Revised Sunspot Numbers and the Effects on Understanding the Sunspot Cycle
Hathaway, D. H.
2014-12-01
While sunspot numbers provide only limited information about the sunspot cycle, they provide that information for at least twice as many sunspot cycles as any other direct solar observation. In particular, sunspot numbers are available before, during, and immediately after the Maunder Minimum (1645-1715). The instruments and methods used to count sunspots have changed over the last 400+ years. This leads to systematic changes in the sunspot number that can mask, or artificially introduce, characteristics of the sunspot cycle. The most widely used sunspot number is the International (Wolf/Zurich) sunspot number which is now calculated at the Solar Influences Data Center in Brussels, Belgium. These numbers extend back to 1749. The Group sunspot number extends back to the first telescopic observations of the Sun in 1610. There are well-known and significant differences between these two numbers where they overlap. Recent work has helped us to understand the sources of these differences and has led to proposed revisions in the sunspot numbers. Independent studies now support many of these revisions. These revised sunspot numbers suggest changes to our understanding of the sunspot cycle itself and to our understanding of its connection to climate change.
Fractal Dimension and Maximum Sunspot Number in Solar Cycle
Directory of Open Access Journals (Sweden)
R.-S. Kim
2006-09-01
Full Text Available The fractal dimension is a quantitative parameter describing the characteristics of irregular time series. In this study, we use this parameter to analyze the irregular aspects of solar activity and to predict the maximum sunspot number in the following solar cycle by examining time series of the sunspot number. For this, we considered the daily sunspot number since 1850 from SIDC (Solar Influences Data analysis Center and then estimated cycle variation of the fractal dimension by using Higuchi's method. We examined the relationship between this fractal dimension and the maximum monthly sunspot number in each solar cycle. As a result, we found that there is a strong inverse relationship between the fractal dimension and the maximum monthly sunspot number. By using this relation we predicted the maximum sunspot number in the solar cycle from the fractal dimension of the sunspot numbers during the solar activity increasing phase. The successful prediction is proven by a good correlation (r=0.89 between the observed and predicted maximum sunspot numbers in the solar cycles.
Evolution of the Sunspot Number and Solar Wind B Time Series
Cliver, Edward W.; Herbst, Konstantin
2018-03-01
The past two decades have witnessed significant changes in our knowledge of long-term solar and solar wind activity. The sunspot number time series (1700-present) developed by Rudolf Wolf during the second half of the 19th century was revised and extended by the group sunspot number series (1610-1995) of Hoyt and Schatten during the 1990s. The group sunspot number is significantly lower than the Wolf series before ˜1885. An effort from 2011-2015 to understand and remove differences between these two series via a series of workshops had the unintended consequence of prompting several alternative constructions of the sunspot number. Thus it has been necessary to expand and extend the sunspot number reconciliation process. On the solar wind side, after a decade of controversy, an ISSI International Team used geomagnetic and sunspot data to obtain a high-confidence time series of the solar wind magnetic field strength (B) from 1750-present that can be compared with two independent long-term (> ˜600 year) series of annual B-values based on cosmogenic nuclides. In this paper, we trace the twists and turns leading to our current understanding of long-term solar and solar wind activity.
The Recalibrated Sunspot Number: Impact on Solar Cycle Predictions
Clette, F.; Lefevre, L.
2017-12-01
Recently and for the first time since their creation, the sunspot number and group number series were entirely revisited and a first fully recalibrated version was officially released in July 2015 by the World Data Center SILSO (Brussels). Those reference long-term series are widely used as input data or as a calibration reference by various solar cycle prediction methods. Therefore, past predictions may now need to be redone using the new sunspot series, and methods already used for predicting cycle 24 will require adaptations before attempting predictions of the next cycles.In order to clarify the nature of the applied changes, we describe the different corrections applied to the sunspot and group number series, which affect extended time periods and can reach up to 40%. While some changes simply involve constant scale factors, other corrections vary with time or follow the solar cycle modulation. Depending on the prediction method and on the selected time interval, this can lead to different responses and biases. Moreover, together with the new series, standard error estimates are also progressively added to the new sunspot numbers, which may help deriving more accurate uncertainties for predicted activity indices. We conclude on the new round of recalibration that is now undertaken in the framework of a broad multi-team collaboration articulated around upcoming ISSI workshops. We outline the future corrections that can still be expected in the future, as part of a permanent upgrading process and quality control. From now on, future sunspot-based predictive models should thus be made more adaptable, and regular updates of predictions should become common practice in order to track periodic upgrades of the sunspot number series, just like it is done when using other modern solar observational series.
Directory of Open Access Journals (Sweden)
Frédéric Ouattara
2009-06-01
Full Text Available Four well known geomagnetic classes of activity such as quiet days activity, fluctuating activity, recurrent activity
and shock activity time occurrences have been determined not only by using time profile of sunspot number
Rz but also by using aa index values.
We show that recurrent wind stream activity and fluctuating activity occur in opposite phase and slow solar wind
activity during minimum phase and shock activity at the maximum phase.
It emerges from this study that fluctuating activity precedes the sunspot cycle by π/2 and the latter also precedes
recurrent activity by π/2. Thus in the majority the activities do not happen at random; the sunspot cycle starts
with quiet days activity, continues with fluctuating activity and during its maximum phase arrives shock activity.
The descending phase is characterized by the manifestation of recurrent wind stream activity.
Directory of Open Access Journals (Sweden)
Cliver Edward W.
2017-01-01
Full Text Available We analyze the normalization factors (k′-factors used to scale secondary observers to the Royal Greenwich Observatory (RGO reference series of the Hoyt & Schatten (1998a, 1998b group sunspot number (GSN. A time series of these k′-factors exhibits an anomaly from 1841 to 1920, viz., the average k′-factor for all observers who began reporting groups from 1841 to 1883 is 1.075 vs. 1.431 for those who began from 1884 to 1920, with a progressive rise, on average, during the latter period. The 1883–1884 break between the two subintervals occurs precisely at the point where Hoyt and Schatten began to use a complex daisy-chaining method to scale observers to RGO. The 1841–1920 anomaly implies, implausibly, that the average sunspot observer who began from 1841 to 1883 was nearly as proficient at counting groups as mid-20th century RGO (for which k′ = 1.0 by definition while observers beginning during the 1884–1920 period regressed in group counting capability relative to those from the earlier interval. Instead, as shown elsewhere and substantiated here, RGO group counts increased relative to those of other long-term observers from 1874 to ~1915. This apparent inhomogeneity in the RGO group count series is primarily responsible for the increase in k′-factors from 1884 to 1920 and the suppression, by 44% on average, of the Hoyt and Schatten GSN relative to the original Wolf sunspot number (WSN before ~1885. Correcting for the early “learning curve” in the RGO reference series and minimizing the use of daisy-chaining rectifies the anomalous behavior of the k′-factor series. The resultant GSN time series (designated GSN* is in reasonable agreement with the revised WSN (SN*; Clette & Lefèvre 2016 and the backbone-based group sunspot number (RGS; Svalgaard & Schatten 2016 but significantly higher than other recent reconstructions (Friedli, personal communication, 2016; Lockwood et al. 2014a, 2014b; Usoskin et al. 2016a. This result
International Nuclear Information System (INIS)
Moore, R.; Rabin, D.
1985-01-01
It is pointed out that the sun provides a close-up view of many astrophysically important phenomena, nearly all connected with the causes and effects of solar magnetic fields. The present article provides a review of the role of sunspots in a number of new areas of research. Connections with other solar phenomena are examined, taking into account flares, the solar magnetic cycle, global flows, luminosity variation, and global oscillations. A selective review of the structure and dynamic phenomena observed within sunspots is also presented. It is found that sunspots are usually contorted during the growth phase of an active region as magnetic field rapidly emerges and sunspots form, coalesce, and move past or even through each other. Attention is given to structure and flows, oscillations and waves, and plans for future studies. 145 references
The Sunspot Number and beyond : reconstructing detailed solar information over centuries
Lefevre, L.
2014-12-01
With four centuries of solar evolution, the International Sunspot Number (SSN) forms the longest solar time series currently available. It provides an essential reference for understanding and quantifying how the solar output has varied over decades and centuries and thus for assessing the variations of the main natural forcing on the Earth climate. Because of its importance, this unique time-series must be closely monitored for any possible biases and drifts. Here, we report about recent disagreements between solar indices, for example the sunspot sumber and the 10.7cm radio flux. Recent analyses indicate that while part of this divergence may be due to a calibration drift in the SSN, it also results from an intrinsic change in the global magnetic parameters of sunspots and solar active regions, suggesting a possible transition to a new activity regime. Going beyond the SSN series, in the framework of the TOSCA (www.cost-tosca.eu/) and SOLID (projects.pmodwrc.ch/solid/) projects, we produced a survey of all existing catalogs providing detailed sunspot information (Lefevre & Clette, 2014:10.1007/s11207-012-0184-5) and we also located different primary solar images and drawing collections that can be exploitable to complement the existing catalogs. These are first steps towards the construction of a multi-parametric time series of multiple sunspot and sunspot group properties over more than a century, allowing to reconstruct and extend the current 1-D SSN series. By bringing new spatial, morphological and evolutionary information, such a data set should bring major advances for the modeling of the solar dynamo and solar irradiance. We will present here the current status of this work. The preliminary version catalog now extends over the last 150 years. It makes use of data from DPD (http://fenyi.solarobs.unideb.hu/DPD/index.html), from the Uccle Solar Equatorial Table (USET:http://sidc.oma.be/uset/) operated by the Royal Obeservatory of Belgium, the Greenwich
Extreme Value Theory Applied to the Millennial Sunspot Number Series
Acero, F. J.; Gallego, M. C.; García, J. A.; Usoskin, I. G.; Vaquero, J. M.
2018-01-01
In this work, we use two decadal sunspot number series reconstructed from cosmogenic radionuclide data (14C in tree trunks, SN 14C, and 10Be in polar ice, SN 10Be) and the extreme value theory to study variability of solar activity during the last nine millennia. The peaks-over-threshold technique was used to compute, in particular, the shape parameter of the generalized Pareto distribution for different thresholds. Its negative value implies an upper bound of the extreme SN 10Be and SN 14C timeseries. The return level for 1000 and 10,000 years were estimated leading to values lower than the maximum observed values, expected for the 1000 year, but not for the 10,000 year return levels, for both series. A comparison of these results with those obtained using the observed sunspot numbers from telescopic observations during the last four centuries suggests that the main characteristics of solar activity have already been recorded in the telescopic period (from 1610 to nowadays) which covers the full range of solar variability from a Grand minimum to a Grand maximum.
Coddington, O.; Lean, J.; Pilewskie, P.; Baranyi, T.; Snow, M. A.; Kopp, G.; Richard, E. C.; Lindholm, C.
2017-12-01
An operational climate data record (CDR) of total and spectral solar irradiance became available in November 2015 as part of the National Oceanographic and Atmospheric Administration's National Centers for Environmental Information Climate Data Record Program. The data record, which is updated quarterly, is available from 1610 to the present as yearly-average values and from 1882 to the present as monthly- and daily-averages, with associated time and wavelength-dependent uncertainties. It was developed jointly by the University of Colorado at Boulder's Laboratory for Atmospheric and Space Physics and the Naval Research Laboratory, and, together with the source code and supporting documentation, is available at https://www.ncdc.noaa.gov/cdr/. In the Solar Irradiance CDR, total solar irradiance (TSI) and solar spectral irradiance (SSI) are estimated from models that determine the changes from quiet Sun conditions arising from bright faculae and dark sunspots on the solar disk. The models are constructed using linear regression of proxies of solar sunspot and facular features with the approximately decade-long irradiance observations from the SOlar Radiation and Climate Experiment. A new revision of this data record was recently released in an ongoing effort to reduce solar irradiance uncertainties in two ways. First, the sunspot darkening proxy was revised using a new cross calibration of the current sunspot region observations made by the Solar Observing Optical Network with the historical records of the Royal Greenwich Observatory. This implementation affects modeled irradiances from 1882 - 1978. Second, the impact of a revised record of sunspot number by the Sunspot Index and Long-term Solar Observations center on modeled irradiances was assessed. This implementation provides two different reconstructions of historical, yearly-averaged irradiances from 1610-1881. Additionally, we show new, preliminary results that demonstrate improvements in modeled TSI by using
Effect of solar flare ans sunspot numbers on the intensity of 5577A line in the night airglow
International Nuclear Information System (INIS)
Kundu, N.; Ghosh, S.N.
1981-01-01
The effects of solar flare and sunspot number on the intensity of 5577 A line emission are presented. The time lag between the occurrence of a flare and the enhancement of 5577 A line intensity is determined by observing the intensity of the line on three successive nights- the night preceding the flare and the two nights following it. The velocity of the solar corpuscles is then calculated. The value obtained at Allahabad (2400 Km/sec) is in agreement with the De Jager's prediction for explosive flare. Day-to-day analyses of the observations taken at Allahabad exhibit high correlation of the intensity of 5577 A line emission with sunspot number. Also, correlation is found for the intensity of 5577 A with the change in sunspot number (DELTA R) from the day preceding the night of observation to the day following it. The intensity appears to vary with the magnetic field produced by the sunspot and not with the spot area. (author)
SOLAR CYCLE 24: CURIOUS CHANGES IN THE RELATIVE NUMBERS OF SUNSPOT GROUP TYPES
International Nuclear Information System (INIS)
Kilcik, A.; Yurchyshyn, V. B.; Ozguc, A.; Rozelot, J. P.
2014-01-01
Here, we analyze different sunspot group (SG) behaviors from the points of view of both the sunspot counts (SSCs) and the number of SGs, in four categories, for the time period of 1982 January-2014 May. These categories include data from simple (A and B), medium (C), large (D, E, and F), and decaying (H) SGs. We investigate temporal variations of all data sets used in this study and find the following results. (1) There is a very significant decrease in the large groups' SSCs and the number of SGs in solar cycle 24 (cycle 24) compared to cycles 21-23. (2) There is no strong variation in the decaying groups' data sets for the entire investigated time interval. (3) Medium group data show a gradual decrease for the last three cycles. (4) A significant decrease occurred in the small groups during solar cycle 23, while no strong changes show in the current cycle (cycle 24) compared to the previous ones. We confirm that the temporal behavior of all categories is quite different from cycle to cycle and it is especially flagrant in solar cycle 24. Thus, we argue that the reduced absolute number of the large SGs is largely, if not solely, responsible for the weak cycle 24. These results might be important for long-term space weather predictions to understand the rate of formation of different groups of sunspots during a solar cycle and the possible consequences for the long-term geomagnetic activity
International Nuclear Information System (INIS)
Joglekar, P.J.; Sathiamurthy, T.S.
1975-01-01
Comparisons of the variation of atmospheric radio noise intensities for 20 to 24 hr to sunspot numbers have been completed. Statistical dependence between the noise intensities and sunspot numbers was found for different seasons at a number of frequencies for many locations in the global network of ARN-2 noise recorders. The noise intensities generally tended to decrease with sunspot number in the range from 50 kHz to 5 MHz, which is presumed to be due to increases in residual ionospheric absorption during nighttime. At frequencies greater than 5 MHz, noise intensities increased with sunspot number in many cases, which would be expected from our present knowledge of ionospheric behavior in the HF range. By convention, CCIR treats year-to-year variation in the noise intensities as random and includes them in the prediction uncertainty sigma /sub Fam/ (for which one value is given at a frequency for a seasonal time block for all locations) in system performance evaluation. An error analysis on a global basis shows that a large portion of the year-to-year variability is due to sunspot variation. This suggests the possibility of improved noise estimates. (auth)
On the insignificance of Herschel's sunspot correlation
Love, Jeffrey J.
2013-08-01
We examine William Herschel's hypothesis that solar-cycle variation of the Sun's irradiance has a modulating effect on the Earth's climate and that this is, specifically, manifested as an anticorrelation between sunspot number and the market price of wheat. Since Herschel first proposed his hypothesis in 1801, it has been regarded with both interest and skepticism. Recently, reports have been published that either support Herschel's hypothesis or rely on its validity. As a test of Herschel's hypothesis, we seek to reject a null hypothesis of a statistically random correlation between historical sunspot numbers, wheat prices in London and the United States, and wheat farm yields in the United States. We employ binary-correlation, Pearson-correlation, and frequency-domain methods. We test our methods using a historical geomagnetic activity index, well known to be causally correlated with sunspot number. As expected, the measured correlation between sunspot number and geomagnetic activity would be an unlikely realization of random data; the correlation is "statistically significant." On the other hand, measured correlations between sunspot number and wheat price and wheat yield data would be very likely realizations of random data; these correlations are "insignificant." Therefore, Herschel's hypothesis must be regarded with skepticism. We compare and contrast our results with those of other researchers. We discuss procedures for evaluating hypotheses that are formulated from historical data.
Chattopadhyay, Surajit; Chattopadhyay, Goutami
The present paper reports studies on the association between the mean annual sunspot numbers and the summer monsoon rainfall over India. The cross correlations have been studied. After Box-Cox transformation, the time spectral analysis has been executed and it has been found that both of the time series have an important spectrum at the fifth harmonic. An artificial neural network (ANN) model has been developed on the data series averaged continuously by five years and the neural network could establish a predictor-predict and relationship between the sunspot numbers and the mean yearly summer monsoon rainfall over India.
Towards the automatic detection and analysis of sunspot rotation
Brown, Daniel S.; Walker, Andrew P.
2016-10-01
Torsional rotation of sunspots have been noted by many authors over the past century. Sunspots have been observed to rotate up to the order of 200 degrees over 8-10 days, and these have often been linked with eruptive behaviour such as solar flares and coronal mass ejections. However, most studies in the literature are case studies or small-number studies which suffer from selection bias. In order to better understand sunspot rotation and its impact on the corona, unbiased large-sample statistical studies are required (including both rotating and non-rotating sunspots). While this can be done manually, a better approach is to automate the detection and analysis of rotating sunspots using robust methods with well characterised uncertainties. The SDO/HMI instrument provide long-duration, high-resolution and high-cadence continuum observations suitable for extracting a large number of examples of rotating sunspots. This presentation will outline the analysis of SDI/HMI data to determine the rotation (and non-rotation) profiles of sunspots for the complete duration of their transit across the solar disk, along with how this can be extended to automatically identify sunspots and initiate their analysis.
Sunspots During the Maunder Minimum from Machina Coelestis by Hevelius
Carrasco, V. M. S.; Álvarez, J. Villalba; Vaquero, J. M.
2015-10-01
We revisited the sunspot observations published by Johannes Hevelius in his book Machina Coelestis (1679) corresponding to the period of 1653 - 1675 (just in the middle of the Maunder Minimum). We show detailed translations of the original Latin texts describing the sunspot records and provide the general context of these sunspot observations. From this source, we present an estimate of the annual values of the group sunspot number based only on the records that explicitly inform us of the presence or absence of sunspots. Although we obtain very low values of the group sunspot number, in accordance with a grand minimum of solar activity, these values are significantly higher in general than the values provided by Hoyt and Schatten ( Solar Phys. 179, 189, 1998) for the same period.
Long-term Modulation of Cosmic Ray Intensity in relation to Sunspot ...
Indian Academy of Sciences (India)
it should be more closely connected with cosmic ray modulation than with other solar characteristics (sunspot numbers or coronal emission intensity). The intensity of galactic cosmic rays varies inversely with sunspot numbers, having their maximum intensity at the minimum of the 11-year sunspot cycle (Forbush 1954, 1958) ...
Size of the coming solar cycle 24 based on Ohl's Precursor Method, final estimate
Directory of Open Access Journals (Sweden)
R. P. Kane
2010-07-01
Full Text Available In Ohl's Precursor Method (Ohl, 1966, 1976, the geomagnetic activity during the declining phase of a sunspot cycle is shown to be well correlated with the size (maximum sunspot number Rz(max of the next cycle. For solar cycle 24, Kane (2007a used aa(min=15.5 (12-month running mean, which occurred during March–May of 2006 and made a preliminary estimate Rz(max=124±26 (12-month running mean. However, in the next few months, the aa index first increased and then decreased to a new low value of 14.8 in July 2007. With this new low value, the prediction was Rz(max=117±26 (12-month running mean. However, even this proved a false signal. Since then, the aa values have decreased considerably and the last 12-monthly value is 8.7, centered at May 2009. For solar cycle 24, using aa(min=8.7, the latest prediction is, Rz(max=58.0±25.0.
Sunspot drawings handwritten character recognition method based on deep learning
Zheng, Sheng; Zeng, Xiangyun; Lin, Ganghua; Zhao, Cui; Feng, Yongli; Tao, Jinping; Zhu, Daoyuan; Xiong, Li
2016-05-01
High accuracy scanned sunspot drawings handwritten characters recognition is an issue of critical importance to analyze sunspots movement and store them in the database. This paper presents a robust deep learning method for scanned sunspot drawings handwritten characters recognition. The convolution neural network (CNN) is one algorithm of deep learning which is truly successful in training of multi-layer network structure. CNN is used to train recognition model of handwritten character images which are extracted from the original sunspot drawings. We demonstrate the advantages of the proposed method on sunspot drawings provided by Chinese Academy Yunnan Observatory and obtain the daily full-disc sunspot numbers and sunspot areas from the sunspot drawings. The experimental results show that the proposed method achieves a high recognition accurate rate.
International Nuclear Information System (INIS)
Lomb, Nick
2013-01-01
The set of sunspot numbers observed since the invention of the telescope is one of the most studied time series in astronomy and yet it is also one of the most complex. Fourteen frequencies are found in the yearly mean sunspot numbers from 1700 to 2011using the Lomb-Scargle periodogram and prewhitening. All of the frequencies corresponding to shorter term periods can be matched with simple algebraic combinations of the frequency of the main 11-year period and the frequencies of the longer term periods in the periodogram. This is exactly what can be expected from amplitude and phase modulation of an 11.12-year periodicity by longer term variations. Similar, though not identical, results are obtained after correcting the sunspot number series as proposed by Svalgaard. On looking separately at the amplitude and phase modulation a clear relationship is found between the two modulations although this relationship has broken down for the last four solar cycles. The phase modulation implies that there is a definite underlying period for the solar cycle. Such a clock mechanism does seem to be a possibility in models of the solar dynamo incorporating a conveyor-belt-like meridional circulation between high polar latitudes and the equator.
Using dynamo theory to predict the sunspot number during solar cycle 21
Schatten, K. H.; Scherrer, P. H.; Svalgaard, L.; Wilcox, J. M.
1978-01-01
On physical grounds it is suggested that the polar field strength of the sun near a solar minimum is closely related to the solar activity of the following cycle. Four methods of estimating the polar magnetic field strength of the sun near solar minimum are employed to provide an estimate of the yearly mean sunspot number of cycle 21 at solar maximum of 140 + or - 20. This estimate may be considered a first-order attempt to predict the cycle activity using one parameter of physical importance based upon dynamo theory.
Featured Image: Bright Dots in a Sunspot
Kohler, Susanna
2018-03-01
This image of a sunspot, located in in NOAA AR 12227, was captured in December 2014 by the 0.5-meter Solar Optical Telescope on board the Hinode spacecraft. This image was processed by a team of scientists led by Rahul Yadav (Udaipur Solar Observatory, Physical Research Laboratory Dewali, India) in order to examine the properties of umbral dots: transient, bright features observed in the umbral region (the central, darkest part) of a sunspot. By exploring these dots, Yadav and collaborators learned how their properties relate to the large-scale properties of the sunspots in which they form for instance, how do the number, intensities, or filling factors of dots relate to the size of a sunspots umbra? To find out more about the authors results, check out the article below.Sunspot in NOAA AR 11921. Left: umbralpenumbral boundary. Center: the isolated umbra from the sunspot. Right: The umbra with locations of umbral dots indicated by yellow plus signs. [Adapted from Yadav et al. 2018]CitationRahul Yadav et al 2018 ApJ 855 8. doi:10.3847/1538-4357/aaaeba
DEFF Research Database (Denmark)
Xiong, Meng; Ozolins, Oskars; Ding, Yunhong
2012-01-01
Simultaneous RZ-OOK to NRZ-OOK and RZ-DPSK to NRZDPSK modulation format conversion in a single silicon microring resonator with free spectral range equal to twice the signal bit rate is experimentally demonstrated for the first time at 41.6 Gb/s. By utilizing an optimized custom-made microring...
Values of Kp Indices, Ap Indices, Cp Indices, C9 Indices, Sunspot Number, and 10.7 cm Flux
National Oceanic and Atmospheric Administration, Department of Commerce — This data file consists of Kp indices, Ap indices, Cp indices, C9 indices, sunspot number, and 10.7 cm flux. The most often requested parameter of this file are the...
Energy Technology Data Exchange (ETDEWEB)
Mandal, Sudip; Chatterjee, Subhamoy; Banerjee, Dipankar, E-mail: sudip@iiap.res.in [Indian Institute of Astrophysics, Koramangala, Bangalore 560034 (India)
2017-02-01
Plages are the magnetically active chromospheric structures prominently visible in the Ca ii K line (3933.67 Å). A plage may or may not be associated with a sunspot, which is a magnetic structure visible in the solar photosphere. In this study we explore this aspect of association of plages with sunspots using the newly digitized Kodaikanal Ca ii K plage data and the Greenwich sunspot area data. Instead of using the plage index or fractional plage area and its comparison with the sunspot number, we use, to our knowledge for the first time, the individual plage areas and compare them with the sunspot area time series. Our analysis shows that these two structures, formed in two different layers, are highly correlated with each other on a timescale comparable to the solar cycle. The area and the latitudinal distributions of plages are also similar to those of sunspots. Different area thresholdings on the “butterfly diagram” reveal that plages of area ≥4 arcmin{sup 2} are mostly associated with a sunspot in the photosphere. Apart from this, we found that the cyclic properties change when plages of different sizes are considered separately. These results may help us to better understand the generation and evolution of the magnetic structures in different layers of the solar atmosphere.
Galilei, Galileo; Reeves, Eileen; Helden, Albert van
2010-01-01
Galileo's telescopic discoveries, and especially his observation of sunspots, caused great debate in an age when the heavens were thought to be perfect and unchanging. Christoph Scheiner, a Jesuit mathematician, argued that sunspots were planets or moons crossing in front of the Sun. Galileo, on the other hand, countered that the spots were on or near the surface of the Sun itself, and he supported his position with a series of meticulous observations and mathematical demonstrations that eventually convinced even his rival. On Sunspots collects the correspondenc
Iwahashi Zenbei's Sunspot Drawings in 1793 in Japan
Hayakawa, Hisashi; Iwahashi, Kiyomi; Tamazawa, Harufumi; Toriumi, Shin; Shibata, Kazunari
2018-01-01
Three Japanese sunspot drawings associated with Iwahashi Zenbei (1756 - 1811) are shown here from contemporary manuscripts and woodprint documents with the relevant texts. We reveal the observational date of one of the drawings to be 26 August 1793, and the overall observations lasted for over a year. Moreover, we identify the observational site for the dated drawing as Fushimi in Japan. We then compare Zenbei's observations with the group sunspot number and the raw group count from the Sunspot Index and Long-term Solar Observations (SILSO) to reveal the context of the data, and we conclude that these drawings fill gaps in our understanding that are due to the fragmental sunspot observations around 1793. These drawings are important as a clue to evaluate astronomical knowledge of contemporary Japan in the late eighteenth century and are valuable as a non-European observation, considering that most sunspot observations up to the middle of the nineteenth century are from Europe.
32.1 Gbit/s InverseRZ-ASK-DQPSK modulation with low implementation penalty
DEFF Research Database (Denmark)
Tokle, Torger; Serbay, M.; Rosenkranz, W.
2006-01-01
32.1 Gbit/s InverseRZ-ASK-DQPSK is experimentally investigated using a new InverseRZ generation method. We demonstrate......32.1 Gbit/s InverseRZ-ASK-DQPSK is experimentally investigated using a new InverseRZ generation method. We demonstrate...
Chatzistergos, Theodosios; Usoskin, Ilya G.; Kovaltsov, Gennady A.; Krivova, Natalie A.; Solanki, Sami K.
2017-06-01
Context. The group sunspot number (GSN) series constitute the longest instrumental astronomical database providing information on solar activity. This database is a compilation of observations by many individual observers, and their inter-calibration has usually been performed using linear rescaling. There are multiple published series that show different long-term trends for solar activity. Aims: We aim at producing a GSN series, with a non-linear non-parametric calibration. The only underlying assumptions are that the differences between the various series are due to different acuity thresholds of the observers, and that the threshold of each observer remains constant throughout the observing period. Methods: We used a daisy chain process with backbone (BB) observers and calibrated all overlapping observers to them. We performed the calibration of each individual observer with a probability distribution function (PDF) matrix constructed considering all daily values for the overlapping period with the BB. The calibration of the BBs was carried out in a similar manner. The final series was constructed by merging different BB series. We modelled the propagation of errors straightforwardly with Monte Carlo simulations. A potential bias due to the selection of BBs was investigated and the effect was shown to lie within the 1σ interval of the produced series. The exact selection of the reference period was shown to have a rather small effect on our calibration as well. Results: The final series extends back to 1739 and includes data from 314 observers. This series suggests moderate activity during the 18th and 19th century, which is significantly lower than the high level of solar activity predicted by other recent reconstructions applying linear regressions. Conclusions: The new series provides a robust reconstruction, based on modern and non-parametric methods, of sunspot group numbers since 1739, and it confirms the existence of the modern grand maximum of solar
Is the Young Star RZ Piscium Consuming Its Own (Planetary) Offspring?
Punzi, K. M.; Kastner, J. H.; Melis, C.; Zuckerman, B.; Pilachowski, C.; Gingerich, L.; Knapp, T.
2018-01-01
The erratically variable star RZ Piscium (RZ Psc) displays extreme optical dropout events and strikingly large excess infrared emission. To ascertain the evolutionary status of this intriguing star, we obtained observations of RZ Psc with the European Space Agency’s X-ray Multi-Mirror Mission (XMM-Newton), as well as high-resolution optical spectroscopy with the Hamilton Echelle on the Lick Shane 3 m telescope and with HIRES on the Keck I 10 m telescope. The optical spectroscopy data demonstrate that RZ Psc is a pre-main sequence star with an effective temperature of 5600 ± 75 K and log g of 4.35 ± 0.10. The ratio of X-ray to bolometric luminosity, {log}{L}X/{L}{bol}, lies in the range ‑3.7 to ‑3.2, consistent with ratios typical of young, solar-mass stars, thereby providing strong support for the young star status of RZ Psc. The Li absorption line strength of RZ Psc suggests an age in the range 30–50 Myr, which in turn implies that RZ Psc lies at a distance of ∼170 pc. Adopting this estimated distance, we find the Galactic space velocity of RZ Psc to be similar to the space velocities of stars in young moving groups near the Sun. Optical spectral features indicative of activity and/or circumstellar material are present in our spectra over multiple epochs, which provide evidence for the presence of a significant mass of circumstellar gas associated with RZ Psc. We suggest that the destruction of one or more massive orbiting bodies has recently occurred within 1 au of the star, and we are viewing the aftermath of such an event along the plane of the orbiting debris.
