stuttgart (Germany); Albrecht, J., E-mail: ja@mf.mpg.de [Aalen University, Beethovenstr, 1, D-73430 Aalen (Germany)

    2012-09-30

    Surface morphology and superconducting properties of MgB{sub 2} superconducting thin films prepared by ex-situ annealing of multilayer Mg/B precursors in Mg vapor are studied. Depending on the precursor structure different physical and microstructural properties of the superconductor evolve. Structure and composition of the films are analyzed by scanning electron microscopy and wavelength dispersive x-ray spectroscopy. It is found that certain precursor structures can lead to high quality superconducting films, however, in specific precursor structures mechanical stress leads to the formation of wrinkles strongly affecting the superconducting homogeneity of the films. A correlation between microstructure and superconducting properties, such as pinning or critical current density, can be provided via magneto-optical Faraday microscopy. - Highlights: Black-Right-Pointing-Pointer Correlation of microstructure and properties of MgB2 films Black-Right-Pointing-Pointer Electron and ion based analysis of microstructure Black-Right-Pointing-Pointer Superconducting properties by magneto-optical imaging Black-Right-Pointing-Pointer Enhanced magnetic field stability by a particular microstructure.

  2. Superconductivity in Medicine

    Science.gov (United States)

    Alonso, Jose R.; Antaya, Timothy A.

    2012-01-01

    Superconductivity is playing an increasingly important role in advanced medical technologies. Compact superconducting cyclotrons are emerging as powerful tools for external beam therapy with protons and carbon ions, and offer advantages of cost and size reduction in isotope production as well. Superconducting magnets in isocentric gantries reduce their size and weight to practical proportions. In diagnostic imaging, superconducting magnets have been crucial for the successful clinical implementation of magnetic resonance imaging. This article introduces each of those areas and describes the role which superconductivity is playing in them.

  3. Enhanced superconductivity of fullerenes

    Energy Technology Data Exchange (ETDEWEB)

    Washington, II, Aaron L.; Teprovich, Joseph A.; Zidan, Ragaiy

    2017-06-20

    Methods for enhancing characteristics of superconductive fullerenes and devices incorporating the fullerenes are disclosed. Enhancements can include increase in the critical transition temperature at a constant magnetic field; the existence of a superconducting hysteresis over a changing magnetic field; a decrease in the stabilizing magnetic field required for the onset of superconductivity; and/or an increase in the stability of superconductivity over a large magnetic field. The enhancements can be brought about by transmitting electromagnetic radiation to the superconductive fullerene such that the electromagnetic radiation impinges on the fullerene with an energy that is greater than the band gap of the fullerene.

  4. Superconducting microfabricated ion traps

    CERN Document Server

    Wang, Shannon X; Labaziewicz, Jaroslaw; Dauler, Eric; Berggren, Karl; Chuang, Isaac L

    2010-01-01

    We fabricate superconducting ion traps with niobium and niobium nitride and trap single 88Sr ions at cryogenic temperatures. The superconducting transition is verified and characterized by measuring the resistance and critical current using a 4-wire measurement on the trap structure, and observing change in the rf reflection. The lowest observed heating rate is 2.1(3) quanta/sec at 800 kHz at 6 K and shows no significant change across the superconducting transition, suggesting that anomalous heating is primarily caused by noise sources on the surface. This demonstration of superconducting ion traps opens up possibilities for integrating trapped ions and molecular ions with superconducting devices.

  5. Protective link for superconducting coil

    Science.gov (United States)

    Umans, Stephen D.

    2009-12-08

    A superconducting coil system includes a superconducting coil and a protective link of superconducting material coupled to the superconducting coil. A rotating machine includes first and second coils and a protective link of superconducting material. The second coil is operable to rotate with respect to the first coil. One of the first and second coils is a superconducting coil. The protective link is coupled to the superconducting coil.

  6. Study of the relation between evaluation of strain distribution on superconducting coil and mechanical heat generation

    Science.gov (United States)

    Seino, Hiroshi; Kurihara, Minoru; Herai, Toshiki; Suzuki, Eiji

    2002-10-01

    In the superconducting Maglev system, on-board superconducting magnets (SCMs) are vibrated at various frequencies according to the train speed by the electromagnetic disturbance which is caused when the train passes over ground coils. Then a mechanical loss is generated inside the inner vessel in the SCM. This phenomenon increases the heat load on the cryogenic equipment in the SCM. It has been surmised that the mechanical heat inside the inner vessel is generated by the frictional heat caused by the relative microscopic slips between fasteners and superconducting coil (SC coil). Nevertheless, heat generation mechanisms inside the inner vessel have not been studied sufficiently. In this study, we suggest a hypothesis that the frictional heat generated by the relative microscopic slips between fasteners and a SC coil will be indicated if the calculated strain distribution on the SC coil is evaluated. The results of this study supported this hypothesis.

  7. First Operation of PIAVE, the Heavy Ion Injector Based on Superconducting RFQ's

    CERN Document Server

    Bisoffi, Giovanni; Battistella, Andrea; Bezzon, Giampietro; Boscagli, Lucia; Calore, Andrea; Canella, Stefania; Carlucci, Davide; Chiurlotto, Francesca; Comunian, Michele; De Lazzari, Mauro; Facco, Alberto; Fagotti, Enrico; Lombardi, Augusto; Modanese, Paolo; Moisio, M Francesca; Pisent, Andrea; Poggi, Marco; Porcellato, Anna M; Stark, Sergey

    2005-01-01

    The Positive Ion Accelerator for low-Velocity Ions (PIAVE), based on superconducting RFQ's (SRFQ's), has been completed in fall 2004 with the first acceleration of beams from the ECR ion source. Superconducting RFQ's were used, for the first time, for beam acceleration on a user-oriented accelerator complex. A general status of the injector performances is given: it includes, besides the SRFQ's, eight superconducting (SC) QWR's and three bunchers; the beam is received from an ECR source on a HV platform and is delivered, through the SC accelerator ALPI, to nuclear physics experimental apparatuses. The paper emphasizes, in particular, the technological challenges related to the operation of the SC cavities, the cryogenics, control, diagnostics and vacuum systems.

  8. Compensation of native donor doping in ScN: Carrier concentration control and p-type ScN

    Science.gov (United States)

    Saha, Bivas; Garbrecht, Magnus; Perez-Taborda, Jaime A.; Fawey, Mohammed H.; Koh, Yee Rui; Shakouri, Ali; Martin-Gonzalez, Marisol; Hultman, Lars; Sands, Timothy D.

    2017-06-01

    Scandium nitride (ScN) is an emerging indirect bandgap rocksalt semiconductor that has attracted significant attention in recent years for its potential applications in thermoelectric energy conversion devices, as a semiconducting component in epitaxial metal/semiconductor superlattices and as a substrate material for high quality GaN growth. Due to the presence of oxygen impurities and native defects such as nitrogen vacancies, sputter-deposited ScN thin-films are highly degenerate n-type semiconductors with carrier concentrations in the (1-6) × 1020 cm-3 range. In this letter, we show that magnesium nitride (MgxNy) acts as an efficient hole dopant in ScN and reduces the n-type carrier concentration, turning ScN into a p-type semiconductor at high doping levels. Employing a combination of high-resolution X-ray diffraction, transmission electron microscopy, and room temperature optical and temperature dependent electrical measurements, we demonstrate that p-type Sc1-xMgxN thin-film alloys (a) are substitutional solid solutions without MgxNy precipitation, phase segregation, or secondary phase formation within the studied compositional region, (b) exhibit a maximum hole-concentration of 2.2 × 1020 cm-3 and a hole mobility of 21 cm2/Vs, (c) do not show any defect states inside the direct gap of ScN, thus retaining their basic electronic structure, and (d) exhibit alloy scattering dominating hole conduction at high temperatures. These results demonstrate MgxNy doped p-type ScN and compare well with our previous reports on p-type ScN with manganese nitride (MnxNy) doping.

  9. 2010 ARRA Lidar: Hampton County (SC)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Provide high density LiDAR elevation data map of Hampton County, SC. Provide Bare Earth DEM (vegetation removal) of Hampton County, SC.

  10. Magnetic moment of {sup 48}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Ohtsubo, T., E-mail: tohtsubo@np.gs.niigata-u.ac.jp; Kawamura, Y.; Ohya, S. [Niigata University, Department of Physics (Japan); Izumikawa, T. [Niigata University, Radioisotope Center (Japan); Nishimura, K. [Toyama University, Faculty of Engineering (Japan); Muto, S. [Neutron Science Laboratory, KEK (Japan); Shinozuka, T. [Tohoku University, Cyclotron and Radioisotope Center (Japan)

    2007-11-15

    Nuclear magnetic resonances were measured for {sup 48}Sc and {sup 44m}Sc oriented at 8 mK in an Fe host metal. The magnetic hyperfine splitting frequencies at an external magnetic field of 0.2 T were determined to be 63.22(11) MHz and 64.81(1) MHz for {sup 48}Sc and {sup 44m}Sc, respectively. With the known magnetic moment of {mu}({sup 44m}Sc)=+3.88 (1) {mu}{sub N}, the magnetic moment of {sup 48}Sc is deduced as {mu}({sup 44}Sc)=+3.785(12) {mu}{sub N}. The measured magnetic moment of {sup 48}Sc is discussed in terms of the shell model using the effective interactions.

  11. Superconductivity in transition metals.

    Science.gov (United States)

    Slocombe, Daniel R; Kuznetsov, Vladimir L; Grochala, Wojciech; Williams, Robert J P; Edwards, Peter P

    2015-03-13

    A qualitative account of the occurrence and magnitude of superconductivity in the transition metals is presented, with a primary emphasis on elements of the first row. Correlations of the important parameters of the Bardeen-Cooper-Schrieffer theory of superconductivity are highlighted with respect to the number of d-shell electrons per atom of the transition elements. The relation between the systematics of superconductivity in the transition metals and the periodic table high-lights the importance of short-range or chemical bonding on the remarkable natural phenomenon of superconductivity in the chemical elements. A relationship between superconductivity and lattice instability appears naturally as a balance and competition between localized covalent bonding and so-called broken covalency, which favours d-electron delocalization and superconductivity. In this manner, the systematics of superconductivity and various other physical properties of the transition elements are related and unified.

  12. A self-consistent determination of the RVB and SC gaps in the YRZ ansatz

    Science.gov (United States)

    Rao, Zi-Ye; Wang, Xiao-Min; Jiang, Hong-Min

    2017-03-01

    A correct understanding of the origin of the pseudogap in high temperature (high-T c) cuprate superconductors is considered to be a peripheral breakthrough in the understanding of the microscopic mechanism of the high-T c superconductivity. Yang-Rice-Zhang (YRZ) ansatz is an important phenomenological theory to describe the phenomenon of pseudogap. However, in the framework of YRZ, the pseudogap (resonant valence bond (RVB) gap) and the superconducting (SC) gap are unable to have a self-consistent determination at different doping concentrations, and this severely limits the application of the YRZ ansatz. Based on the YRZ ansatz, this study develops a technical method to determine the RVB and SC gaps in a self-consistent manner. It is revealed that the self-consistent calculations of the doping dependence of RVB, SC gaps and spectral function are not only consistent with the empirical gap formula in the YRZ framework, but also consistent with the doping evolution of the Fermi surface observed in the angle-resolved photoemission spectroscopy (ARPES) experiments. Our method will greatly extend the applications of the YRZ ansatz, and will deepen our understanding of the origin of pseudogap as well as the mechanism of high-T c superconductivity.

  13. Xemilofiban: SC 54684A, xemlofiban.

    Science.gov (United States)

    2003-01-01

    Xemilofiban [SC 54684, SC 54684A (HCl), xemlofiban], a glycoprotein IIb/IIIa antagonist, is an orally available prodrug of a non-peptide mimetic of the tetrapeptide RGDF. It is converted to the active metabolite, SC 54701 (the free base form of SC 54701A). Development was initiated by Searle (Monsanto). Searle became part of Pharmacia Corporation, which was acquired by, and merged into, Pfizer in April 2003. Searle had co-development and co-marketing agreements with Sankyo in Japan; these have been discontinued. In January 2003, Pharmacia donated the intellectual property for xemilofiban to Western Michigan University. In February 2003, Western Michigan University granted an exclusive worldwide licence of xemilofiban to VDDI Pharmaceuticals (formerly Virtual Drug Development Inc.). Xemilofiban was in a phase III clinical trial, the Evaluation of Xemilofiban in Controlling Thrombotic Events (EXCITE) trial, with Searle (Monsanto) in the US and Europe for the treatment of thrombosis in patients with unstable angina pectoris and acute myocardial infarction undergoing angioplasty. However, as xemilofiban demonstrated no significant clinical benefit, Searle discontinued its development. In Japan, Sankyo discontinued the development of xemilofiban for thrombosis at phase II following Searle's decision to drop the project. VDDI Pharmaceuticals plans to develop xemilofiban in cardiovascular disorders following on from the phase III studies completed by Pharmacia; a restructured dosing schedule and narrowed patient selection will be used. VDDI has research facilities worldwide and will utilise facilities in Ireland for the European clinical development programme; research facilities in the Southwest Michigan Innovation Center are planned while the head office of VDDI is based in Tennessee. Xemilofiban is in phase III development for the treatment of cardiovascular disease in conjunction with percutaneous coronary intervention.

  14. Exploring Interacting Quantum Many-Body Systems by Experimentally Creating Continuous Matrix Product States in Superconducting Circuits

    Science.gov (United States)

    Eichler, C.; Mlynek, J.; Butscher, J.; Kurpiers, P.; Hammerer, K.; Osborne, T. J.; Wallraff, A.

    2015-10-01

    Improving the understanding of strongly correlated quantum many-body systems such as gases of interacting atoms or electrons is one of the most important challenges in modern condensed matter physics, materials research, and chemistry. Enormous progress has been made in the past decades in developing both classical and quantum approaches to calculate, simulate, and experimentally probe the properties of such systems. In this work, we use a combination of classical and quantum methods to experimentally explore the properties of an interacting quantum gas by creating experimental realizations of continuous matrix product states—a class of states that has proven extremely powerful as a variational ansatz for numerical simulations. By systematically preparing and probing these states using a circuit quantum electrodynamics system, we experimentally determine a good approximation to the ground-state wave function of the Lieb-Liniger Hamiltonian, which describes an interacting Bose gas in one dimension. Since the simulated Hamiltonian is encoded in the measurement observable rather than the controlled quantum system, this approach has the potential to apply to a variety of models including those involving multicomponent interacting fields. Our findings also hint at the possibility of experimentally exploring general properties of matrix product states and entanglement theory. The scheme presented here is applicable to a broad range of systems exploiting strong and tunable light-matter interactions.

  15. Coexistence of ferromagnetism and superconductivity in YBCO nanoparticles.

    Science.gov (United States)

    Zhu, Zhonghua; Gao, Daqiang; Dong, Chunhui; Yang, Guijin; Zhang, Jing; Zhang, Jinlin; Shi, Zhenhua; Gao, Hua; Luo, Honggang; Xue, Desheng

    2012-03-21

    Nanoparticles of superconducting YBa(2)Cu(3)O(7-δ) were synthesized via a citrate pyrolysis technique. Room temperature ferromagnetism was revealed in the samples by a vibrating sample magnetometer. Electron spin resonance spectra at selected temperatures indicated that there is a transition from the normal to the superconducting state at temperatures below 100 K. The M-T curves with various applied magnetic fields showed that the superconducting transition temperatures are 92 K and 55 K for the air-annealed and the post-annealed samples, respectively. Compared to the air-annealed sample, the saturation magnetization of the sample by reheating the air-annealed one in argon atmosphere is enhanced but its superconductivity is weakened, which implies that the ferromagnetism maybe originates from the surface oxygen defects. By superconducting quantum interference device measurements, we further confirmed the ferromagnetic behavior at high temperatures and interesting upturns in field cooling magnetization curves within the superconducting region are found. We attributed the upturn phenomena to the coexistence of ferromagnetism and superconductivity at low temperatures. Room temperature ferromagnetism of superconducting YBa(2)Cu(3)O(7-δ) nanoparticles has been observed in some previous related studies, but the issue of the coexistence of ferromagnetism and superconductivity within the superconducting region is still unclear. In the present work, it will be addressed in detail. The cooperation phenomena found in the spin-singlet superconductors will help us to understand the nature of superconductivity and ferromagnetism in more depth.

  16. Inhomogeneous superconductivity in quasi-one dimensional organic conductors and ropes of carbon nanotubes

    Science.gov (United States)

    Bellafi, B.; Haddad, S.; Sfar, I.; Charfi-Kaddour, S.

    2009-03-01

    It has been reported that, in quasi-one dimensional organic conductors, superconductivity may coexist macroscopically with non-superconducting states giving rise to an inhomogeneous phase. We investigate, based on the time-dependent Ginzburg-Landau theory, the effect of disorder on the stability of the superconducting phase in such a mixed state. We also focus on the interplay between superconductivity and disorder in ropes of carbon nanotubes. We show that the superconducting transition temperature in quasi-one organic conductors is reduced by disorder but does not obey the Abrikosov-Gorkov law. However, and contrary to what is expected, disorder can further superconductivity in ropes of carbon nanotubes.

  17. Competition between superconductivity and charge density waves

    Science.gov (United States)

    Kim, Ki-Seok

    2007-02-01

    We derive an effective field theory for the competition between superconductivity (SC) and charge density waves (CDWs) by employing the SO(3) pseudospin representation of the SC and CDW order parameters. One important feature in the effective nonlinear σ model is the emergence of a Berry phase even at half filling, originating from the competition between SC and CDWs, i.e., the pseudospin symmetry. A-well known conflict between the previous studies of Oshikawa [Phys. Rev. Lett. 84, 1535 (2000)] and Lee and Shankar [Phys. Rev. Lett. 65, 1490 (1990)] is resolved by the appearance of the Berry phase. The Berry phase contribution allows a deconfined quantum critical point of fractionalized charge excitations with e instead of 2e in the SC-CDW quantum transition at half filling. Furthermore, we investigate the stability of the deconfined quantum criticality against quenched randomness by performing a renormalization group analysis of an effective vortex action. We argue that, although randomness results in a weak disorder fixed point differing from the original deconfined quantum critical point, deconfinement of the fractionalized charge excitations still survives at the disorder fixed point owing to a nonzero fixed point value of the vortex charge.

  18. A unified theory of superconductivity

    CERN Document Server

    Huang, Xiuqing

    2008-01-01

    In this work, we argue that the phonon-mediated BCS theory may be incorrect. Two kinds of glues, pairing (pseudogap) glue and superconducting glue, are suggested based on a real space Coulomb confinement effect. The scenarios provide a unified explanation of the pairing symmetry, pseudogap and superconducting states, spin--charge stripe order, magic doping fractions and vortex structures in conventional and unconventional (the high-Tc cuprates, MgB2 and the newly-discovered Fe-based family) superconductors. The theory agrees with the existence of a pseudogap in high-temperature superconductors, while no pseudogap feature could be observed in MgB2, iron-based and most of the conventional superconductors. Our results indicate that the superconducting phase can coexist with a triangular vortex lattice in pure MgB2 single crystal with a charge carrier density n=1.49*10^22/cm3. For iron-based superconductors, the relationship between the superconducting vortex phases and the optimal doping levels are analytically ...

  19. The Research of Preparing High Temperature Superconductive Materials for YBCO by the Traditional Solid-state Reaction Technique%固相反应法制备高温超导材料YBCO实验的研究

    Institute of Scientific and Technical Information of China (English)

    张选民; 郭娟; 赵会仙; 李友明

    2011-01-01

    介绍了固相反应法制备高温超导材料钇钡铜氧(YBCO)的实验方法,并研究了YBCO样品制备过程中不同烧结时间对样品的超导转变温度Tc及超导转变宽度ΔTc的影响。给出了实验过程中合适的烧结温度和烧结时间的参考值。%The experiments of preparing High Temperature Superconductive Materials for YBCO by the traditional solid-state reaction technique were introduced.The YBCO samples were subsequently sintered for different hours.We analyzed the treatment time influence on the YBCO superconducting transition temperature Tc and the width ΔTc,and got the experimental process suitable sintering temperature and sintering time references

  20. Phase diagram of K(x)Fe(2-y)Se(2-z)S(z) and the suppression of its superconducting state by an Fe2-Se/S tetrahedron distortion.

    Science.gov (United States)

    Lei, Hechang; Abeykoon, Milinda; Bozin, Emil S; Wang, Kefeng; Warren, J B; Petrovic, C

    2011-09-23

    We report structurally tuned superconductivity in a K(x)Fe(2-y)Se(2-z)S(z) (0 ≤ z ≤ 2) phase diagram. Superconducting T(c) is suppressed as S is incorporated into the lattice, eventually vanishing at 80% of S. The magnetic and conductivity properties can be related to stoichiometry on a poorly occupied Fe1 site and the local environment of a nearly fully occupied Fe2 site. The decreasing T(c) coincides with the increasing Fe1 occupancy and the overall increase in Fe stoichiometry from z = 0 to z = 2. Our results indicate that the irregularity of the Fe2-Se/S tetrahedron is an important controlling parameter that can be used to tune the ground state in the new superconductor family.

  1. Damping and support in high-temperature superconducting levitation systems

    Energy Technology Data Exchange (ETDEWEB)

    Hull, John R. (Sammamish, WA); McIver, Carl R. (Everett, WA); Mittleider, John A. (Kent, WA)

    2009-12-15

    Methods and apparatuses to provide improved auxiliary damping for superconducting bearings in superconducting levitation systems are disclosed. In a superconducting bearing, a cryostat housing the superconductors is connected to a ground state with a combination of a damping strip of material, a set of linkage arms to provide vertical support, and spring washers to provide stiffness. Alternately, the superconducting bearing may be supported by a cryostat connected to a ground state by posts constructed from a mesh of fibers, with the damping and stiffness controlled by the fiber composition, size, and mesh geometry.

  2. Damping and support in high-temperature superconducting levitation systems

    Science.gov (United States)

    Hull, John R.; McIver, Carl R.; Mittleider, John A.

    2009-12-15

    Methods and apparatuses to provide improved auxiliary damping for superconducting bearings in superconducting levitation systems are disclosed. In a superconducting bearing, a cryostat housing the superconductors is connected to a ground state with a combination of a damping strip of material, a set of linkage arms to provide vertical support, and spring washers to provide stiffness. Alternately, the superconducting bearing may be supported by a cryostat connected to a ground state by posts constructed from a mesh of fibers, with the damping and stiffness controlled by the fiber composition, size, and mesh geometry.

  3. 2-D Electromagnetic Model of Fast-Ramping Superconducting Magnets

    CERN Document Server

    Auchmann, B; Kurz, S; Russenschuck, Stephan

    2006-01-01

    Fast-ramping superconducting (SC) accelerator magnets are the subject of R&D efforts by magnet designers at various laboratories. They require modifications of magnet design tools such as the ROXIE program at CERN, i.e. models of dynamic effects in superconductors need to be implemented and validated. In this paper we present the efforts towards a dynamic 2-D simulation of fast-ramping SC magnets with the ROXIE tool. Models are introduced and simulation results are compared to measurements of the GSI001 magnet of a GSI test magnet constructed and measured at BNL.

  4. Materials Characterization of High-Temperature Epoxy Resins: SC-79 and SC-15/SC-79 Blend

    Science.gov (United States)

    2011-03-01

    Army composite applications. SC-15 is a toughened commercial vacuum-assisted resin transfer molding ( VARTM ) resin produced by Applied Poleramic Inc...very well in VARTM processes and has good damage resistance in structural and ballistic applications. However, the relatively low glass transition...low-viscosity, two-phase toughened, cycloaliphatic amine–cured commercial VARTM resin system designed to be easy to handle and have a long processing

  5. Levitation force between a small magnet and a superconducting sample of finite size in the Meissner state

    Science.gov (United States)

    Lugo, Jorge; Sosa, Victor

    1999-10-01

    The repulsion force between a cylindrical superconductor in the Meissner state and a small permanent magnet was calculated under the assumption that the superconductor was formed by a continuous array of dipoles distributed in the finite volume of the sample. After summing up the dipole-dipole interactions with the magnet, we obtained analytical expressions for the levitation force as a function of the superconductor-magnet distance, radius and thickness of the sample. We analyzed two configurations, with the magnet in a horizontal or vertical orientation.

  6. Evidence for Triplet Superconductivity in a Superconductor-Ferromagnet Spin Valve

    Science.gov (United States)

    Leksin, P. V.; Garif'yanov, N. N.; Garifullin, I. A.; Fominov, Ya. V.; Schumann, J.; Krupskaya, Y.; Kataev, V.; Schmidt, O. G.; Büchner, B.

    2012-08-01

    We have studied the dependence of the superconducting (SC) transition temperature on the mutual orientation of magnetizations of Fe1 and Fe2 layers in the spin valve system CoOx/Fe1/Cu/Fe2/Pb. We find that this dependence is nonmonotonic when passing from the parallel to the antiparallel case and reveals a distinct minimum near the orthogonal configuration. The analysis of the data in the framework of the SC triplet spin valve theory gives direct evidence for the long-range triplet superconductivity arising due to noncollinearity of the two magnetizations.

  7. Superconducting pulsed magnets

    CERN Document Server

    CERN. Geneva

    2006-01-01

    Lecture 1. Introduction to Superconducting Materials Type 1,2 and high temperature superconductors; their critical temperature, field & current density. Persistent screening currents and the critical state model. Lecture 2. Magnetization and AC Loss How screening currents cause irreversible magnetization and hysteresis loops. Field errors caused by screening currents. Flux jumping. The general formulation of ac loss in terms of magnetization. AC losses caused by screening currents. Lecture 3. Twisted Wires and Cables Filamentary composite wires and the losses caused by coupling currents between filaments, the need for twisting. Why we need cables and how the coupling currents in cables contribute more ac loss. Field errors caused by coupling currents. Lecture 4. AC Losses in Magnets, Cooling and Measurement Summary of all loss mechanisms and calculation of total losses in the magnet. The need for cooling to minimize temperature rise in a magnet. Measuring ac losses in wires and in magnets. Lecture 5. Stab...

  8. Final Scientific/Technical Report On AWARD NO. DE-SC0015635 “Organization of the 17th Advanced Accelerator Concepts (AAC16) Workshop by the IEEE” The IEEE Council on Superconductivity David F. Sutter (PI) Institute of Electrical & Electronics Engineers, Inc. 445 Hoes Lane Piscataway, NJ, 088544141, US. Period of time covered by the report: 5/1/2016 – 7/30/2017

    Energy Technology Data Exchange (ETDEWEB)

    Sutter, David F. [Inst. of Electrical and Electronics Engineers Inc., Piscataway, NJ (United States)

    2017-07-15

    The 2016 Workshop on Advanced Accelerator Concepts (AAC) was held at the Gaylord Hotel and Conference Center, National Harbor, Maryland, from July 31 through August 5, 2016. This workshop was the seventeenth in a biennial series that began at Los Alamos National Laboratory in 1982 with a workshop on laser acceleration of particles (see AIP Conf. Proc. 91). AAC16 was organized under the sponsorship of the IEEE Council on Superconductivity with financial support from the U. S. Department of Energy Office of High Energy Physics and the National Science Foundation. The scope of the AAC Workshop has grown since 1982 to encompass a broad range of topics related to advancing accelerator science and technology beyond its current scientific and technical limits and is now an internationally acknowledged forum for interdisciplinary discussions on advanced accelerator and beam physics/technology concepts covering the widest possible range of applications. The Workshop continued the trend of growing worldwide participation, attracting world wide participation. The Workshop had a total of 256 attendees comprising (including the U.S.) representatives from 11 countries representing 65 different institutions. Each day’s schedule began with plenary sessions covering broad, cross disciplinary interests or general tutorial topics as selected by the Program Committee, followed by a break out into more narrowly focused working groups. The Workshop was organized into eight Working Groups each with a published statement of topical focus, scope of discussion and goals. A summary of the Working Group activities and conclusions is included in the American Institute of Physics’ (AIP) Conference Proceedings now available as an on line open source document. It has been a long tradition of the AAC workshops to encourage strong student participation. This is accomplished in part by subsidizing student attendance, done for this work shop by using funds from the DOE and National Science

  9. Characteristics of persistent-current mode of HTS coil on superconducting electromagnet

    Energy Technology Data Exchange (ETDEWEB)

    Lee, C.Y., E-mail: cylee@krri.re.kr [Korea Railroad Research Institute, Woram Dong, Uiwang Si 437-757 (Korea, Republic of); Kim, J.; Han, Y.J.; Kang, B. [Korea Railroad Research Institute, Woram Dong, Uiwang Si 437-757 (Korea, Republic of); Chung, Y.D. [Department of Electrical Engineering, Suwon University, Bongdang Eup, Hwaseong Si 445-743 (Korea, Republic of); Yoon, Y.S. [Department of Electrical Engineering, Ansan College of Technology, Choji-Dong, Ansan Si 425-792 (Korea, Republic of); Chu, S.Y.; Hwang, Y.J.; Jo, H.C.; Jang, J.Y.; Ko, T.K. [Department of Electrical and Electronic Engineering, Yonsei University, Sinchon-dong, Seoul 120-749 (Korea, Republic of)

    2011-11-15

    The levitation gap of an electromagnetic suspension (EMS) system affects the current decay rate of superconducting electromagnet. The presence of iron core provides a significant benefit in the PCM performance of SC coil. The increased levitation gap of the EMS model with the SC-EM could negatively affect the design of SC-EM operated in PCM. This paper investigates the way in which the levitation gap of an electromagnetic suspension (EMS) system affects the current decay rate of superconducting electromagnet (SC-EM) operated in persistence-current mode (PCM). Using inductance analyzed from the magnetic circuit of an EMS model, the current decay rate caused by the variation in the levitation gap was simulated. In order to experimentally verify the simulation results, we fabricated a small-scale EMS model with SC coil operated in PCM and measured the current decay rates at different levitation gaps. The result showed that the presence of iron core provides a significant benefit in the PCM performance of SC coil, but the benefit decreased as the levitation gap increases. This study revealed that the increased levitation gap of the EMS model with the SC-EM could negatively affect the design of SC-EM operated in PCM.

  10. Flip effect in the orientation of a magnet levitating over a superconducting torus in the Meissner state

    Energy Technology Data Exchange (ETDEWEB)

    Diez-Jimenez, Efren, E-mail: ediez@ing.uc3m.e [Departamento de Ingenieria Mecanica, Universidad Carlos III de Madrid, Butarque, 15, E28911 Leganes (Spain); Perez-Diaz, Jose-Luis [Departamento de Ingenieria Mecanica, Universidad Carlos III de Madrid, Butarque, 15, E28911 Leganes (Spain)

    2011-01-15

    Research highlights: {yields} A torus superconductor shape has been analyzed. {yields} There is a flip effect on the stablest angular position of a magnet over the superconductor. {yields} The basis for a binary contactless proximity sensor has been presented. - Abstract: The torque between a permanent magnet and a toroidal superconductor in the Meissner state is calculated using a model previously proposed based on London's and Maxwell's equations. A flip effect on the stable orientation of the magnet as a function of position is demonstrated. At large distances the magnet tends to be perpendicular to the axis of the torus, but when you approach it, at a certain point there is a flip and it tends to be parallel to that axis while being closer than a certain limit. This effect can be easily used as a binary detector for proximity.

  11. Superconducting Qubits: A Short Review

    OpenAIRE

    Devoret, M. H.; Wallraff, A.; Martinis, J. M.

    2004-01-01

    Superconducting qubits are solid state electrical circuits fabricated using techniques borrowed from conventional integrated circuits. They are based on the Josephson tunnel junction, the only non-dissipative, strongly non-linear circuit element available at low temperature. In contrast to microscopic entities such as spins or atoms, they tend to be well coupled to other circuits, which make them appealling from the point of view of readout and gate implementation. Very recently, new designs ...

  12. 78 FR 20369 - South Carolina Disaster #SC-00021

    Science.gov (United States)

    2013-04-04

    ... ADMINISTRATION South Carolina Disaster SC-00021 AGENCY: U.S. Small Business Administration. ACTION: Notice. SUMMARY: This is a notice of an Administrative declaration of a disaster for the State of South Carolina dated 03/29/2013. Incident: Windsor Green Condo Complex Fire. Incident Period: 03/16/2013....

  13. Thermoelectric performance of functionalized Sc2C MXenes

    KAUST Repository

    Kumar, S.

    2016-07-05

    Functionalization of the MXene Sc2C, which has the rare property to realize semiconducting states for various functionalizations including O, F, and OH, is studied with respect to the electronic and thermal behavior. The lowest lattice thermal conductivity is obtained for OH functionalization and an additional 30% decrease can be achieved by confining the phonon mean free path to 100 nm. Despite a relatively low Seebeck coefficient, Sc2C(OH)2 is a candidate for intermediate-temperature thermoelectric applications due to compensation by a high electrical conductivity and very low lattice thermal conductivity.

  14. Unconventional superconductivity of NpPd{sub 5}Al{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Aoki, D; Homma, Y; Shiokawa, Y [Institute for Materials Research, Tohoku University, Oarai, Ibaraki 311-1313 (Japan); Haga, Y; Matsuda, T D; Ikeda, S; Sakai, H; Yamamoto, E; Nakamura, A [Advanced Science Research Center, Japan Atomic Energy Agency, Tokai, Ibaraki 319-1195 (Japan); Settai, R; Onuki, Y [Graduate School of Science, Osaka University, Toyonaka, Osaka 560-0043 (Japan)], E-mail: aokidai@gmail.com

    2009-04-22

    The high quality single crystals of NpPd{sub 5}Al{sub 2} with the body-centered tetragonal structure were grown by the Pb flux method. NpPd{sub 5}Al{sub 2} was found to be the first Np-based heavy fermion superconductor with the relatively high critical temperature T{sub sc} = 4.9 K. The upper critical field H{sub c2} is large and highly anisotropic. Corresponding to the heavy electronic state, the initial slope of H{sub c2} is large, but H{sub c2} at low temperatures is suppressed by the magnetic field, indicating a strong Pauli paramagnetic effect and the first-order transition at H{sub c2}. These results imply that NpPd{sub 5}Al{sub 2} is located at the proximity of the antiferromagnetic ordering, which might be hidden by the superconductivity. The d-wave superconductivity with a spin singlet state is most likely realized in NpPd{sub 5}Al{sub 2}.