Predicting Maximum Sunspot Number in Solar Cycle 24 Nipa J Bhatt ...
Indian Academy of Sciences (India)
Key words. Sunspot number—precursor prediction technique—geo- magnetic activity index aa. 1. Introduction. Predictions of solar and geomagnetic activities are important for various purposes, including the operation of low-earth orbiting satellites, operation of power grids on. Earth, and satellite communication systems.
RZ calculations for self shielded multigroup cross sections
Energy Technology Data Exchange (ETDEWEB)
Li, M.; Sanchez, R.; Zmijarevic, I.; Stankovski, Z. [Commissariat a l' Energie Atomique CEA, Direction de l' Energie Nucleaire, DEN/DM2S/SERMA/LENR, 91191 Gif-sur-Yvette Cedex (France)
2006-07-01
A collision probability method has been implemented for RZ geometries. The method accounts for white albedo, specular and translation boundary condition on the top and bottom surfaces of the geometry and for a white albedo condition on the outer radial surface. We have applied the RZ CP method to the calculation of multigroup self shielded cross sections for Gadolinia absorbers in BWRs. (authors)
RZ calculations for self shielded multigroup cross sections
International Nuclear Information System (INIS)
Li, M.; Sanchez, R.; Zmijarevic, I.; Stankovski, Z.
2006-01-01
A collision probability method has been implemented for RZ geometries. The method accounts for white albedo, specular and translation boundary condition on the top and bottom surfaces of the geometry and for a white albedo condition on the outer radial surface. We have applied the RZ CP method to the calculation of multigroup self shielded cross sections for Gadolinia absorbers in BWRs. (authors)
Long-term periodicities in the sunspot record
International Nuclear Information System (INIS)
Wilson, R.M.
1984-07-01
Sunspot records are systematically maintained, with the knowledge that an 11 year average period exists since about 1850. Thus, the sunspot record of highest quality and considered to be the most reliable is that of cycle eight through the present. On the basis of cycles 8 through 20, various combinations of sine curves were used to approximate the observed R sub MAX values (where R sub MAX is the smoothed sunspot number at cycle maximum). It is found that a three component sinusoidal function, having an 11 cycle and a 2 cycle variation on a 90 cycle periodicity, yields computed R sub MAX values which fit, reasonably well, observed R sub MAX values for the modern sunspot cycles. Extrapolation of the empirical functions forward in time allows for the projection of values of R sub MAX for cycles 21 and 22. For cycle 21, the function projects a value of 157.3, very close to the actually observed value of 164.5. For cycle 22, the function projects a value of about 107. Linear regressions applied to cycle 22 indicate a long-period cycle (cycle duration 132 months). An extensive bibliography on techniques used to estimate the time dependent behavior of sunspot cycles is provided
Nature's third cycle a story of sunspots
Choudhuri, Arnab Rai
2015-01-01
The cycle of day and night and the cycle of seasons are two familiar natural cycles around which many human activities are organized. But is there a third natural cycle of importance for us humans? On 13 March 1989, six million people in Canada went without electricity for many hours: a large explosion on the sun was discovered as the cause of this blackout. Such explosions occur above sunspots, dark features on the surface of the Sun that have been observed through telescopes since the time of Galileo. The number of sunspots has been found to wax and wane over a period of 11 years. Although this cycle was discovered less than two centuries ago, it is becoming increasingly important for us as human society becomes more dependent on technology. For nearly a century after its discovery, the cause of the sunspot cycle remained completely shrouded in mystery. The 1908 discovery of strong magnetic fields in sunspots made it clear that the 11-year cycle is the magnetic cycle of the sun. It is only during the last ...
International Nuclear Information System (INIS)
Priest, E.R.
1982-01-01
The existence of sunspots has been known since ancient times, but it was only at the beginning of this century that they were found to be the sites of very strong magnetic fields, and it was realised that they represent the places where huge magnetic flux tubes burst through the solar surface. A theoretical understanding of sunspots has had to await the development of magnetohydrodynamics; however, even now, there is some controversy about answers to fundamental questions, such as: why is a sunspot cool, what is its equilibrium structure and how is it formed. Other topics that are discussed in the present chapter include magnetoconvection and the process of magnetic buoyancy whereby a flux tube deep within the Sun tends to rise towards the surface because it is lighter than its surroundings. Outside active regions the magnetic flux is not spread out uniformly to a weak field of a few Gauss, but instead it is mainly concentrated at supergranulation boundaries into intense flux tubes, whose properties are discussed. (Auth.)
The visibility function and its effect on the observed characteristics of sunspot groups. 1
International Nuclear Information System (INIS)
Kopecky, M.; Kuklin, G.V.; Starkova, I.P.
1985-01-01
The paper is an introductory study to a series dealing with the visibility function, the function of foreshortening of sunspot group areas, and with the effect of these functions on the results of the statistical processing of observations, which has to be taken into account in interpreting the results. A ''diagram of observational conditions'' is described, which enables a number of statistical problems of sunspot groups on the rotating Sun to be solved by computer modelling or by graphical methods. Examples are given of the use of this diagram in studying the distribution of the observed lifetime of sunspot groups with a given actual lifetime, of the decrease in the number of sunspot groups towards the limb of the solar disc, of the east-west asymmetry of sunspot group appearance and disappearance. (author)
Coordination failure caused by sunspots
DEFF Research Database (Denmark)
Beugnot, Julie; Gürgüç, Zeynep; Øvlisen, Frederik Roose
2012-01-01
on the efficient equilibrium, we consider sunspots as a potential reason for coordination failure. We conduct an experiment with a three player 2x2x2 game in which coordination on the efficient equilibrium is easy and should normally occur. In the control session, we find almost perfect coordination on the payoff......-dominant equilibrium, but in the sunspot treatment, dis-coordination is frequent. Sunspots lead to significant inefficiency, and we conclude that sunspots can indeed cause coordination failure....
The use of solar faculae in studies of the sunspot cycle
International Nuclear Information System (INIS)
Brown, G.M.; Evans, R.
1980-01-01
Comparison of the long-term variation of photospheric faculae areas with that of sunspots shows that studies of faculae provide both complementary and supplementary information on the behaviour of the solar cycle. Detailed studies of the development of sunspots with respect to faculae show that there is a high degree of order over much of a given cycle, but marked differences from cycle to cycle. Within a cycle the relationship between spot and faculae areas appears to be similar for the N and S solar hemispheres, and over the early stages of a cycle it is directly related to the magnitude of the maximum sunspot number subsequently attained in that cycle. This result may well have predictive applications, and formulae are given relating the peak sunspot number to simple parameters derived from this early developmental stage. Full application to the current cycle 21 is denied due to the cessation of the Greenwich daily photoheliographic measurements, but use of the cruder weekly data suggests a maximum smoothed sunspot number of 150 +- 22. The effects of the incompatibility of the spot and faculae data, in that faculae are unobservable over a large fraction of the solar disc and also do not always develop associated spots, have been examined in a detailed study of two cycles and shown not to vitiate the results. (orig.)
Hunter, H. E.; Amato, R. A.
1972-01-01
The results are presented of the application of Avco Data Analysis and Prediction Techniques (ADAPT) to derivation of new algorithms for the prediction of future sunspot activity. The ADAPT derived algorithms show a factor of 2 to 3 reduction in the expected 2-sigma errors in the estimates of the 81-day running average of the Zurich sunspot numbers. The report presents: (1) the best estimates for sunspot cycles 20 and 21, (2) a comparison of the ADAPT performance with conventional techniques, and (3) specific approaches to further reduction in the errors of estimated sunspot activity and to recovery of earlier sunspot historical data. The ADAPT programs are used both to derive regression algorithm for prediction of the entire 11-year sunspot cycle from the preceding two cycles and to derive extrapolation algorithms for extrapolating a given sunspot cycle based on any available portion of the cycle.
Is sunspot activity a factor in influenza pandemics?
Qu, Jiangwen
2016-09-01
The 2009 AH1N1 pandemic became a global health concern, although fortunately, its worst anticipated effects were not realised. While the origins of such outbreaks remain poorly understood, it is very important to identify the precipitating factors in their emergence so that future pandemics can be detected as quickly as possible. Methords: Descriptive epidemiology was used to analyse the association between influenza pandemics and possible pandemics and relative number of sunspots. Non-conditional logistic regression was performed to analyse the statistical association between sunspot extremes and influenza pandemics to within plus or minus 1 year. Almost all recorded influenza/possible pandemics have occurred in time frames corresponding to sunspot extremes, or +/- 1 year within such extremes. These periods were identified as important risk factors in both possible and confirmed influenza pandemics (odds ratio: 3.87; 95% confidence interval: 1.08 to 13.85). Extremes of sunspot activity to within plus or minus 1 year may precipitate influenza pandemics. Mechanisms of epidemic initiation and early spread are discussed including primary causation by externally derived viral variants (from space via cometary dust). Efforts to construct a comprehensive early warning system for potential influenza and other viral pandemics that include analysis of sunspot activity and stratospheric sampling for viral variants should be supported. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.
Period of sunspot numbers is 11. 02653720 years (11 years 9 days 16 hours 18 minutes 0 seconds)
Energy Technology Data Exchange (ETDEWEB)
Norita, S [Miyazaki Univ. (Japan). Faculty of Engineering
1976-09-01
In the statistical analysis of time series there have been applied usually the stationary stochastic process or the Markov stochastic process and recently there are applied remarkably an autoregressive process, a stochastic difference equation, an autoregressive-moving average process, a moving average process, the Whittaker periodogram, the correlogram, Schuster periodogram, chi-squared periodogram, level crossings, harmonic process, difference method, spectral density and first order vector equation, but in special case it is desirable to apply the nonstationary stocastic process. In this paper we introduce a stationarity into the autoregressive process and then it is the first purpose to compute precisely the period of sunspot numbers. The result up to the eighth places at the decimal point was obtained that its period is 11.02653720 years, that is, 11 years 9 days 16 hours 18 minutes 0 seconds. This is considered to be more relevant than numerical values by which Schuster (1906) and Yule (1927) had calculated the respective 11.125 years and 10.60 years in the past. We revised the theoretical expression in the thesis of Anderson, Shaman, Lindgren, Brillinger, Newbold, Parzen, Kingman, Van Ness and Kenneth, etc. and executed the numerical analysis of period of sunspot numbers investigated now.
Period of sunspot numbers is 11.02653720 years (11 years 9 days 16 hours 18 minutes 0 seconds)
International Nuclear Information System (INIS)
Norita, Sadataka
1976-01-01
In the statistical analysis of time series there have been applied usually the stationary stochastic process or the Markov stochastic process and recently there are applied remarkably an autoregressive process, a stochastic difference equation, an autoregressive-moving average process, a moving average process, the Whittaker periodogram, the correlogram, Schuster periodogram, chi-squared periodogram, level crossings, harmonic process, difference method, spectral density and first order vector equation, but in special case it is desirable to apply the nonstationary stocastic process. In this paper we introduce an stationarity into the autoregressive process and then it is the first purpose to compute precisely period of sunspot numbers. The result up to the eighth places at the decimal point was obtained that its period is 11.02653720 years, that is, 11 years 9 days 16 hours 18 minutes 0 seconds. This is considered to be more relevant than numerical values by which Schuster (1906) and Yule (1927) had calculated the respective 11.125 years and 10.60 years in the past. We revised the theoretical expression in the thesis of Anderson, Shaman, Lindgren, Brillinger, Newbold, Parzen, Kingman, Van Ness and Kenneth, etc. and executed the numerical analysis of period of sunspot numbers investigated now. (auth.)
Energy Technology Data Exchange (ETDEWEB)
Haddoudi, I.; Sendi, Y.; Batnini, M.; Romdhane, S.B.; Mhadhbi, H.; Mrabet, M.
2017-07-01
A faba bean rhizospheric Pseudomonas aeruginosa isolate RZ9 was used for studying its antifungal activity and protecting effects of faba bean and common bean against the root pathogen Fusarium culmorum strain MZB47. The dual culture tests showed that RZ9 inhibits MZB47 in vitro growth by 56%. When mixing RZ9 cell suspension with MZB47 macroconidia at equal proportion, the macroconidia viability was reduced with 70%. Pathogenicity tests conducted in sterile conditions showed that MZB47 caused an intense root rotting in faba bean ‘Aquadulce’ plantlets and a slight level in common bean ‘Coco blanc’. This was associated to significant decreases in plant growth only in ‘Aquadulce’, reducing shoot dry weight (DW) by 82% and root DW by 70%. In soil samples, MZB47 caused severe root rotting and induced significant decreases in shoot DW (up to 51%) and root DW (up to 60%) for both beans. It was associated to a decrease in nodule number by 73% and 52% for faba bean and common bean, respectively. Biocontrol assays revealed that the inoculation of RZ9 to MZB47-treated plantlets enhanced shoot DWs (25% and 110%) and root DWs (29% and 67%), in faba bean and common bean, respectively. Moreover, root rotting levels decreased and nodule number increased in treated compared to untreated plantlets. Collected data highlighted the disease severity of F. culmorum and demonstrated the potential of using RZ9 in controlling Fusaria root diseases in beans. Thereby, the current study represents the first report on the biocontrol effectiveness of P. aeruginosa against F. culmorum in beans.
Directory of Open Access Journals (Sweden)
Imen Haddoudi
2017-07-01
Full Text Available A faba bean rhizospheric Pseudomonas aeruginosa isolate RZ9 was used for studying its antifungal activity and protecting effects of faba bean and common bean against the root pathogen Fusarium culmorum strain MZB47. The dual culture tests showed that RZ9 inhibits MZB47 in vitro growth by 56%. When mixing RZ9 cell suspension with MZB47 macroconidia at equal proportion, the macroconidia viability was reduced with 70%. Pathogenicity tests conducted in sterile conditions showed that MZB47 caused an intense root rotting in faba bean ‘Aquadulce’ plantlets and a slight level in common bean ‘Coco blanc’. This was associated to significant decreases in plant growth only in ‘Aquadulce’, reducing shoot dry weight (DW by 82% and root DW by 70%. In soil samples, MZB47 caused severe root rotting and induced significant decreases in shoot DW (up to 51% and root DW (up to 60% for both beans. It was associated to a decrease in nodule number by 73% and 52% for faba bean and common bean, respectively. Biocontrol assays revealed that the inoculation of RZ9 to MZB47-treated plantlets enhanced shoot DWs (25% and 110% and root DWs (29% and 67%, in faba bean and common bean, respectively. Moreover, root rotting levels decreased and nodule number increased in treated compared to untreated plantlets. Collected data highlighted the disease severity of F. culmorum and demonstrated the potential of using RZ9 in controlling Fusaria root diseases in beans. Thereby, the current study represents the first report on the biocontrol effectiveness of P. aeruginosa against F. culmorum in beans.
Diode laser heterodyne observations of silicon monoxide in sunspots - A test of three sunspot models
Glenar, D. A.; Deming, D.; Jennings, D. E.; Kostiuk, T.; Mumma, M. J.
1983-01-01
Absorption features from the 8 micron SiO fundamental (upsilon = 1-0) and hot bands (upsilon = 2-1) have been observed in sunspots at sub-Doppler resolution using a ground-based tunable diode laser heterodyne spectrometer. The observed line widths suggest an upper limit of 0.5 km/s for the microturbulent velocity in sunspot umbrae. Since the silicon monoxide abundance is very sensitive to sunspot temperature, the measured equivalent widths permit an unambiguous determination of the temperature-pressure relation in the upper layers of the umbral atmosphere. In the region of SiO line formation (log P sub g = 3.0-4.5), the results support the sunspot model suggested by Stellmacher and Wiehr (1970).
Planetary tides during the Maunder sunspot minimum
International Nuclear Information System (INIS)
Smythe, C.M.; Eddy, J.A.
1977-01-01
Sun-centered planetary conjunctions and tidal potentials are here constructed for the AD1645 to 1715 period of sunspot absence, referred to as the 'Maunder Minimum'. These are found to be effectively indistinguishable from patterns of conjunctions and power spectra of tidal potential in the present era of a well established 11 year sunspot cycle. This places a new and difficult restraint on any tidal theory of sunspot formation. Problems arise in any direct gravitational theory due to the apparently insufficient forces and tidal heights involved. Proponents of the tidal hypothesis usually revert to trigger mechanisms, which are difficult to criticise or test by observation. Any tidal theory rests on the evidence of continued sunspot periodicity and the substantiation of a prolonged period of solar anomaly in the historical past. The 'Maunder Minimum' was the most drastic change in the behaviour of solar activity in the last 300 years; sunspots virtually disappeared for a 70 year period and the 11 year cycle was probably absent. During that time, however, the nine planets were all in their orbits, and planetary conjunctions and tidal potentials were indistinguishable from those of the present era, in which the 11 year cycle is well established. This provides good evidence against the tidal theory. The pattern of planetary tidal forces during the Maunder Minimum was reconstructed to investigate the possibility that the multiple planet forces somehow fortuitously cancelled at the time, that is that the positions of the slower moving planets in the 17th and early 18th centuries were such that conjunctions and tidal potentials were at the time reduced in number and force. There was no striking dissimilarity between the time of the Maunder Minimum and any period investigated. The failure of planetary conjunction patterns to reflect the drastic drop in sunspots during the Maunder Minimum casts doubt on the tidal theory of solar activity, but a more quantitative test
Bit-rate-transparent optical RZ-to-NRZ format conversion based on linear spectral phase filtering
DEFF Research Database (Denmark)
Maram, Reza; Da Ros, Francesco; Guan, Pengyu
2017-01-01
We propose a novel and strikingly simple design for all-optical bit-rate-transparent RZ-to-NRZ conversion based on optical phase filtering. The proposed concept is experimentally validated through format conversion of a 640 Gbit/s coherent RZ signal to NRZ signal.......We propose a novel and strikingly simple design for all-optical bit-rate-transparent RZ-to-NRZ conversion based on optical phase filtering. The proposed concept is experimentally validated through format conversion of a 640 Gbit/s coherent RZ signal to NRZ signal....
Long-term variations in the geomagnetic activity level Part II: Ascending phases of sunspot cycles
Directory of Open Access Journals (Sweden)
V. Mussino
1994-08-01
Full Text Available Monthly averages of the Helsinki Ak-values have been reduced to the equivalent aa-indices to extend the aa-data set back to 1844. A periodicity of about five cycles was found for the correlation coefficient (r between geomagnetic indices and sunspot numbers for the ascending phases of sunspot cycles 9 to 22, confirming previous findings based on a minor number of sunspot cycles. The result is useful to researchers in topics related to solar-terrestrial physics, particularly for the interpretation of long-term trends in geomagnetic activity during the past, and to forecast geomagnetic activity levels in the future.
Investigation of homodyne demodulation of RZ-BPSK signal based on an optical Costas loop
Zhou, Haijun; Zhu, Zunzhen; Xie, Weilin; Dong, Yi
2018-01-01
We demonstrate the coherent detection of 10 Gb/s return-to-zero (RZ) binary phase-shift keying (BPSK) signal based on a homodyne Costas optical phase-locked loop (OPLL). It demonstrates time misalignment tolerance of +/- 10% of the transmitted RZ-BPSK signal, i.e. -20 to +20 ps between the pulse carver and the phase modulator for 5 Gb/s RZ-BPSK signal, -10 to +10 ps or 10 Gb/s RZ-BPSK signal. Besides, the Costas coherent receiver shows a 2.5 dB sensitivity improvement over conventional 5 Gb/s NRZ-BPSK and a 1.4 dB over 10 Gb/s NRZ-BPSK only at the cost of slightly higher residual phase error. Those merits of sufficient tolerance to misalignment, higher receiver sensitivity, and low residual phase error of RZ-BPSK modulation are beneficial to be applied in free space optical (FSO) communication to achieve higher link budget, longer transmission distance.
Self-affinity and nonextensivity of sunspots
International Nuclear Information System (INIS)
Moret, M.A.
2014-01-01
In this paper we study the time series of sunspots by using two different approaches, analyzing its self-affine behavior and studying its distribution. The long-range correlation exponent α has been calculated via Detrended Fluctuation Analysis and the power law vanishes to values greater than 11 years. On the other hand, the distribution of the sunspots obeys a q-exponential decay that suggests a non-extensive behavior. This observed characteristic seems to take an alternative interpretation of the sunspots dynamics. The present findings suggest us to propose a dynamic model of sunspots formation based on a nonlinear Fokker–Planck equation. Therefore its dynamic process follows the generalized thermostatistical formalism.
Tracking the Magnetic Flux in and Around Sunspots
Energy Technology Data Exchange (ETDEWEB)
Sheeley, N. R. Jr.; Stauffer, J. R.; Thomassie, J. C.; Warren, H. P., E-mail: solsheeley@verizon.net, E-mail: harry.warren@nrl.navy.mil [Space Science Division, Naval Research Laboratory, Washington, DC 20375-5352 (United States)
2017-02-10
We have developed a procedure for tracking sunspots observed by the Helioseismic and Magnetic Imager on the Solar Dynamics Observatory and for making curvature-corrected space/time maps of the associated line-of-sight magnetic field and continuum intensity. We apply this procedure to 36 sunspots, each observed continuously for nine days around its central meridian passage time, and find that the proper motions separate into two distinct components depending on their speeds. Fast (∼3–5 km s{sup −1}) motions, comparable to Evershed flows, are produced by weak vertical fluctuations of the horizontal canopy field and recur on a timescale of 12–20 min. Slow (∼0.3–0.5 km s{sup −1}) motions diverge from a sunspot-centered ring whose location depends on the size of the sunspot, occurring in the mid-penumbra for large sunspots and at the outer edge of the penumbra for small sunspots. The slow ingoing features are contracting spokes of a quasi-vertical field of umbral polarity. These inflows disappear when the sunspot loses its penumbra, and may be related to inward-moving penumbral grain. The slow outgoing features may have either polarity depending on whether they originate from quasi-vertical fields of umbral polarity or from the outer edge of the canopy. When a sunspot decays, the penumbra and canopy disappear, and the moat becomes filled with slow outflows of umbral polarity. We apply our procedure to decaying sunspots, to long-lived sunspots, and to numerical simulations of a long-lived sunspot by Rempel.
Statistics of the largest sunspot and facular areas per solar cycle
International Nuclear Information System (INIS)
Willis, D.M.; Kabasakal Tulunay, Y.
1979-01-01
The statistics of extreme values is used to investigate the statistical properties of the largest areas sunspots and photospheric faculae per solar cycle. The largest values of the synodic-solar-rotation mean areas of umbrae, whole spots and faculae, which have been recorded for nine solar cycles, are each shown to comply with the general form of the extreme value probability function. Empirical expressions are derived for the three extreme value populations from which the characteristic statistical parameters, namely the mode, median, mean and standard deviation, can be calculated for each population. These three extreme value populations are also used to find the expected ranges of the extreme areas in a group of solar cycles as a function of the number of cycles in the group. The extreme areas of umbrae and whole spots have a dispersion comparable to that found by Siscoe for the extreme values of sunspot number, whereas the extreme areas of faculae have a smaller dispersion which is comparable to that found by Siscoe for the largest geomagnetic storm per solar cycle. The expected range of the largest sunspot area per solar cycle for a group of one hundred cycles appears to be inconsistent with the existence of the prolonged periods of sunspot minima that have been inferred from the historical information on solar variability. This inconsistency supports the contention that there are temporal changes of solar-cycle statistics during protracted periods of sunspot minima (or maxima). Indeed, without such temporal changes, photospheric faculae should have been continually observable throughout the lifetime of the Sun. (orig.)
Probing sunspots with two-skip time-distance helioseismology
Duvall, Thomas L., Jr.; Cally, Paul S.; Przybylski, Damien; Nagashima, Kaori; Gizon, Laurent
2018-06-01
Context. Previous helioseismology of sunspots has been sensitive to both the structural and magnetic aspects of sunspot structure. Aims: We aim to develop a technique that is insensitive to the magnetic component so the two aspects can be more readily separated. Methods: We study waves reflected almost vertically from the underside of a sunspot. Time-distance helioseismology was used to measure travel times for the waves. Ray theory and a detailed sunspot model were used to calculate travel times for comparison. Results: It is shown that these large distance waves are insensitive to the magnetic field in the sunspot. The largest travel time differences for any solar phenomena are observed. Conclusions: With sufficient modeling effort, these should lead to better understanding of sunspot structure.
640 Gbit/s RZ-to-NRZ format conversion based on optical phase filtering
DEFF Research Database (Denmark)
Maram, Reza; Kong, Deming; Galili, Michael
2014-01-01
We propose a novel approach for all optical RZ-to-NRZ conversion based on optical phase filtering. The proposed concept is experimentally validated through format conversion of a 640 Gbit/s coherent RZ signal to NRZ signal using a simple phase filter implemented by a commercial optical waveshaper....
HELIOSEISMOLOGY OF A REALISTIC MAGNETOCONVECTIVE SUNSPOT SIMULATION
International Nuclear Information System (INIS)
Braun, D. C.; Birch, A. C.; Rempel, M.; Duvall, T. L. Jr.
2012-01-01
We compare helioseismic travel-time shifts measured from a realistic magnetoconvective sunspot simulation using both helioseismic holography and time-distance helioseismology, and measured from real sunspots observed with the Helioseismic and Magnetic Imager instrument on board the Solar Dynamics Observatory and the Michelson Doppler Imager instrument on board the Solar and Heliospheric Observatory. We find remarkable similarities in the travel-time shifts measured between the methodologies applied and between the simulated and real sunspots. Forward modeling of the travel-time shifts using either Born or ray approximation kernels and the sound-speed perturbations present in the simulation indicates major disagreements with the measured travel-time shifts. These findings do not substantially change with the application of a correction for the reduction of wave amplitudes in the simulated and real sunspots. Overall, our findings demonstrate the need for new methods for inferring the subsurface structure of sunspots through helioseismic inversions.
Sunspot activity and influenza pandemics: a statistical assessment of the purported association.
Towers, S
2017-10-01
Since 1978, a series of papers in the literature have claimed to find a significant association between sunspot activity and the timing of influenza pandemics. This paper examines these analyses, and attempts to recreate the three most recent statistical analyses by Ertel (1994), Tapping et al. (2001), and Yeung (2006), which all have purported to find a significant relationship between sunspot numbers and pandemic influenza. As will be discussed, each analysis had errors in the data. In addition, in each analysis arbitrary selections or assumptions were also made, and the authors did not assess the robustness of their analyses to changes in those arbitrary assumptions. Varying the arbitrary assumptions to other, equally valid, assumptions negates the claims of significance. Indeed, an arbitrary selection made in one of the analyses appears to have resulted in almost maximal apparent significance; changing it only slightly yields a null result. This analysis applies statistically rigorous methodology to examine the purported sunspot/pandemic link, using more statistically powerful un-binned analysis methods, rather than relying on arbitrarily binned data. The analyses are repeated using both the Wolf and Group sunspot numbers. In all cases, no statistically significant evidence of any association was found. However, while the focus in this particular analysis was on the purported relationship of influenza pandemics to sunspot activity, the faults found in the past analyses are common pitfalls; inattention to analysis reproducibility and robustness assessment are common problems in the sciences, that are unfortunately not noted often enough in review.
Sunspot Positions and Areas from Observations by Galileo Galilei
Vokhmyanin, M. V.; Zolotova, N. V.
2018-02-01
Sunspot records in the seventeenth century provide important information on the solar activity before the Maunder minimum, yielding reliable sunspot indices and the solar butterfly diagram. Galilei's letters to Cardinal Francesco Barberini and Marcus Welser contain daily solar observations on 3 - 11 May, 2 June - 8 July, and 19 - 21 August 1612. These historical archives do not provide the time of observation, which results in uncertainty in the sunspot coordinates. To obtain them, we present a method that minimizes the discrepancy between the sunspot latitudes. We provide areas and heliographic coordinates of 82 sunspot groups. In contrast to Sheiner's butterfly diagram, we found only one sunspot group near the Equator. This provides a higher reliability of Galilei's drawings. Large sunspot groups are found to emerge at the same longitude in the northern hemisphere from 3 May to 21 August, which indicates an active longitude.
Amplitude regeneration of RZ-DPSK signals in single-pump fiber-optic parametric amplifiers
DEFF Research Database (Denmark)
Peucheret, Christophe; Lorenzen, Michael Rodas; Seoane, Jorge
2009-01-01
to demonstrate amplitude regeneration of a distorted RZ-DPSK signal in a gain-saturated FOPA. An optical signal-to-noise ratio penalty of 3.5 dB after amplitude distortion is shown to be reduced to 0.2 dB after the FOPA, thus clearly demonstrating the regenerative nature of saturated FOPAs for RZ-DPSK modulation....
Oscillations and Waves in Sunspots
Directory of Open Access Journals (Sweden)
Elena Khomenko
2015-11-01
Full Text Available A magnetic field modifies the properties of waves in a complex way. Significant advances have been made recently in our understanding of the physics of sunspot waves with the help of high-resolution observations, analytical theories, as well as numerical simulations. We review the current ideas in the field, providing the most coherent picture of sunspot oscillations as by present understanding.
The sunspot databases of the Debrecen Observatory
Baranyi, Tünde; Gyori, Lajos; Ludmány, András
2015-08-01
We present the sunspot data bases and online tools available in the Debrecen Heliophysical Observatory: the DPD (Debrecen Photoheliographic Data, 1974 -), the SDD (SOHO/MDI-Debrecen Data, 1996-2010), the HMIDD (SDO/HMI-Debrecen Data, HMIDD, 2010-), the revised version of Greenwich Photoheliographic Data (GPR, 1874-1976) presented together with the Hungarian Historical Solar Drawings (HHSD, 1872-1919). These are the most detailed and reliable documentations of the sunspot activity in the relevant time intervals. They are very useful for studying sunspot group evolution on various time scales from hours to weeks. Time-dependent differences between the available long-term sunspot databases are investigated and cross-calibration factors are determined between them. This work has received funding from the European Community's Seventh Framework Programme (FP7/2012-2015) under grant agreement No. 284461 (eHEROES).
The Strongest Magnetic Field in Sunspots
Okamoto, J.; Sakurai, T.
2017-12-01
Sunspots are concentrations of magnetic fields on the solar surface. Generally, the strongest magnetic field in each sunspot is located in the dark umbra in most cases. A typical field strength in sunspots is around 3,000 G. On the other hand, some exceptions also have been found in complex sunspots with bright regions such as light bridges that separate opposite polarity umbrae, for instance with a strength of 4,300 G. However, the formation mechanism of such strong fields outside umbrae is still puzzling. Here we report an extremely strong magnetic field in a sunspot, which was located in a bright region sandwiched by two opposite-polarity umbrae. The strength is 6,250 G, which is the largest ever observed since the discovery of magnetic field on the Sun in 1908 by Hale. We obtained 31 scanned maps of the active region observed by Hinode/SOT/SP with a cadence of 3 hours over 5 days (February 1-6, 2014). Considering the spatial and temporal evolution of the vector magnetic field and the Doppler velocity in the bright region, we suggested that this strong field region was generated as a result of compression of one umbra pushed by the outward flow from the other umbra (Evershed flow), like the subduction of the Earth's crust in plate tectonics.
Solar rotation and meridional motions derived from sunspot groups
International Nuclear Information System (INIS)
Tuominen, J.; Tuominen, I.; Kyroelaeinen, J.
1982-01-01
Latitudinal and longitudinal motions of sunspot groups have been studied using the positions of recurrent sunspot groups of 103 years published by Greenwich observatory. In order to avoid any limb effects, only positions close to the central meridian have been used. The data were divided into two parts: those belonging to the years around sunspot maxima and those belonging to the years around sunspot minima. Using several different criteria it was ascertained that sunspot groups show meridional motions and that their drift curves as a function of latitude are different around maxima and around minima. In addition, also the angular velocity, as a function of latitude, was found to be different around maxima and minima. (Auth.)
Sunspot Modeling: From Simplified Models to Radiative MHD Simulations
Directory of Open Access Journals (Sweden)
Rolf Schlichenmaier
2011-09-01
Full Text Available We review our current understanding of sunspots from the scales of their fine structure to their large scale (global structure including the processes of their formation and decay. Recently, sunspot models have undergone a dramatic change. In the past, several aspects of sunspot structure have been addressed by static MHD models with parametrized energy transport. Models of sunspot fine structure have been relying heavily on strong assumptions about flow and field geometry (e.g., flux-tubes, "gaps", convective rolls, which were motivated in part by the observed filamentary structure of penumbrae or the necessity of explaining the substantial energy transport required to maintain the penumbral brightness. However, none of these models could self-consistently explain all aspects of penumbral structure (energy transport, filamentation, Evershed flow. In recent years, 3D radiative MHD simulations have been advanced dramatically to the point at which models of complete sunspots with sufficient resolution to capture sunspot fine structure are feasible. Here overturning convection is the central element responsible for energy transport, filamentation leading to fine-structure and the driving of strong outflows. On the larger scale these models are also in the progress of addressing the subsurface structure of sunspots as well as sunspot formation. With this shift in modeling capabilities and the recent advances in high resolution observations, the future research will be guided by comparing observation and theory.
INTERFERENCE FRINGES OF SOLAR ACOUSTIC WAVES AROUND SUNSPOTS
Energy Technology Data Exchange (ETDEWEB)
Chou, Dean-Yi; Zhao Hui; Yang, Ming-Hsu; Liang, Zhi-Chao, E-mail: chou@phys.nthu.edu.tw [Physics Department, National Tsing Hua University, Hsinchu, Taiwan (China)
2012-10-20
Solar acoustic waves are scattered by a sunspot due to the interaction between the acoustic waves and the sunspot. The sunspot, excited by the incident wave, generates the scattered wave. The scattered wave is added to the incident wave to form the total wave around the sunspot. The interference fringes between the scattered wave and the incident wave are visible in the intensity of the total wave because the coherent time of the incident wave is of the order of a wave period. The strength of the interference fringes anti-correlates with the width of temporal spectra of the incident wave. The separation between neighboring fringes increases with the incident wavelength and the sunspot size. The strength of the fringes increases with the radial order n of the incident wave from n = 0 to n = 2, and then decreases from n = 2 to n = 5. The interference fringes play a role analogous to holograms in optics. This study suggests the feasibility of using the interference fringes to reconstruct the scattered wavefields of the sunspot, although the quality of the reconstructed wavefields is sensitive to the noise and errors in the interference fringes.
Visual Circular Analysis of 266 Years of Sunspot Counts.
Buelens, Bart
2016-06-01
Sunspots, colder areas that are visible as dark spots on the surface of the Sun, have been observed for centuries. Their number varies with a period of ∼11 years, a phenomenon closely related to the solar activity cycle. Recently, observation records dating back to 1749 have been reassessed, resulting in the release of a time series of sunspot numbers covering 266 years of observations. This series is analyzed using circular analysis to determine the periodicity of the occurrence of solar maxima. The circular analysis is combined with spiral graphs to provide a single visualization, simultaneously showing the periodicity of the series, the degree to which individual cycle lengths deviate from the average period, and differences in levels reached during the different maxima. This type of visualization of cyclic time series with varying cycle lengths in which significant events occur periodically is broadly applicable. It is aimed particularly at science communication, education, and public outreach.
Potato seed dressing with Pseudomonas aeruginosa strain RZ9 enhances yield and reduces black scurf
Directory of Open Access Journals (Sweden)
Moncef MRABET
2015-09-01
Full Text Available A rhizospheric strain RZ9 of Pseudomonas aeruginosa was assessed for in-vitro growth inhibition of Rhizoctonia solani and effectiveness to control black scurf on potatoes (Solanum tuberosum L. of the cultivars Spunta and Nicola, in greenhouse and field experiments. The strain RZ9 inhibited R. solani mycelial growth by more than 60% and completely inhibited the germination of sclerotia from infested potato tubers in in-vitro tests. In greenhouse assays, seed potato treatment with RZ9 cell suspension increased stem length, decreased the relative weight of infected potato tubers (by 67%, and increased the potato yield (by 16% compared to pathogen-inoculated plants for both potato cultivars. In field trials conducted on sandy soils during 2012 and 2013, strain RZ9 reduced black scurf incidence and increased potato yield by an average of 5.3 t ha-1 for ′Spunta′ and 5 t ha-1 for ′Nicola′. This study showed that the selected strain of P. aeruginosa is an efficient bacterium for enhancing yield and reducing black scurf of field-grown potatoes.
Wings of the butterfly: Sunspot groups for 1826-2015
Leussu, R.; Usoskin, I. G.; Senthamizh Pavai, V.; Diercke, A.; Arlt, R.; Denker, C.; Mursula, K.
2017-03-01
The spatio-temporal evolution of sunspot activity, the so-called Maunder butterfly diagram, has been continously available since 1874 using data from the Royal Greenwich Observatory, extended by SOON network data after 1976. Here we present a new extended butterfly diagram of sunspot group occurrence since 1826, using the recently digitized data from Schwabe (1826-1867) and Spörer (1866-1880). The wings of the diagram are separated using a recently developed method based on an analysis of long gaps in sunspot group occurrence in different latitude bands. We define characteristic latitudes, corresponding to the start, end, and the largest extent of the wings (the F, L, and H latitudes). The H latitudes (30°-45°) are highly significantly correlated with the strength of the wings (quantified by the total sum of the monthly numbers of sunspot groups). The F latitudes (20°-30°) depict a weak tendency, especially in the southern hemisphere, to follow the wing strength. The L latitudes (2°-10°) show no clear relation to the wing strength. Overall, stronger cycle wings tend to start at higher latitudes and have a greater wing extent. A strong (5-6)-cycle periodic oscillation is found in the start and end times of the wings and in the overlap and gaps between successive wings of one hemisphere. While the average wing overlap is zero in the southern hemisphere, it is two to three months in the north. A marginally significant oscillation of about ten solar cycles is found in the asymmetry of the L latitudes. The new long database of butterfly wings provides new observational constraints to solar dynamo models that discuss the spatio-temporal distribution of sunspot occurrence over the solar cycle and longer. Digital data for Fig. 1 are available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/599/A131
HELIOSEISMIC HOLOGRAPHY OF SIMULATED SUNSPOTS: MAGNETIC AND THERMAL CONTRIBUTIONS TO TRAVEL TIMES
Energy Technology Data Exchange (ETDEWEB)
Felipe, T. [Departamento de Astrofísica, Universidad de La Laguna, E-38205 La Laguna, Tenerife (Spain); Braun, D. C.; Crouch, A. D. [NorthWest Research Associates, Colorado Research Associates, Boulder, CO 80301 (United States); Birch, A. C., E-mail: tobias@iac.es [Max-Planck-Institut für Sonnensystemforschung, Justus-von-Liebig-Weg 3, D-37077 Göttingen (Germany)
2016-10-01
Wave propagation through sunspots involves conversion between waves of acoustic and magnetic character. In addition, the thermal structure of sunspots is very different than that of the quiet Sun. As a consequence, the interpretation of local helioseismic measurements of sunspots has long been a challenge. With the aim of understanding these measurements, we carry out numerical simulations of wave propagation through sunspots. Helioseismic holography measurements made from the resulting simulated wavefields show qualitative agreement with observations of real sunspots. We use additional numerical experiments to determine, separately, the influence of the thermal structure of the sunspot and the direct effect of the sunspot magnetic field. We use the ray approximation to show that the travel-time shifts in the thermal (non-magnetic) sunspot model are primarily produced by changes in the wave path due to the Wilson depression rather than variations in the wave speed. This shows that inversions for the subsurface structure of sunspots must account for local changes in the density. In some ranges of horizontal phase speed and frequency there is agreement (within the noise level in the simulations) between the travel times measured in the full magnetic sunspot model and the thermal model. If this conclusion proves to be robust for a wide range of models, it would suggest a path toward inversions for sunspot structure.
HELIOSEISMIC HOLOGRAPHY OF SIMULATED SUNSPOTS: MAGNETIC AND THERMAL CONTRIBUTIONS TO TRAVEL TIMES
International Nuclear Information System (INIS)
Felipe, T.; Braun, D. C.; Crouch, A. D.; Birch, A. C.
2016-01-01
Wave propagation through sunspots involves conversion between waves of acoustic and magnetic character. In addition, the thermal structure of sunspots is very different than that of the quiet Sun. As a consequence, the interpretation of local helioseismic measurements of sunspots has long been a challenge. With the aim of understanding these measurements, we carry out numerical simulations of wave propagation through sunspots. Helioseismic holography measurements made from the resulting simulated wavefields show qualitative agreement with observations of real sunspots. We use additional numerical experiments to determine, separately, the influence of the thermal structure of the sunspot and the direct effect of the sunspot magnetic field. We use the ray approximation to show that the travel-time shifts in the thermal (non-magnetic) sunspot model are primarily produced by changes in the wave path due to the Wilson depression rather than variations in the wave speed. This shows that inversions for the subsurface structure of sunspots must account for local changes in the density. In some ranges of horizontal phase speed and frequency there is agreement (within the noise level in the simulations) between the travel times measured in the full magnetic sunspot model and the thermal model. If this conclusion proves to be robust for a wide range of models, it would suggest a path toward inversions for sunspot structure.
Schatten, K. H.; Hedin, A. E.
1986-01-01
Using the dynamo theory method to predict solar activity, a value for the smoothed sunspot number of 109 + or - 20 is obtained for solar cycle 22. The predicted cycle is expected to peak near December, 1990 + or - 1 year. Concommitantly, F(10.7) radio flux is expected to reach a smoothed value of 158 + or - 18 flux units. Global mean exospheric temperature is expected to reach 1060 + or - 50 K and global total average total thermospheric density at 400 km is expected to reach 4.3 x 10 to the -15th gm/cu cm + or - 25 percent.
Schatten, K. H.; Hedin, A. E.
1984-01-01
Using the 'dynamo theory' method to predict solar activity, a value for the smoothed sunspot number of 109 + or - 20 is obtained for solar cycle 22. The predicted cycle is expected to peak near December, 1990 + or - 1 year. Concommitantly, F(10.7) radio flux is expected to reach a smoothed value of 158 + or - 18 flux units. Global mean exospheric temperature is expected to reach 1060 + or - 50 K and global total average total thermospheric density at 400 km is expected to reach 4.3 x 10 to the -15th gm/cu cm + or - 25 percent.
Efimenko, V. M.; Lozitsky, V. G.
2018-06-01
We analyze the Greenwich catalog data on areas of sunspot groups of last thirteen solar cycles. Various parameters of sunspots are considered, namely: average monthly smoothed areas, maximum area for each year and equivalent diameters of groups of sunspots. The first parameter shows an exceptional power of the 19th cycle of solar activity, which appears here more contrastively than in the numbers of spots (that is, in Wolf's numbers). It was found that in the maximum areas of sunspot groups for a year there is a unique phenomenon: a short and high jump in the 18th cycle (in 1946-1947) that has no analogues in other cycles. We also studied the integral distributions for equivalent diameters and found the following: (a) the average value of the index of power-law approximation is 5.4 for the last 13 cycles and (b) there is reliable evidence of Hale's double cycle (about 44 years). Since this indicator reflects the dispersion of sunspot group diameters, the results obtained show that the convective zone of the Sun generates embryos of active regions in different statistical regimes which change with a cycle of about 44 years.
Absorption of acoustic waves by sunspots. II - Resonance absorption in axisymmetric fibril models
Rosenthal, C. S.
1992-01-01
Analytical calculations of acoustic waves scattered by sunspots which concentrate on the absorption at the magnetohydrodynamic Alfven resonance are extended to the case of a flux-tube embedded in a uniform atmosphere. The model is based on a flux-tubes of varying radius that are highly structured, translationally invariant, and axisymmetric. The absorbed fractional energy is determined for different flux-densities and subphotospheric locations with attention given to the effects of twist. When the flux is highly concentrated into annuli efficient absorption is possible even when the mean magnetic flux density is low. The model demonstrates low absorption at low azimuthal orders even in the presence of twist which generally increases the range of wave numbers over which efficient absorption can occur. Resonance absorption is concluded to be an efficient mechanism in monolithic sunspots, fibril sunspots, and plage fields.
Lin, Gong-Ru; Chang, Yung-Cheng; Yu, Kun-Chieh
2006-09-01
By injecting the optical NRZ data into a Fabry-Perot laser diode (FPLD) synchronously modulated at below threshold condition or a semiconductor optical amplifier (SOA) gain-depleted with a backward injected clock stream, the all-optical non-return to zero (NRZ) to return-to-zero (RZ) format conversion of a STM-64 date-stream for synchronous digital hierarchy (SDH) or an OC-192 data stream for synchronous optical network (SONET) in high-speed fiber-optic communication link can be performed. Without the assistance of any complicated RF electronic circuitry, the output RZ data-stream at bit rate of up to 10 Gbit/s is successfully transformed in the optically NRZ injection-locked FPLD, in which the incoming NRZ data induces gain-switching of the FPLD without DC driving current or at below threshold condition. A power penalty of 1.2 dB is measured after NRZ-to-RZ transformation in the FPLD. Alternatively, the all-optical 10Gbits/s NRZ-to-RZ format conversion can also be demonstrated in a semiconductor optical amplifier under a backward dark-optical-comb injection with its duty-cycle 70%, which is obtained by reshaping from the received data clock at 10 GHz. The incoming optical NRZ data-stream is transformed into a pulsed RZ data-stream with its duty-cycle, rms timing jitter, and conversion gain of 15%, 4ps, and 3dB, respectively. In contrast to the FPLD, the SOA based NRZ-to-RZ converter exhibits an enhanced extinction ratio from 7 to 13 dB, and BER of 10 -13 at -18.5 dBm. In particular, the power penalty of the received RZ data-stream has greatly improved by 5 dB as compared to that obtained from FPLD.
RE-EXAMINING SUNSPOT TILT ANGLE TO INCLUDE ANTI-HALE STATISTICS
Energy Technology Data Exchange (ETDEWEB)
McClintock, B. H. [University of Southern Queensland, Toowoomba, 4350 (Australia); Norton, A. A. [HEPL, Stanford University, Palo Alto, CA 94305 (United States); Li, J., E-mail: u1049686@umail.usq.edu.au, E-mail: aanorton@stanford.edu, E-mail: jli@igpp.ucla.edu [Department of Earth, Planetary, and Space Sciences, University of California at Los Angeles, Los Angeles, CA 90095 (United States)
2014-12-20
Sunspot groups and bipolar magnetic regions (BMRs) serve as an observational diagnostic of the solar cycle. We use Debrecen Photohelographic Data (DPD) from 1974-2014 that determined sunspot tilt angles from daily white light observations, and data provided by Li and Ulrich that determined sunspot magnetic tilt angle using Mount Wilson magnetograms from 1974-2012. The magnetograms allowed for BMR tilt angles that were anti-Hale in configuration, so tilt values ranged from 0 to 360° rather than the more common ±90°. We explore the visual representation of magnetic tilt angles on a traditional butterfly diagram by plotting the mean area-weighted latitude of umbral activity in each bipolar sunspot group, including tilt information. The large scatter of tilt angles over the course of a single cycle and hemisphere prevents Joy's law from being visually identified in the tilt-butterfly diagram without further binning. The average latitude of anti-Hale regions does not differ from the average latitude of all regions in both hemispheres. The distribution of anti-Hale sunspot tilt angles are broadly distributed between 0 and 360° with a weak preference for east-west alignment 180° from their expected Joy's law angle. The anti-Hale sunspots display a log-normal size distribution similar to that of all sunspots, indicating no preferred size for anti-Hale sunspots. We report that 8.4% ± 0.8% of all bipolar sunspot regions are misclassified as Hale in traditional catalogs. This percentage is slightly higher for groups within 5° of the equator due to the misalignment of the magnetic and heliographic equators.
RE-EXAMINING SUNSPOT TILT ANGLE TO INCLUDE ANTI-HALE STATISTICS
International Nuclear Information System (INIS)
McClintock, B. H.; Norton, A. A.; Li, J.
2014-01-01
Sunspot groups and bipolar magnetic regions (BMRs) serve as an observational diagnostic of the solar cycle. We use Debrecen Photohelographic Data (DPD) from 1974-2014 that determined sunspot tilt angles from daily white light observations, and data provided by Li and Ulrich that determined sunspot magnetic tilt angle using Mount Wilson magnetograms from 1974-2012. The magnetograms allowed for BMR tilt angles that were anti-Hale in configuration, so tilt values ranged from 0 to 360° rather than the more common ±90°. We explore the visual representation of magnetic tilt angles on a traditional butterfly diagram by plotting the mean area-weighted latitude of umbral activity in each bipolar sunspot group, including tilt information. The large scatter of tilt angles over the course of a single cycle and hemisphere prevents Joy's law from being visually identified in the tilt-butterfly diagram without further binning. The average latitude of anti-Hale regions does not differ from the average latitude of all regions in both hemispheres. The distribution of anti-Hale sunspot tilt angles are broadly distributed between 0 and 360° with a weak preference for east-west alignment 180° from their expected Joy's law angle. The anti-Hale sunspots display a log-normal size distribution similar to that of all sunspots, indicating no preferred size for anti-Hale sunspots. We report that 8.4% ± 0.8% of all bipolar sunspot regions are misclassified as Hale in traditional catalogs. This percentage is slightly higher for groups within 5° of the equator due to the misalignment of the magnetic and heliographic equators
Sunspots Resource--From Ancient Cultures to Modern Research
Craig, N.
2000-10-01
Sunspots is a web-based lesson that was developed by the Science Education Gateway (SEGway) program with participants from the Exploratorium, a well known science Museum in San Francisco, UC Berkeley Space Sciences Laboratory, and teachers from several California schools. This space science resource allows 8-12 grade students to explore the nature of sunspots and the history of solar physics in its effort to understand their nature. Interviews with solar physicists and archeo-astronomers, historic images, cutting-edge NASA images, movies, and research results, as well as a student-centered sunspot research activity using NASA space science data defines this lesson. The sunspot resource is aligned with the NCTM and National Science Education Standards. It emphasizes inquiry-based methods and mathematical exercises through measurement, graphic data representation, analysis of NASA data, lastly, interpreting results and drawing conclusions. These resources have been successfully classroom tested in 4 middle schools in the San Francisco Unified School District as part of the 3-week Summer School Science curricula. Lessons learned from the Summer School 1999 will be explained. This resource includes teacher-friendly lesson plans, space science background material and student worksheets. There will be Sunspots lesson CD-ROM and printed version of the relevant classroom-ready materials and a teacher resource booklet available. Sunspot resource is brought to you by, The Science Education Gateway - SEGway - Project, and the HESSI satellite and NASA's Office of Space Science Sun-Earth Connection Education Forum.
Froehlich, Claus; Pap, Judit M.; Hudson, Hugh S.
1994-06-01
The photometric sunspot index (PSI) was developed to study the effects of sunspots on solar irradiance. It is calculated from the sunspot data published in the Solar-Geophysical Data catalog. It has been shown that the former PSI models overestimate the effect of dark sunspots on solar irradiance; furthermore results of direct sunspot photometry indicate that the contrast of spots depends on their area. An improved PSI calculation is presented; it takes into account the area dependence of the contrast and calculates `true' daily means for each observation using the differential rotation of the spots. Moreover, the observations are screened for outliers which improves the homogeneity of the data set substantially, at least for the period after December 1981 when NOAA started to report data from a few instead of one to two stations. A detailed description of the method is provided. The correlation between the newly calculated PSI and total solar irradiance is studied for different phases of the solar cycles 21 and 22 using bi-variate spectral analysis. The results can be used as a `calibration' of PSI in terms of gain, the factor by which PSI has to be multiplied to yield the observed irradiance change. The factor changes with time from about 0.6 in 1980 to 1.1 in 1990. This unexpected result cannot be interpreted by a change of the contrast relative to the quiet Sun (as it is normally defined and determined by direct photometry) but rather as a change of the contrast between the spots and their surrounding as seen in total irradiance (integrated over the solar disk). This may partly be explained by a change in the ratio between the areas of the spots and the surrounding faculae.
Latitudinal migration of sunspots based on the ESAI database
Zhang, Juan; Li, Fu-Yu; Feng, Wen
2018-01-01
The latitudinal migration of sunspots toward the equator, which implies there is propagation of the toroidal magnetic flux wave at the base of the solar convection zone, is one of the crucial observational bases for the solar dynamo to generate a magnetic field by shearing of the pre-existing poloidal magnetic field through differential rotation. The Extended time series of Solar Activity Indices (ESAI) elongated the Greenwich observation record of sunspots by several decades in the past. In this study, ESAI’s yearly mean latitude of sunspots in the northern and southern hemispheres during the years 1854 to 1985 is utilized to statistically test whether hemispherical latitudinal migration of sunspots in a solar cycle is linear or nonlinear. It is found that a quadratic function is statistically significantly better at describing hemispherical latitudinal migration of sunspots in a solar cycle than a linear function. In addition, the latitude migration velocity of sunspots in a solar cycle decreases as the cycle progresses, providing a particular constraint for solar dynamo models. Indeed, the butterfly wing pattern with a faster latitudinal migration rate should present stronger solar activity with a shorter cycle period, and it is located at higher latitudinal position, giving evidence to support the Babcock-Leighton dynamo mechanism.
Empirical mode decomposition and long-range correlation analysis of sunspot time series
International Nuclear Information System (INIS)
Zhou, Yu; Leung, Yee
2010-01-01
Sunspots, which are the best known and most variable features of the solar surface, affect our planet in many ways. The number of sunspots during a period of time is highly variable and arouses strong research interest. When multifractal detrended fluctuation analysis (MF-DFA) is employed to study the fractal properties and long-range correlation of the sunspot series, some spurious crossover points might appear because of the periodic and quasi-periodic trends in the series. However many cycles of solar activities can be reflected by the sunspot time series. The 11-year cycle is perhaps the most famous cycle of the sunspot activity. These cycles pose problems for the investigation of the scaling behavior of sunspot time series. Using different methods to handle the 11-year cycle generally creates totally different results. Using MF-DFA, Movahed and co-workers employed Fourier truncation to deal with the 11-year cycle and found that the series is long-range anti-correlated with a Hurst exponent, H, of about 0.12. However, Hu and co-workers proposed an adaptive detrending method for the MF-DFA and discovered long-range correlation characterized by H≈0.74. In an attempt to get to the bottom of the problem in the present paper, empirical mode decomposition (EMD), a data-driven adaptive method, is applied to first extract the components with different dominant frequencies. MF-DFA is then employed to study the long-range correlation of the sunspot time series under the influence of these components. On removing the effects of these periods, the natural long-range correlation of the sunspot time series can be revealed. With the removal of the 11-year cycle, a crossover point located at around 60 months is discovered to be a reasonable point separating two different time scale ranges, H≈0.72 and H≈1.49. And on removing all cycles longer than 11 years, we have H≈0.69 and H≈0.28. The three cycle-removing methods—Fourier truncation, adaptive detrending and the
Role of the SRRz/Rz1 lambdoid lysis cassette in the pathoadaptive evolution of Shigella.
Leuzzi, Adriano; Grossi, Milena; Di Martino, Maria Letizia; Pasqua, Martina; Micheli, Gioacchino; Colonna, Bianca; Prosseda, Gianni
2017-06-01
Shigella, the etiological agent of bacillary dysentery (shigellosis), is a highly adapted human pathogen. It evolved from an innocuous ancestor resembling the Escherichia coli strain by gain and loss of genes and functions. While the gain process concerns the acquisition of the genetic determinants of virulence, the loss is related to the adaptation of the genome to the new pathogenic status and occurs by pathoadaptive mutation of antivirulence genes. In this study, we highlight that the SRRz/Rz 1 lambdoid lysis cassette, even though stably adopted in E. coli K12 by virtue of its beneficial effect on cell physiology, has undergone a significant decay in Shigella. Moreover, we show the antivirulence nature of the SRRz/Rz 1 lysis cassette in Shigella. In fact, by restoring the SRRz/Rz 1 expression in this pathogen, we observe an increased release of peptidoglycan fragments, causing an unbalance in the fine control exerted by Shigella on host innate immunity and a mitigation of its virulence. This strongly affects the virulence of Shigella and allows to consider the loss of SRRz/Rz 1 lysis cassette as another pathoadaptive event in the life of Shigella. Copyright © 2017 Elsevier GmbH. All rights reserved.
International Nuclear Information System (INIS)
Singleton, D.G.
1974-11-01
A recently proposed means of combining models of ionospheric F-layer peak electron density and irregularity incremental electron density (ΔN) so as to simulate the global occurrence probability of the frequency spreading component of spread-F is discussed. This procedure is then used to model experimental spread-F occurrence results. It is found possible to readily simulate the sunspot-maximum results, independently of season, with only small adjustments to the amplitudes of the empirical expressions used to ΔN in the several latitude regimes. However, at sunspot minimum and for each season, the ΔN model requires modification in the equatorial and mid-latitude regions of high irregularity incidence, before successful simulations of the spread-F data can be obtained. These modifications, which include a broadening of the equatorial region and a polewards shift to the mid-latitude region with decreasing sunspot number, are discussed in detail. It is concluded that the scintillation data base, from which the original ΔN model derives, is not sufficiently representative with regard to sunspot number and magnetic index. The use of the spread-F adaptation of the ΔN model, as well as its original scintillation version, to rectify these failings of the ΔN model are also discussed. (author)
A Standard Law for the Equatorward Drift of the Sunspot Zones
Hathaway, David H.
2012-01-01
The latitudinal location of the sunspot zones in each hemisphere is determined by calculating the centroid position of sunspot areas for each solar rotation from May 1874 to June 2012. When these centroid positions are plotted and analyzed as functions of time from each sunspot cycle maximum there appears to be systematic differences in the positions and equatorward drift rates as a function of sunspot cycle amplitude. If, instead, these centroid positions are plotted and analyzed as functions of time from each sunspot cycle minimum then most of the differences in the positions and equatorward drift rates disappear. The differences that remain disappear entirely if curve fitting is used to determine the starting times (which vary by as much as 8 months from the times of minima). The sunspot zone latitudes and equatorward drift measured relative to this starting time follow a standard path for all cycles with no dependence upon cycle strength or hemispheric dominance. Although Cycle 23 was peculiar in its length and the strength of the polar fields it produced, it too shows no significant variation from this standard. This standard law, and the lack of variation with sunspot cycle characteristics, is consistent with Dynamo Wave mechanisms but not consistent with current Flux Transport Dynamo models for the equatorward drift of the sunspot zones.
DEFF Research Database (Denmark)
Grüner-Nielsen, L.; Clausen, Anders; Oxenløwe, Leif Katsuo
2000-01-01
A tuneable RZ-pulsesource over the entire EDFA gain bandwidth is proposed. The pulses show good performance in a transmission-experiment over 160 km Standard Single Mode Fibre and multiplexing/demultiplexing experiments. Expandable to a multiple RZ pulsesource....
DEFF Research Database (Denmark)
Ding, Yunhong; Peucheret, Christophe; Pu, Minhao
2010-01-01
We comprehensively analyze multiple WDM channels RZ-to- NRZ format conversion using a single microring resonator. The scheme relies on simultaneous suppression of the first order harmonic components in the spectra of all the RZ channels. An optimized silicon microring resonator with free spectral...... range of 100 GHz and Q value of 7900 is designed and fabricated for this purpose. Multi-channel RZ-to-NRZ format conversion is demonstrated experimentally at 50 Gbit/s for WDM channels with 200 GHz channel spacing using the fabricated device. Bit error rate (BER)measurements show very good conversion...
COMPARISON OF CHAOTIC AND FRACTAL PROPERTIES OF POLAR FACULAE WITH SUNSPOT ACTIVITY
Energy Technology Data Exchange (ETDEWEB)
Deng, L. H.; Xiang, Y. Y.; Dun, G. T. [Yunnan Observatories, Chinese Academy of Sciences, Kunming 650216 (China); Li, B., E-mail: wooden@escience.cn [Shandong Provincial Key Laboratory of Optical Astronomy and Solar-Terrestrial Environment, School of Space Science and Physics, Shandong University at Weihai, Weihai 264209 (China)
2016-01-15
The solar magnetic activity is governed by a complex dynamo mechanism and exhibits a nonlinear dissipation behavior in nature. The chaotic and fractal properties of solar time series are of great importance to understanding the solar dynamo actions, especially with regard to the nonlinear dynamo theories. In the present work, several nonlinear analysis approaches are proposed to investigate the nonlinear dynamical behavior of the polar faculae and sunspot activity for the time interval from 1951 August to 1998 December. The following prominent results are found: (1) both the high- and the low-latitude solar activity are governed by a three-dimensional chaotic attractor, and the chaotic behavior of polar faculae is the most complex, followed by that of the sunspot areas, and then the sunspot numbers; (2) both the high- and low-latitude solar activity exhibit a high degree of persistent behavior, and their fractal nature is due to such long-range correlation; (3) the solar magnetic activity cycle is predictable in nature, but the high-accuracy prediction should only be done for short- to mid-term due to its intrinsically dynamical complexity. With the help of the Babcock–Leighton dynamo model, we suggest that the nonlinear coupling of the polar magnetic fields with strong active-region fields exhibits a complex manner, causing the statistical similarities and differences between the polar faculae and the sunspot-related indicators.
Photometric measurements of solar irradiance variations due to sunspots
International Nuclear Information System (INIS)
Chapman, G.A.; Herzog, A.D.; Laico, D.E.; Lawrence, J.K.; Templer, M.S.
1989-01-01
A photometric telescope constructed to obtain photometric sunspot areas and deficits on a daily basis is described. Data from this Cartesian full disk telescope (CFDT) are analyzed with attention given to the period between June 4 and June 17, 1985 because of the availability of overlapping sunspot area and irradiance deficit data from high-resolution digital spectroheliograms made with the San Fernando Observatory 28 cm vacuum solar telescope and spectroheliograph. The CFDT sunspot deficits suggest a substantial irradiance contribution from faculae and active region plage. 23 refs
The Flares Associated with the Dynamics of the Sunspots K. M. ...