  15. Evidence for a spin pseudogap in the normal state of superconducting Mo{sub 3}Sb{sub 7}

    Energy Technology Data Exchange (ETDEWEB)

    Tran, V H; Miiller, W [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, PO Box 1410, 50-950 Wroclaw (Poland); Hillier, A D; Adroja, D T [ISIS Facility, Rutherford Appleton Laboratory, Chilton, Oxfordshire OX11 0QX (United Kingdom); Bukowski, Z [Laboratory for Solid State Physics, ETH Zuerich, 8093 Zuerich (Switzerland)

    2009-12-02

    Using muon spin relaxation (muSR) and inelastic neutron scattering (INS) we have investigated the normal state of the superconductor Mo{sub 3}Sb{sub 7} and the reference compound Ru{sub 3}Sn{sub 7}. The muSR experiments on Ru{sub 3}Sn{sub 7} reveal static and relatively slow dynamic relaxations, which are ascribed to a random static nuclear dipole field and thermally activated muon motion, respectively. INS experiments on Ru{sub 3}Sn{sub 7}, on the other hand, reveal three phononic excitations at 11, 18 and 23 meV, substantiating the assertion of Einstein and Debye oscillations derived from the specific heat and electrical resistivity data. The distinct difference in the muSR as well as INS spectra between Ru{sub 3}Sn{sub 7} and Mo{sub 3}Sb{sub 7} provides strong evidence for a magnetic/electronic nature of the phase transition at T{sup *} = 50 K in the Mo-based compound. On the basis of the muSR and INS data, the energy spin pseudogap of 150(10) K was estimated. The observed weak magnetism in the dynamic susceptibility chi{sup ''}(Q,omega) and residual longitudinal field relaxation at 5 K imply a static ordering or quantum fluctuations.

  16. Development of a Solid State RF Amplifier in the kW Regime for Application with Low Beta Superconducting RF Cavities

    CERN Document Server

    Piel, Christian; Borisov, A; Kolesov, Sergej; Piel, Helmut

    2005-01-01

    Projects based on the use of low beta superconducting cavities for ions are under operation or development at several labs worldwide. Often these cavities are individually driven by RF power sources in the kW regime. For an ongoing project a modular 2 kW, 176 MHz unconditionally stable RF amplifier for CW and pulsed operation was designed, built, and tested. Extended thermal analysis was used to develop a water cooling system in order to optimize the performance of the power transistors and other thermally loaded components. The paper will outline the design concept of the amplifier and present first results on the test of the amplifier with a superconducting cavity.

  17. Bond polarons and high-Tc superconductivity in single layer La_(2-x)Sr_xCuO_4: normal state currents and pairing

    CERN Document Server

    Georgiev, Mladen

    2011-01-01

    We use the term "bond polaron" for a phonon coupled entity which makes the link between neighboring conductive CuO_2 layers in high-Tc superconductive materials. The link is essential for the superconductivity which requires a long range phase coherence in addition to pairing of carriers. The linkage features studied point to a process which is less dependent on the doped hole density implanted as x in the solid solution. The analysis applies to single layered materials mostly but may help understand multilayer ones as well.

  18. Superconducting energy recovery linacs

    Science.gov (United States)

    Ben-Zvi, Ilan

    2016-10-01

    High-average-power and high-brightness electron beams from a combination of laser photocathode electron guns and a superconducting energy recovery linac (ERL) is an emerging accelerator science with applications in ERL light sources, high repetition rate free electron lasers , electron cooling, electron ion colliders and more. This paper reviews the accelerator physics issues of superconducting ERLs, discusses major subsystems and provides a few examples of superconducting ERLs.

  19. Te vacancy-driven superconductivity in orthorhombic molybdenum ditelluride

    Science.gov (United States)

    Cho, Suyeon; Kang, Se Hwang; Yu, Ho Sung; Kim, Hyo Won; Ko, Wonhee; Hwang, Sung Woo; Han, Woo Hyun; Choe, Duk-Hyun; Jung, Young Hwa; Chang, Kee Joo; Lee, Young Hee; Yang, Heejun; Wng Kim, Sung

    2017-06-01

    Two-dimensional (2D) transition metal dichalcogenides (TMDs) have received great attentions because of diverse quantum electronic states such as topological insulating (TI), Weyl semimetallic (WSM) and superconducting states. Recently, the superconducting states emerged in pressurized semimetallic TMDs such as MoTe2 and WTe2 have become one of the central issues due to their predicted WSM states. However, the difficulty in synthetic control of chalcogen vacancies and the ambiguous magneto transport properties have hindered the rigorous study on superconducting and WSM states. Here, we report the emergence of superconductivity at 2.1 K in Te-deficient orthorhombic T d-MoTe2-x with an intrinsic electron-doping, while stoichiometric monoclinic 1T‧-MoTe2 shows no superconducting state down to 10 mK, but exhibits a large magnetoresistance of 32 000% at 2 K in a magnetic field of 14 T originating from nearly perfect compensation of electron and hole carriers. Scanning tunnelling spectroscopy and synchrotron x-ray diffraction combined with theoretical calculations clarify that Te vacancies trigger superconductivity via intrinsic electron doping and the evolution of the T d phase from the 1T‧ phase below 200 K. Unlike the pressure-induced superconducting state of monoclinic MoTe2, this Te vacancy-induced superconductivity is emerged in orthorhombic MoTe2, which is predicted as Weyl semimetal, via electron-doping. This chalcogen vacancy induced-superconductivity provides a new route for cultivating superconducting state together with WSM state in 2D van der Waals materials.

  20. Superconductive imaging surface magnetometer

    Science.gov (United States)

    Overton, Jr., William C.; van Hulsteyn, David B.; Flynn, Edward R.

    1991-01-01

    An improved pick-up coil system for use with Superconducting Quantum Interference Device gradiometers and magnetometers involving the use of superconducting plates near conventional pick-up coil arrangements to provide imaging of nearby dipole sources and to deflect environmental magnetic noise away from the pick-up coils. This allows the practice of gradiometry and magnetometry in magnetically unshielded environments. One embodiment uses a hemispherically shaped superconducting plate with interior pick-up coils, allowing brain wave measurements to be made on human patients. another embodiment using flat superconducting plates could be used in non-destructive evaluation of materials.

  1. Basic Study of Superconductive Actuator

    OpenAIRE

    涌井, 和也; 荻原, 宏康

    2000-01-01

    There are two kinds of electromagnetic propulsion ships : a superconductive electromagnetic propulsion ship and a superconductive electricity propulsion ship. A superconductive electromagnetic propulsion ship uses the electromagnetic force (Lorenz force) by the interaction between a magnetic field and a electric current. On the other hand, a superconductive electricity propulsion ship uses screws driven by a superconductive motor. A superconductive propulsion ship technique has the merits of ...

  2. A first-principles study of hydrogen interaction and saturation on ScAl{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Samolia, Madhu [Department of Chemistry, Indian Institute of Technology Ropar, Rupnagar 140001 (India); Dhilip Kumar, T.J., E-mail: dhilip@iitrpr.ac.in [Department of Chemistry, Indian Institute of Technology Ropar, Rupnagar 140001 (India)

    2013-03-05

    of 6 H{sub 2} molecules resulting in stable ScAl{sub 3}H{sub 12} structure. To obtain mechanistic insights into the hydrogenation process, the transition state and activation energy of H{sub 2} dissociation on the ScAl{sub 3} system has been determined.

  3. The insulating-to-superconducting transition in europium high-temperature superconducting ceramics

    CERN Document Server

    Rosenbaum, R

    1997-01-01

    Experiment resistivity data on high-temperature superconducting ceramics of fully oxygenated EuBa sub 2 Cu sub 3 sub - sub x Co sub x O sub y show that the insulating-to-superconducting transitions take place at liquid-helium temperature, provided that the cobalt fraction x exceeds 0.3. The resistivity follows a simple power-law dependence rho propor to T sup - sup 1 sup / sup 2 , attributed to electron-electron interactions. A model based upon intrinsic Josephson tunnelling junctions is suggested to explain the transition from insulating to superconducting states. (author)

  4. Cs2Te normal conducting photocathodes in the superconducting rf gun

    CERN Document Server

    Xiang, R; Buettig, H; Janssen, D; Justus, M; Lehnert, U; Michel, P; Murcek, P; Schamlott, A; Schneider, Ch; Schurig, R; Staufenbiel, F; Teichert, J

    2010-01-01

    The superconducting radio frequency photoinjector (SRF gun) is one of the latest applications of superconducting rf technology in the accelerator field. Since superconducting photocathodes with high quantum efficiency are yet unavailable, normal conducting cathode material is the main choice for SRF photoinjectors. However, the compatibility between the photocathode and the cavity is one of the challenges for this concept. Recently, a SRF gun with Cs2Te cathode has been successfully operated in Forschungszentrum Dresden-Rossendorf. In this paper, we will present the physical properties of Cs2Te photocathodes in the SC cavity, such as the quantum efficiency, the lifetime, the rejuvenation, the charge saturation, and the dark current.

  5. Odd-Parity Superconductivity and the Ferromagnetic Quantum Critical Point

    Science.gov (United States)

    Huxley, A. D.; Yates, S. J. C.; Lévy, F.; Sheikin, I.

    2007-05-01

    The study of the emergence of superconductivity close to quantum critical points affords a powerful means to identify the mechanism that drives the formation of unconventional superconductivity in heavy fermion materials. The recent discovery of superconducting states close to quantum critical points in ferromagnets UGe2 and URhGe is reviewed in this light. For URhGe we examine whether the predominant type of magnetic excitations involved are longitudinal excitations, hitherto considered theoretically to be the most promising candidate to mediate equal-spin-paired superconductivity.

  6. Superconductivity in anti-post-Perovskite vanadium compounds.

    Science.gov (United States)

    Wang, Bosen; Ohgushi, Kenya

    2013-11-29

    Superconductivity, which is a quantum state induced by spontaneous gauge symmetry breaking, frequently emerges in low-dimensional materials. Hence, low dimensionality has long been considered as necessary to achieve high superconducting transition temperatures (TC). The recently discovered post-perovskite (ppv) MgSiO3, which constitutes the Earth's lowermost mantle (D" layer), has attracted significant research interest due to its importance in geoscience. The ppv structure has a peculiar two-dimensional character and is expected to be a good platform for superconductivity. However, hereunto, no superconductivity has been observed in isostructural materials, despite extensive investigation. Here, we report the discovery of superconductivity with a maximum TC of 5.6 K in V3PnNx (Pn = P, As) phases with the anti-ppv structure, where the anion and cation positions are reversed with respect to the ppv structure. This discovery stimulates further explorations of new superconducting materials with ppv and anti-ppv structures.

  7. Superconducting electron and hole lenses

    Science.gov (United States)

    Cheraghchi, H.; Esmailzadeh, H.; Moghaddam, A. G.

    2016-06-01

    We show how a superconducting region (S), sandwiched between two normal leads (N), in the presence of barriers, can act as a lens for propagating electron and hole waves by virtue of the so-called crossed Andreev reflection (CAR). The CAR process, which is equivalent to Cooper pair splitting into two N electrodes, provides a unique possibility of constructing entangled electrons in solid state systems. When electrons are locally injected from an N lead, due to the CAR and normal reflection of quasiparticles by the insulating barriers at the interfaces, sequences of electron and hole focuses are established inside another N electrode. This behavior originates from the change of momentum during electron-hole conversion beside the successive normal reflections of electrons and holes due to the barriers. The focusing phenomena studied here are fundamentally different from the electron focusing in other systems, such as graphene p-n junctions. In particular, due to the electron-hole symmetry of the superconducting state, the focusing of electrons and holes is robust against thermal excitations. Furthermore, the effects of the superconducting layer width, the injection point position, and barrier strength are investigated on the focusing behavior of the junction. Very intriguingly, it is shown that by varying the barrier strength, one can separately control the density of electrons or holes at the focuses.

  8. Superconductivity in the Tungsten Bronzes

    Science.gov (United States)

    Wu, Phillip; Ishii, Satoshi; Tanabe, Kenji; Munakata, Ko; Hammond, Robert H.; Tokiwa, Kazuyasu; Geballe, Theodore H.; Beasley, Malcolm R.

    2015-03-01

    Via pulsed laser deposition and post-annealing, high quality K-doped WO3-y films with reproducible transport properties are obtained. A home built two-coil mutual inductance setup is used to probe the behavior of the films in the superconducting and normal state. The inverse penetration depths and dissipation peaks are measured as a function of temperature and field. Separately, via thin film deposition techniques, we report for the first time stable crystalline hexagonal WO3 on substrates. In order to tune the physical properties of the undoped material, we utilized an ionic liquid gating technique. We observe an insulator-to-metal transition, showing the ionic liquid gate to be a viable technique to alter the electrical transport properties of this material. By comparing the alkali and ionic liquid gated WO3, we conclude with some remarks regarding how superconductivity arises in this system.

  9. Superconducting quantum circuits theory and application

    Science.gov (United States)

    Deng, Xiuhao

    states. The model and toolbox are engineered with a superconducting quantum circuit where two superconducting resonators are coupled via the UQDP circuit. Using fourth order perturbation theory one can realize a complete set of quantum operations between these two photon modes. This helps open a new field to treat photon modes as qubits. Additional, a three-wave mixing scheme using phase qubits permits one to engineer the coupling Hamiltonian using a phase qubit as a tunable coupler. Along with Feynman's idea using quantum to simulate quantum, superconducting quantum simulators have been studied intensively recently. Taking the advantage of mesoscopic size of superconducting circuit and local tunability, we came out the idea to simulate quantum phase transition due to disorder. Our first paper was to propose a superconducting quantum simulator of Bose-Hubbard model to do site-wise manipulation and observe Mott-insulator to superfluid phase transition. The side-band cooling of an array of superconducting resonators is solved after the paper was published. In light of the developed technology in manipulating quantum information with superconducting circuit, one can couple other quantum oscillator system to superconducting resonators in order manipulation of its quantum states or parametric amplification of weak quantum signal. A theory that works for different coupling schemes has been studied in chapter 5. This will be a platform for further research.

  10. Design and comparative analysis of 10 MW class superconducting wind power generators according to different types of superconducting wires

    Science.gov (United States)

    Sung, Hae-Jin; Kim, Gyeong-Hun; Kim, Kwangmin; Park, Minwon; Yu, In-Keun; Kim, Jong-Yul

    2013-11-01

    Wind turbine concepts can be classified into the geared type and the gearless type. The gearless type wind turbine is more attractive due to advantages of simplified drive train and increased energy yield, and higher reliability because the gearbox is omitted. In addition, this type resolves the weight issue of the wind turbine with the light weight of gearbox. However, because of the low speed operation, this type has disadvantage such as the large diameter and heavy weight of generator. Super-Conducting (SC) wind power generator can reduce the weight and volume of a wind power system. Properties of superconducting wire are very different from each company. This paper considers the design and comparative analysis of 10 MW class SC wind power generators according to different types of SC wires. Super-Conducting Synchronous Generators (SCSGs) using YBCO and Bi-2223 wires are optimized by an optimal method. The magnetic characteristics of the SCSGs are investigated using the finite elements method program. The optimized specifications of the SCSGs are discussed in detail, and the optimization processes can be used effectively to develop large scale wind power generation systems.

  11. Oxide-based platform for reconfigurable superconducting nanoelectronics

    Science.gov (United States)

    Veazey, Joshua P.; Cheng, Guanglei; Irvin, Patrick; Cen, Cheng; Bogorin, Daniela F.; Bi, Feng; Huang, Mengchen; Bark, Chung-Wung; Ryu, Sangwoo; Cho, Kwang-Hwan; Eom, Chang-Beom; Levy, Jeremy

    2013-09-01

    We report quasi-1D superconductivity at the interface of LaAlO3 and SrTiO3. The material system and nanostructure fabrication method supply a new platform for superconducting nanoelectronics. Nanostructures having line widths w ˜ 10 nm are formed from the parent two-dimensional electron liquid using conductive atomic force microscope lithography. Nanowire cross-sections are small compared to the superconducting coherence length in LaAlO3/SrTiO3, placing them in the quasi-1D regime. Broad superconducting transitions versus temperature and finite resistances in the superconducting state well below Tc ≈ 200 mK are observed, suggesting the presence of fluctuation- and heating-induced resistance. The superconducting resistances and V-I characteristics are tunable through the use of a back gate. Four-terminal resistances in the superconducting state show an unusual dependence on the current path, varying by as much as an order of magnitude. This new technology, i.e., the ability to ‘write’ gate-tunable superconducting nanostructures on an insulating LaAlO3/SrTiO3 ‘canvas’, opens possibilities for the development of new families of reconfigurable superconducting nanoelectronics.