Indian Academy of Sciences (India)
tional theory of magnetic reconnection is briefly discussed. ... between changes in the sunspots' dynamics, emerging flux region, twisting of the field ... the eventual triggering of the flares is due to proper motion of the sunspots. Using .... rotation rates obtained from the daily motion of sunspot groups with respect to their life.
Sunspot splitting triggering an eruptive flare
Louis, Rohan E.; Puschmann, Klaus G.; Kliem, Bernhard; Balthasar, Horst; Denker, Carsten
2014-02-01
Aims: We investigate how the splitting of the leading sunspot and associated flux emergence and cancellation in active region NOAA 11515 caused an eruptive M5.6 flare on 2012 July 2. Methods: Continuum intensity, line-of-sight magnetogram, and dopplergram data of the Helioseismic and Magnetic Imager were employed to analyse the photospheric evolution. Filtergrams in Hα and He I 10830 Å of the Chromospheric Telescope at the Observatorio del Teide, Tenerife, track the evolution of the flare. The corresponding coronal conditions were derived from 171 Å and 304 Å images of the Atmospheric Imaging Assembly. Local correlation tracking was utilized to determine shear flows. Results: Emerging flux formed a neutral line ahead of the leading sunspot and new satellite spots. The sunspot splitting caused a long-lasting flow towards this neutral line, where a filament formed. Further flux emergence, partly of mixed polarity, as well as episodes of flux cancellation occurred repeatedly at the neutral line. Following a nearby C-class precursor flare with signs of interaction with the filament, the filament erupted nearly simultaneously with the onset of the M5.6 flare and evolved into a coronal mass ejection. The sunspot stretched without forming a light bridge, splitting unusually fast (within about a day, complete ≈6 h after the eruption) in two nearly equal parts. The front part separated strongly from the active region to approach the neighbouring active region where all its coronal magnetic connections were rooted. It also rotated rapidly (by 4.9° h-1) and caused significant shear flows at its edge. Conclusions: The eruption resulted from a complex sequence of processes in the (sub-)photosphere and corona. The persistent flows towards the neutral line likely caused the formation of a flux rope that held the filament. These flows, their associated flux cancellation, the emerging flux, and the precursor flare all contributed to the destabilization of the flux rope. We
SEISMIC DISCRIMINATION OF THERMAL AND MAGNETIC ANOMALIES IN SUNSPOT UMBRAE
International Nuclear Information System (INIS)
Lindsey, C.; Cally, P. S.; Rempel, M.
2010-01-01
Efforts to model sunspots based on helioseismic signatures need to discriminate between the effects of (1) a strong magnetic field that introduces time-irreversible, vantage-dependent phase shifts, apparently connected to fast- and slow-mode coupling and wave absorption and (2) a thermal anomaly that includes cool gas extending an indefinite depth beneath the photosphere. Helioseismic observations of sunspots show travel times considerably reduced with respect to equivalent quiet-Sun signatures. Simulations by Moradi and Cally of waves skipping across sunspots with photospheric magnetic fields of order 3 kG show travel times that respond strongly to the magnetic field and relatively weakly to the thermal anomaly by itself. We note that waves propagating vertically in a vertical magnetic field are relatively insensitive to the magnetic field, while remaining highly responsive to the attendant thermal anomaly. Travel-time measurements for waves with large skip distances into the centers of axially symmetric sunspots are therefore a crucial resource for discrimination of the thermal anomaly beneath sunspot umbrae from the magnetic anomaly. One-dimensional models of sunspot umbrae based on compressible-radiative-magnetic-convective simulations such as by Rempel et al. can be fashioned to fit observed helioseismic travel-time spectra in the centers of sunspot umbrae. These models are based on cooling of the upper 2-4 Mm of the umbral subphotosphere with no significant anomaly beneath 4.5 Mm. The travel-time reductions characteristic of these models are primarily a consequence of a Wilson depression resulting from a strong downward buoyancy of the cooled umbral medium.
Wavelength conversion of 80 Gb/s RZ-DPSK Pol-MUX signals in a silicon nanowire
DEFF Research Database (Denmark)
Vukovic, Dragana; Peucheret, Christophe; Oxenløwe, Leif Katsuo
2014-01-01
All-optical wavelength conversion of 80 Gb/s RZ-DPSK polarization multiplexed signals is demonstrated in a silicon nanowire using an angled-pump scheme. The quality of the converted signal is characterized through BER measurements for the first time.......All-optical wavelength conversion of 80 Gb/s RZ-DPSK polarization multiplexed signals is demonstrated in a silicon nanowire using an angled-pump scheme. The quality of the converted signal is characterized through BER measurements for the first time....
All-Optical Wavelength Conversion of a High-Speed RZ-OOK Signal in a Silicon Nanowire
DEFF Research Database (Denmark)
Hu, Hao; Ji, Hua; Galili, Michael
2011-01-01
All-optical wavelength conversion of a 320 Gb/s line-rate RZ-OOK signal is demonstrated based on four-wave mixing in a 3.6 mm long silicon nanowire. Bit error rate measurements validate the performance within FEC limits.......All-optical wavelength conversion of a 320 Gb/s line-rate RZ-OOK signal is demonstrated based on four-wave mixing in a 3.6 mm long silicon nanowire. Bit error rate measurements validate the performance within FEC limits....
RZ-to-NRZ format conversion at 50 Gbit/s based on a silicon microring resonator
DEFF Research Database (Denmark)
Ding, Yunhong; Peucheret, Christophe; Pu, Minhao
2010-01-01
We demonstrate RZ-to-NRZ format conversion at 50 Gbit/s based on silicon microring resonator with FSR of 100 GHz. Bit error rate measurements show a low power penalty compared to electrical NRZ signal for error free operation.......We demonstrate RZ-to-NRZ format conversion at 50 Gbit/s based on silicon microring resonator with FSR of 100 GHz. Bit error rate measurements show a low power penalty compared to electrical NRZ signal for error free operation....
41.6 Gb/s RZ-DPSK to NRZ-DPSK Format Conversion in a Microring Resonator
DEFF Research Database (Denmark)
Xiong, Meng; Ozolins, Oskars; Ding, Yunhong
2012-01-01
RZ-DPSK to NRZ-DPSK format conversion in a silicon microring resonator is demonstrated experimentally for the first time at 41.6 Gb/s. The converted signal eye diagrams and bit-error-rate measurements show the good performance of the scheme........RZ-DPSK to NRZ-DPSK format conversion in a silicon microring resonator is demonstrated experimentally for the first time at 41.6 Gb/s. The converted signal eye diagrams and bit-error-rate measurements show the good performance of the scheme.....
Sunspot Oscillations From The Chromosphere To The Corona
Brynildsen, N.; Maltby, P.; Fredvik, T.; Kjeldseth-Moe, O.
The behavior of the 3 minute sunspot oscillations is studied as a function of temper- ature through the transition region using observations with CDS/SOHO and TRACE. The oscillations occur above the umbra, with amplitudes increasing to a maximum near 200 000 K, then decreasing towards higher temperatures. Deviations from pure linear oscillations are present in several cases. Power spectra of the oscillations are remarkably similar in the chromosphere and through the transition region in contra- diction to the predictions of the sunspot filter theory. The 3 minute oscillations pene- trate to the low temperature end of the corona, where they are channeled into smaller areas coinciding with the endpoints of sunspot coronal loops. This differs from the transition zone where the oscillating region covers the umbra.
Ma, Hai-Yan; Yang, Bo; Wang, Hong-Wei; Yang, Qi-Yin; Dai, Chuan-Chao
2016-01-15
Continuous cropping practices cause a severe decline in peanut yield. The aim of this study was to investigate the remediation effect of Serratia marcescens on continuously cropped peanut soil. A pot experiment was conducted under natural conditions to determine peanut agronomic indices, soil microorganism characteristics, soil enzyme activities and antagonism ability to typical pathogens at different growth stages. Four treatments were applied to red soil as follows: an active fermentation liquor of S. marcescens (RZ-21), an equivalent sterilized fermentation liquor (M), an equivalent fermentation medium (P) and distilled water (CK). S. marcescens significantly inhibited the two typical plant pathogens Fusarium oxysporum A1 and Ralstonia solanacearum B1 and reduced their populations in rhizosphere soil. The RZ-21 treatment significantly increased peanut yield, vine dry weight, root nodules and taproot length by 62.3, 33, 72 and 61.4% respectively, followed by the M treatment. The P treatment also increased root nodules and root length slightly. RZ-21 also enhanced the activities of soil urease, sucrase and hydrogen peroxidase at various stages. In addition, RZ-21 and M treatments increased the average population of soil bacteria and decreased the average population of fungi in the three critical peanut growth stages, except for M in the case of the fungal population at flowering, thus balancing the structure of the soil microorganism community. This is the first report of S. marcescens being applied to continuously cropped peanut soil. The results suggest that S. marcescens RZ-21 has the potential to improve the soil environment and agricultural products and thus allow the development of sustainable management practices. © 2015 Society of Chemical Industry.
Interactions between nested sunspots. 1: The formation and breakup of a delta-type sunspot
Gaizauskas, V.; Harvey, K. L.; Proulx, M.
1994-01-01
We investigate a nest of sunspots in which three ordinary bipolar pairs of sunspots are aligned collinearly. The usual spreading action of the growing regions brings two spots of leading polarity together (p-p collision) and forces the leading and trailing spots of the two interior regions to overlap inot a single penumbra (p-f collision), thus forming a delta-spot. We examine digitally processed images from the Ottawa River Solar Observatory of two related events inside the delta-spot 5 days after the p-f collision begins: the violent disruption of the f-umbra, and the formation in less than a day of an hydrogen-alpha filament. The evolutionary changes in shape, area, relative motions, and brightness that we measure for each spot in the elongated nest are more compatible with Parker's (1979a) hypothesis of a sunspot as a cluster of flux tubes held together by downdrafts than with the notion of a sunspot as a monolithic plug of magnetic flux. From chromospheric developments over the delta-spot, we show that a shearing motion along a polarity inversion is more effective than convergence for creating a chromospheric filament. We invoke the release of an instability, triggered by a sequence of processes lasting 1 day or more, to explain the disruption of the f-umbra in this delta-spot. We show that the sequence is initiated when the colliding p-f umbrae reach a critical separation around 3200 +/- 200 km. We present a descriptive model in which the reconnected magnetic fields block vertical transport of convective heat flux just beneath the photosphere. We observe the formation of an unusual type of penumbra adjacent to the f-polarity portion of this delta-spot just before its disruption. A tangential penumbral band grows out of disordered matter connected to the f-umbra. We present this as evidence for the extrusion of umbral magnetic flux by thermal plumes rising through a loosely bound umbra.
Nordemann, D. J. R.; Rigozo, N. R.; de Souza Echer, M. P.; Echer, E.
2008-11-01
We present here an implementation of a least squares iterative regression method applied to the sine functions embedded in the principal components extracted from geophysical time series. This method seems to represent a useful improvement for the non-stationary time series periodicity quantitative analysis. The principal components determination followed by the least squares iterative regression method was implemented in an algorithm written in the Scilab (2006) language. The main result of the method is to obtain the set of sine functions embedded in the series analyzed in decreasing order of significance, from the most important ones, likely to represent the physical processes involved in the generation of the series, to the less important ones that represent noise components. Taking into account the need of a deeper knowledge of the Sun's past history and its implication to global climate change, the method was applied to the Sunspot Number series (1750-2004). With the threshold and parameter values used here, the application of the method leads to a total of 441 explicit sine functions, among which 65 were considered as being significant and were used for a reconstruction that gave a normalized mean squared error of 0.146.
All-optical phase-preserving amplitude regeneration of a 640 Gbit/s RZ-DPSK signal
DEFF Research Database (Denmark)
Lali-Dastjerdi, Zohreh; Galili, Michael; Mulvad, Hans Christian Hansen
2013-01-01
Phase-preserving amplitude regeneration based on optical parametric amplification has been experimentally demonstrated for a 640 Gbit/s RZ-DPSK signal. Improvement of 2.2 dB in receiver sensitivity at a BER of 10-9 together with 13.3 dB net gain have been successfully achieved.......Phase-preserving amplitude regeneration based on optical parametric amplification has been experimentally demonstrated for a 640 Gbit/s RZ-DPSK signal. Improvement of 2.2 dB in receiver sensitivity at a BER of 10-9 together with 13.3 dB net gain have been successfully achieved....
Observational Evidence of a Flux Rope within a Sunspot Umbra
Energy Technology Data Exchange (ETDEWEB)
Guglielmino, Salvo L.; Zuccarello, Francesca [Dipartimento di Fisica e Astronomia—Sezione Astrofisica, Università di Catania, Via S. Sofia 78, I-95125 Catania (Italy); Romano, Paolo, E-mail: salvo.guglielmino@oact.inaf.it [INAF—Osservatorio Astrofisico di Catania, Via S. Sofia 78, I-95125 Catania (Italy)
2017-09-10
We observed an elongated filamentary bright structure inside the umbra of the big sunspot in active region NOAA 12529, which differs from the light bridges usually observed in sunspots for its morphology, magnetic configuration, and velocity field. We used observations taken with the Solar Dynamic Observatory satellite to characterize this feature. Its lifetime is 5 days, during which it reaches a maximum length of about 30″. In the maps of the vertical component of the photospheric magnetic field, a portion of the feature has a polarity opposite to that of the hosting sunspot. At the same time, in the entire feature the horizontal component of the magnetic field is about 2000 G, substantially stronger than in the surrounding penumbral filaments. Doppler velocity maps reveal the presence of both upward and downward plasma motions along the structure at the photospheric level. Moreover, looking at the chromospheric level, we noted that it is located in a region corresponding to the edge of a small filament that seems rooted in the sunspot umbra. Therefore, we interpreted the bright structure as the photospheric counterpart of a flux rope touching the sunspot and giving rise to penumbral-like filaments in the umbra.
Travaglini, Guido
2015-09-01
Solar activity, as measured by the yearly revisited time series of sunspot numbers (SSN) for the period 1700-2014 (Clette et al., 2014), undergoes in this paper a triple statistical and econometric checkup. The conclusions are that the SSN sequence: (1) is best modeled as a signal that features nonlinearity in mean and variance, long memory, mean reversion, 'threshold' symmetry, and stationarity; (2) is best described as a discrete damped harmonic oscillator which linearly approximates the flux-transport dynamo model; (3) its prediction well into the 22nd century testifies of a substantial fall of the SSN centered around the year 2030. In addition, the first and last Gleissberg cycles show almost the same peak number and height during the period considered, yet the former slightly prevails when measured by means of the estimated smoother. All of these conclusions are achieved by making use of modern tools developed in the field of Financial Econometrics and of two new proposed procedures for signal smoothing and prediction.
Solar Indices - Sunspot Numbers
National Oceanic and Atmospheric Administration, Department of Commerce — Collection includes a variety of indices related to solar activity contributed by a number of national and private solar observatories located worldwide. This...
The magnetic nature of umbra-penumbra boundary in sunspots
Jurčák, J.; Rezaei, R.; González, N. Bello; Schlichenmaier, R.; Vomlel, J.
2018-03-01
Context. Sunspots are the longest-known manifestation of solar activity, and their magnetic nature has been known for more than a century. Despite this, the boundary between umbrae and penumbrae, the two fundamental sunspot regions, has hitherto been solely defined by an intensity threshold. Aim. Here, we aim at studying the magnetic nature of umbra-penumbra boundaries in sunspots of different sizes, morphologies, evolutionary stages, and phases of the solar cycle. Methods: We used a sample of 88 scans of the Hinode/SOT spectropolarimeter to infer the magnetic field properties in at the umbral boundaries. We defined these umbra-penumbra boundaries by an intensity threshold and performed a statistical analysis of the magnetic field properties on these boundaries. Results: We statistically prove that the umbra-penumbra boundary in stable sunspots is characterised by an invariant value of the vertical magnetic field component: the vertical component of the magnetic field strength does not depend on the umbra size, its morphology, and phase of the solar cycle. With the statistical Bayesian inference, we find that the strength of the vertical magnetic field component is, with a likelihood of 99%, in the range of 1849-1885 G with the most probable value of 1867 G. In contrast, the magnetic field strength and inclination averaged along individual boundaries are found to be dependent on the umbral size: the larger the umbra, the stronger and more horizontal the magnetic field at its boundary. Conclusions: The umbra and penumbra of sunspots are separated by a boundary that has hitherto been defined by an intensity threshold. We now unveil the empirical law of the magnetic nature of the umbra-penumbra boundary in stable sunspots: it is an invariant vertical component of the magnetic field.
The EUV Spectrum of Sunspot Plumes Observed by SUMER on ...
Indian Academy of Sciences (India)
tribpo
Abstract. We present results from sunspot observations obtained by. SUMER on SOHO. In sunspot plumes the EUV spectrum differs from the quiet Sun; continua are observed with different slopes and intensities; emission lines from molecular hydrogen and many unidentified species indicate unique plasma conditions ...
Synchronization and NRZ-to-RZ format conversion of 10 G Ethernet packet based on a time lens
DEFF Research Database (Denmark)
Hu, Hao; Laguardia Areal, Janaina; Palushani, Evarist
2010-01-01
10 G Ethernet packet with maximum frame size of 1518 bytes is synchronized to a global clock using a time lens. The 10 Gb/s NRZ signal is converted into RZ signal at the same time.......10 G Ethernet packet with maximum frame size of 1518 bytes is synchronized to a global clock using a time lens. The 10 Gb/s NRZ signal is converted into RZ signal at the same time....
TIME DISTRIBUTIONS OF LARGE AND SMALL SUNSPOT GROUPS OVER FOUR SOLAR CYCLES
International Nuclear Information System (INIS)
Kilcik, A.; Yurchyshyn, V. B.; Abramenko, V.; Goode, P. R.; Cao, W.; Ozguc, A.; Rozelot, J. P.
2011-01-01
Here we analyze solar activity by focusing on time variations of the number of sunspot groups (SGs) as a function of their modified Zurich class. We analyzed data for solar cycles 20-23 by using Rome (cycles 20 and 21) and Learmonth Solar Observatory (cycles 22 and 23) SG numbers. All SGs recorded during these time intervals were separated into two groups. The first group includes small SGs (A, B, C, H, and J classes by Zurich classification), and the second group consists of large SGs (D, E, F, and G classes). We then calculated small and large SG numbers from their daily mean numbers as observed on the solar disk during a given month. We report that the time variations of small and large SG numbers are asymmetric except for solar cycle 22. In general, large SG numbers appear to reach their maximum in the middle of the solar cycle (phases 0.45-0.5), while the international sunspot numbers and the small SG numbers generally peak much earlier (solar cycle phases 0.29-0.35). Moreover, the 10.7 cm solar radio flux, the facular area, and the maximum coronal mass ejection speed show better agreement with the large SG numbers than they do with the small SG numbers. Our results suggest that the large SG numbers are more likely to shed light on solar activity and its geophysical implications. Our findings may also influence our understanding of long-term variations of the total solar irradiance, which is thought to be an important factor in the Sun-Earth climate relationship.
A new look at sunspot formation using theory and observations
Losada, I. R.; Warnecke, J.; Glogowski, K.; Roth, M.; Brandenburg, A.; Kleeorin, N.; Rogachevskii, I.
2017-10-01
Sunspots are of basic interest in the study of the Sun. Their relevance ranges from them being an activity indicator of magnetic fields to being the place where coronal mass ejections and flares erupt. They are therefore also an important ingredient of space weather. Their formation, however, is still an unresolved problem in solar physics. Observations utilize just 2D surface information near the spot, but it is debatable how to infer deep structures and properties from local helioseismology. For a long time, it was believed that flux tubes rising from the bottom of the convection zone are the origin of the bipolar sunspot structure seen on the solar surface. However, this theory has been challenged, in particular recently by new surface observation, helioseismic inversions, and numerical models of convective dynamos. In this article we discuss another theoretical approach to the formation of sunspots: the negative effective magnetic pressure instability. This is a large-scale instability, in which the total (kinetic plus magnetic) turbulent pressure can be suppressed in the presence of a weak large-scale magnetic field, leading to a converging downflow, which eventually concentrates the magnetic field within it. Numerical simulations of forced stratified turbulence have been able to produce strong super-equipartition flux concentrations, similar to sunspots at the solar surface. In this framework, sunspots would only form close to the surface due to the instability constraints on stratification and rotation. Additionally, we present some ideas from local helioseismology, where we plan to use the Hankel analysis to study the pre-emergence phase of a sunspot and to constrain its deep structure and formation mechanism.
Atwell, William; Tylka, Allan J.; Dietrich, William F.; Rojdev, Kristina; Matzkind, Courtney
2016-01-01
In an earlier paper presented at ICES in 2015, we investigated solar particle event (SPE) radiation exposures (absorbed dose) to small, thinly-shielded spacecraft during a period when the monthly smoothed sunspot number (SSN) was less than 30. Although such months are generally considered "solar-quiet", SPEs observed during these months even include Ground Level Events, the most energetic type of SPE. In this paper, we add to previous study those SPEs that occurred in 1973-2015 when the SSN was greater than 30 but less than 50. Based on the observable energy range of the solar protons, we classify the event as GLEs, sub-GLEs, and sub-sub-GLEs, all of which are potential contributors to the radiation hazard. We use the spectra of these events to construct a probabilistic model of the absorbed dose due to solar protons when SSN < 50 at various confidence levels for various depths of shielding and for various mission durations. We provide plots and tables of solar proton-induced absorbed dose as functions of confidence level, shielding thickness, and mission-duration that will be useful to system designers.
Towards a first detailed reconstruction of sunspot information over the last 150 years
Lefevre, Laure; Clette, Frédéric
2013-04-01
With four centuries of solar evolution, the International Sunspot Number (SSN) forms the longest solar time series currently available. It provides an essential reference for understanding and quantifying how the solar output has varied over decades and centuries and thus for assessing the variations of the main natural forcing on the Earth climate. For such a quantitative use, this unique time-series must be closely monitored for any possible biases and drifts. This is the main objective of the Sunspot Workshops organized jointly by the National Solar Observatory (NSO) and the Royal Observatory of Belgium (ROB) since 2010. Here, we will report about some recent outcomes of past workshops, like diagnostics of scaling errors and their proposed corrections, or the recent disagreement between the sunspot sumber and other solar indices like the 10.7cm radio flux. Our most recent analyses indicate that while part of this divergence may be due to a calibration drift in the SSN, it also results from an intrinsic change in the global magnetic parameters of sunspots and solar active regions, suggesting a possible transition to a new activity regime. Going beyond the SSN series, in the framework of the SOTERIA, TOSCA and SOLID projects, we produced a survey of all existing catalogs providing detailed sunspot information and we also located different primary solar images and drawing collections that can be exploitable to complement the existing catalogs (COMESEP project). These are first steps towards the construction of a multi-parametric time series of multiple sunspot group properties over at least the last 150 years, allowing to reconstruct and extend the current 1-D SSN series. By bringing new spatial, morphological and evolutionary information, such a data set should bring major advances for the modeling of the solar dynamo and solar irradiance. We will present here the current status of this work. The catalog now extends over the last 3 cycles (Lefevre & Clette 2011
Directory of Open Access Journals (Sweden)
D. M. Willis
2005-03-01
Full Text Available Comprehensive catalogues of ancient sunspot and auroral observations from East Asia are used to identify possible intense historical geomagnetic storms in the interval 210 BC-AD 1918. There are about 270 entries in the sunspot catalogue and about 1150 entries in the auroral catalogue. Special databases have been constructed in which the scientific information in these two catalogues is placed in specified fields. For the purposes of this study, an historical geomagnetic storm is defined in terms of an auroral observation that is apparently associated with a particular sunspot observation, in the sense that the auroral observation occurred within several days of the sunspot observation. More precisely, a selection criterion is formulated for the automatic identification of such geomagnetic storms, using the oriental records stored in the sunspot and auroral databases. The selection criterion is based on specific assumptions about the duration of sunspot visibility with the unaided eye, the likely range of heliographic longitudes of an energetic solar feature, and the likely range of transit times for ejected solar plasma to travel from the Sun to the Earth. This selection criterion results in the identification of nineteen putative historical geomagnetic storms, although two of these storms are spurious in the sense that there are two examples of a single sunspot observation being associated with two different auroral observations separated by more than half a (synodic solar rotation period. The literary and scientific reliabilities of the East Asian sunspot and auroral records that define the nineteen historical geomagnetic storms are discussed in detail in a set of appendices. A possible time sequence of events is presented for each geomagnetic storm, including possible dates for both the central meridian passage of the sunspot and the occurrence of the energetic solar feature, as well as likely transit times for the ejected solar plasma
International Nuclear Information System (INIS)
Markova, E.
1978-01-01
The relation between the flare activity of active regions within the scope of a large complex and the magnetic gradients of these active regions and their daily variations is investigated in the interval of the exceptionally high flare activity occurring in June 1970. New indices, characterizing the active region, were defined, e.g., the instantaneous sunspot-area density and the instantaneous sunspot-number density. These indices were determined on the basis of measurements of the surface containing all sunspots of the complex of active regions enclosed by an envelope. An attempt was made to substitute the surface in the relation for the individual indices by distance. The daily variations of these indices were again compared with the flare activity and some mutual relations were derived. (author)
Investigation of Quasi-periodic Solar Oscillations in Sunspots Based on SOHO/MDI Magnetograms
Kallunki, J.; Riehokainen, A.
2012-10-01
In this work we study quasi-periodic solar oscillations in sunspots, based on the variation of the amplitude of the magnetic field strength and the variation of the sunspot area. We investigate long-period oscillations between three minutes and ten hours. The magnetic field synoptic maps were obtained from the SOHO/MDI. Wavelet (Morlet), global wavelet spectrum (GWS) and fast Fourier transform (FFT) methods are used in the periodicity analysis at the 95 % significance level. Additionally, the quiet Sun area (QSA) signal and an instrumental effect are discussed. We find several oscillation periods in the sunspots above the 95 % significance level: 3 - 5, 10 - 23, 220 - 240, 340 and 470 minutes, and we also find common oscillation periods (10 - 23 minutes) between the sunspot area variation and that of the magnetic field strength. We discuss possible mechanisms for the obtained results, based on the existing models for sunspot oscillations.
Photoelectric observations of propagating sunspot oscillations
International Nuclear Information System (INIS)
Lites, B.W.; White, O.R.; Packman, D.
1982-01-01
The Sacramento Park Observatory Vacuum Tower Telescope and diode array were used to make repeated intensity and velocity images of a large, isolated sunspot in both a chromospheric (lambda8542 Ca II) and a photospheric (lambda5576 Fe I) line. The movie of the digital data for the chromospheric line shows clearly a relationship between the propagating umbral disturbances and the running penumbral waves. The velocities for transverse propagating of the umbral and penumbral disturbances are 60--70 km s -1 and 20--35 km s -1 , respectively. Power spectra of the oscillations show a sharp peak at a period of about 170 s in both the velocity and intensity signals. The rms velocity fluctuation of this power peak is 0.26 km s -1 . The oscillations at any given point in the sunspot are very regular, and the phase relationship between the velocity and intensity of the chromospheric oscillations is radically different than that for the quiet Sun. Our preliminary interpretation of the phase relationship involves acoustic waves with wave vector directed downwards along the magnetic field lines; however, this interpretation relies on assumptions involved in the data reduction scheme. The mechanical energy flux carried by the observed umbral disturbances does not appear to be a significant contributor to the overall energy budget of the sunspot or the surrounding active region
On the chromospheric network structure around deVeloped groups of sunspots
International Nuclear Information System (INIS)
Kartashova, L.G.
1980-01-01
The chromospheric network structure around several developed groups of sunspots were studied on the basis of the observations in the Hsub(α) line. The resolution on the filtergrams was of 2. The following was found: 1) in the neighbourhood of the groups of sunspots 70% (from 870) of network cells stretch along fibrils direction (with accuracy 30 deg), and 15% of cells stretch approximately across that (at angles 70-90 deg); 2) out of the boundary of the main radial fibrils structure the groups of sunspots is often rounded by the system of network cells stretched approximately perpendicular to radial direction
The photospheric vector magnetic field of a sunspot and its vertical gradient
Hagyard, M. J.; West, E. A.; Tandberg-Hanssen, E.; Smith, J. E.; Henze, W., Jr.; Beckers, J. M.; Bruner, E. C.; Hyder, C. L.; Gurman, J. B.; Shine, R. A.
1981-01-01
The results of direct comparisons of photospheric and transition region line-of-sight field observations of sunspots using the SMM UV spectrometer and polarimeter are reported. The analysis accompanying the data is concentrated on demonstrating that the sunspot concentrated magnetic field extends into the transition region. An observation of a sunspot on Oct. 23, 1980 at the S 18 E 03 location is used as an example. Maximum field strengths ranged from 2030-2240 gauss for large and small umbrae viewed and inclination of the field to the line-of-sight was determined for the photosphere and transition region. The distribution of the magnetic field over the sunspot and variation of the line-of-sight gradient are discussed, as are the magnitudes and gradients of the photospheric field across the penumbral-photospheric boundaries.
B and V photometry and analysis of the eclipsing binary RZ CAS
Riazi, N.; Bagheri, M. R.; Faghihi, F.
1994-01-01
Photoelectric light curves of the eclipsing binary RZ Cas are presented for B and V filters. The light curves are analyzed for light and geometrical elements, starting with a previously suggested preliminary method. The approximate results thus obtained are then optimised through the Wilson-Devinney computer programs.
ASYMMETRIC SUNSPOT ACTIVITY AND THE SOUTHWARD DISPLACEMENT OF THE HELIOSPHERIC CURRENT SHEET
International Nuclear Information System (INIS)
Wang, Y.-M.; Robbrecht, E.
2011-01-01
Observations of the interplanetary magnetic field (IMF) have suggested a statistical tendency for the heliospheric current sheet (HCS) to be shifted a few degrees southward of the heliographic equator during the period 1965-2010, particularly in the years near sunspot minimum. Using potential-field source-surface extrapolations and photospheric flux-transport simulations, we demonstrate that this southward displacement follows from Joy's law and the observed hemispheric asymmetry in the sunspot numbers, with activity being stronger in the southern (northern) hemisphere during the declining (rising) phase of cycles 20-23. The hemispheric asymmetry gives rise to an axisymmetric quadrupole field, whose equatorial zone has the sign of the leading-polarity flux in the dominant hemisphere; during the last four cycles, the polarity of the IMF around the equator thus tended to match that of the north polar field both before and after polar field reversal. However, large fluctuations are introduced by the nonaxisymmetric field components, which depend on the longitudinal distribution of sunspot activity in either hemisphere. Consistent with this model, the HCS showed an average northward displacement during cycle 19, when the 'usual' alternation was reversed and the northern hemisphere became far more active than the southern hemisphere during the declining phase of the cycle. We propose a new method for determining the north-south displacement of the HCS from coronal streamer observations.
DEFF Research Database (Denmark)
Fjelde, Tina; Wolfson, David; Kloch, Allan
2000-01-01
High-speed experiments show that the influence from the limited relaxation frequency of GC-SOAs that severely degrades the performance for NRZ signals is reduced by using RZ signals, thus resulting in a higher input power dynamic range.......High-speed experiments show that the influence from the limited relaxation frequency of GC-SOAs that severely degrades the performance for NRZ signals is reduced by using RZ signals, thus resulting in a higher input power dynamic range....
Vertical gradients of sunspot magnetic fields
Hagyard, M. J.; Teuber, D.; West, E. A.; Tandberg-Hanssen, E.; Henze, W., Jr.; Beckers, J. M.; Bruner, M.; Hyder, C. L.; Woodgate, B. E.
1983-01-01
The results of a Solar Maximum Mission (SMM) guest investigation to determine the vertical gradients of sunspot magnetic fields for the first time from coordinated observations of photospheric and transition-region fields are described. Descriptions are given of both the photospheric vector field of a sunspot, derived from observations using the NASA Marshall Space Flight Center vector magnetograph, and of the line-of-sight component in the transition region, obtained from the SMM Ultraviolet Spectrometer and Polarimeter instrument. On the basis of these data, vertical gradients of the line-of-sight magnetic field component are calculated using three methods. It is found that the vertical gradient of Bz is lower than values from previous studies and that the transition-region field occurs at a height of approximately 4000-6000 km above the photosphere.
Sunspot Equilibria in a Production Economy: Do Rational Animal Spirits Cause Overproduction?
Kajii, Atsushi
2008-01-01
We study a standard two period economy with one nominal bond and one firm. The input of the firm is done in the first period and financed with the nominal bond, and its profits are distributed to the shareholders in the second period. We show that a sunspot equilibrium exists around each efficient equilibrium. The interest rate is lower than optimal and there is over production in sunspot equilibria, under some conditions. But a sunspot equilibrium does not exist if the profit share can be tr...
8x40 Gb/s RZ all-optical broadcasting utilizing an electroabsorption modulator
DEFF Research Database (Denmark)
Xu, Lin; Chi, Nan; Yvind, Kresten
2004-01-01
We experimentally demonstrate all-optical broadcasting through simultaneous 8 × 40 Gb/s wavelength conversion in the RZ format based on cross absorption modulation in an electroabsorption modulator. The original intensity-modulated information is successfully duplicated onto eight wavelengths...
Prediction on sunspot activity based on fuzzy information granulation and support vector machine
Peng, Lingling; Yan, Haisheng; Yang, Zhigang
2018-04-01
In order to analyze the range of sunspots, a combined prediction method of forecasting the fluctuation range of sunspots based on fuzzy information granulation (FIG) and support vector machine (SVM) was put forward. Firstly, employing the FIG to granulate sample data and extract va)alid information of each window, namely the minimum value, the general average value and the maximum value of each window. Secondly, forecasting model is built respectively with SVM and then cross method is used to optimize these parameters. Finally, the fluctuation range of sunspots is forecasted with the optimized SVM model. Case study demonstrates that the model have high accuracy and can effectively predict the fluctuation of sunspots.
Corona magnetic field over sunspots estimated by m-wave observation
International Nuclear Information System (INIS)
Kurihara, Masahiro
1974-01-01
The shape of the magnetic field in corona was estimated from the observation of the type I storm occurred in the last decade of August, 1971. It was found from the observation with a 160 MHz interferometer at Mt. Nobeyama that at most three storm sources, which are called radio wave source, were produced. The radio wave sources were fixed above sunspots. The height of the radio wave sources was estimated to be 0.45 R from the photosphere. The sunspots under the radio wave sources can be classified to four sub-groups. Weakening of the magnetic field on the photosphere was found from the reduction of the area of some sub-group. The relation between the activity of type I storm and the intensity of the magnetic field of sunspots is qualitatively suggested. It is considered that the radio wave sources and the sunspots were connected by common magnetic force lines. The probable magnetic field in corona was presumed and is shown in a figure. An interesting point is that the direction of magnetic force lines inclined by about 30 0 outward to the vertical line to the photosphere surface. (Kato, T.)
Willamo, T.; Usoskin, I. G.; Kovaltsov, G. A.
2018-04-01
The method of active-day fraction (ADF) was proposed recently to calibrate different solar observers to standard observational conditions. The result of the calibration may depend on the overall level of solar activity during the observational period. This dependency is studied quantitatively using data of the Royal Greenwich Observatory by formally calibrating synthetic pseudo-observers to the full reference dataset. It is shown that the sunspot group number is precisely estimated by the ADF method for periods of moderate activity, may be slightly underestimated by 0.5 - 1.5 groups ({≤} 10%) for strong and very strong activity, and is strongly overestimated by up to 2.5 groups ({≤} 30%) for weak-to-moderate activity. The ADF method becomes inapplicable for the periods of grand minima of activity. In general, the ADF method tends to overestimate the overall level of activity and to reduce the long-term trends.
SUNSPOT CYCLES IMPACTS ON TOURISM AND QUALITY OF LIFE
Directory of Open Access Journals (Sweden)
Tadeja Jere Jakulin
2017-09-01
Full Text Available We live under the influence of natural cycles caused by the rotation of our planet and its revolution around the sun. The nature of our nearest star is also subject to cyclical change. This article presents a study of a correlation between sunspot cycles and foreign tourists arrivals in Slovenia, based on historical data between sunspot cycles and sea salt production in Slovenia's Municipality of Piran during the Maunder Minimum period (1645-1715. The production of salt by the solar evaporation of brine in salt pans and tourist industry are seasonal economic activities that are affected by changes to the weather. The paper looks at sea salt production in Piran during a particular period in the past. The repetition of the sea salt production in the past is not possible. For this reason, the study uses mathematical tools and an additional case study, which analyses arrivals of foreign tourists to Slovenia over the past 65 years (1948-2012. The study has two purposes: to identify a linear correlation coefficient, which provides evidence of a correlation between arrivals of foreign tourists to Slovenia and sunspot cycles and to develop a causal loop diagram (CLD or so called qualitative model of a complex tourism system, which shows the interdependency of sunspot cycles, tourism system, and quality of life.
CHOLESK, Diffusion Calculation with 2-D Source in X-Y or R-Z Geometry
International Nuclear Information System (INIS)
1988-01-01
1 - Description of problem or function: Solution of the diffusion equation with source in two-dimensional geometries x-y or r-z. 2 - Method of solution: The finite-element method of Ritz-Galerkin is applied
Physical Properties of Umbral Dots Observed in Sunspots: A Hinode Observation
Yadav, Rahul; Mathew, Shibu K.
2018-04-01
Umbral dots (UDs) are small-scale bright features observed in the umbral part of sunspots and pores. It is well established that they are manifestations of magnetoconvection phenomena inside umbrae. We study the physical properties of UDs in different sunspots and their dependence on decay rate and filling factor. We have selected high-resolution, G-band continuum filtergrams of seven sunspots from Hinode to study their physical properties. We have also used Michelson Doppler Imager (MDI) continuum images to estimate the decay rate of selected sunspots. An identification and tracking algorithm was developed to identify the UDs in time sequences. The statistical analysis of UDs exhibits an averaged maximum intensity and effective diameter of 0.26 I_{QS} and 270 km. Furthermore, the lifetime, horizontal speed, trajectory length, and displacement length (birth-death distance) of UDs are 8.19 minutes, 0.5 km s-1, 284 km, and 155 km, respectively. We also find a positive correlation between intensity-diameter, intensity-lifetime, and diameter-lifetime of UDs. However, UD properties do not show any significant relation with the decay rate or filling factor.
On the structure of small sunspots
International Nuclear Information System (INIS)
Ringnes, T.S.
1984-01-01
The smallest and most short-lived sunspots are decribed differently at the observatories in Zuerich and Greenwich. These differences which seem to originate both from the observing procedure and from the definitions of penumbra and umbra adopted, are further discussed
International Nuclear Information System (INIS)
Shapoval, A.; Le Mouël, J.-L.; Courtillot, V.; Shnirman, M.
2015-01-01
The irregularity index λ is applied to the high-frequency content of daily sunspot numbers ISSN. This λ is a modification of the standard maximal Lyapunov exponent. It is computed here as a function of embedding dimension m, within four-year time windows centered at the maxima of Schwabe cycles. The λ(m) curves form separate clusters (pre-1923 and post-1933). This supports a regime transition and narrows its occurrence to cycle 16, preceding the growth of activity leading to the Modern Maximum. The two regimes are reproduced by a simple autoregressive process AR(1), with the mean of Poisson noise undergoing 11 yr modulation. The autocorrelation a of the process (linked to sunspot lifetime) is a ≈ 0.8 for 1850-1923 and ≈0.95 for 1933-2013. The AR(1) model suggests that groups of spots appear with a Poisson rate and disappear at a constant rate. We further applied the irregularity index to the daily sunspot group number series for the northern and southern hemispheres, provided by the Greenwich Royal Observatory (RGO), in order to study a possible desynchronization. Correlations between the north and south λ(m) curves vary quite strongly with time and indeed show desynchronization. This may reflect a slow change in the dimension of an underlying dynamical system. The ISSN and RGO series of group numbers do not imply an identical mechanism, but both uncover a regime change at a similar time. Computation of the irregularity index near the maximum of cycle 24 will help in checking whether yet another regime change is under way
SUNSPOT ROTATION AS A DRIVER OF MAJOR SOLAR ERUPTIONS IN THE NOAA ACTIVE REGION 12158
Energy Technology Data Exchange (ETDEWEB)
Vemareddy, P.; Ravindra, B. [Indian Institute of Astrophysics, Koramangala, Bangalore-560034 (India); Cheng, X., E-mail: vemareddy@iiap.res.in [School of Astronomy and Space Science, Nanjing University, Nanjing-210023 (China)
2016-09-20
We studied the development conditions of sigmoid structure under the influence of the magnetic non-potential characteristics of a rotating sunspot in the active region (AR) 12158. Vector magnetic field measurements from the Helioseismic Magnetic Imager and coronal EUV observations from the Atmospheric Imaging Assembly reveal that the erupting inverse-S sigmoid had roots at the location of the rotating sunspot. The sunspot rotates at a rate of 0°–5° h{sup −1} with increasing trend in the first half followed by a decrease. The time evolution of many non-potential parameters had a good correspondence with the sunspot rotation. The evolution of the AR magnetic structure is approximated by a time series of force-free equilibria. The non-linear force-free field magnetic structure around the sunspot manifests the observed sigmoid structure. Field lines from the sunspot periphery constitute the body of the sigmoid and those from the interior overlie the sigmoid, similar to a flux rope structure. While the sunspot was rotating, two major coronal mass ejection eruptions occurred in the AR. During the first (second) event, the coronal current concentrations were enhanced (degraded), consistent with the photospheric net vertical current; however, magnetic energy was released during both cases. The analysis results suggest that the magnetic connections of the sigmoid are driven by the slow motion of sunspot rotation, which transforms to a highly twisted flux rope structure in a dynamical scenario. Exceeding the critical twist in the flux rope probably leads to the loss of equilibrium, thus triggering the onset of the two eruptions.
Yiǧit, Erdal; Kilcik, Ali; Elias, Ana Georgina; Dönmez, Burçin; Ozguc, Atila; Yurchshyn, Vasyl; Rozelot, Jean-Pierre
2018-06-01
The long term solar activity dependencies of ionospheric F1 and F2 regions' critical frequencies (f0F1 and f0F2) are analyzed for the last four solar cycles (1976-2015). We show that the ionospheric F1 and F2 regions have different solar activity dependencies in terms of the sunspot group (SG) numbers: F1 region critical frequency (f0F1) peaks at the same time with the small SG numbers, while the f0F2 reaches its maximum at the same time with the large SG numbers, especially during the solar cycle 23. The observed differences in the sensitivity of ionospheric critical frequencies to sunspot group (SG) numbers provide a new insight into the solar activity effects on the ionosphere and space weather. While the F1 layer is influenced by the slow solar wind, which is largely associated with small SGs, the ionospheric F2 layer is more sensitive to Coronal Mass Ejections (CMEs) and fast solar winds, which are mainly produced by large SGs and coronal holes. The SG numbers maximize during of peak of the solar cycle and the number of coronal holes peaks during the sunspot declining phase. During solar minimum there are relatively less large SGs, hence reduced CME and flare activity. These results provide a new perspective for assessing how the different regions of the ionosphere respond to space weather effects.
Sunspots sketches during the solar eclipses of 9th January and 29th December of 1777 in Mexico
Domínguez-Castro, Fernando; Gallego, María Cruz; Vaquero, José Manuel
2017-06-01
Two sunspot observations recorded by the Mexican Felipe de Zúñiga y Ontiveros have been revealed from a manuscript. One sunspot group was recorded on 9th January 1777 and four sunspot groups on 29th December 1777. Both records were taken during the observation of solar eclipses from Mexico City and their description also included sketches of the solar disk with sunspots. The sunspot group corresponding to 9th January was also observed by Erasmus Lievog. The observation on 29th December 1777 is the only record corresponding to this date.
On two populations of sunspot groups
International Nuclear Information System (INIS)
Kuklin, G.V.
1980-01-01
The principal component method was applied studying the sunspot groups distribution in respect to the maximum area for the individual 11-year cycles 12 to 19 (Lopez Arroyo and Lahulla, 1974) and for the years 1900 to 1964 (Mandrykina, 1974). The existence of two populations of sunspot groups is confirmed. The variations of the importance parameter q, which determines the population shares, in the 80-, 22- and 11-year cycles are considered. The obtained maximal area distributions for populations I and II are approximated by linear combination of logarithmic-normal distributions, the subpopulations Ia, Ib, Ic by the most probable maximum areas of 22, 298 and 90 mvh, respectively, and the subpopulations IIa, IIb, IIc by the most probable maximal areas of 6, 142 and 754 mvh, respectively. The characteristic distinction between populations I and II is apparently the magnetic structure of the groups belonging to them (bipolar and unipolar ones). (author)
A Relationship Between the Solar Rotation and Activity Analysed by Tracing Sunspot Groups
Ruždjak, Domagoj; Brajša, Roman; Sudar, Davor; Skokić, Ivica; Poljančić Beljan, Ivana
2017-12-01
The sunspot position published in the data bases of the Greenwich Photoheliographic Results (GPR), the US Air Force Solar Optical Observing Network and National Oceanic and Atmospheric Administration (USAF/NOAA), and of the Debrecen Photoheliographic Data (DPD) in the period 1874 to 2016 were used to calculate yearly values of the solar differential-rotation parameters A and B. These differential-rotation parameters were compared with the solar-activity level. We found that the Sun rotates more differentially at the minimum than at the maximum of activity during the epoch 1977 - 2016. An inverse correlation between equatorial rotation and solar activity was found using the recently revised sunspot number. The secular decrease of the equatorial rotation rate that accompanies the increase in activity stopped in the last part of the twentieth century. It was noted that when a significant peak in equatorial rotation velocity is observed during activity minimum, the next maximum is weaker than the previous one.
International Nuclear Information System (INIS)
Zhao, Hui; Chou, Dean-Yi
2016-01-01
The solar acoustic waves are modified by the interaction with sunspots. The interaction can be treated as a scattering problem: an incident wave propagating toward a sunspot is scattered by the sunspot into different modes. The absorption cross section and scattering cross section are two important parameters in the scattering problem. In this study, we use the wavefunction of the scattered wave, measured with a deconvolution method, to compute the absorption cross section σ ab and the scattering cross section σ sc for the radial order n = 0–5 for two sunspots, NOAA 11084 and NOAA 11092. In the computation of the cross sections, the random noise and dissipation in the measured acoustic power are corrected. For both σ ab and σ sc , the value of NOAA 11092 is greater than that of NOAA 11084, but their overall n dependence is similar: decreasing with n . The ratio of σ ab of NOAA 11092 to that of NOAA 11084 approximately equals the ratio of sunspot radii for all n , while the ratio of σ sc of the two sunspots is greater than the ratio of sunspot radii and increases with n . This suggests that σ ab is approximately proportional to the sunspot radius, while the dependence of σ sc on radius is faster than the linear increase.
Energy Technology Data Exchange (ETDEWEB)
Zhao, Hui [National Astronomical Observatories, Chinese Academy of Sciences, Beijing, 200012 (China); Chou, Dean-Yi, E-mail: chou@phys.nthu.edu.tw [Physics Department, National Tsing Hua University, Hsinchu, Taiwan (China)
2016-05-01
The solar acoustic waves are modified by the interaction with sunspots. The interaction can be treated as a scattering problem: an incident wave propagating toward a sunspot is scattered by the sunspot into different modes. The absorption cross section and scattering cross section are two important parameters in the scattering problem. In this study, we use the wavefunction of the scattered wave, measured with a deconvolution method, to compute the absorption cross section σ {sub ab} and the scattering cross section σ {sub sc} for the radial order n = 0–5 for two sunspots, NOAA 11084 and NOAA 11092. In the computation of the cross sections, the random noise and dissipation in the measured acoustic power are corrected. For both σ {sub ab} and σ {sub sc}, the value of NOAA 11092 is greater than that of NOAA 11084, but their overall n dependence is similar: decreasing with n . The ratio of σ {sub ab} of NOAA 11092 to that of NOAA 11084 approximately equals the ratio of sunspot radii for all n , while the ratio of σ {sub sc} of the two sunspots is greater than the ratio of sunspot radii and increases with n . This suggests that σ {sub ab} is approximately proportional to the sunspot radius, while the dependence of σ {sub sc} on radius is faster than the linear increase.
International Nuclear Information System (INIS)
Liu, S; Fu, S; Tang, M; Shum, P; Liu, D
2013-01-01
We experimentally demonstrate simultaneous 4 × 10 Gb s −1 all-optical wavelength multicasting and non-return-to-zero (NRZ)-on-off-keying (OOK) to return-to-zero (RZ)-OOK format conversion with a tunable duty cycle using nonlinear polarization rotation in a semiconductor optical amplifier (SOA). The experimental results show that the duty cycle of four converted RZ-OOK signals can be tuned by adjusting the orientation of a polarizer placed at the SOA output. Four-channel NRZ-OOK-to-RZ-OOK conversion with a full width at half maximum of 33–67 ps can be simultaneously obtained with an extinction ratio over 10 dB. Moreover, it is experimentally verified that such a wavelength multicasting scheme with simultaneous NRZ-OOK-to-RZ-OOK conversion is insensitive to the wavelength of the input signal, indicating that such a scheme can be operated in the whole C-band with less than 0.18 dB power penalty at a bit error ratio level of 10 −9 . The device can facilitate the cross-connection between optical transmission networks employing different modulation formats. (paper)
Directory of Open Access Journals (Sweden)
Ozimek Teresa
2015-09-01
Full Text Available Badania prowadzono w trzech czyszczalniach hydrofi towych z powierzchniowym przepływem ścieków typu Lemna System, zbudowanych według projektu Lemna Corporation. Składają się one ze stawu napowietrzanego i stawu rzęsowego wyposażonego w system barier mających na celu równomierne rozmieszczenie roślin. Stawy poprzedzone są osadnikiem wstępnym. Według projektantów odpowiednia praca tych oczyszczalni związana jest z występowaniem rzęsy na powierzchni stawu rzęsowego. Badano efektywność oczyszczania ścieków komunalnych w trzech oczyszczalniach Lemna System usytuowanych w centralnej Polsce ze szczególnym uwzględnieniem roli stawu rzęsowego i samej rzęsy. Oczyszczalnie różniły się między sobą występowaniem rzęsy. W dwóch z nich (w Rakowie i Bąkowcu w trakcie całego okresu badań rzęsa nie występowała, natomiast w trzeciej (w Falęcinie Starym w okresie wegetacyjnym pokrywała do 90%.powierzchni stawu. Efektywność oczyszczanie ścieków nie różniła się w oczyszczalni z rzęsą i bez rzęsy. Rzęsa nie wpływała istotnie na efektywność oczyszczania ścieków. We wszystkich oczyszczalniach główną rolę w redukcji zanieczyszczeń odgrywał staw napowietrzany
Frequently Occurring Reconnection Jets from Sunspot Light Bridges
Tian, Hui; Yurchyshyn, Vasyl; Peter, Hardi; Solanki, Sami K.; Young, Peter R.; Ni, Lei; Cao, Wenda; Ji, Kaifan; Zhu, Yingjie; Zhang, Jingwen; Samanta, Tanmoy; Song, Yongliang; He, Jiansen; Wang, Linghua; Chen, Yajie
2018-02-01
Solid evidence of magnetic reconnection is rarely reported within sunspots, the darkest regions with the strongest magnetic fields and lowest temperatures in the solar atmosphere. Using the world’s largest solar telescope, the 1.6 m Goode Solar Telescope, we detect prevalent reconnection through frequently occurring fine-scale jets in the Hα line wings at light bridges, the bright lanes that may divide the dark sunspot core into multiple parts. Many jets have an inverted Y-shape, shown by models to be typical of reconnection in a unipolar field environment. Simultaneous spectral imaging data from the Interface Region Imaging Spectrograph show that the reconnection drives bidirectional flows up to 200 km s‑1, and that the weakly ionized plasma is heated by at least an order of magnitude up to ∼80,000 K. Such highly dynamic reconnection jets and efficient heating should be properly accounted for in future modeling efforts of sunspots. Our observations also reveal that the surge-like activity previously reported above light bridges in some chromospheric passbands such as the Hα core has two components: the ever-present short surges likely to be related to the upward leakage of magnetoacoustic waves from the photosphere, and the occasionally occurring long and fast surges that are obviously caused by the intermittent reconnection jets.
Energy Technology Data Exchange (ETDEWEB)
Przybylski, D.; Shelyag, S.; Cally, P. S. [Monash Center for Astrophysics, School of Mathematical Sciences, Monash University, Clayton, Victoria 3800 (Australia)
2015-07-01
We present a technique to construct a spectropolarimetrically accurate magnetohydrostatic model of a large-scale solar magnetic field concentration, mimicking a sunspot. Using the constructed model we perform a simulation of acoustic wave propagation, conversion, and absorption in the solar interior and photosphere with the sunspot embedded into it. With the 6173 Å magnetically sensitive photospheric absorption line of neutral iron, we calculate observable quantities such as continuum intensities, Doppler velocities, as well as the full Stokes vector for the simulation at various positions at the solar disk, and analyze the influence of non-locality of radiative transport in the solar photosphere on helioseismic measurements. Bisector shapes were used to perform multi-height observations. The differences in acoustic power at different heights within the line formation region at different positions at the solar disk were simulated and characterized. An increase in acoustic power in the simulated observations of the sunspot umbra away from the solar disk center was confirmed as the slow magnetoacoustic wave.
International Nuclear Information System (INIS)
Przybylski, D.; Shelyag, S.; Cally, P. S.
2015-01-01
We present a technique to construct a spectropolarimetrically accurate magnetohydrostatic model of a large-scale solar magnetic field concentration, mimicking a sunspot. Using the constructed model we perform a simulation of acoustic wave propagation, conversion, and absorption in the solar interior and photosphere with the sunspot embedded into it. With the 6173 Å magnetically sensitive photospheric absorption line of neutral iron, we calculate observable quantities such as continuum intensities, Doppler velocities, as well as the full Stokes vector for the simulation at various positions at the solar disk, and analyze the influence of non-locality of radiative transport in the solar photosphere on helioseismic measurements. Bisector shapes were used to perform multi-height observations. The differences in acoustic power at different heights within the line formation region at different positions at the solar disk were simulated and characterized. An increase in acoustic power in the simulated observations of the sunspot umbra away from the solar disk center was confirmed as the slow magnetoacoustic wave
International Nuclear Information System (INIS)
Matausek, M.V.; Milosevic, M.
1986-01-01
In the present paper a generalization is performed of a procedure to solve multigroup spherical harmonics equations, which has originally been proposed and developed for one-dimensional systems in cylindrical or spherical geometry, and later extended for a special case of a two-dimensional system in r-z geometry. The expressions are derived for the axial and the radial dependence of the group values of the neutron flux moments, in the P-3 approximation of the spherical harmonics method, in a cylindrically symmetrical system with an arbitrary number of material regions in both r- and z-directions. In the special case of an axially homogeneous system, these expressions reduce to the relations derived previously. (author)
General solution of the multigroup spherical harmonics equations in R-Z geometry
International Nuclear Information System (INIS)
Matausek, M.
1983-01-01
In the present paper the generalization is performed of the procedure to solve multigroup spherical harmonics equations, which has originally been proposed and developed foe one-dimensional systems in cylindrical or spherical geometry, and later extended for special case of a two-dimensional system in r-z geometry. The expressions are derived for the axial and the radial dependence of the group values of the neutron flux moments, in the P-3 approximation of the spherical harmonics method, in a cylindrically symmetrical system with an arbitrary number of material regions in both r and z directions. In the special case of an axially homogeneous system, these expressions reduce to the relations derived previously. The analysis is performed of the possibilities to satisfy the boundary conditions in the case when the system considered represents an elementary reactor lattice cell and in the case when the system represents a reactor as a whole. The computational effort is estimated for system of a given configuration. (author)
Sunspot variation and selected associated phenomena: a look at solar cycle 21 and beyond
International Nuclear Information System (INIS)
Wilson, R.M.
1982-02-01
Solar sunspot cycles 8 through 21 are reviewed. Mean time intervals are calculated for maximum to maximum, minimum to minimum, minimum to maximum, and maximum to minimum phases for cycles 8 through 20 and 8 through 21. Simple cosine functions with a period of 132 years are compared to, and found to be representative of, the variation of smoothed sunspot numbers at solar maximum and minimum. A comparison of cycles 20 and 21 is given, leading to a projection for activity levels during the Spacelab 2 era (tentatively, November 1984). A prediction is made for cycle 22. Major flares are observed to peak several months subsequent to the solar maximum during cycle 21 and to be at minimum level several months after the solar minimum. Additional remarks are given for flares, gradual rise and fall radio events and 2800 MHz radio emission. Certain solar activity parameters, especially as they relate to the near term Spacelab 2 time frame are estimated
Energy Technology Data Exchange (ETDEWEB)
Yurchyshyn, V.; Abramenko, V. [Big Bear Solar Observatory, New Jersey Institute of Technology, Big Bear City, CA 92314 (United States); Kilcik, A. [Department of Space Science and Technologies, Akdeniz University, 07058 Antalya (Turkey)
2015-01-10
We analyze sunspot oscillations using Interface Region Imaging Spectrograph (IRIS) slit-jaw and spectral data and narrow-band chromospheric images from the New Solar Telescope (NST) for the main sunspot in NOAA AR 11836. We report that the difference between the shock arrival times as measured by the Mg II k 2796.35 Å and Si IV 1393.76 Å line formation levels changes during the observed period, and peak-to-peak delays may range from 40 s to zero. The intensity of chromospheric shocks also displays long-term (about 20 min) variations. NST's high spatial resolution Hα data allowed us to conclude that, in this sunspot, umbral flashes (UFs) appeared in the form of narrow bright lanes stretched along the light bridges and around clusters of umbral bright points. The time series also suggested that UFs preferred to appear on the sunspot-center side of light bridges, which may indicate the existence of a compact sub-photospheric driver of sunspot oscillations. The sunspot's umbra as seen in the IRIS chromospheric and transition region data appears bright above the locations of light bridges and the areas where the dark umbra is dotted with clusters of umbral dots. Co-spatial and co-temporal data from the Atmospheric Imaging Assembly on board the Solar Dynamics Observatory showed that the same locations were associated with bright footpoints of coronal loops suggesting that the light bridges may play an important role in heating the coronal sunspot loops. Finally, the power spectra analysis showed that the intensity of chromospheric and transition region oscillations significantly vary across the umbra and with height, suggesting that umbral non-uniformities and the structure of sunspot magnetic fields may play a role in wave propagation and heating of umbral loops.
An essay on sunspots and solar flares
International Nuclear Information System (INIS)
Akasofu, S.-I.
1984-01-01
The presently prevailing theories of sunspots and solar flares rely on the hypothetical presence of magnetic flux tubes beneath the photosphere and the two subsequent hypotheses, their emergence above the photosphere and explosive magnetic reconnection, converting magnetic energy carried by the flux tubes for solar flare energy. In this paper, attention is paid to the fact that there are large-scale magnetic fields which divide the photosphere into positive and negative (line-of-sight) polarity regions and that they are likely to be more fundamental than sunspot fields, as emphasized most recently by McIntosh. A new phenomenological model of the sunspot pair formation is then constructed by considering an amplification process of these large-scale fields near their boundaries by shear flows, including localized vortex motions. The amplification results from a dynamo process associated with such vortex flows and the associated convergence flow in the large-scale fields. This dynamo process generates also some of the familiar ''force-free'' fields or the ''sheared'' magnetic fields in which the magnetic field-aligned currents are essential. Upward field-aligned currents generated by the dynamo process are carried by downward streaming electrons which are expected to be accelerated by an electric potential structure; a similar structure is responsible for accelerating auroral electrons in the magnetosphere. Depending on the magnetic field configuration and the shear flows, the current-carrying electrons precipitate into different geometrical patterns, causing circular flares, umbral flares, two-ribbon flares, etc. Thus, it is suggested that ''low temperature flares'' are directly driven by the photospheric dynamo process. (author)
Energy Technology Data Exchange (ETDEWEB)
Szkody, Paula; Mukadam, Anjum S. [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States); Toloza, Odette; Gänsicke, Boris T.; Pala, Anna F. [Department of Physics, University of Warwick, Coventry CV4 7AL (United Kingdom); Dai, Zhibin [Yunnan Observatories, Chinese Academy of Sciences, 396 Yangfangwang, Guandu District, Kunming, 650216 (China); Waagen, Elizabeth O. [AAVSO, 48 Bay State Rd, Cambridge, MA 02138 (United States); Godon, Patrick; Sion, Edward M., E-mail: szkody@astro.washington.edu [Department of Astrophysics and Planetary Science, Villanova University, Villanova, PA 19085 (United States)
2017-03-01
Time-tag ultraviolet data obtained on the Hubble Space Telescope in 2013 reveal interesting variability related to the white dwarf spin in the two cataclysmic variables RZ Leo and CC Scl. RZ Leo shows a period at 220 s and its harmonic at 110 s, thus identifying it as a likely Intermediate Polar (IP). The spin signal is not visible in a short single night of ground-based data in 2016, but the shorter exposures in that data set indicate a possible partial eclipse. The much larger UV amplitude of the spin signal in the known IP CC Scl allows the spin of 389 s, previously only seen at outburst, to be visible at quiescence. Spectra created from the peaks and troughs of the spin times indicate a hotter temperature of several thousand degrees during the peak phases, with multiple components contributing to the UV light.
Studies of kinematic elements in two multicenter sunspot groups
International Nuclear Information System (INIS)
Korobova, Z.B.
1983-01-01
Some features of kinematic elements (KE) in two multicenter sunspot groups were studied using Tashkent full-disc white light heliograms. KE and morphological elements do not reveal any relationship. A KE coincides with a unipolar or multipolar spot or with part of a spot. It may also contain an extended stream including several spots. Relation of KE to large-scale photospheric magnetic fields is less clear. The line of polarity reversal is, in most cases, the deviding line between two adjacent KE. At the same time, a KE can contain spots of both polarities. Sunspot trajectories in the leading polarity regions show the best similarity. Interactions of KE are greatly influenced by the meridional drift. (author)
DEFF Research Database (Denmark)
Hu, Hao; Nouroozi, R.; Ludwig, R.