  12. Color symmetrical superconductivity in a schematic nuclear quark model

    DEFF Research Database (Denmark)

    Bohr, Henrik; Providencia, C.; da Providencia, J.

    2010-01-01

    In this letter, a novel BCS-type formalism is constructed in the framework of a schematic QCD inspired quark model, having in mind the description of color symmetrical superconducting states. In the usual approach to color superconductivity, the pairing correlations affect only the quasi......-particle states of two colors, the single-particle states of the third color remaining unaffected by the pairing correlations. In the theory of color symmetrical superconductivity here proposed, the pairing correlations affect symmetrically the quasi-particle states of the three colors and vanishing net color...

  13. Main: 3SC2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 3SC2 小麦 Bread Wheat Triticum aestivum Serine Carboxypeptidase Ii Chains A And B Nam... 1WHS; X-ray; A=6-260, B=266-418.|PDB; 1WHT; X-ray; A=5-260, B=266-418.|PDB; 3SC2; X-ray; A=1-259, B=266-417...WHDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPGQTKNAT wheat_3SC2.jpg ...

  14. Graphene: Carbon's superconducting footprint

    Science.gov (United States)

    Vafek, Oskar

    2012-02-01

    Graphene exhibits many extraordinary properties, but superconductivity isn't one of them. Two theoretical studies suggest that by decorating the surface of graphene with the right species of dopant atoms, or by using ionic liquid gating, superconductivity could yet be induced.

  15. Superconducting cavities for LEP

    CERN Multimedia

    1983-01-01

    Above: a 350 MHz superconducting accelerating cavity in niobium of the type envisaged for accelerating electrons and positrons in later phases of LEP. Below: a small 1 GHz cavity used for investigating the surface problems of superconducting niobium. Albert Insomby stays on the right. See Annual Report 1983 p. 51.

  16. Academic training: Applied superconductivity

    CERN Multimedia

    2007-01-01

    LECTURE SERIES 17, 18, 19 January from 11.00 to 12.00 hrs Council Room, Bldg 503 Applied Superconductivity : Theory, superconducting Materials and applications E. PALMIERI/INFN, Padova, Italy When hearing about persistent currents recirculating for several years in a superconducting loop without any appreciable decay, one realizes that we are dealing with a phenomenon which in nature is the closest known to the perpetual motion. Zero resistivity and perfect diamagnetism in Mercury at 4.2 K, the breakthrough during 75 years of several hundreds of superconducting materials, the revolution of the "liquid Nitrogen superconductivity"; the discovery of still a binary compound becoming superconducting at 40 K and the subsequent re-exploration of the already known superconducting materials: Nature discloses drop by drop its intimate secrets and nobody can exclude that the last final surprise must still come. After an overview of phenomenology and basic theory of superconductivity, the lectures for this a...

  17. Electromagnetic superconductivity of vacuum induced by strong magnetic field

    CERN Document Server

    Chernodub, M N

    2012-01-01

    The quantum vacuum may become an electromagnetic superconductor in the presence of a strong external magnetic field of the order of 10^{16} Tesla. The magnetic field of the required strength (and even stronger) is expected to be generated for a short time in ultraperipheral collisions of heavy ions at the Large Hadron Collider. The superconducting properties of the new phase appear as a result of a magnetic-field-assisted condensation of quark-antiquark pairs with quantum numbers of electrically charged rho mesons. We discuss similarities and differences between the suggested superconducting state of the quantum vacuum, a conventional superconductivity and the Schwinger pair creation. We argue qualitatively and quantitatively why the superconducting state should be a natural ground state of the vacuum at the sufficiently strong magnetic field. We demonstrate the existence of the superconducting phase using both the Nambu-Jona-Lasinio model and an effective bosonic model based on the vector meson dominance (th...

  18. Superconductivity in cubic noncentrosymmetric PdBiSe Crystal

    Science.gov (United States)

    Joshi, B.; Thamizhavel, A.; Ramakrishnan, S.

    2015-03-01

    Mixing of spin singlet and spin triplet superconducting pairing state is expected in noncentrosymmetric superconductors (NCS) due to the inherent presence of Rashba-type antisymmetric spin-orbit coupling. Unlike low symmetry (tetragonal or monoclinic) NCS, parity is isotropicaly broken in space for cubic NCS and can additionally lead to the coexistence of magnetic and superconducting state under certain conditions. Motivated with such enriched possibility of unconventional superconducting phases in cubic NCS we are reporting successful formation of single crystalline cubic noncentrosymmetric PdBiSe with lattice parameter a = 6.4316 Å and space group P21 3 (space group no. 198) which undergoes to superconducting transition state below 1.8 K as measured by electrical transport and AC susceptibility measurements. Significant strength of Rashba-type antisymmetric spin-orbit coupling can be expected for PdBiSe due to the presence of high Z (atomic number) elements consequently making it potential candidate for unconventional superconductivity.

  19. Angle-resolved photoemission studies of the superconducting gap symmetry in Fe-based superconductors

    Directory of Open Access Journals (Sweden)

    Y.-B. Huang

    2012-12-01

    Full Text Available The superconducting gap is the fundamental parameter that characterizes the superconducting state, and its symmetry is a direct consequence of the mechanism responsible for Cooper pairing. Here we discuss about angle-resolved photoemission spectroscopy measurements of the superconducting gap in the Fe-based high-temperature superconductors. We show that the superconducting gap is Fermi surface dependent and nodeless with small anisotropy, or more precisely, a function of the momentum location in the Brillouin zone. We show that while this observation seems inconsistent with weak coupling approaches for superconductivity in these materials, it is well supported by strong coupling models and global superconducting gaps. We also suggest that a smaller lifetime of the superconducting Cooper pairs induced by the momentum dependent interband scattering inherent to these materials could affect the residual density of states at low energies, which is critical for a proper evaluation of the superconducting gap.

  20. Influence of substitutional disorder on the electrical transport and the superconducting properties of Fe{sub 1+z}Te{sub 1−x−y}Se{sub x}S{sub y}

    Energy Technology Data Exchange (ETDEWEB)

    Rodríguez, M.G. [Laboratorio de Bajas Temperaturas, Departamento de Física, FCEyNUBA and IFIBA-CONICET, Buenos Aires (Argentina); Polla, G.; Ramos, C.P. [Gerencia de Investigación y Aplicaciones, CAC-CNEA, San Martín (Argentina); Acha, C., E-mail: acha@df.uba.ar [Laboratorio de Bajas Temperaturas, Departamento de Física, FCEyNUBA and IFIBA-CONICET, Buenos Aires (Argentina)

    2015-11-15

    We have carried out an investigation of the structural, magnetic, transport and superconducting properties of Fe{sub 1+z}Te{sub 1−x−y}Se{sub x}S{sub y} ceramic compounds, for z = 0 and some specific Se (0 ≤ x ≤ 0.5) and S (0 ≤ y ≤ 0.12) contents. The incorporation of Se and S to the FeTe structure produces a progressive reduction of the crystallographic parameters as well as different degrees of structural disorder associated with the differences of the ionic radius of the substituting cations. In the present study, we measure transport properties of this family of compounds and we show the direct influence of disorder in the normal and superconductor states. We notice that the structural disorder correlates with a variable range hopping conducting regime observed at temperatures T > 200 K. At lower temperatures, all the samples except the one with the highest degree of disorder show a crossover to a metallic-like regime, probably related to the transport of resilient-quasi-particles associated with the proximity of a Fermi liquid state at temperatures below the superconducting transition. Moreover, the superconducting properties are depressed only for that particular sample, in accordance to the condition that superconductivity is affected by disorder when the electronic localization length ξ{sub L} becomes smaller than the coherence length ξ{sub SC}. - Highlights: • New Fe(1 + z)Te(1−x−y)Se(x)S(y) ceramic samples were synthesized. • Structural, magnetic, transport and superconducting properties are presented. • Nonmagnetic disorder determines a VRH conduction regime near room temperature. • Superconductivity is affected by disorder.

  1. Field-Induced Superconductivity in Electric Double Layer Transistors

    NARCIS (Netherlands)

    Ueno, Kazunori; Shimotani, Hidekazu; Yuan, Hongtao; Ye, Jianting; Kawasaki, Masashi; Iwasa, Yoshihiro

    2014-01-01

    Electric field tuning of superconductivity has been a long-standing issue in solid state physics since the invention of the field-effect transistor (FET) in 1960. Owing to limited available carrier density in conventional FET devices, electric-field-induced superconductivity was believed to be possi

  2. Superconductivity and electron-phonon coupling in doped MgB{sub 2} and related compounds

    Energy Technology Data Exchange (ETDEWEB)

    Petzold, V.; Rosner, H. [MPI CPfS Dresden (Germany); Koepernik, K. [MPI CPfS Dresden (Germany); IFW Dresden (Germany)

    2007-07-01

    Recently, substitutions on the Mg site in MgB{sub 2}, e.g., Mg{sub 1-x}Sc{sub x}B{sub 2}, Mg{sub 1-x}(AlLi){sub x}B{sub 2} were investigated intensively. For achievable doping levels, Mg{sub 1-x}Sc{sub x}B{sub 2} shows only very small structural changes but clear changes in the electronic structure, whereas AlLi doping affects the lattice parameters but has almost no influence on the electronic structure. Our theoretical approach comprises different approximations in the framework of band structure calculations: the rigid band and virtual crystal method as well as supercell calculations and coherent potential approximation. We show that the latter two lead to consistent results with respect to lattice expansion and electronic properties. We show that lattice effects are of minor importance. Concluding that the B 2p {sigma} states remain the most relevant subsystem with regard to superconductivity, we calculated the electron phonon coupling constant {lambda} and the critical temperature T{sub c}. In contrast, for ZrB{sub 2} as a typical representative of transition metal diborides TB{sub 2} we find the sp{sup 2}(B)-d(T) hybridization to be crucial. Comparing calculated and measured angle dependent dHvA-data we show that: (i) LDA provides an excellent description of the electronic structure of TB{sub 2}. (ii) The electron phonon coupling is too small to expect superconductivity above a few mK for the stoichiometric compounds. (orig.)

  3. Superconductivity in carbon nanomaterials

    Science.gov (United States)

    Dlugon, Katarzyna

    The purpose of this thesis is to explain the phenomenon of superconductivity in carbon nanomaterials such as graphene, fullerenes and carbon nanotubes. In the introductory chapter, there is a description of superconductivity and how it occurs at critical temperature (Tc) that is characteristic and different to every superconducting material. The discovery of superconductivity in mercury in 1911 by Dutch physicist Heike Kamerlingh Onnes is also mentioned. Different types of superconductors, type I and type II, low and high temperatures superconductors, as well as the BCS theory that was developed in 1957 by Bardeen, Cooper, and Schrieffer, are also described in detail. The BCS theory explains how Cooper's pairs are formed and how they are responsible for the superconducting properties of many materials. The following chapters explain superconductivity in doped fullerenes, graphene and carbon nanotubes, respectively. There is a thorough explanation followed by many examples of different types of carbon nanomaterials in which small changes in chemical structure cause significant changes in superconducting properties. The goal of this research was not only to take into consideration well known carbon based superconductors but also to search for the newest available materials such as the fullerene nanowhiskers discovered quite recently. There is also a presentation of fairly new ideas about inducing superconductivity in a monolayer of graphene which is more challenging than inducing superconductivity in graphite by simply intercalating metal atoms between its graphene sheets. An effort has been taken to look for any available information about carbon nanomaterials that have the potential to superconduct at room temperature, mainly because discovery of such materials would be a real revolution in the modern world, although no such materials have been discovered yet.

  4. Quantum Magnetomechanics with Levitating Superconducting Microspheres

    CERN Document Server

    Romero-Isart, O; Navau, C; Sanchez, A; Cirac, J I

    2011-01-01

    We show that by magnetically trapping a superconducting microsphere close to a quantum circuit, it is experimentally feasible to perform ground state cooling and to prepare quantum superpositions of the center-of-mass motion of the microsphere. Due to the absence of clamping losses and time dependent electromagnetic fields, the mechanical motion of micrometer-sized metallic spheres in the Meissner state is predicted to be extremely well isolated from the environment. Hence, we propose to combine the technology of magnetic mictrotraps and superconducting qubits to bring relatively large objects to the quantum regime.

  5. Coexistence of Incommensurate Magnetism and Superconductivity in the Two-Dimensional Hubbard Model.

    Science.gov (United States)

    Yamase, Hiroyuki; Eberlein, Andreas; Metzner, Walter

    2016-03-04

    We analyze the competition of magnetism and superconductivity in the two-dimensional Hubbard model with a moderate interaction strength, including the possibility of incommensurate spiral magnetic order. Using an unbiased renormalization group approach, we compute magnetic and superconducting order parameters in the ground state. In addition to previously established regions of Néel order coexisting with d-wave superconductivity, the calculations reveal further coexistence regions where superconductivity is accompanied by incommensurate magnetic order.

  6. Superconductivity in aromatic hydrocarbons

    Energy Technology Data Exchange (ETDEWEB)

    Kubozono, Yoshihiro, E-mail: kubozono@cc.okayama-u.ac.jp [Research Laboratory for Surface Science, Okayama University, Okayama 700-8530 (Japan); Research Center of New Functional Materials for Energy Production, Storage and Transport, Okayama University, Okayama 700-8530 (Japan); Japan Science and Technology Agency, ACT-C, Kawaguchi 332-0012 (Japan); Goto, Hidenori; Jabuchi, Taihei [Research Laboratory for Surface Science, Okayama University, Okayama 700-8530 (Japan); Yokoya, Takayoshi [Research Laboratory for Surface Science, Okayama University, Okayama 700-8530 (Japan); Research Center of New Functional Materials for Energy Production, Storage and Transport, Okayama University, Okayama 700-8530 (Japan); Kambe, Takashi [Department of Physics, Okayama University, Okayama 700-8530 (Japan); Sakai, Yusuke; Izumi, Masanari; Zheng, Lu; Hamao, Shino; Nguyen, Huyen L.T. [Research Laboratory for Surface Science, Okayama University, Okayama 700-8530 (Japan); Sakata, Masafumi; Kagayama, Tomoko; Shimizu, Katsuya [Center of Science and Technology under Extreme Conditions, Osaka University, Osaka 560-8531 (Japan)

    2015-07-15

    Highlights: • Aromatic superconductor is one of core research subjects in superconductivity. Superconductivity is observed in certain metal-doped aromatic hydrocarbons. Some serious problems to be solved exist for future advancement of the research. This article shows the present status of aromatic superconductors. - Abstract: ‘Aromatic hydrocarbon’ implies an organic molecule that satisfies the (4n + 2) π-electron rule and consists of benzene rings. Doping solid aromatic hydrocarbons with metals provides the superconductivity. The first discovery of such superconductivity was made for K-doped picene (K{sub x}picene, five benzene rings). Its superconducting transition temperatures (T{sub c}’s) were 7 and 18 K. Recently, we found a new superconducting K{sub x}picene phase with a T{sub c} as high as 14 K, so we now know that K{sub x}picene possesses multiple superconducting phases. Besides K{sub x}picene, we discovered new superconductors such as Rb{sub x}picene and Ca{sub x}picene. A most serious problem is that the shielding fraction is ⩽15% for K{sub x}picene and Rb{sub x}picene, and it is often ∼1% for other superconductors. Such low shielding fractions have made it difficult to determine the crystal structures of superconducting phases. Nevertheless, many research groups have expended a great deal of effort to make high quality hydrocarbon superconductors in the five years since the discovery of hydrocarbon superconductivity. At the present stage, superconductivity is observed in certain metal-doped aromatic hydrocarbons (picene, phenanthrene and dibenzopentacene), but the shielding fraction remains stubbornly low. The highest priority research area is to prepare aromatic superconductors with a high superconducting volume-fraction. Despite these difficulties, aromatic superconductivity is still a core research target and presents interesting and potentially breakthrough challenges, such as the positive pressure dependence of T{sub c} that is clearly

  7. 46 CFR 7.70 - Folly Island, SC to Hilton Head Island, SC.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Folly Island, SC to Hilton Head Island, SC. 7.70 Section... BOUNDARY LINES Atlantic Coast § 7.70 Folly Island, SC to Hilton Head Island, SC. (a) A line drawn from the southernmost extremity of Folly Island to latitude 32°35′ N. longitude 79°58.2′ W. (Stono Inlet Lighted...

  8. Model study of coexistence of Jahn-Teller distortion, antiferromagnetism and superconductivity in iron pnictide superconductors

    Science.gov (United States)

    Pradhan, B.; Goi, S. K.; Behera, Srikanta; Parida, P. K.; Mishra, R. N.

    2016-12-01

    We have proposed a theoretical model for the coexistence of superconductivity (SC), antiferromagnetism (AFM) and Jahn-Teller (JT) effect in the mean field approximation for iron based superconductors. The model is solved by using Zubarev's double-time Green's function technique to get their selfconsistent gap equations. Then these gap equations are solved numerically.