2010-01-01
Polarization-insensitive wavelength conversion of a single channel 320 Gb/s RZ-DQPSK data signal using a Ti:PPLN waveguide in a bi-directional loop configuration with less than 0.5 dB polarization sensitivity is reported. The conversion efficiency with polarization scrambling of the signal was -2...... little broadening and chirping, indicating the potential for wavelength conversion of even much higher data rates.......Polarization-insensitive wavelength conversion of a single channel 320 Gb/s RZ-DQPSK data signal using a Ti:PPLN waveguide in a bi-directional loop configuration with less than 0.5 dB polarization sensitivity is reported. The conversion efficiency with polarization scrambling of the signal was -21...
Photospheric Origin of Three-minute Oscillations in a Sunspot
Energy Technology Data Exchange (ETDEWEB)
Chae, Jongchul; Lee, Jeongwoo; Cho, Kyuhyoun; Song, Donguk [Astronomy Program, Department of Physics and Astronomy, Seoul National University, 1 Gwanak-ro, Gwanak-gu, Seoul 08826 (Korea, Republic of); Cho, Kyungsuk; Yurchyshyn, Vasyl [Korea Astronomy and Space Science Institute, 776 Daedeokdae-ro, Yuseong-gu, Daejeon 34055 (Korea, Republic of)
2017-02-10
The origin of the three-minute oscillations of intensity and velocity observed in the chromosphere of sunspot umbrae is still unclear. We investigated the spatio-spectral properties of the 3 minute oscillations of velocity in the photosphere of a sunspot umbra as well as those in the low chromosphere using the spectral data of the Ni i λ 5436, Fe i λ 5435, and Na i D{sub 2} λ 5890 lines taken by the Fast Imaging Solar Spectrograph of the 1.6 m New Solar Telescope at the Big Bear Solar Observatory. As a result, we found a local enhancement of the 3 minute oscillation power in the vicinities of a light bridge (LB) and numerous umbral dots (UDs) in the photosphere. These 3 minute oscillations occurred independently of the 5 minute oscillations. Through wavelet analysis, we determined the amplitudes and phases of the 3 minute oscillations at the formation heights of the spectral lines, and they were found to be consistent with the upwardly propagating slow magnetoacoustic waves in the photosphere with energy flux large enough to explain the chromospheric oscillations. Our results suggest that the 3 minute chromospheric oscillations in this sunspot may have been generated by magnetoconvection occurring in the LB and UDs.
Outflow of chromospheric emission features from the rim of a sunspot
Liu, S.-Y.
1973-01-01
In viewing a 16 mm movie made from a time sequence of spectroheliograms, some of these emission features are found to move outward from the rim of the sunspot until they are eventually lost in the small plage. There are two interpretations for the streaming of the magnetic features. It is possible that kinks in the line of force propagate along a horizontal extension of the penumbral magnetic field. Alternatively, fragments of the sunspot magnetic field are carried away by the photospheric velocity field.
DEFF Research Database (Denmark)
Yu, Jianjun; Yujun, Qian; Jeppesen, Palle
2001-01-01
A single or multiple wavelength RZ optical pulse source at 40 GHz is successfully obtained by using wavelength conversion in a nonlinear optical loop mirror consisting of high nonlinearity-dispersion shifted fiber.......A single or multiple wavelength RZ optical pulse source at 40 GHz is successfully obtained by using wavelength conversion in a nonlinear optical loop mirror consisting of high nonlinearity-dispersion shifted fiber....
International Nuclear Information System (INIS)
Chen Long-Quan; Qiao Yao-Jun; Ji Yue-Feng
2013-01-01
In this paper, we propose a new structure of a centralized-light-source wavelength division multiplexed passive optical network (WDM-PON) utilizing inverse-duobinary-return-to-zero (inverse-duobinary-RZ) downstream and DPSK upstream. It reuses downstream light for the upstream modulation, which retrenches lasers assembled at each optical network unit (ONU), and ultimately cuts down the cost of ONUs a great deal. Meanwhile, a 50-km-reach WDM-PON experiment with 10-Gb/s inverse-duobinary-RZ downstream and 6-Gb/s DPSK upstream is demonstrated here. It is revealed to be a novel cost-effective alternative for the next generation access network. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)
The 17 GHz active region number
Energy Technology Data Exchange (ETDEWEB)
Selhorst, C. L.; Pacini, A. A. [IP and D-Universidade do Vale do Paraíba-UNIVAP, São José dos Campos (Brazil); Costa, J. E. R. [CEA, Instituto Nacional de Pesquisas Espaciais, São José dos Campos (Brazil); Giménez de Castro, C. G.; Valio, A. [CRAAM, Universidade Presbiteriana Mackenzie, São Paulo (Brazil); Shibasaki, K., E-mail: caius@univap.br [Nobeyama Solar Radio Observatory/NAOJ, Minamisaku, Nagano 384-1305 (Japan)
2014-08-01
We report the statistics of the number of active regions (NAR) observed at 17 GHz with the Nobeyama Radioheliograph between 1992, near the maximum of cycle 22, and 2013, which also includes the maximum of cycle 24, and we compare with other activity indexes. We find that NAR minima are shorter than those of the sunspot number (SSN) and radio flux at 10.7 cm (F10.7). This shorter NAR minima could reflect the presence of active regions generated by faint magnetic fields or spotless regions, which were a considerable fraction of the counted active regions. The ratio between the solar radio indexes F10.7/NAR shows a similar reduction during the two minima analyzed, which contrasts with the increase of the ratio of both radio indexes in relation to the SSN during the minimum of cycle 23-24. These results indicate that the radio indexes are more sensitive to weaker magnetic fields than those necessary to form sunspots, of the order of 1500 G. The analysis of the monthly averages of the active region brightness temperatures shows that its long-term variation mimics the solar cycle; however, due to the gyro-resonance emission, a great number of intense spikes are observed in the maximum temperature study. The decrease in the number of these spikes is also evident during the current cycle 24, a consequence of the sunspot magnetic field weakening in the last few years.
Aurorae, sunspots and weather, mainly since A.D. 1200
International Nuclear Information System (INIS)
Schove, D.J.
1981-01-01
Auroral records recieved for the Spectrum of Time project were used in 1955 to estimate sunspot activity and the dates maxima and minima back to 649 B.C. An additional set of rules has been developed and has made possible further improvements utilizing the separate auroral maxima associated with flares and coronal holes on the sun. A further set can now be given. 1) The time between sunspot maxima depends especially on the ratio of the amplitudes: the time between minima is high if the next cycle is very weak and low when the two consecutive cycles are both strong. 2) The time of rise is usually dependent on the strength of the next maxima, and the time of fall is low when a moderate cycle is followed by a strong one. (orig./WL)
On the determination of heliographic positions and rotation velocities of sunspots. Pt. 2
International Nuclear Information System (INIS)
Balthasar, H.
1983-01-01
Using sunspot positions of small sunspots observed at Debrecen and Locarno as well as positions of recurrent sunspots taken from the Greenwich Photoheliographic Results (1940-1976) the influence of the Wilson depression on the rotation velocities was investigated. It was found that the Wilson depression can be determined by minimizing errors of the rotation velocities or minimizing the differences of rotation velocities determined from disk passages and central meridian passages. The Wilson depressions found were between 765 km and 2500 km for the first sample while they were between 0 km and several 1000 km for the second sample. The averaged Wilson depression for the second sample is between 500 km and 965 km depending on the reduction method. A dependence of the Wilson depression on the age of the spots investigated seems not to exist. (orig.)
Application of the Markov chain approximation to the sunspot observations
International Nuclear Information System (INIS)
Onal, M.
1988-01-01
The positions of the 13,588 sunspot groups observed during the cycle of 1950-1960 at the Istanbul University Observatory have been corrected for the effect of differential rotation. The evolution probability of a sunspot group to the other one in the same region have been determined. By using the Markov chain approximation, the types of these groups and their transition probabilities during the following activity cycle (1950-1960), and the concentration of active regions during 1950-1960 have been estimated. The transition probabilities from the observations of the activity cycle 1960-1970 have been compared with the predicted transition probabilities and a good correlation has been noted. 5 refs.; 2 tabs
MODELING THE CHROMOSPHERE OF A SUNSPOT AND THE QUIET SUN
Energy Technology Data Exchange (ETDEWEB)
Avrett, E.; Tian, H. [Smithsonian Astrophysical Observatory, Cambridge, MA 02138 (United States); Landi, E. [Department of Atmospheric, Oceanic and Space Sciences, University of Michigan, Ann Arbor, MI 48109 (United States); Curdt, W. [Max Planck Institut für Sonnensystemfoschung, Goettingen (Germany); Wülser, J.-P. [Lockheed Martin Advanced Techonology Center (United States)
2015-10-01
Semiempirical atmospheric modeling attempts to match an observed spectrum by finding the temperature distribution and other physical parameters along the line of sight through the emitting region such that the calculated spectrum agrees with the observed one. In this paper we take the observed spectrum of a sunspot and the quiet Sun in the EUV wavelength range 668–1475 Å from the 2001 SUMER atlas of Curdt et al. to determine models of the two atmospheric regions, extending from the photosphere through the overlying chromosphere into the transition region. We solve the coupled statistical equilibrium and optically thick radiative transfer equations for a set of 32 atoms and ions. The atoms that are part of molecules are treated separately, and are excluded from the atomic abundances and atomic opacities. We compare the Mg ii k line profile observations from the Interface Region Imaging Spectrograph with the profiles calculated from the two models. The calculated profiles for the sunspot are substantially lower than the observed ones, based on the SUMER models. The only way we have found to raise the calculated Mg ii lines to agree with the observations is to introduce illumination of the sunspot from the surrounding active region.
LONG-TERM MEASUREMENTS OF SUNSPOT MAGNETIC TILT ANGLES
Energy Technology Data Exchange (ETDEWEB)
Li Jing [Department of Earth and Space Sciences, University of California at Los Angeles, Los Angeles, CA 90095-1567 (United States); Ulrich, Roger K., E-mail: jli@igpp.ucla.edu [Department of Physics and Astronomy, University of California at Los Angeles, Los Angeles, CA 90095-1567 (United States)
2012-10-20
Tilt angles of close to 30,600 sunspots are determined using Mount Wilson daily averaged magnetograms taken from 1974 to 2012, and SOHO/MDI magnetograms taken from 1996 to 2010. Within a cycle, more than 90% of sunspots have a normal polarity alignment along the east-west direction following Hale's law. The median tilts increase with increasing latitude (Joy's law) at a rate of {approx}0.{sup 0}5 per degree of latitude. Tilt angles of spots appear largely invariant with respect to time at a given latitude, but they decrease by {approx}0.{sup 0}9 per year on average, a trend that largely reflects Joy's law following the butterfly diagram. We find an asymmetry between the hemispheres in the mean tilt angles. On average, the tilts are greater in the Southern than in the Northern Hemisphere for all latitude zones, and the differences increase with increasing latitude.
Response of Solar Irradiance to Sunspot-area Variations
Dudok de Wit, T.; Kopp, G.; Shapiro, A.; Witzke, V.; Kretzschmar, M.
2018-02-01
One of the important open questions in solar irradiance studies is whether long-term variability (i.e., on timescales of years and beyond) can be reconstructed by means of models that describe short-term variability (i.e., days) using solar proxies as inputs. Preminger & Walton showed that the relationship between spectral solar irradiance and proxies of magnetic-flux emergence, such as the daily sunspot area, can be described in the framework of linear system theory by means of the impulse response. We significantly refine that empirical model by removing spurious solar-rotational effects and by including an additional term that captures long-term variations. Our results show that long-term variability cannot be reconstructed from the short-term response of the spectral irradiance, which questions the extension of solar proxy models to these timescales. In addition, we find that the solar response is nonlinear in a way that cannot be corrected simply by applying a rescaling to a sunspot area.
CHROMOSPHERIC SUNSPOTS IN THE MILLIMETER RANGE AS OBSERVED BY THE NOBEYAMA RADIOHELIOGRAPH
Energy Technology Data Exchange (ETDEWEB)
Iwai, Kazumasa [National Institute of Information and Communications Technology, Koganei 184-8795, Tokyo (Japan); Koshiishi, Hideki [Aerospace Research and Development Directorate, Japan Aerospace Exploration Agency, Tsukuba 305-8505 (Japan); Shibasaki, Kiyoto [Nobeyama Solar Radio Observatory, National Astronomical Observatory of Japan, Minamimaki, Nagano 384-1305 (Japan); Nozawa, Satoshi; Miyawaki, Shun; Yoneya, Takuro, E-mail: kazumasa.iwai@nict.go.jp [Department of Science, Ibaraki University, Mito, Ibaraki 310-8512 (Japan)
2016-01-10
We investigate the upper chromosphere and the transition region of the sunspot umbra using the radio brightness temperature at 34 GHz (corresponding to 8.8 mm observations) as observed by the Nobeyama Radioheliograph (NoRH). Radio free–free emission in the longer millimeter range is generated around the transition region, and its brightness temperature yields the region's temperature and density distribution. We use the NoRH data at 34 GHz by applying the Steer-CLEAN image synthesis. These data and the analysis method enable us to investigate the chromospheric structures in the longer millimeter range with high spatial resolution and sufficient visibilities. We also perform simultaneous observations of one sunspot using the NoRH and the Nobeyama 45 m telescope operating at 115 GHz. We determine that 115 GHz emission mainly originates from the lower chromosphere while 34 GHz emission mainly originates from the upper chromosphere and transition region. These observational results are consistent with the radio emission characteristics estimated from current atmospheric models of the chromosphere. On the other hand, the observed brightness temperature of the umbral region is almost the same as that of the quiet region. This result is inconsistent with current sunspot models, which predict a considerably higher brightness temperature of the sunspot umbra at 34 GHz. This inconsistency suggests that the temperature of the region at which the 34 GHz radio emission becomes optically thick should be lower than that predicted by the models.
Far Ultraviolet Spectroscopy of Three Long Period Nova-Like Variables, V363 Aur, AC Cnc and RZ Gru
Bisol, Alexandra; Sion, E. M.
2011-01-01
We have selected three nova-like variables: V363 Aur, RZ Gru and AC Cnc, all of which are UX UMa types, having similar orbital periods well beyond the 3 to 4 hour range where most nova-likes are found. All should have very similar secondary stars given the fact that they their physical parameters are so similar. V363 Aur is a bona fide SW Sex star, and AC Cnc is a probable one, while RZ Gru is not a member of the SW Sex subclass. Our objective is to carry out the first synthetic spectral analysis of far ultraviolet spectra of the three systems using state-of-the-art models both of accretion disks and photospheres. Therefore we shall compare the distances we obtain from the best fitting synthetic spectral models to other distance estimates in the literature. We present model-derived accretion rates and distances for all three systems. The FUV flux range of RZ Gru and V363 Aur is dominated by radiation from an optically thick, steady state, accretion but for AC Cnc, we find that a hot white dwarf accounts for 70% of the FUV flux. We compare the FUV characteristics and physical properties of these three long period nova-like systems to the properties of other nova-likes at shorter periods. This work was supported in part by NSF grant AST0807892 to Villanova University.
Gnevyshev peaks in solar radio emissions at different frequencies
Directory of Open Access Journals (Sweden)
R. P. Kane
2009-04-01
Full Text Available Sunspots have a major 11-year cycle, but the years near the sunspot maximum show two or more peaks called GP (Gnevyshev Peaks. In this communication, it was examined whether these peaks in sunspots are reflected in other parameters such as Lyman-α (the chromospheric emission 121.6 nm, radio emissions 242–15 400 MHz emanating from altitude levels 2000–12 000 km, the low latitude (+45° to −45° solar open magnetic flux and the coronal green line emission (Fe XIV, 530.3 nm. In the different solar cycles 20–23, the similarity extended at least upto the level of 609 MHz, but in cycle 22, the highest level was of 242 MHz. The extension to the higher level in cycle 22 does not seem to be related to the cycle strength Rz(max, or to the cycle length.
Molecular Diagnostics of the Internal Structure of Starspots and Sunspots
Afram, N.; Berdyugina, S. V.; Fluri, D. M.; Solanki, S. K.; Lagg, A.; Petit, P.; Arnaud, J.
2006-12-01
We have analyzed the usefulness of molecules as a diagnostic tool for studying solar and stellar magnetism with the molecular Zeeman and Paschen-Back effects. In the first part we concentrate on molecules that are observed in sunspots such as MgH and TiO. We present calculated molecular line profiles obtained by assuming magnetic fields of 2-3 kG and compare these synthetic Stokes profiles with spectro-polarimetric observations in sunspots. The good agreement between the theory and observations allows us to turn our attention in the second part to starspots to gain insight into their internal structure. We investigate the temperature range in which the selected molecules can serve as indicators for magnetic fields on highly active cool stars and compare synthetic Stokes profiles with our recent observations.
Initial phase of the development of sunspot groups and their forecast
International Nuclear Information System (INIS)
Berlyand, B.O.; Burov, V.A.; Stepanyan, N.N.
1979-01-01
Some characteristics of the initial phase of sunspot groups and their forecast have been considered. Experimental data on 340 sunspot groups were obtained in 1967-1969. It was found that oscillations of the magnetic flux in the groups indicate the possibility of the existence of typical periods (2 and 4 days) of the magnetic field development. Most of the groups appears in young plages. The probability of the protons injection from the young groups is very small. The typical time of the development of the proton centre is 10-30 days. The characteristics of the group on the first day of its existence are vaguely connected with the lifetime of the group. On the second and third days the magnetic characteristics (the summary magnetic flux and the number of the unipolar regions) have the highest correlation coefficient (approximately 70%) with the lifetime of the group. The problem of the group lifetime forecast was being solved with the pattern recognition technique. On the base of the second day observation of the existence of the group verification of the received forecast 14% exceeds the verification of the climatological forecast. The forecast of the Zurich class with the same technique is effective beginning with the fifth day of the group existence and the forecast of the flare activity of the group since the day of its appearance. The exceeding of the verification as compared with the climatological forecasts in these problems is 10% and 8% accordingly
Hayakawa, Hisashi; Iwahashi, Kiyomi; Tamazawa, Harufumi; Ebihara, Yusuke; Kawamura, Akito Davis; Isobe, Hiroaki; Namiki, Katsuko; Shibata, Kazunari
2017-12-01
We present the results of the surveys on sunspots and auroral candidates in Rikkokushi, Japanese official histories from the early 7th century to 887, to review the solar and auroral activities. In total, we found one sunspot record and 13 auroral candidates in Rikkokushi. We then examine the records of the sunspots and auroral candidates, compare the auroral candidates with the lunar phase to estimate their reliability, and compare the records of the sunspots and auroral candidates with the contemporary total solar irradiance reconstructed from radioisotope data. We also identify the locations of the observational sites to review possible equatorward expansion of the auroral oval. These discussions suggest a major gap in auroral candidates from the late 7th to early 9th centuries, which includes the candidate of the grand minimum reconstructed from the radioisotope data, a similar tendency as the distributions of sunspot records in contemporary China, and a relatively high magnetic latitude of observational sites with a higher potential for observing aurorae more frequently than at present.
International Nuclear Information System (INIS)
Klimes, J.; Krivsky, L.
1984-01-01
Using data from 11-year solar cycle No. 20, it was found that flares with type II radio bursts are more than twice as frequent and flares with type IV bursts nearly twice as frequent in sunspot groups which developed close to each other or which merged in the course of revolutions than in isolated sunspot groups. With both types the occurrence of these flares is concentrated in the revolution of the so-called sunspot group interaction (their approximation, merging). (author)
International Nuclear Information System (INIS)
Stephenson, F.R.
1990-01-01
The value of sunspot observations in investigating solar activity trends - mainly on the centennial to millennial timescale - is considered in some detail. It is shown that although observations made since the mid-eighteenth century are in general very reliable indicators of solar activity, older data are of dubious quality and utility. The sunspot record in both the pretelescopic and early telescopic periods appears to be confused by serious data artefacts. (author)
Directory of Open Access Journals (Sweden)
Santos Ângela R. G.
2017-01-01
Full Text Available The activity-related variations in the solar acoustic frequencies have been known for 30 years. However, the importance of the different contributions is still not well established. With this in mind, we developed an empirical model to estimate the spot-induced frequency shifts, which takes into account the sunspot properties, such as area and latitude. The comparison between the model frequency shifts obtained from the daily sunspot records and those observed suggests that the contribution from a stochastic component to the total frequency shifts is about 30%. The remaining 70% is related to a global, long-term variation. We also propose a new observable to investigate the short-and mid-term variations of the frequency shifts, which is insensitive to the long-term variations contained in the data. On the shortest time scales the variations in the frequency shifts are strongly correlated with the variations in the total area covered by sunspots. However, a significant loss of correlation is still found, which cannot be fully explained by ignoring the invisible side of the Sun when accounting for the total sunspot area. We also verify that the times when the frequency shifts and the sunspot areas do not vary in a similar way tend to coincide with the times of the maximum amplitude of the quasi-biennial variations found in the seismic data.
Yan, X. L.; Wang, J. C.; Pan, G. M.; Kong, D. F.; Xue, Z. K.; Yang, L. H.; Li, Q. L.; Feng, X. S.
2018-03-01
We present a clear case study on the occurrence of two successive X-class flares, including a decade-class flare (X9.3) and two coronal mass ejections (CMEs) triggered by shearing motion and sunspot rotation in active region NOAA 12673 on 2017 September 6. A shearing motion between the main sunspots with opposite polarities began on September 5 and lasted even after the second X-class flare on September 6. Moreover, the main sunspot with negative polarity rotated around its umbral center, and another main sunspot with positive polarity also exhibited a slow rotation. The sunspot with negative polarity at the northwest of the active region also began to rotate counterclockwise before the onset of the first X-class flare, which is related to the formation of the second S-shaped structure. The successive formation and eruption of two S-shaped structures were closely related to the counterclockwise rotation of the three sunspots. The existence of a flux rope is found prior to the onset of two flares by using nonlinear force-free field extrapolation based on the vector magnetograms observed by Solar Dynamics Observatory/Helioseismic and Magnetic Image. The first flux rope corresponds to the first S-shaped structures mentioned above. The second S-shaped structure was formed after the eruption of the first flux rope. These results suggest that a shearing motion and sunspot rotation play an important role in the buildup of the free energy and the formation of flux ropes in the corona that produces solar flares and CMEs.
On the correlation of longitudinal and latitudinal motions of sunspots
International Nuclear Information System (INIS)
Gilman, P.A.
1984-01-01
Using new measurements of positions of individual sunspots and sunspot groups obtained from 62 years of the Mt. Wilson white-light plate collection, we have recomputed the correlation between longitude and latitude motion. Our results for groups are similar to those of Ward (1965a) computed from the Greenwich record, but for individual spots the covariance is reduced by a factor of about 3 from the Ward values, though still of the same sign and still statistically significant. We conclude that there is a real correlation between longitude and latitude movement of individual spots, implying angular momentum transport toward the equator as inferred by Ward. The two thirds reduction in the covariance for individual spots as opposed to groups is probably due to certain properties of spot groups, as first pointed out in an unpublished manuscript by Leighton. (orig.)
The chromosphere above a δ-sunspot in the presence of fan-shaped jets
Robustini, Carolina; Leenaarts, Jorrit; de la Cruz Rodríguez, Jaime
2018-01-01
Context. Delta-sunspots are known to be favourable locations for fast and energetic events like flares and coronal mass ejections. The photosphere of this sunspot type has been thoroughly investigated in the past three decades. The atmospheric conditions in the chromosphere are not as well known, however. Aims: This study is focused on the chromosphere of a δ-sunspot that harbours a series of fan-shaped jets in its penumbra. The aim of this study is to establish the magnetic field topology and the temperature distribution in the presence of jets in the photosphere and the chromosphere. Methods: We use data from the Swedish 1m Solar Telescope (SST) and the Solar Dynamics Observatory. We invert the spectropolarimetric Fe I 6302 Å and Ca II 8542 Å data from the SST using the non-LTE inversion code NICOLE to estimate the magnetic field configuration, temperature, and velocity structure in the chromosphere. Results: A loop-like magnetic structure is observed to emerge in the penumbra of the sunspot. The jets are launched from this structure. Magnetic reconnection between this emerging field and the pre-existing vertical field is suggested by hot plasma patches on the interface between the two fields. The height at which the reconnection takes place is located between log τ500 = -2 and log τ500 = -3. The magnetic field vector and the atmospheric temperature maps show a stationary configuration during the whole observation. Movies associated to Figs. 3-5 are available at http://www.aanda.org
On the evolution of magnetic and velocity fields of an originating sunspot group
International Nuclear Information System (INIS)
Bachmann, G.
1978-01-01
Magnetographic measurements were made to derive longitudinal magnetic field strengths, line-of-sight velocities and the brightness distribution in an originating sunspot group. These results and photographs of the group are used to compare the evaluation of a relatively simple active region with our present ideas about the evolution of active regions in general. We found that the total magnetic flux increased from about 4 to 20x10 20 Mx over three days. The downward flow of gas in regions with stronger magnetic fields is formed only after the magnetic field has already been bipolar for two days. The maximum velocity always occurred in the main spots of the preceding and the subsequent parts of the sunspot group. Transformation into a flow pattern, which looks like Evershed motion, is observed in the main preceding sunspot after the formation of the penumbra. The generation of new active regions by concentration and amplification of magnetic fields, under the action of supergranulation flow in photospheric layers, cannot play an important role. On the contrary, the behaviour of the active region is in agreement with the conception of rising flux tubes, out of which the gas flows down. Our observations confirm that a magnetic field strength, leading to the generation of sunspots, is attained earlier in the preceding part of the originating active region than in its subsequent part. A series of subflares occurred in the active region, when short-lived small magnetic structure elements emerged in the larger bipolar magnetic field. (author)
NUMERICAL SIMULATIONS OF CONVERSION TO ALFVÉN WAVES IN SUNSPOTS
International Nuclear Information System (INIS)
Khomenko, E.; Cally, P. S.
2012-01-01
We study the conversion of fast magnetoacoustic waves to Alfvén waves by means of 2.5D numerical simulations in a sunspot-like magnetic configuration. A fast, essentially acoustic, wave of a given frequency and wave number is generated below the surface and propagates upward through the Alfvén/acoustic equipartition layer where it splits into upgoing slow (acoustic) and fast (magnetic) waves. The fast wave quickly reflects off the steep Alfvén speed gradient, but around and above this reflection height it partially converts to Alfvén waves, depending on the local relative inclinations of the background magnetic field and the wavevector. To measure the efficiency of this conversion to Alfvén waves we calculate acoustic and magnetic energy fluxes. The particular amplitude and phase relations between the magnetic field and velocity oscillations help us to demonstrate that the waves produced are indeed Alfvén waves. We find that the conversion to Alfvén waves is particularly important for strongly inclined fields like those existing in sunspot penumbrae. Equally important is the magnetic field orientation with respect to the vertical plane of wave propagation, which we refer to as 'field azimuth'. For a field azimuth less than 90° the generated Alfvén waves continue upward, but above 90° downgoing Alfvén waves are preferentially produced. This yields negative Alfvén energy flux for azimuths between 90° and 180°. Alfvén energy fluxes may be comparable to or exceed acoustic fluxes, depending upon geometry, though computational exigencies limit their magnitude in our simulations.
Distribution of electric currents in sunspots from photosphere to corona
Energy Technology Data Exchange (ETDEWEB)
Gosain, Sanjay [National Solar Observatory, 950 North Cherry Avenue, Tucson, AZ 85719 (United States); Démoulin, Pascal [Observatoire de Paris, LESIA, UMR 8109 (CNRS), F-92195 Meudon Principal Cedex (France); López Fuentes, Marcelo [Instituto de Astronomía y Física del Espacio (IAFE), UBA-CONICET, CC. 67, Suc. 28 Buenos Aires 1428 (Argentina)
2014-09-20
We present a study of two regular sunspots that exhibit nearly uniform twist from the photosphere to the corona. We derive the twist parameter in the corona and in the chromosphere by minimizing the difference between the extrapolated linear force-free field model field lines and the observed intensity structures in the extreme-ultraviolet images of the Sun. The chromospheric structures appear more twisted than the coronal structures by a factor of two. Further, we derive the vertical component of electric current density, j{sub z} , using vector magnetograms from the Hinode Solar Optical Telescope (SOT). The spatial distribution of j{sub z} has a zebra pattern of strong positive and negative values owing to the penumbral fibril structure resolved by Hinode/SOT. This zebra pattern is due to the derivative of the horizontal magnetic field across the thin fibrils; therefore, it is strong and masks weaker currents that might be present, for example, as a result of the twist of the sunspot. We decompose j{sub z} into the contribution due to the derivatives along and across the direction of the horizontal field, which follows the fibril orientation closely. The map of the tangential component has more distributed currents that are coherent with the chromospheric and coronal twisted structures. Moreover, it allows us to map and identify the direct and return currents in the sunspots. Finally, this decomposition of j{sub z} is general and can be applied to any vector magnetogram in order to better identify the weaker large-scale currents that are associated with coronal twisted/sheared structures.
High Velocity Horizontal Motions at the Edge of Sunspot Penumbrae
Hagenaar-Daggett, Hermance J.; Shine, R.
2010-05-01
The outer edges of sunspot penumbrae have long been noted as a region of interesting dynamics including formation of MMFs, extensions and retractions of the penumbral tips, fast moving (2-3 km/s) bright features dubbed"streakers", and localized regions of high speed downflows interpreted as Evershed "sinks". Using 30s cadence movies of high spatial resolution G band and Ca II H images taken by the Hinode SOT/FPP instrument from 5-7 Jan 2007, we have been investigating the penumbra around a sunspot in AR 10933. In addition to the expected phenomena, we also see occasional small dark crescent-shaped features with high horizontal velocities (6.5 km/s) in G band movies. These appear to be emitted from penumbral tips. They travel about 1.5 Mm developing a bright wake that evolves into a slower moving (1-2 km/s) bright feature. In some cases, there may be an earlier outward propagating disturbance within the penumbra. We have also analyzed available Fe 6302 Stokes V images to obtain information on the magnetic field. Although only lower resolution 6302 images made with a slower cadence are available for these particular data sets, we can establish that the features have the opposite magnetic polarity of the sunspot. This observation may be in agreement with simulations showing that a horizontal flux tube develops crests that move outward with a velocity as large as 10 km/s. This work was supported by NASA contract NNM07AA01C.
Energy Technology Data Exchange (ETDEWEB)
McIntosh, Scott W.; Wang, Xin; Markel, Robert S.; Thompson, Michael J. [High Altitude Observatory, National Center for Atmospheric Research, P.O. Box 3000, Boulder, CO 80307 (United States); Leamon, Robert J.; Malanushenko, Anna V. [Department of Physics, Montana State University, Bozeman, MT 59717 (United States); Davey, Alisdair R. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Howe, Rachel [School of Physics and Astronomy, University of Birmingham, Edgbaston, Birmingham, B15 2TT (United Kingdom); Krista, Larisza D. [Cooperative Institute for Research in Environmental Sciences, University of Colorado, Boulder, CO 80205 (United States); Cirtain, Jonathan W. [Marshall Space Flight Center, Code ZP13, Huntsville, AL 35812 (United States); Gurman, Joseph B.; Pesnell, William D., E-mail: mscott@ucar.edu [Solar Physics Laboratory, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States)
2014-09-01
Sunspots are a canonical marker of the Sun's internal magnetic field which flips polarity every ∼22 yr. The principal variation of sunspots, an ∼11 yr variation, modulates the amount of the magnetic field that pierces the solar surface and drives significant variations in our star's radiative, particulate, and eruptive output over that period. This paper presents observations from the Solar and Heliospheric Observatory and Solar Dynamics Observatory indicating that the 11 yr sunspot variation is intrinsically tied to the spatio-temporal overlap of the activity bands belonging to the 22 yr magnetic activity cycle. Using a systematic analysis of ubiquitous coronal brightpoints and the magnetic scale on which they appear to form, we show that the landmarks of sunspot cycle 23 can be explained by considering the evolution and interaction of the overlapping activity bands of the longer-scale variability.
SUNSPOT AND STARSPOT LIFETIMES IN A TURBULENT EROSION MODEL
Energy Technology Data Exchange (ETDEWEB)
Litvinenko, Yuri E. [Department of Mathematics, University of Waikato, P. B. 3105, Hamilton (New Zealand); Wheatland, M. S. [Sydney Institute for Astronomy, School of Physics, The University of Sydney, NSW 2006 (Australia)
2017-01-10
Quantitative models of sunspot and starspot decay predict the timescale of magnetic diffusion and may yield important constraints in stellar dynamo models. Motivated by recent measurements of starspot lifetimes, we investigate the disintegration of a magnetic flux tube by nonlinear diffusion. Previous theoretical studies are extended by considering two physically motivated functional forms for the nonlinear diffusion coefficient D : an inverse power-law dependence D ∝ B {sup −ν} and a step-function dependence of D on the magnetic field magnitude B . Analytical self-similar solutions are presented for the power-law case, including solutions exhibiting “super fast” diffusion. For the step-function case, the heat-balance integral method yields approximate solutions, valid for moderately suppressed diffusion in the spot. The accuracy of the resulting solutions is confirmed numerically, using a method which provides an accurate description of long-time evolution by imposing boundary conditions at infinite distance from the spot. The new models may allow insight into the differences and similarities between sunspots and starspots.
Possibility to explain the temperature distribution in sunspots by an anisotropic heat transfer
Energy Technology Data Exchange (ETDEWEB)
Eschrich, K O; Krause, F [Akademie der Wissenschaften der DDR, Potsdam. Zentralinstitut fuer Astrophysik
1977-01-01
Numerical solutions of a heat conduction problem in an anisotropic medium are used for a discussion of the possibility to explain the temperature distribution in sunspots and their environment. The anisotropy is assumed being due to the strong magnetic field in sunspots and the region below. This magnetic field forces the convection to take an anisotropic structure (two-dimensional turbulence) and thus the region gets anisotropic conduction properties, on the average. The discussion shows that the observed temperature profiles can be explained in the case the depth of the region of anisotropy is about as large as the diameter of the spot or larger.
International Nuclear Information System (INIS)
Chou, D.-Y.; Liang, Z.-C.; Yang, M.-H.; Zhao Hui; Sun, M.-T.
2009-01-01
The power of solar acoustic waves in magnetic regions is lower relative to the quiet Sun. Absorption, emissivity reduction, and local suppression of acoustic waves contribute to the observed power reduction in magnetic regions. We propose a model for the energy budget of acoustic waves propagating through a sunspot in terms of the coefficients of absorption, emissivity reduction, and local suppression of the sunspot. Using the property that the waves emitted along the wave path between two points have no correlation with the signal at the starting point, we can separate the effects of these three mechanisms. Applying this method to helioseismic data filtered with direction and phase-velocity filters, we measure the fraction of the contribution of each mechanism to the power deficit in the umbra of the leading sunspot of NOAA 9057. The contribution from absorption is 23.3 ± 1.3%, emissivity reduction 8.2 ± 1.4%, and local suppression 68.5 ± 1.5%, for a wave packet corresponding to a phase velocity of 6.98 x 10 -5 rad s -1 .
Automated Sunspot Detection and Classification Using SOHO/MDI Imagery
2015-03-01
to the geocentric North). 3. Focus and size of the solar disk is adjusted to fit an 18 cm diameter circle on the worksheet. 4. Analyst hand draws the...General Nature of the Sunspot,” The Astrophysical Journal 230, 905–913 (1979). 14. Wheatland, M. S., “A Bayesian Approach to Solar Flare Prediction,” The
Atwell, William; Tylka, Allan J.; Dietrich, William; Rojdev, Kristina; Matzkind, Courtney
2016-01-01
In an earlier paper (Atwell, et al., 2015), we investigated solar particle event (SPE) radiation exposures (absorbed dose) to small, thinly-shielded spacecraft during a period when the sunspot number (SSN) was less than 30. These SPEs contain Ground Level Events (GLE), sub-GLEs, and sub-sub-GLEs (Tylka and Dietrich, 2009, Tylka and Dietrich, 2008, and Atwell, et al., 2008). GLEs are extremely energetic solar particle events having proton energies extending into the several GeV range and producing secondary particles in the atmosphere, mostly neutrons, observed with ground station neutron monitors. Sub-GLE events are less energetic, extending into the several hundred MeV range, but do not produce secondary atmospheric particles. Sub-sub GLEs are even less energetic with an observable increase in protons at energies greater than 30 MeV, but no observable proton flux above 300 MeV. In this paper, we consider those SPEs that occurred during 1973-2010 when the SSN was greater than 30 but less than 50. In addition, we provide probability estimates of absorbed dose based on mission duration with a 95% confidence level (CL). We also discuss the implications of these data and provide some recommendations that may be useful to spacecraft designers of these smaller spacecraft.
3-color photometry of a sunspot using speckle masking techniques
Wiehr, E.; Sütterlin, P.
1998-01-01
A three-colour photometry is used to deduce the temperature of sunspot fine-structures. Using the Speckle-Masking method for image restoration, the resulting images (one per colour and burst) have a spatial resolution only limited by the telescope's aperture, i.e. 95km (blue), 145 km (red) and
Depressed emission between magnetic arcades near a sunspot
Ryabov, B. I.; Shibasaki, K.
The locations of the depressed emission in microwaves, EUV and soft X-rays are compared with each other and with the location of the plasma outflow in the active region (AR) 8535 on the Sun. We found that two open-field regions overlap the regions of depressed emission near the AR's sunspot. These two open-field regions are simulated with the potential-field source-surface (PFSS) model under radial distances of RSS = 1.8 R⊙ and RSS = 2.5 R⊙. Each open-field region is located between the arcades of the loops of the same magnetic polarity. The former open-field region covers the region of the plasma outflow, which is thus useful for the tests on connection to the heliosphere. The utmost microwave depression of the intensity in the ordinary mode (the Very Large Array 15 GHz observations) also overlaps the region of the plasma outflow and thus indicates this outflow. The lasting for eight days depression in soft X-rays and the SOHO EIT 2.84× 10-8 m images are attributed to the evacuation of as hot coronal plasma as T≥ 2× 106 K from the extended in height (``open") magnetic structures. We conclude that the AR 8535 presents the sunspot atmosphere affected by the large-scale magnetic fields.
VARI-QUIR-3, 2-D Multigroup Steady-State Neutron Diffusion in X-Y R-Z or R-Theta Geometry
International Nuclear Information System (INIS)
Collier, George
1984-01-01
1 - Nature of physical problem solved: The steady-state, multigroup, two-dimensional neutron diffusion equations are solved in x-y, r-z, and r-theta geometry. 2 - Method of solution: A Gauss-Seidel type of solution with inner and outer iterations is used. The source is held constant during the inner iterations
Energy Technology Data Exchange (ETDEWEB)
Yan, X. L.; Xue, Z. K.; Wang, J. C.; Yang, L. H. [Yunnan Observatories, Chinese Academy of Sciences, Kunming 650011 (China); Priest, E. R. [Mathematics Institute, University of St Andrews, St Andrews, KY16 9SS (United Kingdom); Guo, Q. L., E-mail: yanxl@ynao.ac.cn [College of Mathematics Physics and Information Engineering, Jiaxing University, Jiaxing 314001 (China)
2016-11-20
We present a detailed study of the formation of an inverse S-shaped filament prior to its eruption in active region NOAA 11884 from 2013 October 31 to November 2. In the initial stage, clockwise rotation of a small positive sunspot around the main negative trailing sunspot formed a curved filament. Then the small sunspot cancelled with the negative magnetic flux to create a longer active-region filament with an inverse S-shape. At the cancellation site a brightening was observed in UV and EUV images and bright material was transferred to the filament. Later the filament erupted after cancellation of two opposite polarities below the upper part of the filament. Nonlinear force-free field extrapolation of vector photospheric fields suggests that the filament may have a twisted structure, but this cannot be confirmed from the current observations.
Baker, J. C. A.; Gloor, M.; Boom, A.; Neill, D. A.; Cintra, B. B. L.; Clerici, S. J.; Brienen, R. J. W.
2018-02-01
It was suggested in a recent article that sunspots drive decadal variation in Amazon River flow. This conclusion was based on a novel time series decomposition method used to extract a decadal signal from the Amazon River record. We have extended this analysis back in time, using a new hydrological proxy record of tree ring oxygen isotopes (δ18OTR). Consistent with the findings of Antico and Torres, we find a positive correlation between sunspots and the decadal δ18OTR cycle from 1903 to 2012 (r = 0.60, p r = -0.30, p = 0.11, 1799-1902). This result casts considerable doubt over the mechanism by which sunspots are purported to influence Amazon hydrology.
A two dimensional code (R,Z) for nuclear reactor analysis and its application to the UAR-RI reactor
International Nuclear Information System (INIS)
Bishay, S.T.; Mikhail, I.F.I.; Gaafar, M.A.; Michaiel, M.L.; Nassar, S.F.
1988-01-01
A detailed study is given of fuel consumption in completely reflected cylindrical reactors. A two group, two dimensional (r,z) code is developed to carry out the required procedure. The code is applied to the UAR-RI reactor and the results are found to be in complete agreement with the experimental observations and with the theoretical interpretations. 7 fig., 12 tab
A model of a sunspot chromosphere based on OSO 8 observations
Lites, B. W.; Skumanich, A.
1982-01-01
OSO 8 spectrometer observations of the H I, Mg II, and Ca II resonance lines of a large quiet sunspot during November 16-17, 1975, along with a C IV line of that event obtained by a ground-based spectrometer, are analyzed together with near-simultaneous ground-based Stokes measurements to yield an umbral chromosphere and transition region model. Features of this model include a chromosphere that is effectively thin in the resonance lines of H I and Mg II, while being saturated in Ca II, and an upper chromospheric structure similar to that of quiet-sun models. The similarity of the upper chromosphere of the sunspot umbra to the quiet-sun chromosphere suggests that the intense magnetic field plays only a passive role in the chromospheric heating mechanism, and the observations cited indicate that solar-type stars with large areas of ordered magnetic flux would not necessarily exhibit extremely active chromosphere.
Energy Technology Data Exchange (ETDEWEB)
Muñoz-Jaramillo, Andrés; Windmueller, John C.; Amouzou, Ernest C.; Longcope, Dana W. [Department of Physics, Montana State University, Bozeman, MT 59717 (United States); Senkpeil, Ryan R. [Department of Physics, Purdue University, West Lafayette, IN 47907 (United States); Tlatov, Andrey G. [Kislovodsk Mountain Astronomical Station of the Pulkovo Observatory, Kislovodsk 357700 (Russian Federation); Nagovitsyn, Yury A. [Pulkovo Astronomical Observatory, Russian Academy of Sciences, St. Petersburg 196140 (Russian Federation); Pevtsov, Alexei A. [National Solar Observatory, Sunspot, NM 88349 (United States); Chapman, Gary A.; Cookson, Angela M. [San Fernando Observatory, Department of Physics and Astronomy, California State University Northridge, Northridge, CA 91330 (United States); Yeates, Anthony R. [Department of Mathematical Sciences, Durham University, South Road, Durham DH1 3LE (United Kingdom); Watson, Fraser T. [National Solar Observatory, Tucson, AZ 85719 (United States); Balmaceda, Laura A. [Institute for Astronomical, Terrestrial and Space Sciences (ICATE-CONICET), San Juan (Argentina); DeLuca, Edward E. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Martens, Petrus C. H., E-mail: munoz@solar.physics.montana.edu [Department of Physics and Astronomy, Georgia State University, Atlanta, GA 30303 (United States)
2015-02-10
In this work, we take advantage of 11 different sunspot group, sunspot, and active region databases to characterize the area and flux distributions of photospheric magnetic structures. We find that, when taken separately, different databases are better fitted by different distributions (as has been reported previously in the literature). However, we find that all our databases can be reconciled by the simple application of a proportionality constant, and that, in reality, different databases are sampling different parts of a composite distribution. This composite distribution is made up by linear combination of Weibull and log-normal distributions—where a pure Weibull (log-normal) characterizes the distribution of structures with fluxes below (above) 10{sup 21}Mx (10{sup 22}Mx). Additionally, we demonstrate that the Weibull distribution shows the expected linear behavior of a power-law distribution (when extended to smaller fluxes), making our results compatible with the results of Parnell et al. We propose that this is evidence of two separate mechanisms giving rise to visible structures on the photosphere: one directly connected to the global component of the dynamo (and the generation of bipolar active regions), and the other with the small-scale component of the dynamo (and the fragmentation of magnetic structures due to their interaction with turbulent convection)
BURNY-SQUID, 2-D Burnup of UO2 and Mix UO2 PuO2 Fuel in X-Y or R-Z Geometry
International Nuclear Information System (INIS)
Rosa, I.; Zara, G.; Guidotti, R.
1974-01-01
1 - Nature of physical problem solved: - Multigroup neutron diffusion and burnup equations for two- to five- energy groups over a rectangular region of the x-y or r-z plane. - For a given geometry and initial enrichment, it calculates the two- to five- group flux distributions, the nuclides burnt in a time step t, and then the flux distribution again. This process is repeated until the maximum burn-up is reached. - Criticality search by uniform variation of a control isotope. - Solution of problems with fuel having different geometrical parameters, by means of super-compositions. - Recycle and restart options are available. - UO 2 and PUO 2 -UO 2 fuel can be handled. 2 - Method of solution: The zero-dimension burn-up program RIBOT-5 is coupled with the two-dimension program SQUID and alternately executed. The differential equations are solved by the difference method. 3 - Restrictions on the complexity of the problem: 200 maximum number of compositions 10,000 maximum number of mesh points 5 maximum Number of groups. 4 maximum number of super-compositions. Diagonal symmetry allowed
SOHO sees right through the Sun, and finds sunspots on the far side
2000-03-01
The story is told today in the journal Science by Charles Lindsey of Tucson, Arizona, and Doug Braun of Boulder, Colorado. They realised that the analytical witchcraft called helioseismic holography might open a window right through the Sun. And the technique worked when they used it to decode waves seen on the visible surface by one of SOHO's instruments, the Michelson Doppler Imager, or MDI. "We've known for ten years that in theory we could make the Sun transparent all the way to the far side," said Charles Lindsey. "But we needed observations of exceptional quality. In the end we got them, from MDI on SOHO." For more than 100 years scientists have been aware that groups of dark sunspots on the Sun's visible face are often the scene of flares and other eruptions. Nowadays they watch the Sun more closely than ever, because modern systems are much more vulnerable to solar disturbances than old-style technology was. The experts can still be taken by surprise, because the Sun turns on its axis. A large group of previously hidden sunspots can suddenly swing into view on the eastern (left-hand) edge of the Sun. It may already be blazing away with menacing eruptions. With a far-side preview of sunspots, nasty shocks for the space weather forecasters may now be avoidable. Last year, French and Finnish scientists used SWAN, another instrument on SOHO, to detect activity on the far side. They saw an ultraviolet glow lighting up gas in the Solar System beyond the Sun, and moving across the sky like a lighthouse beam as the Sun rotated. The method used by Lindsey and Braun with MDI data is completely different, and it pinpoints the source of the activity on the far side. Solar seismology chalks up another success Detection of sound waves reverberating through the Sun opened its gassy interior for investigation, in much the same way as seismologists learned to explore the Earth's rocky interior with earthquake waves. Using special telescopes on the ground and in space
Sunspot Light Walls Suppressed by Nearby Brightenings
Energy Technology Data Exchange (ETDEWEB)
Yang, Shuhong; Zhang, Jun; Hou, Yijun; Li, Xiaohong [CAS Key Laboratory of Solar Activity, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China); Erdélyi, Robertus [Solar Physics and Space Plasma Research Centre, School of Mathematics and Statistics, University of Sheffield, Hicks Building, Hounsfield Road, Sheffield S3 7RH (United Kingdom); Yan, Limei, E-mail: shuhongyang@nao.cas.cn [Key Laboratory of Earth and Planetary Physics, Institute of Geology and Geophysics, Chinese Academy of Sciences, Beijing 100029 (China)
2017-07-01
Light walls, as ensembles of oscillating bright structures rooted in sunspot light bridges, have not been well studied, although they are important for understanding sunspot properties. Using the Interface Region Imaging Spectrograph and Solar Dynamics Observatory observations, here we study the evolution of two oscillating light walls each within its own active region (AR). The emission of each light wall decays greatly after the appearance of adjacent brightenings. For the first light wall, rooted within AR 12565, the average height, amplitude, and oscillation period significantly decrease from 3.5 Mm, 1.7 Mm, and 8.5 minutes to 1.6 Mm, 0.4 Mm, and 3.0 minutes, respectively. For the second light wall, rooted within AR 12597, the mean height, amplitude, and oscillation period of the light wall decrease from 2.1 Mm, 0.5 Mm, and 3.0 minutes to 1.5 Mm, 0.2 Mm, and 2.1 minutes, respectively. Particularly, a part of the second light wall even becomes invisible after the influence of a nearby brightening. These results reveal that the light walls are suppressed by nearby brightenings. Considering the complex magnetic topology in light bridges, we conjecture that the fading of light walls may be caused by a drop in the magnetic pressure, where the flux is canceled by magnetic reconnection at the site of the nearby brightening. Another hypothesis is that the wall fading is due to the suppression of driver source ( p -mode oscillation), resulting from the nearby avalanche of downward particles along reconnected brightening loops.
LOOKING FOR GRANULATION AND PERIODICITY IMPRINTS IN THE SUNSPOT TIME SERIES
Energy Technology Data Exchange (ETDEWEB)
Lopes, Ilídio [Centro Multidisciplinar de Astrofísica, Instituto Superior Técnico, Universidade de Lisboa, Av. Rovisco Pais, 1049-001 Lisboa (Portugal); Silva, Hugo G., E-mail: ilidio.lopes@tecnico.ulisboa.pt, E-mail: hgsilva@uevora.pt [Departamento de Física, ECT, Instituto de Ciências da Terra, Universidade de Évora, Rua Romão Ramalho 59, 7002-554 Évora (Portugal)
2015-05-10
The sunspot activity is the end result of the cyclic destruction and regeneration of magnetic fields by the dynamo action. We propose a new method to analyze the daily sunspot areas data recorded since 1874. By computing the power spectral density of daily data series using the Mexican hat wavelet, we found a power spectrum with a well-defined shape, characterized by three features. The first term is the 22 yr solar magnetic cycle, estimated in our work to be 18.43 yr. The second term is related to the daily volatility of sunspots. This term is most likely produced by the turbulent motions linked to the solar granulation. The last term corresponds to a periodic source associated with the solar magnetic activity, for which the maximum power spectral density occurs at 22.67 days. This value is part of the 22–27 day periodicity region that shows an above-average intensity in the power spectra. The origin of this 22.67 day periodic process is not clearly identified, and there is a possibility that it can be produced by convective flows inside the star. The study clearly shows a north–south asymmetry. The 18.43 yr periodical source is correlated between the two hemispheres, but the 22.67 day one is not correlated. It is shown that toward the large timescales an excess occurs in the northern hemisphere, especially near the previous two periodic sources. To further investigate the 22.67 day periodicity, we made a Lomb–Scargle spectral analysis. The study suggests that this periodicity is distinct from others found nearby.
A study of Solar-Enso correlation with southern Brazil tree ring index (1955- 1991)
Rigozo, N.; Nordemann, D.; Vieira, L.; Echer, E.
The effects of solar activity and El Niño-Southern Oscillation on tree growth in Southern Brazil were studied by correlation analysis. Trees for this study were native Araucaria (Araucaria Angustifolia)from four locations in Rio Grande do Sul State, in Southern Brazil: Canela (29o18`S, 50o51`W, 790 m asl), Nova Petropolis (29o2`S, 51o10`W, 579 m asl), Sao Francisco de Paula (29o25`S, 50o24`W, 930 m asl) and Sao Martinho da Serra (29o30`S, 53o53`W, 484 m asl). From these four sites, an average tree ring Index for this region was derived, for the period 1955-1991. Linear correlations were made on annual and 10 year running averages of this tree ring Index, of sunspot number Rz and SOI. For annual averages, the correlation coefficients were low, and the multiple regression between tree ring and SOI and Rz indicates that 20% of the variance in tree rings was explained by solar activity and ENSO variability. However, when the 10 year running averages correlations were made, the coefficient correlations were much higher. A clear anticorrelation is observed between SOI and Index (r=-0.81) whereas Rz and Index show a positive correlation (r=0.67). The multiple regression of 10 year running averages indicates that 76% of the variance in tree ring INdex was explained by solar activity and ENSO. These results indicate that the effects of solar activity and ENSO on tree rings are better seen on long timescales.
Fine structure in sunspots. IV. Penumbral grains in speckle reconstucted images
Czech Academy of Sciences Publication Activity Database
Sobotka, Michal; Suetterlin, P.
2001-01-01
Roč. 380, č. 2 (2001), s. 714-718 ISSN 0004-6361 R&D Projects: GA AV ČR KSK2043105; GA AV ČR IAA3003903 Institutional research plan: CEZ:AV0Z1003909 Keywords : sun * sunspots Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.790, year: 2000
Photometry of long-period Algol binaries. VI. Multicolor photometric solutions for RZ Cancri
Energy Technology Data Exchange (ETDEWEB)
Olson, E.C. (Illinois Univ., Urbana (USA))
1989-09-01
New intermediate-band photometry of the late-giant eclipsing system RZ CNc is used to obtain photometric solutions, both with the Popper (1976) spectroscopic mass ratio and by allowing the mass ratio and gravity-darkening coefficients to vary. New y observations are combined with earlier V data of Lenouvel (1957) and Broglia and Conconi (1973) in one solution set. Additional solutions are obtained from the new observations. The mean photometric mass ratio is somewhat larger than Popper's spectroscopic values; the general indeterminacy of photometric solutions may explain this apparent discrepancy. Possible photometric effects of a mass-transferring stream are discussed, and it is concluded that such effects cannot account for the mass-ratio discrepancy. 26 refs.
Photometry of long-period Algol binaries. VI. Multicolor photometric solutions for RZ Cancri
International Nuclear Information System (INIS)
Olson, E.C.
1989-01-01
New intermediate-band photometry of the late-giant eclipsing system RZ CNc is used to obtain photometric solutions, both with the Popper (1976) spectroscopic mass ratio and by allowing the mass ratio and gravity-darkening coefficients to vary. New y observations are combined with earlier V data of Lenouvel (1957) and Broglia and Conconi (1973) in one solution set. Additional solutions are obtained from the new observations. The mean photometric mass ratio is somewhat larger than Popper's spectroscopic values; the general indeterminacy of photometric solutions may explain this apparent discrepancy. Possible photometric effects of a mass-transferring stream are discussed, and it is concluded that such effects cannot account for the mass-ratio discrepancy. 26 refs
Are climatological correlations with the Hale double sunspot cycle meaningful
International Nuclear Information System (INIS)
Goldberg, R.A.; Herman, J.R.
1975-09-01
A sunspot cycle which may have been subject to a predicted phase reversal between 1800 and 1880 A.D. is discussed. Several climatological parameters normally correlated with this cycle are examined and do not exhibit a corresponding phase reversal during this period. It is proposed that this apparent discrepency can be resolved by suitable observations during the upcoming half decade
The Formation of a Sunspot Penumbra Sector in Active Region NOAA 12574
Li, Qiaoling; Yan, Xiaoli; Wang, Jincheng; Kong, DeFang; Xue, Zhike; Yang, Liheng; Cao, Wenda
2018-04-01
We present a particular case of the formation of a penumbra sector around a developing sunspot in the active region NOAA 12574 on 2016 August 11 by using the high-resolution data observed by the New Solar Telescope at the Big Bear Solar Observatory and the data acquired by the Helioseismic and Magnetic Imager and the Atmospheric Imaging Assembly on board the Solar Dynamics Observatory satellite. Before the new penumbra sector formed, the developing sunspot already had two umbrae with some penumbral filaments. The penumbra sector gradually formed at the junction of two umbrae. We found that the formation of the penumbra sector can be divided into two stages. First, during the initial stage of penumbral formation, the region where the penumbra sector formed always appeared blueshifted in a Dopplergram. The area, mean transverse magnetic field strength, and total magnetic flux of the umbra and penumbra sector all increased with time. The initial penumbral formation was associated with magnetic emergence. Second, when the penumbra sector appeared, the magnetic flux and area of the penumbra sector increased after the umbra’s magnetic flux and area decreased. These results indicate that the umbra provided magnetic flux for penumbral development after the penumbra sector appeared. We also found that the newly formed penumbra sector was associated with sunspot rotation. Based on these findings, we suggest that the penumbra sector was the result of the emerging flux that was trapped in the photosphere at the initial stage of penumbral formation, and when the rudimentary penumbra formed, the penumbra sector developed at the cost of the umbra.
Temperature mapping of sunspots and pores from speckle reconstructed three colour photometry
Sütterlin, P.; Wiehr, E.
1998-01-01
The two-dimensional temperature distribution in a highly structured sunspot and in two small umbrae is determined from a three-colour photometry in narrow spectral continua. Disturbing influences from the earths atmosphere are removed by speckle masking techniques, yielding a spatial resolution
Directory of Open Access Journals (Sweden)
Robitaille P.-M.
2011-07-01
Full Text Available Father Angelo Secchi used the existence of solar granulation as a central line of rea- soning when he advanced that the Sun was a gaseous body with a photosphere contain- ing incandescent particulate matter (Secchi A. Sulla Struttura della Fotosfera Solare. Bullettino Meteorologico dell’Osservatorio del Collegio Romano , 30 November 1864, v.3(11, 1–3. Secchi saw the granules as condensed matter emitting the photospheric spectrum, while the darkened intergranular lanes conveyed the presence of a gaseous solar interior. Secchi also considered the nature of sunspots and limb darkening. In the context of modern solar models, opacity arguments currently account for the emis- sive properties of the photosphere. Optical depth is thought to explain limb darkening. Both temperature variations and magnetic fields are invoked to justify the weakened emissivities of sunspots, even though the presence of static magnetic fields in materi- als is not usually associated with modified emissivity. Conversely, within the context of a liquid metallic hydrogen solar model, the appearance of granules, limb darkening, and sunspots can be elegantly understood through the varying directional emissivity of condensed matter. A single explanation is applicable to all three phenomena. Granular contrast can be directly associated with the generation of limb darkening. Depending on size, granules can be analyzed by considering Kolmogoroff’s formulations and B ́ enard convection, respectively, both of which were observed using incompressible liquids, not gases. Granules follow the 2-dimensional space filling laws of Aboav-Weiner and Lewis. Their adherence to these structural laws provides supportive evidence that the granular surface of the Sun represents elements which can only be constructed from condensed matter. A gaseous Sun cannot be confined to a 2-dimensional framework. Mesogranules, supergranules, and giant cells constitute additional entities which further
Performance of FSO Links using CSRZ, RZ, and NRZ and Effects of Atmospheric Turbulence
Nadeem, Lubna; Saadullah Qazi, M.; Hassam, Ammar
2018-04-01
Free space optical (FSO) communication is a wireless communication technology in which data is transferred from one point to another through highly directed beam of light. The main factors that limit the FSO link availability is the local weather conditions. It guarantees the potential of high bandwidth capacity over unlicensed optical wavelengths. The transmission medium of FSO is atmosphere and is significantly affected by the various weather conditions such as rain, fog, snow, wind, etc. In this paper, the modulation techniques under consideration are RZ, NRZ and CSRZ. Analysis is carried out regarding Q-factor with respect to varying distance, bit rates and input laser power.
Mahmood, Tanvir
Considering the network size, bit rate, spectral and channel capacity limitations, different modulation formats may be selectively used in future optical networks. Although the traditional metropolitan area networks (MANs) still uses the non-return-to-zero on-off keying (NRZ-OOK) modulation format due to its technical simplicity and therefore low cost, QPSK format is more advantageous in spectrally efficient long-haul fiber optic transmission systems because of its constant power envelope, and robustness to various transmission impairments. Consequently, an important problem may arise, in particular how to route the OOK-data streams from MANs to long-haul backbone networks when the state of polarization (SOP) of the remotely generated OOK is unpredictable. Hence, the focus of this dissertation was to investigate a polarization insensitive (PI) all-optical nonlinear optical signal processing (NOSP) method that can be implemented at the network cross-connect (X-connect) to transfer data from a remotely and a locally generated OOK data simultaneously to more effectual QPSK format for long-haul transmission. By utilizing cross-phase modulation (XPM) and inherent birefringence of the device, the work demonstrated, for the first time, PI all-optical data transfer utilizing dual pump-phase transmultiplexing (DPTM) from 2 x 10-GBd OOKs to 10-GBd RZ-QPSK in a passive nonlinear birefringent photonic crystal fiber (PCF). Polarization insensitivity was achieved by scrambling the SOP of the remotely generated OOK pump and launching the locally generated OOK pump and the probe off-axis. To mitigate polarization induced power fluctuations and detrimental effects due to nearby partially degenerate and non-degenerate four wave mixings, an optimum pump-probe detuning was also utilized. The PI DPTM RZ-QPSK demonstrated a pre-amplified receiver sensitivity penalty < 5.5 dB at 10--9 bit-error-rate (BER), relative to relative to the FPGA-precoded RZ-DQPSK baseline in ASE
The Temperature - Magnetic Field Relation in Observed and Simulated Sunspots
Czech Academy of Sciences Publication Activity Database
Sobotka, Michal; Rezaei, R.
2017-01-01
Roč. 292, č. 12 (2017), 188/1-188/12 ISSN 0038-0938 R&D Projects: GA ČR(CZ) GA14-04338S; GA MŠk(CZ) 7E13003 EU Projects: European Commission(XE) 312495 - SOLARNET Institutional support: RVO:67985815 Keywords : sunspots * magnetic fields * comparison Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 2.682, year: 2016
TVEDIM, 2-D Homogeneous and Inhomogeneous Neutron Diffusion for X-Y, R-Z, R-Theta Geometry
International Nuclear Information System (INIS)
Kristiansen, G.K.