  9. Magnetic field effects on the charge-density-wave and superconducting states in pressurized {alpha}-(BEDT-TTF){sub 2}KHg(SCN){sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Kartsovnik, M.V., E-mail: mark.kartsovnik@wmi.badw.de [Walther-Meissner-Institut, Bayerische Akademie der Wissenschaften, 85748 Garching (Germany); Biberacher, W.; Andres, D.; Jakob, S.; Kunz, M.; Neumaier, K. [Walther-Meissner-Institut, Bayerische Akademie der Wissenschaften, 85748 Garching (Germany); Mueller, H. [European Synchrotron Radiation Facility, 38043 Grenoble (France); Kushch, N.D. [Institute of Problems of Chemical Physics, 142432 Chernogolovka (Russian Federation)

    2012-06-01

    Coupling of a magnetic field to the orbital and spin degrees of freedom of charge carriers is well known to cause suppression of superconductivity. While the orbital pair-breaking generally dominates in conventional superconductors, the Pauli paramagnetic effect may become important in some heavy fermion compounds or strongly anisotropic materials such as high-T{sub c} or organic superconductors. The same two mechanisms are predicted to be operative also in the case of charge-density-wave (CDW) ordering. However, now they lead to opposite effects: the paramagnetic coupling weakens the CDW interaction whereas the orbital coupling enhances it in a system with an imperfectly nested Fermi surface. Here we report on the experimental evidence of both kinds of magnetic field effects on the CDW and superconducting instabilities in the layered organic metal {alpha}-(BEDT-TTF){sub 2}KHg(SCN){sub 4} under quasihydrostatic pressure.

  10. Magnetic field effects on the charge-density-wave and superconducting states in pressurized α-(BEDT-TTF)2KHg(SCN)4

    Science.gov (United States)

    Kartsovnik, M. V.; Biberacher, W.; Andres, D.; Jakob, S.; Kunz, M.; Neumaier, K.; Müller, H.; Kushch, N. D.

    2012-06-01

    Coupling of a magnetic field to the orbital and spin degrees of freedom of charge carriers is well known to cause suppression of superconductivity. While the orbital pair-breaking generally dominates in conventional superconductors, the Pauli paramagnetic effect may become important in some heavy fermion compounds or strongly anisotropic materials such as high-Tc or organic superconductors. The same two mechanisms are predicted to be operative also in the case of charge-density-wave (CDW) ordering. However, now they lead to opposite effects: the paramagnetic coupling weakens the CDW interaction whereas the orbital coupling enhances it in a system with an imperfectly nested Fermi surface. Here we report on the experimental evidence of both kinds of magnetic field effects on the CDW and superconducting instabilities in the layered organic metal α-(BEDT-TTF)2KHg(SCN)4 under quasihydrostatic pressure.

  11. Attenuation in Superconducting Circular Waveguides

    Directory of Open Access Journals (Sweden)

    K. H. Yeap

    2016-09-01

    Full Text Available We present an analysis on wave propagation in superconducting circular waveguides. In order to account for the presence of quasiparticles in the intragap states of a superconductor, we employ the characteristic equation derived from the extended Mattis-Bardeen theory to compute the values of the complex conductivity. To calculate the attenuation in a circular waveguide, the tangential fields at the boundary of the wall are first matched with the electrical properties (which includes the complex conductivity of the wall material. The matching of fields with the electrical properties results in a set of transcendental equations which is able to accurately describe the propagation constant of the fields. Our results show that although the attenuation in the superconducting waveguide above cutoff (but below the gap frequency is finite, it is considerably lower than that in a normal waveguide. Above the gap frequency, however, the attenuation in the superconducting waveguide increases sharply. The attenuation eventually surpasses that in a normal waveguide. As frequency increases above the gap frequency, Cooper pairs break into quasiparticles. Hence, we attribute the sharp rise in attenuation to the increase in random collision of the quasiparticles with the lattice structure.

  12. Ballistic superconductivity in semiconductor nanowires

    Science.gov (United States)

    Zhang, Hao; Gül, Önder; Conesa-Boj, Sonia; Nowak, Michał P.; Wimmer, Michael; Zuo, Kun; Mourik, Vincent; de Vries, Folkert K.; van Veen, Jasper; de Moor, Michiel W. A.; Bommer, Jouri D. S.; van Woerkom, David J.; Car, Diana; Plissard, Sébastien R.; Bakkers, Erik P. A. M.; Quintero-Pérez, Marina; Cassidy, Maja C.; Koelling, Sebastian; Goswami, Srijit; Watanabe, Kenji; Taniguchi, Takashi; Kouwenhoven, Leo P.

    2017-07-01

    Semiconductor nanowires have opened new research avenues in quantum transport owing to their confined geometry and electrostatic tunability. They have offered an exceptional testbed for superconductivity, leading to the realization of hybrid systems combining the macroscopic quantum properties of superconductors with the possibility to control charges down to a single electron. These advances brought semiconductor nanowires to the forefront of efforts to realize topological superconductivity and Majorana modes. A prime challenge to benefit from the topological properties of Majoranas is to reduce the disorder in hybrid nanowire devices. Here we show ballistic superconductivity in InSb semiconductor nanowires. Our structural and chemical analyses demonstrate a high-quality interface between the nanowire and a NbTiN superconductor that enables ballistic transport. This is manifested by a quantized conductance for normal carriers, a strongly enhanced conductance for Andreev-reflecting carriers, and an induced hard gap with a significantly reduced density of states. These results pave the way for disorder-free Majorana devices.

  13. Physics of electrons in solids: Volume 1 - Solid state physics, band structure, superconductivity and magnetism; Volume 2 - Solid state physics, exercises and problems with keys; Physique des electrons dans les solides: Tome 1, structure de bandes, supraconductivite et magnetisme. Physique des electrons dans les solides: Tome 2, recueil d'exercices et de problemes

    Energy Technology Data Exchange (ETDEWEB)

    Alloul, H. [Paris-11 Univ., 91 - Orsay (France). Lab. de Physique des Solides

    2007-07-01

    The diversity of the macroscopic properties of solids like magnetism or superconductivity stems from the quantum states of electrons. Today only the experimental approach reveals the spectacular effects of these properties but basic concepts of quantum mechanics and of statistical physics are necessary to give an account of the link between the microscopic scale and the macroscopic world. The simple approach involving independent electrons gives a description of the electronic structure as energy bands that explains the existence of metals, isolators and semi-conductors. Magnetism and superconductivity can be understood only by taking into account the existence of correlations between the electrons in the solids. The first tome presents the formalism of quantum mechanics applied to the system formed by nuclei and the electrons in solids. Different issues like electronic structures in solids, electron transport, the microscopic origin of superconductivity, the magnetism of isolators, the dynamics of spin and magnetic resonance are explained. The second volume can be divided into 2 parts, the first part giving the keys of the questions arisen in the first volume while the second part propose a series of problems (with keys). These problems illustrate the topics presented in the first volume and deal with issues like optical properties of solids, electron bands, Peierls transition, phonons in solids, isolator-metal transition, cyclotron resonance, superconductivity of NbSe{sub 2}, electronic properties of La{sub 2}CuO{sub 4}, or the magnetism of thin films. (A.C.)

  14. Quasiparticle Excitations in the Superconducting State of FeSe Probed by Thermal Hall Conductivity in the Vicinity of the BCS-BEC Crossover

    Science.gov (United States)

    Watashige, Tatsuya; Arsenijević, Stevan; Yamashita, Takuya; Terazawa, Daiki; Onishi, Takafumi; Opherden, Lars; Kasahara, Shigeru; Tokiwa, Yoshifumi; Kasahara, Yuichi; Shibauchi, Takasada; von Löhneysen, Hilbert; Wosnitza, Jochen; Matsuda, Yuji

    2017-01-01

    There is growing evidence that the superconducting semimetal FeSe (Tc ˜ 8 K) is in the crossover regime between weak-coupling Bardeen-Cooper-Schrieffer (BCS) and strong-coupling Bose-Einstein-condensate (BEC) limits. We report on longitudinal and transverse thermal conductivities, κxx and κxy, respectively, in magnetic fields up to 20 T. The field dependences of κxx and κxy imply that a highly anisotropic small superconducting gap forms at the electron Fermi-surface pocket whereas a more isotropic and larger gap forms at the hole pocket. Below ˜1.0 K, both κxx and κxy exhibit distinct anomalies (kinks) at the upper critical field Hc2 and at a field H* slightly below Hc2. The analysis of the thermal Hall angle (κxy/κxx) indicates a change of the quasiparticle scattering rate at H*. These results provide strong support to the previous suggestion that above H* a distinct field-induced superconducting phase emerges with an unprecedented large spin imbalance.

  15. Nonlocal transport in superconducting oxide nanostructures

    Science.gov (United States)

    Veazey, Joshua; Cheng, Guanglei; Lu, Shicheng; Tomczyk, Michelle; Irvin, Patrick; Huang, Mengchen; Wung Bark, Chung; Ryu, Sangwoo; Eom, Chang-Beom; Levy, Jeremy

    2013-03-01

    We report nonlocal transport signatures in the superconducting state of nanostructures formed[2] at the LaAlO3/SrTiO3 interface using conductive AFM lithography. Nonlocal resistances (nonlocal voltage divided by current) are as large as 200 Ω when 2-10 μm separate the current-carrying segments from the voltage-sensing leads. The nonlocal resistance reverses sign at the local critical current of the superconducting state. Features observed in the nonlocal V-I curves evolve with back gate voltage and magnetic field, and are correlated with the local four-terminal V-I curves. We discuss how nonlocal and local transport effects in LaAlO3/SrTiO3 nanostructures may result from the electronic phase separation and superconducting inhomogeneity reported by others in planar structures[3]. This work is supported by AFOSR (FA9550-10-1-0524) and NSF DMR-0906443

  16. Cyclotron production of high purity (44m,44)Sc with deuterons from (44)CaCO3 targets.

    Science.gov (United States)

    Alliot, C; Kerdjoudj, R; Michel, N; Haddad, F; Huclier-Markai, S

    2015-06-01

    Due to its longer half-life, (44)Sc (T1/2 = 3.97 h) as a positron emitter can be an interesting alternative to (68)Ga (T1/2 = 67.71 min). It has been already proposed as a PET radionuclide for scouting bone disease and is already available as a (44)Ti/(44)Sc generator. (44)Sc has an isomeric state, (44 m)Sc (T1/2 = 58.6 h), which can be co-produced with (44)Sc and that has been proved to be considered as an in-vivo PET generator (44 m)Sc/(44)Sc. This work presents the production route of (44 m)Sc/(44)Sc generator from (44)Ca(d,2n), its extraction/purification process and the evaluation of its performances. Irradiation was performed in a low activity target station using a deuteron beam of 16 MeV, which favors the number of (44 m)Sc atoms produced simultaneously to (44)Sc. Typical irradiation conditions were 60 min at 0.2 μA producing 44 MBq of (44)Sc with a (44)Sc/(44 m)Sc activity ratio of 50 at end of irradiation. Separations of the radionuclides were performed by means of cation exchange chromatography using a DGA® resin (Triskem). Then, the developed process was applied with bigger targets, and could be used for preclinical studies. The extraction/purification process leads to a radionucleidic purity higher than 99.99% ((43)Sc, (46)Sc, (48)Sc < DL). (44 m)Sc/(44)Sc labeling towards DOTA moiety was performed in order to get an evaluation of the specific activities that could be reached with regard to all metallic impurities from the resulting source. Reaction parameters of radiolabeling were optimized, reaching yields over 95%, and leading to a specific activity of about 10-20 MBq/nmol for DOTA. A recycling process for the enriched (44)Ca target was developed and optimized. The quality of the final batch with regard to radionucleidic purity, specific activity and metal impurities allowed a right away use for further radiopharmaceutical evaluation. This radionucleidic pair of (44 m)Sc/(44)Sc offers a quite interesting PET radionuclide for being further

  17. rotor of the SC rotating condenser

    CERN Multimedia

    1974-01-01

    The rotor of the rotating condenser was installed instead of the tuning fork as the modulating element of the radiofrequency system, when the SC accelerator underwent extensive improvements between 1973 to 1975 (see object AC-025). The SC was the first accelerator built at CERN. It operated from August 1957 until it was closed down at the end of 1990.

  18. Radiation Protection Section (SC/SL/RP)

    CERN Multimedia

    2006-01-01

    We should like to inform you that the Radiation Protection Section (SC/SL/RP) located on the Prévessin site has moved from Building 865 (ground floor) to new premises in Wing A of Building 892 (second floor). Telephone numbers remain the same. SC/SL/RP section

  19. The superconducting spin valve and triplet superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Garifullin, I.A., E-mail: ilgiz_garifullin@yahoo.com [Zavoisky Physical-Technical Institute, Kazan Scientific Center of Russian Academy of Sciences, 420029 Kazan (Russian Federation); Leksin, P.V.; Garif' yanov, N.N.; Kamashev, A.A. [Zavoisky Physical-Technical Institute, Kazan Scientific Center of Russian Academy of Sciences, 420029 Kazan (Russian Federation); Fominov, Ya.V. [L. D. Landau Institute for Theoretical Physics RAS, 119334 Moscow (Russian Federation); Moscow Institute of Physics and Technology, 141700 Dolgoprudny (Russian Federation); Schumann, J.; Krupskaya, Y.; Kataev, V.; Schmidt, O.G. [Leibniz Institute for Solid State and Materials Research IFW Dresden, D-01171 Dresden (Germany); Büchner, B. [Leibniz Institute for Solid State and Materials Research IFW Dresden, D-01171 Dresden (Germany); Institut für Festkörperphysik, Technische Universität Dresden, D-01062 Dresden (Germany)

    2015-01-01

    A review of our recent results on the spin valve effect is presented. We have used a theoretically proposed spin switch design F1/F2/S comprising a ferromagnetic bilayer (F1/F2) as a ferromagnetic component, and an ordinary superconductor (S) as the second interface component. Based on it we have prepared and studied in detail a set of multilayers CoO{sub x}/Fe1/Cu/Fe2/S (S=In or Pb). In these heterostructures we have realized for the first time a full spin switch effect for the superconducting current, have observed its sign-changing oscillating behavior as a function of the Fe2-layer thickness and finally have obtained direct evidence for the long-range triplet superconductivity arising due to noncollinearity of the magnetizations of the Fe1 and Fe2 layers. - Highlights: • We studied a spin switch design F1/F2/S. • We prepared a set of multilayers CoOx/Fe1/Cu/Fe2/S (S=In or Pb). • The full spin switch effect for the superconducting current was realized. • We observed its oscillating behavior as a function of the Fe2-layer thickness. • We obtained direct evidence for the long-range triplet superconductivity.

  20. Damping in high-temperature superconducting levitation systems

    Energy Technology Data Exchange (ETDEWEB)

    Hull, John R.

    2009-12-15

    Methods and apparatuses for improved damping in high-temperature superconducting levitation systems are disclosed. A superconducting element (e.g., a stator) generating a magnetic field and a magnet (e.g. a rotor) supported by the magnetic field are provided such that the superconducting element is supported relative to a ground state with damped motion substantially perpendicular to the support of the magnetic field on the magnet. Applying this, a cryostat housing the superconducting bearing may be coupled to the ground state with high damping but low radial stiffness, such that its resonant frequency is less than that of the superconducting bearing. The damping of the cryostat may be substantially transferred to the levitated magnetic rotor, thus, providing damping without affecting the rotational loss, as can be derived applying coupled harmonic oscillator theory in rotor dynamics. Thus, damping can be provided to a levitated object, without substantially affecting the rotational loss.

  1. Damping in high-temperature superconducting levitation systems

    Science.gov (United States)

    Hull, John R.

    2009-12-15

    Methods and apparatuses for improved damping in high-temperature superconducting levitation systems are disclosed. A superconducting element (e.g., a stator) generating a magnetic field and a magnet (e.g. a rotor) supported by the magnetic field are provided such that the superconducting element is supported relative to a ground state with damped motion substantially perpendicular to the support of the magnetic field on the magnet. Applying this, a cryostat housing the superconducting bearing may be coupled to the ground state with high damping but low radial stiffness, such that its resonant frequency is less than that of the superconducting bearing. The damping of the cryostat may be substantially transferred to the levitated magnetic rotor, thus, providing damping without affecting the rotational loss, as can be derived applying coupled harmonic oscillator theory in rotor dynamics. Thus, damping can be provided to a levitated object, without substantially affecting the rotational loss.

  2. Superconducting fluctuations in organic molecular metals enhanced by Mott criticality.

    Science.gov (United States)

    Nam, Moon-Sun; Mézière, Cécile; Batail, Patrick; Zorina, Leokadiya; Simonov, Sergey; Ardavan, Arzhang

    2013-12-02

    Unconventional superconductivity typically occurs in materials in which a small change of a parameter such as bandwidth or doping leads to antiferromagnetic or Mott insulating phases. As such competing phases are approached, the properties of the superconductor often become increasingly exotic. For example, in organic superconductors and underdoped high-T(c) cuprate superconductors a fluctuating superconducting state persists to temperatures significantly above T(c). By studying alloys of quasi-two-dimensional organic molecular metals in the κ-(BEDT-TTF)₂X family, we reveal how the Nernst effect, a sensitive probe of superconducting phase fluctuations, evolves in the regime of extreme Mott criticality. We find strong evidence that, as the phase diagram is traversed through superconductivity towards the Mott state, the temperature scale for superconducting fluctuations increases dramatically, eventually approaching the temperature at which quasiparticles become identifiable at all.

  3. Mean field theory of high Tc cuprate superconductivity

    Directory of Open Access Journals (Sweden)

    K. Maki

    2006-09-01

    Full Text Available   Two decades ago the epoch making discovery of high Tc cuprate superconductivity by Bednorz and Müller shocked the world’s superconductivity community. However, already in 1979 and 1980, the first heavy fermion superconductor CeCu2Si2 and organic superconductor (TMTSF2PF6 have been discovered respectively. Also we know now that all these superconductors are unconventional and nodal. Further the quasiparticles in the normal state in these systems are Fermi liquids and the superconducting states are described in terms of generalized BCS wave function. Also the pseudogap phase in underdoped high Tc cuprates is described in terms of d-wave density wave. This implies necessarily that the superconductivity in underdoped cuprates is gossamer (i.e. d-wave superconductivity coexists with d-wave density wave. We shall present some quantitative tests of these new concepts, notions and ideas.

  4. Superconducting gap anomaly in heavy fermion systems

    Indian Academy of Sciences (India)

    G C Rout; M S Ojha; S N Behera

    2008-04-01

    The heavy fermion system (HFS) is described by the periodic Anderson model (PAM), treating the Coulomb correlation between the -electrons in the mean-field Hartree-Fock approximation. Superconductivity is introduced by a BCS-type pairing term among the conduction electrons. Within this approximation the equation for the superconducting gap is derived, which depends on the effective position of the energy level of the -electrons relative to the Fermi level. The latter in turn depends on the occupation probability f of the -electrons. The gap equation is solved self-consistently with the equation for f; and their temperature dependences are studied for different positions of the bare -electron energy level, with respect to the Fermi level. The dependence of the superconducting gap on the hybridization leads to a re-entrant behaviour with increasing strength. The induced pairing between the -electrons and the pairing of mixed conduction and -electrons due to hybridization are also determined. The temperature dependence of the hybridization parameter, which characterizes the number of electrons with mixed character and represents the number of heavy electrons is studied. This number is shown to be small. The quasi-particle density of states (DOS) shows the existence of a pseudo-gap due to superconductivity and the signature of a hybridization gap at the Fermi level. For the choice of the model parameters, the DOS shows that the HFS is a metal and undergoes a transition to the gap-less superconducting state.

  5. Static Measurements on HTS Coils of Fully Superconducting AC Electric Machines for Aircraft Electric Propulsion System

    Science.gov (United States)

    Choi, Benjamin B.; Hunker, Keith R.; Hartwig, Jason; Brown, Gerald V.

    2017-01-01

    The NASA Glenn Research Center (GRC) has been developing the high efficiency and high-power density superconducting (SC) electric machines in full support of electrified aircraft propulsion (EAP) systems for a future electric aircraft. A SC coil test rig has been designed and built to perform static and AC measurements on BSCCO, (RE)BCO, and YBCO high temperature superconducting (HTS) wire and coils at liquid nitrogen (LN2) temperature. In this paper, DC measurements on five SC coil configurations of various geometry in zero external magnetic field are measured to develop good measurement technique and to determine the critical current (Ic) and the sharpness (n value) of the super-to-normal transition. Also, standard procedures for coil design, fabrication, coil mounting, micro-volt measurement, cryogenic testing, current control, and data acquisition technique were established. Experimentally measured critical currents are compared with theoretical predicted values based on an electric-field criterion (Ec). Data here are essential to quantify the SC electric machine operation limits where the SC begins to exhibit non-zero resistance. All test data will be utilized to assess the feasibility of using HTS coils for the fully superconducting AC electric machine development for an aircraft electric propulsion system.

  6. Cs3ScCl6

    Directory of Open Access Journals (Sweden)

    Matthew D. Ward

    2014-06-01

    Full Text Available Crystals of tricaesium scandium(III hexachloride were obtained as a side product from the reaction of U, SnCl2, Sc, and S in a CsCl flux at 1073 K. Cs3ScCl6 crystallizes in the Rb3YCl6 structure type. The asymmetric unit comprises three Cs sites, two Sc sites, and six Cl sites, all of which have site symmetry 1, except for the two Sc sites that have site symmetries of 2 and -1, respectively. The structure is composed of isolated [ScCl6]3− octahedra that are surrounded by Cs+ cations. Two Cs+ cations have interactions with eight Cl− anions, while the third has interactions with ten Cl− anions.

  7. Tunneling in superconducting structures

    Science.gov (United States)

    Shukrinov, Yu. M.

    2010-12-01

    Here we review our results on the breakpoint features in the coupled system of IJJ obtained in the framework of the capacitively coupled Josephson junction model with diffusion current. A correspondence between the features in the current voltage characteristics (CVC) and the character of the charge oscillations in superconducting layers is demonstrated. Investigation of the correlations of superconducting currents in neighboring Josephson junctions and the charge correlations in neighboring superconducting layers reproduces the features in the CVC and gives a powerful method for the analysis of the CVC of coupled Josephson junctions. A new method for determination of the dissipation parameter is suggested.

  8. Superconductivity in doped insulators

    Energy Technology Data Exchange (ETDEWEB)

    Emery, V.J. [Brookhaven National Lab., Upton, NY (United States); Kivelson, S.A. [California Univ., Los Angeles, CA (United States). Dept. of Physics

    1995-12-31

    It is shown that many synthetic metals, including high temperature superconductors are ``bad metals``, with such a poor conductivity that the usual meanfield theory of superconductivity breaks down because of anomalously large classical and quantum fluctuations of the phase of the superconducting order parameter. It is argued that the supression of a first order phase transition (phase separation) by the long-range Coulomb interaction leads to high temperature superconductivity accompanied by static or dynamical charge inhomogeneIty. Evidence in support of this picture for high temperature superconductors is described.

  9. Coherence properties in superconducting flux qubits

    Energy Technology Data Exchange (ETDEWEB)

    Spilla, Samuele

    2015-02-16

    The research work discussed in this thesis deals with the study of superconducting Josephson qubits. Superconducting qubits are solid-state artificial atoms which are based on lithographically defined Josephson tunnel junctions properties. When sufficiently cooled, these superconducting devices exhibit quantized states of charge, flux or junction phase depending on their design parameters. This allows to observe coherent evolutions of their states. The results presented can be divided into two parts. In a first part we investigate operations of superconducting qubits based on the quantum coherence in superconducting quantum interference devices (SQUID). We explain experimental data which has been observed in a SQUID subjected to fast, large-amplitude modifications of its effective potential shape. The motivations for this work come from the fact that in the past few years there have been attempts to interpret the supposed quantum behavior of physical systems, such as Josephson devices, within a classical framework. Moreover, we analyze the possibility of generating GHZ states, namely maximally entangled states, in a quantum system made out of three Josephson qubits. In particular, we investigate the possible limitations of the GHZ state generation due to coupling to bosonic baths. In the second part of the thesis we address a particular cause of decoherence of flux qubits which has been disregarded until now: thermal gradients, which can arise due to accidental non equilibrium quasiparticle distributions. The reason for these detrimental effects is that heat currents flowing through Josephson tunnel junctions in response to a temperature gradient are periodic functions of the phase difference between the electrodes. The phase dependence of the heat current comes from Andreev reflection, namely an interplay between the quasiparticles which carry heat and the superconducting condensate which is sensitive to the superconducting phase difference. Generally speaking

  10. Magnetic fluctuations and superconducting properties of CaKFe4As4 studied by 75As NMR

    Science.gov (United States)

    Cui, J.; Ding, Q.-P.; Meier, W. R.; Böhmer, A. E.; Kong, T.; Borisov, V.; Lee, Y.; Bud'ko, S. L.; Valentí, R.; Canfield, P. C.; Furukawa, Y.

    2017-09-01

    We report 75As nuclear magnetic resonance (NMR) studies on a new iron-based superconductor, CaKFe4As4 , with Tc=35 K. 75As NMR spectra show two distinct lines corresponding to the As(1) and As(2) sites close to the K and Ca layers, respectively, revealing that K and Ca layers are well ordered without site inversions. We found that nuclear quadrupole frequencies νQ of the As(1) and As(2) sites show an opposite temperature T dependence. Nearly T independent behavior of the Knight shifts K is observed in the normal state, and a sudden decrease in K in the superconducting (SC) state suggests spin-singlet Cooper pairs. 75As spin-lattice relaxation rates 1 /T1 show a power-law T dependence with different exponents for the two As sites. The isotropic antiferromagnetic spin fluctuations characterized by the wave vector q =(π ,0 ) or (0 ,π ) in the single-iron Brillouin zone notation are revealed by 1 /T1T and K measurements. Such magnetic fluctuations are necessary to explain the observed temperature dependence of the 75As quadrupole frequencies, as evidenced by our first-principles calculations. In the SC state, 1 /T1 shows a rapid decrease below Tc without a Hebel-Slichter peak and decreases exponentially at low T , consistent with an s± nodeless two-gap superconductor.

  11. Conductance of a superconducting Coulomb-blockaded Majorana nanowire

    Science.gov (United States)

    Chiu, Ching-Kai; Sau, Jay D.; Das Sarma, S.

    2017-08-01

    In the presence of an applied magnetic field introducing Zeeman spin splitting, a superconducting (SC) proximitized one-dimensional (1D) nanowire with spin-orbit coupling can pass through a topological quantum phase transition developing zero-energy topological Majorana bound states (MBSs) on the wire ends. One of the promising experimental platforms in this context is a Coulomb-blockaded island, where by measuring the two-terminal conductance one can in principle investigate the MBS properties. Here, we theoretically study the tunneling transport of a single electron across the superconducting Coulomb-blockaded nanowire at finite temperature in order to obtain the generic conductance equation. By considering all possible scenarios where only MBSs are present at the ends of the nanowire, we compute the nanowire conductance as a function of the magnetic field, the temperature, and the gate voltage. In the simplest 1D topological SC model, the oscillations of the conductance peak spacings (OCPSs) arising from the Majorana overlap from the two wire ends manifest an increasing oscillation amplitude with increasing magnetic field (in disagreement with a recent experimental observation). We develop a generalized finite-temperature master-equation theory including not only multiple subbands in the nanowire, but also the possibility of ordinary Andreev bound states in the nontopological regime. Inclusion of all four effects (temperature, multiple subbands, Andreev bound states, and MBSs) provides a complete picture of the tunneling transport properties of the Coulomb-blockaded nanowire. Based on this complete theory, we indeed obtain OCPSs whose amplitudes decrease with increasing magnetic field in qualitative agreement with recent experimental results, but this happens only for rather high temperatures with multisubband occupancy and the simultaneous presence of both Andreev bound states and MBSs in the system. Thus, the experimentally observed OCPSs manifesting

  12. Impacto da intensificação da densidade de plantio na rentabilidade em duas cultivares de macieira em Fraiburgo-SC Economic analysis of investment in the agribusiness of the apples in Fraiburgo, state of Santa Catarina

    OpenAIRE

    2006-01-01

    Este artigo analisa as expectativas de retorno associadas ao agronegócio da maçã, com base em pomares existentes na região de Fraiburgo-SC. Detalham-se os custos de produção das cultivares Gala e Fuji implantadas em sistemas de alta e superalta densidade. Os resultados indicam ser apenas mediana a rentabilidade do agronegócio em análise. A intensificação tecnológica via ampliação da densidade de plantio, propicia um incremento na rentabilidade. O mesmo pode ser dito da cultivar Fuji em relaçã...

  13. Unconventional high-Tc superconductivity in fullerides.

    Science.gov (United States)

    Takabayashi, Yasuhiro; Prassides, Kosmas

    2016-09-13

    A3C60 molecular superconductors share a common electronic phase diagram with unconventional high-temperature superconductors such as the cuprates: superconductivity emerges from an antiferromagnetic strongly correlated Mott-insulating state upon tuning a parameter such as pressure (bandwidth control) accompanied by a dome-shaped dependence of the critical temperature, Tc However, unlike atom-based superconductors, the parent state from which superconductivity emerges solely by changing an electronic parameter-the overlap between the outer wave functions of the constituent molecules-is controlled by the C60 (3-) molecular electronic structure via the on-molecule Jahn-Teller effect influence of molecular geometry and spin state. Destruction of the parent Mott-Jahn-Teller state through chemical or physical pressurization yields an unconventional Jahn-Teller metal, where quasi-localized and itinerant electron behaviours coexist. Localized features gradually disappear with lattice contraction and conventional Fermi liquid behaviour is recovered. The nature of the underlying (correlated versus weak-coupling Bardeen-Cooper-Schrieffer theory) s-wave superconducting states mirrors the unconventional/conventional metal dichotomy: the highest superconducting critical temperature occurs at the crossover between Jahn-Teller and Fermi liquid metal when the Jahn-Teller distortion melts.This article is part of the themed issue 'Fullerenes: past, present and future, celebrating the 30th anniversary of Buckminster Fullerene'.

  14. Superconducting wind turbine generators

    DEFF Research Database (Denmark)

    Abrahamsen, Asger Bech; Mijatovic, Nenad; Seiler, Eugen

    2010-01-01

    , the main challenge of the superconducting direct drive technology is to prove that the reliability is superior to the alternative drive trains based on gearboxes or permanent magnets. A strategy of successive testing of superconducting direct drive trains in real wind turbines of 10 kW, 100 kW, 1 MW and 10...... offshore turbines of 8 and 10 MW have been determined from an up-scaling of an existing 5 MW turbine and the necessary properties of the superconducting drive train are discussed. We have found that the absence of the gear box is the main benefit and the reduced weight and size is secondary. However...... MW generator and it is concluded that the present production capacity of coated conductors must be increased by a factor of 36 by 2020, resulting in a ten times lower price of the tape in order to reach a realistic price level for the superconducting drive train....

  15. Magnetic and superconducting nanowires

    DEFF Research Database (Denmark)

    Piraux, L.; Encinas, A.; Vila, L.

    2005-01-01

    magnetic and superconducting nanowires. Using different approaches entailing measurements on both single wires and arrays, numerous interesting physical properties have been identified in relation to the nanoscopic dimensions of these materials. Finally, various novel applications of the nanowires are also...

  16. Gapless superconductivity and string theory

    CERN Document Server

    Khlebnikov, S

    2014-01-01

    Coexistence of superconducting and normal components in nanowires at currents below the critical (a "mixed" state) would have important consequences for the nature and range of potential applications of these systems. From the theoretical perspective, it represents a genuine interaction effect, not seen in the mean-field theory. Here we consider properties of such a state in the gravity dual of a strongly coupled superconductor constructed from D3 and D5 branes. We find numerically uniform gapless solutions containing both components but argue that they are unstable against phase separation, as their free energies are not convex. We speculate on the possible nature of the resulting non-uniform sate ("emulsion") and draw analogies between that state and the familiar mixed state of a type II superconductor in a magnetic field.

  17. Computation of Normal Conducting and Superconducting Linear Accelerator (LINAC) Availabilities

    Energy Technology Data Exchange (ETDEWEB)

    Haire, M.J.

    2000-07-11

    A brief study was conducted to roughly estimate the availability of a superconducting (SC) linear accelerator (LINAC) as compared to a normal conducting (NC) one. Potentially, SC radio frequency cavities have substantial reserve capability, which allows them to compensate for failed cavities, thus increasing the availability of the overall LINAC. In the initial SC design, there is a klystron and associated equipment (e.g., power supply) for every cavity of an SC LINAC. On the other hand, a single klystron may service eight cavities in the NC LINAC. This study modeled that portion of the Spallation Neutron Source LINAC (between 200 and 1,000 MeV) that is initially proposed for conversion from NC to SC technology. Equipment common to both designs was not evaluated. Tabular fault-tree calculations and computer-event-driven simulation (EDS) computer computations were performed. The estimated gain in availability when using the SC option ranges from 3 to 13% under certain equipment and conditions and spatial separation requirements. The availability of an NC LINAC is estimated to be 83%. Tabular fault-tree calculations and computer EDS modeling gave the same 83% answer to within one-tenth of a percent for the NC case. Tabular fault-tree calculations of the availability of the SC LINAC (where a klystron and associated equipment drive a single cavity) give 97%, whereas EDS computer calculations give 96%, a disagreement of only 1%. This result may be somewhat fortuitous because of limitations of tabular fault-tree calculations. For example, tabular fault-tree calculations can not handle spatial effects (separation distance between failures), equipment network configurations, and some failure combinations. EDS computer modeling of various equipment configurations were examined. When there is a klystron and associated equipment for every cavity and adjacent cavity, failure can be tolerated and the SC availability was estimated to be 96%. SC availability decreased as

  18. Photoemission, Correlation and Superconductivity:

    Science.gov (United States)

    Abrecht, M.; Ariosa, D.; Cloëtta, D.; Pavuna, D.; Perfetti, L.; Grioni, M.; Margaritondo, G.

    We review some of the problems still affecting photoemission as a probe of high-temperature superconductivity, as well as important recent results concerning their solution. We show, in particular, some of the first important results on thin epitaxial films grown by laser ablation, which break the monopoly of cleaved BCSCO in this type of experiments. Such results, obtained on thin LSCO, may have general implications on the theory of high-temperature superconductivity.

  19. Quantum Memristors with Superconducting Circuits

    Science.gov (United States)

    Salmilehto, J.; Deppe, F.; di Ventra, M.; Sanz, M.; Solano, E.

    2017-02-01

    Memristors are resistive elements retaining information of their past dynamics. They have garnered substantial interest due to their potential for representing a paradigm change in electronics, information processing and unconventional computing. Given the advent of quantum technologies, a design for a quantum memristor with superconducting circuits may be envisaged. Along these lines, we introduce such a quantum device whose memristive behavior arises from quasiparticle-induced tunneling when supercurrents are cancelled. For realistic parameters, we find that the relevant hysteretic behavior may be observed using current state-of-the-art measurements of the phase-driven tunneling current. Finally, we develop suitable methods to quantify memory retention in the system.

  20. Superconductivity, antiferromagnetism, and neutron scattering

    Science.gov (United States)

    Tranquada, John M.; Xu, Guangyong; Zaliznyak, Igor A.

    2014-01-01

    High-temperature superconductivity in both the copper-oxide and the iron-pnictide/chalcogenide systems occurs in close proximity to antiferromagnetically ordered states. Neutron scattering has been an essential technique for characterizing the spin correlations in the antiferromagnetic phases and for demonstrating how the spin fluctuations persist in the superconductors. While the nature of the spin correlations in the superconductors remains controversial, the neutron scattering measurements of magnetic excitations over broad ranges of energy and momentum transfers provide important constraints on the theoretical options. We present an overview of the neutron scattering work on high-temperature superconductors and discuss some of the outstanding issues.

  1. Quantum Memristors with Superconducting Circuits

    Science.gov (United States)

    Salmilehto, J.; Deppe, F.; Di Ventra, M.; Sanz, M.; Solano, E.

    2017-01-01

    Memristors are resistive elements retaining information of their past dynamics. They have garnered substantial interest due to their potential for representing a paradigm change in electronics, information processing and unconventional computing. Given the advent of quantum technologies, a design for a quantum memristor with superconducting circuits may be envisaged. Along these lines, we introduce such a quantum device whose memristive behavior arises from quasiparticle-induced tunneling when supercurrents are cancelled. For realistic parameters, we find that the relevant hysteretic behavior may be observed using current state-of-the-art measurements of the phase-driven tunneling current. Finally, we develop suitable methods to quantify memory retention in the system. PMID:28195193

  2. Superconductive Signal-Processing Circuits

    Science.gov (United States)

    1994-08-01

    September 1991. 13. P. H. Xiao, E. Charbon , A. Sangiovanni-Vincentelli, T. Van Duzer,and S.W. Whiteley, "INDEX: An inductance extractor for superconducting...wideband analog-to-digital to a useful binary representation. In order to achieve an N-bit converter reported earlier [1]. The original design has been...rises, the SQUID Parameter Original Modified switches to the voltage state, and the output goes high. Ic(J1) 337 367 I tA S gaicGate: The comparator

  3. Precise ab initio calculations of the 3d transition-metal clusters: Sc2

    Directory of Open Access Journals (Sweden)

    Ilya G. Kaplan

    2011-06-01

    Full Text Available The ground 5Σu− state of Sc2 was studied by the valence multireference configuration interaction method with single and double excitations plus Davidson correction (MRCISD(+Q at the complete basis set limit. The calculations were made under C2v symmetry restrictions, which allowed us to obtain at the dissociation limit the Sc atoms in different states (in all previous studies of Sc2 the D2h symmetry group was employed. From the Mulliken population analysis and energy calculations follows that in the ground state Sc2 dissociates in one Sc in the ground state and the other in the second excited quartet state, 4Fu. The corrected parameters of the ground potential curve are the following: Re = 5.2 bohr, De = 50.37 kcal/mol, and ωe = 234.5 cm-1. The dissociation energy in respect to the dissociation on two Sc in the ground states was estimated as De = 9.98 kcal/mol.

  4. Superconducting Fullerene Nanowhiskers

    Directory of Open Access Journals (Sweden)

    Yoshihiko Takano

    2012-04-01

    Full Text Available We synthesized superconducting fullerene nanowhiskers (C60NWs by potassium (K intercalation. They showed large superconducting volume fractions, as high as 80%. The superconducting transition temperature at 17 K was independent of the K content (x in the range between 1.6 and 6.0 in K-doped C60 nanowhiskers (KxC60NWs, while the superconducting volume fractions changed with x. The highest shielding fraction of a full shielding volume was observed in the material of K3.3C60NW by heating at 200 °C. On the other hand, that of a K-doped fullerene (K-C60 crystal was less than 1%. We report the superconducting behaviors of our newly synthesized KxC60NWs in comparison to those of KxC60 crystals, which show superconductivity at 19 K in K3C60. The lattice structures are also discussed, based on the x-ray diffraction (XRD analyses.

  5. High temperature interfacial superconductivity

    Science.gov (United States)

    Bozovic, Ivan [Mount Sinai, NY; Logvenov, Gennady [Port Jefferson Station, NY; Gozar, Adrian Mihai [Port Jefferson, NY

    2012-06-19

    High-temperature superconductivity confined to nanometer-scale interfaces has been a long standing goal because of potential applications in electronic devices. The spontaneous formation of a superconducting interface in bilayers consisting of an insulator (La.sub.2CuO.sub.4) and a metal (La.sub.1-xSr.sub.xCuO.sub.4), neither of which is superconducting per se, is described. Depending upon the layering sequence of the bilayers, T.sub.c may be either .about.15 K or .about.30 K. This highly robust phenomenon is confined to within 2-3 nm around the interface. After exposing the bilayer to ozone, T.sub.c exceeds 50 K and this enhanced superconductivity is also shown to originate from a 1 to 2 unit cell thick interfacial layer. The results demonstrate that engineering artificial heterostructures provides a novel, unconventional way to fabricate stable, quasi two-dimensional high T.sub.c phases and to significantly enhance superconducting properties in other superconductors. The superconducting interface may be implemented, for example, in SIS tunnel junctions or a SuFET.

  6. Observation of a new turbulence-driven limit-cycle state in H-modes with lower hybrid current drive and lithium-wall conditioning in the EAST superconducting tokamak

    DEFF Research Database (Denmark)

    Wang, H.Q.; Xu, G.S.; Guo, H.Y.;

    2012-01-01

    -frequency oscillation, termed a limit-cycle state, appears at the edge during the quiescent phase with good energy and particle confinement. Detailed measurements by edge Langmuir probes show modulation interaction and strong three-wave coupling between the low-frequency oscillations and high-frequency-broadband (80......The first high confinement H-mode plasma has been obtained in the Experimental Advanced Superconducting Tokamak (EAST) with about 1 MW lower hybrid current drive after wall conditioning by lithium evaporation and real-time injection of Li powder. Following the L–H transition, a small-amplitude, low....... And the measurements demonstrate that the energy gain of zonal flows is of the same order as the energy loss of turbulence. This strongly suggests the interactions between zonal flows and high-frequency turbulences at the pedestal during the limit-cycle state....

  7. Feedback control of superconducting quantum circuits

    NARCIS (Netherlands)

    Ristè, D.

    2014-01-01

    Superconducting circuits have recently risen to the forefront of the solid-state prototypes for quantum computing. Reaching the stage of robust quantum computing requires closing the loop between measurement and control of quantum bits (qubits). This thesis presents the realization of feedback contr

  8. Critical fields of liquid superconducting metallic hydrogen

    Science.gov (United States)

    Jaffe, J.; Ashcroft, N. W.

    1983-01-01

    Liquid metallic hydrogen, in a fully dissociated state, is predicted at certain densities to pass from dirty to clean and from type II to type I superconducting behavior as temperature is lowered. Previously announced in STAR as N82-29374

  9. Studying superconducting Nb3Sn wire

    CERN Multimedia

    AUTHOR|(CDS)2099575

    2015-01-01

    Studying superconducting Nb3Sn wire. From the current experience from LHC and HL-LHC we know that the performance requirements for Nb3Sn conductor for future circular collider are challenging and should exceed that of present state-of-the-art materials.

  10. Specific heat measurements of Ba0.68 K0.32 Fe2 As2 single crystals: evidence for a multiband strong-coupling superconducting state

    NARCIS (Netherlands)

    Popovich, P.; Boris, A.V.; Dolgov, O.V.; Golubov, A.A.; Sun, S.L.; Lin, C.T.; Kremer, R.K.; Keimer, B.

    2010-01-01

    The specific heat of high-purity Ba0.68 K0.32 Fe2 As2 single crystals with the highest reported superconducting Tc =38.5  K was studied. The electronic specific heat Cp below Tc shows two gap features, with Δ1≈11  meV and Δ2≈3.5  meV obtained from an α-model analysis. The reduced gap value, 2Δmax

  11. SC-FDMA for mobile communications

    CERN Document Server

    Abd El-Samie, Fathi E

    2013-01-01

    SC-FDMA for Mobile Communications examines Single-Carrier Frequency Division Multiple Access (SC-FDMA). Explaining this rapidly evolving system for mobile communications, it describes its advantages and limitations and outlines possible solutions for addressing its current limitations. The book explores the emerging trend of cooperative communication with SC-FDMA and how it can improve the physical layer security. It considers the design of distributed coding schemes and protocols for wireless relay networks where users cooperate to send their data to the destination. Supplying you with the re

  12. Superconductivity Bordering Rashba Type Topological Transition

    Science.gov (United States)

    Jin, M. L.; Sun, F.; Xing, L. Y.; Zhang, S. J.; Feng, S. M.; Kong, P. P.; Li, W. M.; Wang, X. C.; Zhu, J. L.; Long, Y. W.; Bai, H. Y.; Gu, C. Z.; Yu, R. C.; Yang, W. G.; Shen, G. Y.; Zhao, Y. S.; Mao, H. K.; Jin, C. Q.

    2017-01-01

    Strong spin orbital interaction (SOI) can induce unique quantum phenomena such as topological insulators, the Rashba effect, or p-wave superconductivity. Combining these three quantum phenomena into a single compound has important scientific implications. Here we report experimental observations of consecutive quantum phase transitions from a Rashba type topological trivial phase to topological insulator state then further proceeding to superconductivity in a SOI compound BiTeI tuned via pressures. The electrical resistivity measurement with V shape change signals the transition from a Rashba type topological trivial to a topological insulator phase at 2 GPa, which is caused by an energy gap close then reopen with band inverse. Superconducting transition appears at 8 GPa with a critical temperature TC of 5.3 K. Structure refinements indicate that the consecutive phase transitions are correlated to the changes in the Bi-Te bond and bond angle as function of pressures. The Hall Effect measurements reveal an intimate relationship between superconductivity and the unusual change in carrier density that points to possible unconventional superconductivity.

  13. Superconductivity Bordering Rashba Type Topological Transition

    Energy Technology Data Exchange (ETDEWEB)

    Jin, M. L.; Sun, F.; Xing, L. Y.; Zhang, S. J.; Feng, S. M.; Kong, P. P.; Li, W. M.; Wang, X. C.; Zhu, J. L.; Long, Y. W.; Bai, H. Y.; Gu, C. Z.; Yu, R. C.; Yang, W. G.; Shen, G. Y.; Zhao, Y. S.; Mao, H. K.; Jin, C. Q.

    2017-01-04

    Strong spin orbital interaction (SOI) can induce unique quantum phenomena such as topological insulators, the Rashba effect, or p-wave superconductivity. Combining these three quantum phenomena into a single compound has important scientific implications. Here we report experimental observations of consecutive quantum phase transitions from a Rashba type topological trivial phase to topological insulator state then further proceeding to superconductivity in a SOI compound BiTeI tuned via pressures. The electrical resistivity measurement with V shape change signals the transition from a Rashba type topological trivial to a topological insulator phase at 2 GPa, which is caused by an energy gap close then reopen with band inverse. Superconducting transition appears at 8 GPa with a critical temperature TC of 5.3 K. Structure refinements indicate that the consecutive phase transitions are correlated to the changes in the Bi–Te bond and bond angle as function of pressures. The Hall Effect measurements reveal an intimate relationship between superconductivity and the unusual change in carrier density that points to possible unconventional superconductivity.

  14. The superconducting spin valve and triplet superconductivity

    Science.gov (United States)

    Garifullin, I. A.; Leksin, P. V.; Garif`yanov, N. N.; Kamashev, A. A.; Fominov, Ya. V.; Schumann, J.; Krupskaya, Y.; Kataev, V.; Schmidt, O. G.; Büchner, B.

    2015-01-01

    A review of our recent results on the spin valve effect is presented. We have used a theoretically proposed spin switch design F1/F2/S comprising a ferromagnetic bilayer (F1/F2) as a ferromagnetic component, and an ordinary superconductor (S) as the second interface component. Based on it we have prepared and studied in detail a set of multilayers CoOx/Fe1/Cu/Fe2/S (S=In or Pb). In these heterostructures we have realized for the first time a full spin switch effect for the superconducting current, have observed its sign-changing oscillating behavior as a function of the Fe2-layer thickness and finally have obtained direct evidence for the long-range triplet superconductivity arising due to noncollinearity of the magnetizations of the Fe1 and Fe2 layers.

  15. Substitution of Ni for Fe in superconducting Fe0.98Te0.5Se0.5 depresses the normal-state conductivity but not the magnetic spectral weight

    Science.gov (United States)

    Wang, Jinghui; Zhong, Ruidan; Li, Shichao; Gan, Yuan; Xu, Zhijun; Zhang, Cheng; Ozaki, T.; Matsuda, M.; Zhao, Yang; Li, Qiang; Xu, Guangyong; Gu, Genda; Tranquada, J. M.; Birgeneau, R. J.; Wen, Jinsheng

    2015-01-01

    We have performed systematic resistivity and inelastic neutron scattering measurements on Fe0.98 -zNizTe0.5Se0.5 samples to study the impact of Ni substitution on the transport properties and the low-energy (≤12 meV) magnetic excitations. It is found that, with increasing Ni doping, both the conductivity and superconductivity are gradually suppressed; in contrast, the low-energy magnetic spectral weight changes little. Comparing with the impact of Co and Cu substitution, we find that the effects on conductivity and superconductivity for the same degree of substitution grow systematically as the atomic number of the substituent deviates from that of Fe. The impact of the substituents as scattering centers appears to be greater than any contribution to carrier concentration. The fact that low-energy magnetic spectral weight is not reduced by increased electron scattering indicates that the existence of antiferromagnetic correlations does not depend on electronic states close to the Fermi energy.

  16. Structural Stability Driven by the Spin-Orbit Coupling and the Superconductivity in simple-cubic Polonium

    Science.gov (United States)

    Kang, Chang-Jong; Kim, Kyoo; Min, B. I.

    2013-03-01

    Polonium is the only element which has the simple-cubic (SC) structure in the periodic table. We have studied its structural stability based on the phonon dispersion calculations using the first-principles all-electron full-potential band method. We have demonstrated that the strong spin-orbit coupling (SOC) in SC-Po suppresses the Peierls instability and makes the SC structure stable. We have also discussed the structural chirality realized in beta-Po, as a consequence of the phonon instability. Further, we have investigated the possible superconductivity in SC-Po, and predicted that it becomes a superconductor with Tc ~ 4 K at ambient pressure. The transverse soft phonon mode at q ~ 2/3 R, which is greatly affected by the SOC, plays an important role both in the structural stability and the superconductivity in SC-Po. We have explored effects of the SOC and the volume variation on the phonon dispersions and superconducting properties of SC-Po.

  17. 1D-transport properties of single superconducting lead nanowires

    DEFF Research Database (Denmark)

    Michotte, S.; Mátéfi-Tempfli, Stefan; Piraux, L.

    2003-01-01

    We report on the transport properties of single superconducting lead nanowires grown by an electrodeposition technique, embedded in a nanoporous track-etched polymer membrane. The nanowires are granular, have uniform diameter of ̃40 nm and a very large aspect ratio (̃500). The diameter of the nan......We report on the transport properties of single superconducting lead nanowires grown by an electrodeposition technique, embedded in a nanoporous track-etched polymer membrane. The nanowires are granular, have uniform diameter of ̃40 nm and a very large aspect ratio (̃500). The diameter...... of the nanowire is small enough to ensure a 1D superconducting regime in a wide temperature range below T. The non-zero resistance in the superconducting state and its variation caused by fluctuations of the superconducting order parameter were measured versus temperature, magnetic field, and applied DC current...

  18. Superconductivity in heavily boron-doped silicon carbide

    Directory of Open Access Journals (Sweden)

    Markus Kriener, Takahiro Muranaka, Junya Kato, Zhi-An Ren, Jun Akimitsu and Yoshiteru Maeno

    2008-01-01

    Full Text Available The discoveries of superconductivity in heavily boron-doped diamond in 2004 and silicon in 2006 have renewed the interest in the superconducting state of semiconductors. Charge-carrier doping of wide-gap semiconductors leads to a metallic phase from which upon further doping superconductivity can emerge. Recently, we discovered superconductivity in a closely related system: heavily boron-doped silicon carbide. The sample used for that study consisted of cubic and hexagonal SiC phase fractions and hence this led to the question which of them participated in the superconductivity. Here we studied a hexagonal SiC sample, free from cubic SiC phase by means of x-ray diffraction, resistivity, and ac susceptibility.

  19. Coulomb blockade and BLOCH oscillations in superconducting Ti nanowires.

    Science.gov (United States)

    Lehtinen, J S; Zakharov, K; Arutyunov, K Yu

    2012-11-01

    Quantum fluctuations in quasi-one-dimensional superconducting channels leading to spontaneous changes of the phase of the order parameter by 2π, alternatively called quantum phase slips (QPS), manifest themselves as the finite resistance well below the critical temperature of thin superconducting nanowires and the suppression of persistent currents in tiny superconducting nanorings. Here we report the experimental evidence that in a current-biased superconducting nanowire the same QPS process is responsible for the insulating state--the Coulomb blockade. When exposed to rf radiation, the internal Bloch oscillations can be synchronized with the external rf drive leading to formation of quantized current steps on the I-V characteristic. The effects originate from the fundamental quantum duality of a Josephson junction and a superconducting nanowire governed by QPS--the QPS junction.

  20. Crystal structure of the superconducting phase of sulfur hydride

    Science.gov (United States)

    Einaga, Mari; Sakata, Masafumi; Ishikawa, Takahiro; Shimizu, Katsuya; Eremets, Mikhail I.; Drozdov, Alexander P.; Troyan, Ivan A.; Hirao, Naohisa; Ohishi, Yasuo

    2016-09-01

    A superconducting critical temperature above 200 K has recently been discovered in H2S (or D2S) under high hydrostatic pressure. These measurements were interpreted in terms of a decomposition of these materials into elemental sulfur and a hydrogen-rich hydride that is responsible for the superconductivity, although direct experimental evidence for this mechanism has so far been lacking. Here we report the crystal structure of the superconducting phase of hydrogen sulfide (and deuterium sulfide) in the normal and superconducting states obtained by means of synchrotron X-ray diffraction measurements, combined with electrical resistance measurements at both room and low temperatures. We find that the superconducting phase is mostly in good agreement with the theoretically predicted body-centred cubic (bcc) structure for H3S. The presence of elemental sulfur is also manifest in the X-ray diffraction patterns, thus proving the decomposition mechanism of H2S to H3S + S under pressure.

  1. z206sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z206SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  2. z107sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z107SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  3. z206sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z206SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  4. z107sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z107SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  5. Bandwidth challenge teams at SC2003 conference

    CERN Multimedia

    2003-01-01

    Results from the fourth annual High-Performance Bandwidth Challenge, held in conjunction with SC2003, the international conference on high-performance computing and networking which occurred last week in Phoenix, AZ (1 page).

  6. Recrystallization of Al-Sc alloys

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Toropova, L.S.; Bykov, Yu.G.; Ber, L.B.

    Scandium effect on the temperature range of aluminium recrystallization was investigated. Al-Sc alloys were studied under cold rolled and hot pressed conditions. It is found that the temperature range of Al-Sc alloy recrystallization depends on ScAl/sub 3/ particle dispersion during recrystallization heats. During heating in quenched alloys at 200-300 deg C decomposition occurs which prevents recrystallization, In the alloys with scandium contents less 0.2% decomposition and recrystallization processes pass simultaneously. In quenched alloys with scandium contents over 0.2% and in aged alloys the initiation and subsequent development of recrystallization are determined by the processes of coalescence and solution of ScAl/sub 3/ phase particles.

  7. Effects of the Next Nearest Neighbor Hopping on Superconductivity and Antiferromagnetism of Gossamer Superconductivity

    Institute of Scientific and Technical Information of China (English)

    刘芬芬; 张勇; 袁峰; 夏临华

    2012-01-01

    The two dimensions hole-doped t-t '-J-U model was studied based on the Gutzwiller approach and the renormalized mean-field theory.The phase diagrams of gossamer superconductors and the effects of the next-nearestneighbor hopping(t ') on superconductivity and antiferromagnetism based on the t-t '-J-U model were investigated.The results show that the qualitative feature of the phase diagrams in the t-t '-J-U model is the same as in the case of the t-J-U model.The antiferromagnetic order coexists with the d-wave superconductivity(dSC) in the underdoped region below the doping δ≈ 0.1 and is enhanced by the t '.The dSC order is slightly suppressed by t ' in the underdoped region and greatly enhanced in the overdoped region.The dSC order is pushed to a larger doping region and the coexistence region of the AF and dSC extends to higher doping.

  8. Sample of superconducting wiring  (Niobium Titanium)

    CERN Multimedia

    About NbTi cable: The cable consists of 36 strands of superconducting wire, each strand has a diameter of 0.825 mm and houses 6300 superconducting filaments of niobium-titanium (Nb-Ti, a superconducting alloy). Each filament has a diameter of about 0.006 mm, i.e. 10 times smaller than a typical human hair. The filaments are embedded in a high-purity copper matrix.  Copper is a normal conducting material. The filaments are in the superconductive state when the temperature is below about -263ºC (10.15 K). When the filaments leave the superconductive state, the copper acts as conductor transports the electrical current. Each strand of The NbTi cable (at superconducting state) has a current density of up to above 2000 A/mm2 at 9 T and -271ºC (2.15 K). A cable transport a current of about 13000 A at 10 T and -271ºC (2.15 K). About LHC superconducting wiring: The high magnetic fields needed for the LHC can only be reached using superconductors. At very low temperatures, superconductors have no electrical resis...

  9. Conceptual study of superconducting urban area power systems

    Science.gov (United States)

    Noe, Mathias; Bach, Robert; Prusseit, Werner; Willén, Dag; Gold-acker, Wilfried; Poelchau, Juri; Linke, Christian

    2010-06-01

    Efficient transmission, distribution and usage of electricity are fundamental requirements for providing citizens, societies and economies with essential energy resources. It will be a major future challenge to integrate more sustainable generation resources, to meet growing electricity demand and to renew electricity networks. Research and development on superconducting equipment and components have an important role to play in addressing these challenges. Up to now, most studies on superconducting applications in power systems have been concentrated on the application of specific devices like for example cables and current limiters. In contrast to this, the main focus of our study is to show the consequence of a large scale integration of superconducting power equipment in distribution level urban power systems. Specific objectives are to summarize the state-of-the-art of superconducting power equipment including cooling systems and to compare the superconducting power system with respect to energy and economic efficiency with conventional solutions. Several scenarios were considered starting from the replacement of an existing distribution level sub-grid up to a full superconducting urban area distribution level power system. One major result is that a full superconducting urban area distribution level power system could be cost competitive with existing solutions in the future. In addition to that, superconducting power systems offer higher energy efficiency as well as a number of technical advantages like lower voltage drops and improved stability.

  10. Electrostatic separation of superconducting particles from non-superconducting particles and improvement in fuel atomization by electrorheology

    Science.gov (United States)

    Chhabria, Deepika

    This thesis has two major topics: (1) Electrostatic Separation of Superconducting Particles from a Mixture of Non-Superconducting Particles. (2) Improvement in fuel atomization by Electrorheology. (1) Based on the basic science research, the interactions between electric field and superconductors, we have developed a new technology, which can separate superconducting granular particles from their mixture with non-superconducting particles. The electric-field induced formation of superconducting balls is important aspect of the interaction between superconducting particles and electric field. When the applied electric field exceeds a critical value, the induced positive surface energy on the superconducting particles forces them to aggregate into balls or cling to the electrodes. In fabrication of superconducting materials, especially HTSC materials, it is common to come across materials with multiple phases: some grains are in superconducting state while the others are not. Our technology is proven to be very useful in separating superconducting grains from the rest non-superconducting materials. To separate superconducting particles from normal conducting particles, we apply a suitable strong electric field. The superconducting particles cling to the electrodes, while normal conducting particles bounce between the electrodes. The superconducting particles could then be collected from the electrodes. To separate superconducting particles from insulating ones, we apply a moderate electric field to force insulating particles to the electrodes to form short chains while the superconducting particles are collected from the middle of capacitor. The importance of this technology is evidenced by the unsuccessful efforts to utilize the Meissner effect to separate superconducting particles from nonsuperconducting ones. Because the Meissner effect is proportional to the particle volume, it has been found that the Meissner effect is not useful when the superconducting

  11. Effects of pressure and magnetic field on superconductivity in ZrTe3: local pair-induced superconductivity

    Science.gov (United States)

    Tsuchiya, S.; Matsubayashi, K.; Yamaya, K.; Takayanagi, S.; Tanda, S.; Uwatoko, Y.

    2017-06-01

    In this work, the origin of the highly anisotropic superconducting transition in ZrTe3, where the resistance along the a axis, R a , is reduced at 4 K but those along the b axis, R b , and {c}\\prime axis, R c‧, are reduced at 2 K, was explored with the application of a magnetic field and pressure by the electrical resistance measurements. We found that the behavior of the upper critical field and its anisotropy as well as the pressure dependence determined by the R a measurements are quite similar to those of R b . Moreover, the excess conductivity for R b indicates anomalous behavior. These results support an unconventional origin for the anisotropic transition rather than conventional superconducting fluctuation. The reduction in R a is due to filamentary superconductivity (SC) induced by locally bound electron pairs (local pairs), which correspond to bi-polarons, and the transition of R b corresponds to the emergence of bulk SC originating from the Cooper pairs triggered by the transfer of the local pairs.

  12. A new family of high-Tc compounds-Stepping stones toward understanding unconventional superconductivity

    Institute of Scientific and Technical Information of China (English)

    SUN Yang; Mike GUIDRY; WU ChengLi

    2008-01-01

    @@ High-transition temperature (Tc) superconductivity was first discovered in layered copper-based oxides (cuprates)more than two decades ago[1], but its theoretical inter-pretation remains controversial[2,3]. The main question concerning the high-Tc superconductivity phase diagram is the transition between the antiferromagnetic (AF) and superconducting (SC) phases, which is dominated by anomalous properties commonly attributed to a pseu-dogap[4,5] in the spectrum. It is believed that the high-Tc mechanism in cuprates cannot be fully understood within the BCS theory[6] that explains normal supercon-ductivity. Despite much effort, there is no consensus as to the origin of the pseudogap properties, and the high-Tc mechanism remains an open question.

  13. Structural, elastic and thermodynamic properties of Ti2SC

    Indian Academy of Sciences (India)

    Hongzhi Fu; Wenfang Liu; Tao Gao

    2011-12-01

    The structural parameters, elastic constants and thermodynamic properties of Ti2SC were investigated under pressure and temperature by using first-principles plane-wave pseudopotential density functional theory within the generalized gradient approximation. The obtained results are in agreement with the available experimental data. The bulk moduli along the - and -axes, $B_{a}$ and $B_{c}$, almost linearly increase with pressure, and the former is always smaller than the latter. The ratio of $B_{c}/B_{a}$ has a trend of gradual increase as the pressure increases. It is found that the elastic constants, anisotropy and Debye temperature of Ti2SC increase with pressure, while axial compressibility along the - and -axes decreases with pressure. The thermal properties including the equation of state, the Grüneisen parameter , the anisotropies $\\Delta_{p}, \\Delta_{S1}$ and $\\Delta_{S2}$, and the heat capacity are estimated at various pressures and temperatures.

  14. Superconducting gap symmetry determined by the electron density

    Energy Technology Data Exchange (ETDEWEB)

    Perez, Luis A. [Instituto de Fisica, Universidad Nacional Autonoma de Mexico (UNAM), A.P. 20-364, C.P. 01000, Mexico D.F. (Mexico)]. E-mail: lperez@fisica.unam.mx; Millan, J. Samuel [Facultad de Ingenieria, UNACAR, C.P. 24180, Cd. del Carmen, Campeche, Mexico. (Mexico); Wang Chumin [Instituto de Investigaciones en Materiales, UNAM, A.P. 70-360, C.P. 04510, Mexico D.F. (Mexico)

    2006-05-01

    In this work, a comparative study of pairing and superconducting states in square lattices with s-, p- and d-symmetries is performed within the BCS formalism and a generalized Hubbard model, in which correlated-hopping interactions are considered in addition to the repulsive Coulomb interactions. The two-particle analysis reveals the importance of the van Hove singularity in the formation of pairs and then the two-particle states with different pairing symmetry have their maximum binding energies at the same hopping strength. This feature is confirmed by the superconducting critical temperature (T {sub c}) calculation at the low-density regime. However, a different picture is found for the high-density regime, i.e., the maxima of the s- and d-channel T {sub c} split from the expected value and no p-wave superconducting state is found. This study suggests that the three superconducting symmetries can be analyzed within a single framework.

  15. Sc3N and Sc2C2 encapsulated B40: Smarter than its carbon analogue

    Science.gov (United States)

    Shah, Esha V.; Roy, Debesh R.

    2016-10-01

    A detailed comparative investigation on the recently synthesised B40 and C40 along with their metal nitride (Sc3N)and carbide (Sc2C2) encapsulated endohedral fullerenes, is performed under density functional theory for the first time. The structures, electronic, thermodynamic and magnetic properties of all the considered compounds are explored in detail. The present study identifies borospherene (B40) and its encapsulated nitride (Sc3N@B40) and carbide (Sc2C2@B40) endohedral borofullerenes as the better candidates for future novel nano-applications compared to their carbon bucky ball analogues.

  16. STM/STS study of the superconducting gap in SmFeAsO1-xFx

    Science.gov (United States)

    Kawashima, Yuki; Ichimura, Koichi; Katono, Kazuhiro; Kurosawa, Tohru; Oda, Migaku; Tanda, Satoshi; Kamihara, Yoichi; Hosono, Hideo

    2015-02-01

    We report an electron tunneling study of SmFeAsO1-xFx in the low doping region (x=0, 0.045, 0.046, 0.069) by low temperature UHV-STM/STS. Superconducting gaps are observed for each superconducting sample x=0.045 (Tc=12.9 K), x=0.046 (Tc=32.9 K) and x=0.069 (Tc=46.9 K). We obtained corresponding superconducting gap size of ΔSC = 9.5 ± 0.5 meV, 9.75±0.25 meV and 11±1 meV. While Tc increases, ΔSC is kept the same. This suggests that the effective attractive interaction is the same and that there is some mechanism that suppresses the superconductivity in the low doping region. On the other hand, similar gap structures were found in a non-superconducting sample with x=0 at 7.8 K. The obtained gap size was ΔN = 8.5 ± 1.5 meV, which is almost the same as the superconducting gap in the superconducting samples (x=0.045, 0.046, 0.069).

  17. Nanoscience and Engineering in Superconductivity

    CERN Document Server

    Moshchalkov, Victor; Lang, Wolfgang

    2010-01-01

    For emerging energy saving technologies, superconducting materials with superior performance are needed. Such materials can be developed by manipulating the 'elementary building blocks' through nanostructuring. For superconductivity the 'elementary blocks' are Cooper pair and fluxon (vortex). This book presents new ways how to modify superconductivity and vortex matter through nanostructuring and the use of nanoscale magnetic templates. The basic nano-effects, vortex and vortex-antivortex patterns, vortex dynamics, Josephson phenomena, critical currents, and interplay between superconductivity

  18. 8 April 2011 - Brazilian Minister of State for Science and Technology A. Mercadante Oliva signing the guest book with CERN Director-General R. Heuer and Head of International Relations F. Pauss; in the ATLAS visitor centre with Collaboration Former Spokesperson P. Jenni; visiting LHC superconducting magnet test hall with J.M. Jimenez.

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    8 April 2011 - Brazilian Minister of State for Science and Technology A. Mercadante Oliva signing the guest book with CERN Director-General R. Heuer and Head of International Relations F. Pauss; in the ATLAS visitor centre with Collaboration Former Spokesperson P. Jenni; visiting LHC superconducting magnet test hall with J.M. Jimenez.

  19. William Brinkman (centre), Director of the Department of Energy, U.S.A. at the superconducting magnet test hall SM18 with (from left to right) Coordinator for External Relations F. Pauss, Advisor for Non-Member States J. Ellis, J. Strait from Fermilab and Deputy Head of Technology Department L. Rossi on 13 November 2009.

    CERN Multimedia

    Maximilien Brice; SM18

    2009-01-01

    William Brinkman (centre), Director of the Department of Energy, U.S.A. at the superconducting magnet test hall SM18 with (from left to right) Coordinator for External Relations F. Pauss, Advisor for Non-Member States J. Ellis, J. Strait from Fermilab and Deputy Head of Technology Department L. Rossi on 13 November 2009.

  20. 19 September 2011 - Austrian State Secretary for European and International Affairs W. Waldner, signing the guest book with Head of International Relations F. Pauss; visiting CMS service cavern with Collaboration Spokesperson G. Tonelli and the LHC superconducting magnet test hall with M. Zerlauth.

    CERN Multimedia

    Benoît Jeannet

    2011-01-01

    Austrian state secretary for foreign affairs, Wolfgang Waldner, left, was welcomed to CERN by Felicitas Pauss, head of international relations at CERN, on 19 September. While at CERN, he toured the CMS control room and underground experimental service cavern, the LHC superconducting magnet test hall, and the Universe of Particles exhibition in the Globe of Science and Innovation.