1987-01-01
1 - Nature of physical problem solved: The two-dimensional neutron diffusion equation (x-y, r-z, or r-theta geometry is solved, either in the inhomogeneous (source calculation) or the homogeneous form (K eff calculation or absorber adjustment). The boundary conditions specify each group current as a linear homogeneous function of the group fluxes (gamma matrix concept). For each material, the fission matrix is assumed to by dyadic. 2 - Method of solution: Finite difference formulation (5 point scheme, mesh corner variant) is used. Solution technique: multi-line SOR. Eigenvalue estimate by neutron balance
Energy Technology Data Exchange (ETDEWEB)
Chen, Feng; Rempel, Matthias; Fan, Yuhong, E-mail: chenfeng@ucar.edu [High Altitude Observatory, NCAR, P.O. Box 3000, Boulder, CO, 80307 (United States)
2017-09-10
We present a realistic numerical model of sunspot and active region formation based on the emergence of flux bundles generated in a solar convective dynamo. To this end, we use the magnetic and velocity fields in a horizontal layer near the top boundary of the solar convective dynamo simulation to drive realistic radiative-magnetohydrodynamic simulations of the uppermost layers of the convection zone. The main results are as follows. (1) The emerging flux bundles rise with the mean speed of convective upflows and fragment into small-scale magnetic elements that further rise to the photosphere, where bipolar sunspot pairs are formed through the coalescence of the small-scale magnetic elements. (2) Filamentary penumbral structures form when the sunspot is still growing through ongoing flux emergence. In contrast to the classical Evershed effect, the inflow seems to prevail over the outflow in a large part of the penumbra. (3) A well-formed sunspot is a mostly monolithic magnetic structure that is anchored in a persistent deep-seated downdraft lane. The flow field outside the spot shows a giant vortex ring that comprises an inflow below 15 Mm depth and an outflow above 15 Mm depth. (4) The sunspots successfully reproduce the fundamental properties of the observed solar active regions, including the more coherent leading spots with a stronger field strength, and the correct tilts of bipolar sunspot pairs. These asymmetries can be linked to the intrinsic asymmetries in the magnetic and flow fields adapted from the convective dynamo simulation.
BURNY-SQUID, 2-D Burnup of UO{sub 2} and Mix UO{sub 2} PuO{sub 2} Fuel in X-Y or R-Z Geometry
Energy Technology Data Exchange (ETDEWEB)
Rosa, I; Zara, G; Guidotti, R [ENEL-DCO, Via G.B. Martini, 3, 00198 Rome (Italy)
1974-08-01
1 - Nature of physical problem solved: - Multigroup neutron diffusion and burnup equations for two- to five- energy groups over a rectangular region of the x-y or r-z plane. - For a given geometry and initial enrichment, it calculates the two- to five- group flux distributions, the nuclides burnt in a time step t, and then the flux distribution again. This process is repeated until the maximum burn-up is reached. - Criticality search by uniform variation of a control isotope. - Solution of problems with fuel having different geometrical parameters, by means of super-compositions. - Recycle and restart options are available. - UO{sub 2} and PUO{sub 2}-UO{sub 2} fuel can be handled. 2 - Method of solution: The zero-dimension burn-up program RIBOT-5 is coupled with the two-dimension program SQUID and alternately executed. The differential equations are solved by the difference method. 3 - Restrictions on the complexity of the problem: 200 maximum number of compositions 10,000 maximum number of mesh points 5 maximum Number of groups. 4 maximum number of super-compositions. Diagonal symmetry allowed.
The mutual attraction of magnetic knots. [solar hydromagnetic instability in sunspot regions
Parker, E. N.
1978-01-01
It is observed that the magnetic knots associated with active regions on the sun have an attraction for each other during the formative period of the active regions, when new magnetic flux is coming to the surface. The attraction disappears when new flux ceases to rise through the surface. Then the magnetic spots and knots tend to come apart, leading to disintegration of the sunspots previously formed. The dissolution of the fields is to be expected, as a consequence of the magnetic repulsion of knots of like polarity and as a consequence of the hydromagnetic exchange instability. The purpose of this paper is to show that the mutual attraction of knots during the formative stages of a sunspot region may be understood as the mutual hydrodynamic attraction of the rising flux tubes. Two rising tubes attract each other, as a consequence of the wake of the leading tube when one is moving behind the other, and as a consequence of the Bernoulli effect when rising side by side.
Energy Technology Data Exchange (ETDEWEB)
Wang, Ya; Su, Yingna; Hong, Zhenxiang; Ji, Haisheng [Key Laboratory of DMSA, Purple Mountain Observatory, CAS, Nanjing, 210008 (China); Zeng, Zhicheng; Goode, Philip R.; Cao, Wenda [Big Bear Solar Observatory, 40386 North Shore Lane, Big Bear City, CA 92314 (United States); Ji, Kaifan [Yunnan Astronomical Observatories, Kunming 650011 (China)
2016-12-20
In this paper, we report our first-step results of high resolution He i 10830 Å narrow-band imaging (bandpass: 0.5 Å) of an M1.8 class two-ribbon flare on 2012 July 5. The flare was observed with the 1.6 m aperture New Solar Telescope at Big Bear Solar Observatory. For this unique data set, sunspot dynamics during flaring were analyzed for the first time. By directly imaging the upper chromosphere, running penumbral waves are clearly seen as an outward extension of umbral flashes; both take the form of absorption in the 10830 Å narrow-band images. From a space–time image made of a slit cutting across a flare ribbon and the sunspot, we find that the dark lanes for umbral flashes and penumbral waves are obviously broadened after the flare. The most prominent feature is the sudden appearance of an oscillating absorption strip inside the ribbon when it sweeps into the sunspot’s penumbral and umbral regions. During each oscillation, outwardly propagating umbral flashes and subsequent penumbral waves rush out into the inwardly sweeping ribbon, followed by a return of the absorption strip with similar speed. We tentatively explain the phenomena as the result of a sudden increase in the density of ortho-helium atoms in the area of the sunspot being excited by the flare’s extreme ultraviolet illumination. This explanation is based on the observation that 10830 Å absorption around the sunspot area gets enhanced during the flare. Nevertheless, questions are still open and we need further well-devised observations to investigate the behavior of sunspot dynamics during flares.
Hewagama, Tilak; Deming, Drake; Jennings, Donald E.; Osherovich, Vladimir; Wiedemann, Gunter; Zipoy, David; Mickey, Donald L.; Garcia, Howard
1993-01-01
Polarimetric observations at 12 microns of two sunpots are reported. The horizontal distribution of parameters such as magnetic field strength, inclination, azimuth, and magnetic field filling factors are presented along with information about the height dependence of the magnetic field strength. Comparisons with contemporary magnetostatic sunspot models are made. The magnetic data are used to estimate the height of 12 micron line formation. From the data, it is concluded that within a stable sunspot there are no regions that are magnetically filamentary, in the sense of containing both strong-field and field-free regions.
Preliminary results from the orbiting solar observatory 8: Transition-zone dynamics over a sunspot
International Nuclear Information System (INIS)
Bruner, E.C. Jr.; Chipman, E.G.; Lites, B.W.; Rottman, G.J.; Shine, R.A.; Athay, R.G.; White, O.R.
1976-01-01
The University of Colorado experiment aboard OSO-8 observed the C IV 1548 A line in the bright plume over a sunspot. Transient redshifts at 5 minute intervals were studied, but the expected phenomena associated with simple Alfven wave effects were not observed
WAVES AS THE SOURCE OF APPARENT TWISTING MOTIONS IN SUNSPOT PENUMBRAE
International Nuclear Information System (INIS)
Bharti, L.; Cameron, R. H.; Hirzberger, J.; Solanki, S. K.; Rempel, M.
2012-01-01
The motion of dark striations across bright filaments in a sunspot penumbra has become an important new diagnostic of convective gas flows in penumbral filaments. The nature of these striations has, however, remained unclear. Here, we present an analysis of small-scale motions in penumbral filaments in both simulations and observations. The simulations, when viewed from above, show fine structure with dark lanes running outward from the dark core of the penumbral filaments. The dark lanes either occur preferentially on one side or alternate between both sides of the filament. We identify this fine structure with transverse (kink) oscillations of the filament, corresponding to a sideways swaying of the filament. These oscillations have periods in the range of 5-7 minutes and propagate outward and downward along the filament. Similar features are found in observed G-band intensity time series of penumbral filaments in a sunspot located near disk center obtained by the Broadband Filter Imager on board the Hinode. We also find that some filaments show dark striations moving to both sides of the filaments. Based on the agreement between simulations and observations we conclude that the motions of these striations are caused by transverse oscillations of the underlying bright filaments.
Directory of Open Access Journals (Sweden)
Y. Brugnara
2013-07-01
Full Text Available Here we present a study of the 11 yr sunspot cycle's imprint on the Northern Hemisphere atmospheric circulation, using three recently developed gridded upper-air data sets that extend back to the early twentieth century. We find a robust response of the tropospheric late-wintertime circulation to the sunspot cycle, independent from the data set. This response is particularly significant over Europe, although results show that it is not directly related to a North Atlantic Oscillation (NAO modulation; instead, it reveals a significant connection to the more meridional Eurasian pattern (EU. The magnitude of mean seasonal temperature changes over the European land areas locally exceeds 1 K in the lower troposphere over a sunspot cycle. We also analyse surface data to address the question whether the solar signal over Europe is temporally stable for a longer 250 yr period. The results increase our confidence in the existence of an influence of the 11 yr cycle on the European climate, but the signal is much weaker in the first half of the period compared to the second half. The last solar minimum (2005 to 2010, which was not included in our analysis, shows anomalies that are consistent with our statistical results for earlier solar minima.
International Nuclear Information System (INIS)
Hardersen, Paul S.; Balasubramaniam, K. S.; Shkolyar, Svetlana
2013-01-01
This work utilizes Improved Solar Observing Optical Network continuum (630.2 nm) and Hα (656.2 nm) data to: (1) detect and measure intrinsic sunspot rotations occurring in the photosphere and chromosphere, (2) identify and measure chromospheric filament mass motions, and (3) assess any large-scale photospheric and chromospheric mass couplings. Significant results from 2003 October 27-29, using the techniques of Brown et al., indicate significant counter-rotation between the two large sunspots in NOAA AR 10486 on October 29, as well as discrete filament mass motions in NOAA AR 10484 on October 27 that appear to be associated with at least one C-class solar flare
Czech Academy of Sciences Publication Activity Database
Honzátko, Pavel; Karásek, Miroslav
2010-01-01
Roč. 283, č. 10 (2010), s. 2061-2065 ISSN 0030-4018 R&D Projects: GA AV ČR 1ET300670502; GA MŠk OE08021; GA ČR GAP102/10/0120 Institutional research plan: CEZ:AV0Z20670512 Keywords : RZ-to-NRZ modulation format conversion * Fiber cross phase modulation * Nonlinear optical loop mirror Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.517, year: 2010
Flow and magnetic field properties in the trailing sunspots of active region NOAA 12396
Czech Academy of Sciences Publication Activity Database
Verma, M.; Denker, C.; Boehm, F.; Balthasar, H.; Fischer, C.E.; Kuckein, C.; Gonzalez, N.B.; Berkefeld, T.; Collados Vera, M.; Diercke, A.; Feller, A.; Gonzalez Manrique, S. J.; Hofmann, A.; Lagg, A.; Nicklas, H.; Orozco Suárez, D.; Pator Yabar, A.; Rezaei, R.; Schlichenmaier, R.; Schmidt, D.; Schmidt, W.; Sigwarth, M.; Sobotka, Michal; Solanki, S.K.; Soltau, D.; Staude, J.; Strassmeier, K.G.; Volkmer, R.; von der Lühe, O.; Waldmann, T.A.
2016-01-01
Roč. 337, č. 10 (2016), s. 1090-1098 ISSN 0004-6337. [Dynamic Sun - Exploring the Many Facets of Solar Eruptive Events. Potsdam, 26.10. 2015 -29.10. 2015 ] Institutional support: RVO:67985815 Keywords : Sun * magnetic fields * sunspots Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.916, year: 2016
Yau, K.
2001-12-01
A prolonged decrease in the Sun's irradiance during the Maunder Minimum has been proposed as a cause of the Little Ice Age ({ca} 1600-1800). Eddy [{Science} {192}, 1976, 1189] made this suggestion after noting that very few sunspots were observed from 1645 to 1715, indicative of a weakened Sun. Pre-telescopic Oriental sunspot records go back over 2200 years. Periods when no sunspots were seen have been documented by, {eg}, Clark [{Astron} {7}, 2/1979, 50]. Abundances of C 14 in tree rings and Be10 in ice cores are also good indicators of past solar activity. These isotopes are produced by cosmic rays high in the atmosphere. When the Sun is less active more of them are made and deposited at ground level. There is thus a strong {negative} correlation between their abundances and sunspot counts. Minima of solar activity in tree rings and a south polar ice core have been collated by, {eg}, Bard [{Earth Planet Sci Lett} {150} 1997, 453]; and show striking correspondence with periods when no sunspots were seen, centered at {ca} 900, 1050, 1500, 1700. Pang and Yau [{Eos} {79}, #45, 1998, F149] investigated the Medieval Minimum at 700, using in addition the frequency of auroral sighting7s, a good indicator of solar activity too [Yau, PhD thesis, 1988]; and found that the progression of minima in solar activity goes back to 700. Auroral frequency, C 14 and Be 10 concentrations are also affected by variations in the geomagnetic field. Deposition changes can also influence C 14 and Be 10 abundances. Sunspot counts are thus the only true indicator of solar activity. The Sun's bolometric variations (-0.3% for the Maunder Minimum) can contribute to climatic changes (\\0.5° C for the Little Ice Age)[{eg}, Lean, {GRL} {22}, 1995, 3195]. For times with no thermometer data, temperature can be estimated from, {eg}, Oxygen 18 isotopic abundance in ice cores, which in turn depends on the temperature of the ocean water it evaporated from. We have linked the Medieval Minimum to the cold
Fully Automated Sunspot Detection and Classification Using SDO HMI Imagery in MATLAB
2014-03-27
initiating the java program scripted to communicate with the SOON telescope used for continual observation of the sun. The SOON telescope is used at...proximity of spots refers to the angular separation between different spots that could make up a group. The area of each sunspot means the total area...degrees and the different magnetic polarities of each spot being considered. For a spot pair that has the same polarity and small angular separation
Parametric amplification and phase preserving amplitude regeneration of a 640 Gbit/s RZ-DPSK signal
DEFF Research Database (Denmark)
Lali-Dastjerdi, Zohreh; Galili, Michael; Mulvad, Hans Christian Hansen
2013-01-01
We report the first experimental demonstration of parametric amplification and all-optical phase-preserving amplitude regeneration for a 640 Gbit/s return-to-zero (RZ) differential phase-shift keying (DPSK) optical time division multiplexed (OTDM) signal. In the designed gain-flattened single......-pump fiber optical parametric amplifier (FOPA), 620 fs short optical pulses are successfully amplified with 15 dB gain with error-free performance and less than 1 dB power penalty. Phase-preserving amplitude regeneration based on gain saturation in the FOPA is carried out for optical signals with degraded...... optical signal-to-noise ratio. An improvement of 2.2 dB in receiver sensitivity at a bit-error-ratio of 10−9 has been successfully achieved after regeneration, together with 13.3 dB net gain....
International Nuclear Information System (INIS)
Tiwari, Sanjiv K.; Moore, Ronald L.; Winebarger, Amy R.; Alpert, Shane E.
2016-01-01
Penumbral microjets (PJs) are transient narrow bright features in the chromosphere of sunspot penumbrae, first characterized by Katsukawa et al. using the Ca ii H-line filter on Hinode's Solar Optical Telescope (SOT). It was proposed that the PJs form as a result of reconnection between two magnetic components of penumbrae (spines and interspines), and that they could contribute to the transition region (TR) and coronal heating above sunspot penumbrae. We propose a modified picture of formation of PJs based on recent results on the internal structure of sunspot penumbral filaments. Using data of a sunspot from Hinode/SOT, High Resolution Coronal Imager, and different passbands of the Atmospheric Imaging Assembly (AIA) on board the Solar Dynamics Observatory, we examine whether PJs have signatures in the TR and corona. We find hardly any discernible signature of normal PJs in any AIA passbands, except for a few of them showing up in the 1600 Å images. However, we discovered exceptionally stronger jets with similar lifetimes but bigger sizes (up to 600 km wide) occurring repeatedly in a few locations in the penumbra, where evidence of patches of opposite-polarity fields in the tails of some penumbral filaments is seen in Stokes-V images. These tail PJs do display signatures in the TR. Whether they have any coronal-temperature plasma is unclear. We infer that none of the PJs, including the tail PJs, directly heat the corona in active regions significantly, but any penumbral jet might drive some coronal heating indirectly via the generation of Alfvén waves and/or braiding of the coronal field
Observations of the birth and fine structure of sunspot penumbrae
International Nuclear Information System (INIS)
Collados, M.; Garcia de la Rosa, J.I.; Moreno-Insertis, F.; Vazquez, M.
1985-01-01
High resolution white-light pictures of sunspot penumbrae are presented. These include pictures showing details of their filamentary structure and some instances of birth of a penumbra. The observations are discussed in the framework of current penumbra theories. A series of pictures have been presented, which give additional evidence of the existence of dark penumbral filaments as individual structures. With respect to the birth of the penumbra some new observational aspects can be seen. The existence of the filamentary penumbra even in the first moments, its non uniformity and its short length are the major aspects derived from the pictures
SCORE-4, 2-D Removal Diffusion in X-Y or R-Z Geometry for Rectangular Shields
International Nuclear Information System (INIS)
Richardson, B.L.
1974-01-01
1 - Nature of physical problem solved: The neutron flux is calculated for a shield made up of rectangular regions. The geometry is either x-y or r-z. 2 - Method of solution: Removal fluxes and sources throughout the shield regions are calculated from a given reactor core power distribution using a point kernel method. The diffusion neutron fluxes are obtained from the removal source distribution using an iterative Method of solution. 3 - Restrictions on the complexity of the problem: The amount of fast core required for the program depends on the size of shield being calculated. For example, a 100 by 100 mesh shielding calculation would require approximately 300 k bytes. Larger problems could be solved by increasing the fast storage requirements
Sunspots and the physics of magnetic flux tubes in the sun
International Nuclear Information System (INIS)
Ballegooijen, A.A. van.
1982-01-01
This thesis refers to the sub-surface structure of the solar magnetic field. Following an introductory chapter, chapter II presents an analysis of spectroscopic observations of a sunspot at infrared wavelengths and models of the temperature stratification in the sunspot atmosphere are derived. The main subject of this thesis concerns the structure of the magnetic field deep down below the stellar surface, near the base of the convective envelope. In Chapter III the stability of toroidal flux tubes to wave-like perturbations is discussed, assuming that the tubes are neutrally buoyant. A model is proposed in which the toroidal flux tubes are neutrally buoyant and located in a stably stratified layer just below the base of the convective zone. On the basis of some simple assumptions for the temperature stratification in this storage layer the author considers in Chapter IV the properties of the vertical flux tubes in the convective zone. The adiabatic flux model cannot satisfactorily be applied to the simplified model of the storage layer, so that the problem of magnetic flux storage is reconsidered in Chapter V. A new model of the temperature stratification at the interface of convective zone and radiative interior of the sun is described. Finally, in Chapter VI, the stability of toroidal flux tubes in a differentially rotating star are discussed. It is demonstrated that for realistic values of the magnetic field strength, rotation has a strong effect on the stability of the toroidal flux tubes. (C.F.)
Sunspots and the physics of magnetic flux tubes. II. Aerodynamic drag
International Nuclear Information System (INIS)
Parker, E.N.
1979-01-01
The aerodynamic drag on a slender flux tube stretched vertically across a convective cell may push the flux tube into the updrafts or into the downdrafts, depending on the density stratification of the convecting fluid and the asymmetry of the fluid motions. The drag is approximately proportional to the local kinetic energy density, so the density stratification weights the drag in favor of the upper layers where the density is low, tending to push the vertical tube into the downdrafts. If, however, the horizontal motions in the convective cell are concentrated toward the bottom of the cell, they may dominate over the upper layers, pushing the tube into the updrafts. In the simple, idealized circumstance of a vertical tube extending across a fluid of uniform density in a convective cell that is symmetric about its midplane, the net aerodynamic drag vanishes in lowest order. The higher order contributions, including the deflection of the tube, then provide a nonvanishing force pushing the tube into a stable equilibrium midway between the updraft and the downdraft.It is pointed out that in the strongly stratified convective zone of the Sun, a downdraft herds flux tubes together into a cluster, while an updraft disperses them. To account for the observed strong cohesion of the cluster of flux tubes that make up a sunspot, we propose a downdraft of the order 2 km s - 1 through the cluster of seprate tubes beneath the sunspot
Energy Technology Data Exchange (ETDEWEB)
Sanford, T.W.L.; Mock, R.C.; Marder, B.M. [and others
1997-12-01
A systematic study of annular aluminum-wire z-pinches on the Saturn accelerator shows that the quality of the implosion, (as measured by the radial convergence, the radiated energy, pulse width, and power), increases with wire number. Radiation magnetohydrodynamic (RMHC) xy simulations suggest that the implosion transitions from that of individual wire plasmas to that of a continuous plasma shell when the interwire spacing is reduced below {approximately} 1.4 mm. In this plasma-shell regime, many of the global radiation and plasma characteristics are in agreement with those simulated by 2D-RMHC rz simulations. In this regime, measured changes in the radiation pulse width with variations in load mass and array radius are consistent with the simulations and are explained by the development of 2D fluid motion in the rz plane. Associated variations in the K-shell yield are qualitatively explained by simple radiation-scaling models.
International Nuclear Information System (INIS)
Sanford, T.W.L.; Mock, R.C.; Marder, B.M.
1997-01-01
A systematic study of annular aluminum-wire z-pinches on the Saturn accelerator shows that the quality of the implosion, (as measured by the radial convergence, the radiated energy, pulse width, and power), increases with wire number. Radiation magnetohydrodynamic (RMHC) xy simulations suggest that the implosion transitions from that of individual wire plasmas to that of a continuous plasma shell when the interwire spacing is reduced below ∼ 1.4 mm. In this plasma-shell regime, many of the global radiation and plasma characteristics are in agreement with those simulated by 2D-RMHC rz simulations. In this regime, measured changes in the radiation pulse width with variations in load mass and array radius are consistent with the simulations and are explained by the development of 2D fluid motion in the rz plane. Associated variations in the K-shell yield are qualitatively explained by simple radiation-scaling models
Sanford, T. W. L.; Mock, R. C.; Marder, B. M.; Nash, T. J.; Spielman, R. B.; Peterson, D. L.; Roderick, N. F.; Hammer, J. H.; De Groot, J. S.; Mosher, D.; Whitney, K. G.; Apruzese, J. P.
1997-05-01
A systematic study of annular aluminum-wire z-pinches on the Saturn accelerator shows that the quality of the implosion, (as measured by the radial convergence, the radiated energy, pulse width, and power), increases with wire number. Radiation magnetohydrodynamic (RMHC) xy simulations suggest that the implosion transitions from that of individual wire plasmas to that of a continuous plasma shell when the interwire spacing is reduced below ˜1.4 mm. In this "plasma-shell regime," many of the global radiation and plasma characteristics are in agreement with those simulated by 2D-RMHC rz simulations. In this regime, measured changes in the radiation pulse width with variations in load mass and array radius are consistent with the simulations and are explained by the development of 2D fluid motion in the rz plane. Associated variations in the K-shell yield are qualitatively explained by simple radiation-scaling models.
International Nuclear Information System (INIS)
Sanford, T. W. L.; Mock, R. C.; Marder, B. M.; Nash, T. J.; Spielman, R. B.; Peterson, D. L.; Roderick, N. F.; Hammer, J. H.; De Groot, J. S.; Mosher, D.; Whitney, K. G.; Apruzese, J. P.
1997-01-01
A systematic study of annular aluminum-wire z-pinches on the Saturn accelerator shows that the quality of the implosion, (as measured by the radial convergence, the radiated energy, pulse width, and power), increases with wire number. Radiation magnetohydrodynamic (RMHC) xy simulations suggest that the implosion transitions from that of individual wire plasmas to that of a continuous plasma shell when the interwire spacing is reduced below ∼1.4 mm. In this ''plasma-shell regime,'' many of the global radiation and plasma characteristics are in agreement with those simulated by 2D-RMHC rz simulations. In this regime, measured changes in the radiation pulse width with variations in load mass and array radius are consistent with the simulations and are explained by the development of 2D fluid motion in the rz plane. Associated variations in the K-shell yield are qualitatively explained by simple radiation-scaling models
TILT ANGLE AND FOOTPOINT SEPARATION OF SMALL AND LARGE BIPOLAR SUNSPOT REGIONS OBSERVED WITH HMI
International Nuclear Information System (INIS)
McClintock, B. H.; Norton, A. A.
2016-01-01
We investigate bipolar sunspot regions and how tilt angle and footpoint separation vary during emergence and decay. The Helioseismic and Magnetic Imager on board the Solar Dynamic Observatory collects data at a higher cadence than historical records and allows for a detailed analysis of regions over their lifetimes. We sample the umbral tilt angle, footpoint separation, and umbral area of 235 bipolar sunspot regions in Helioseismic and Magnetic Imager—Debrecen Data with an hourly cadence. We use the time when the umbral area peaks as time zero to distinguish between the emergence and decay periods of each region and we limit our analysis of tilt and separation behavior over time to within ±96 hr of time zero. Tilt angle evolution is distinctly different for regions with small (≈30 MSH), midsize (≈50 MSH), and large (≈110 MSH) maximum umbral areas, with 45 and 90 MSH being useful divisions for separating the groups. At the peak umbral area, we determine median tilt angles for small (7.°6), midsize (5.°9), and large (9.°3) regions. Within ±48 hr of the time of peak umbral area, large regions steadily increase in tilt angle, midsize regions are nearly constant, and small regions show evidence of negative tilt during emergence. A period of growth in footpoint separation occurs over a 72-hr period for all of the regions from roughly 40 to 70 Mm. The smallest bipoles (<9 MSH) are outliers in that they do not obey Joy's law and have a much smaller footpoint separation. We confirm the Muñoz-Jaramillo et al. results that the sunspots appear to be two distinct populations
Variations and Regularities in the Hemispheric Distributions in Sunspot Groups of Various Classes
Gao, Peng-Xin
2018-05-01
The present study investigates the variations and regularities in the distributions in sunspot groups (SGs) of various classes in the northern and southern hemispheres from Solar Cycles (SCs) 12 to 23. Here, we use the separation scheme that was introduced by Gao, Li, and Li ( Solar Phys. 292, 124, 2017), which is based on A/U ( A is the corrected area of the SG, and U is the corrected umbral area of the SG), in order to separate SGs into simple SGs (A/U ≤ 4.5) and complex SGs (A/U > 6.2). The time series of Greenwich photoheliographic results from 1875 to 1976 (corresponding to complete SCs 12 - 20) and Debrecen photoheliographic data during the period 1974 - 2015 (corresponding to complete SCs 21 - 23) are used to show the distributions of simple and complex SGs in the northern and southern hemispheres. The main results we obtain are reported as follows: i) the larger of the maximum annual simple SG numbers in the two hemispheres and the larger of the maximum annual complex SG numbers in the two hemispheres occur in different hemispheres during SCs 12, 14, 18, and 19; ii) the relative changing trends of two curves - cumulative SG numbers in the northern and southern hemispheres - for simple SGs are different from those for complex SGs during SCs 12, 14, 18, and 21; and iii) there are discrepancies between the dominant hemispheres of simple and complex SGs for SCs 12, 14, 18, and 21.
Henze, W., Jr.; Tandberg-Hanssen, E.; Hagyard, M. J.; West, E. A.; Woodgate, B. E.; Shine, R. A.; Beckers, J. M.; Bruner, M.; Hyder, C. L.; West, E. A.
1982-01-01
The Ultraviolet Spectrometer and Polarimeter on the Solar Maximum Mission spacraft has observed for the first time the longitudinal component of the magnetic field by means of the Zeeman effect in the transition region above a sunspot. The data presented here were obtained on three days in one sunspot, have spatial resolutions of 10 arcsec and 3 arcsec, and yield maximum field strengths greater than 1000 G above the umbrae in the spot. The method of analysis, including a line-width calibration feature used during some of the observations, is described in some detail in an appendix; the line width is required for the determination of the longitudinal magnetic field from the observed circular polarization. The transition region data for one day are compared with photospheric magnetograms from the Marshall Space Flight Center. Vertical gradients of the magnetic field are compared from the two sets of data; the maximum gradients of 0.41 to 0.62 G/km occur above the umbra and agree with or are smaller than values observed previously in the photosphere and low chromosphere.
The Frequency-dependent Damping of Slow Magnetoacoustic Waves in a Sunspot Umbral Atmosphere
Energy Technology Data Exchange (ETDEWEB)
Prasad, S. Krishna; Jess, D. B. [Astrophysics Research Centre, School of Mathematics and Physics, Queen’s University Belfast, Belfast, BT7 1NN (United Kingdom); Doorsselaere, T. Van [Centre for mathematical Plasma Astrophysics, Mathematics Department, KU Leuven, Celestijnenlaan 200B bus 2400, B-3001 Leuven (Belgium); Verth, G. [School of Mathematics and Statistics, The University of Sheffield, Hicks Building, Hounsfield Road, Sheffield, S3 7RH (United Kingdom); Morton, R. J. [Department of Mathematics, Physics and Electrical Engineering, Northumbria University, Ellison Building, Newcastle upon Tyne, NE1 8ST (United Kingdom); Fedun, V. [Department of Automatic Control and Systems Engineering, University of Sheffield, Sheffield, S1 3JD (United Kingdom); Erdélyi, R. [Solar Physics and Space Plasma Research Centre (SP2RC), School of Mathematics and Statistics, University of Sheffield, Sheffield S3 7RH (United Kingdom); Christian, D. J., E-mail: krishna.prasad@qub.ac.uk [Department of Physics and Astronomy, California State University Northridge, Northridge, CA 91330 (United States)
2017-09-20
High spatial and temporal resolution images of a sunspot, obtained simultaneously in multiple optical and UV wavelengths, are employed to study the propagation and damping characteristics of slow magnetoacoustic waves up to transition region heights. Power spectra are generated from intensity oscillations in sunspot umbra, across multiple atmospheric heights, for frequencies up to a few hundred mHz. It is observed that the power spectra display a power-law dependence over the entire frequency range, with a significant enhancement around 5.5 mHz found for the chromospheric channels. The phase difference spectra reveal a cutoff frequency near 3 mHz, up to which the oscillations are evanescent, while those with higher frequencies propagate upward. The power-law index appears to increase with atmospheric height. Also, shorter damping lengths are observed for oscillations with higher frequencies suggesting frequency-dependent damping. Using the relative amplitudes of the 5.5 mHz (3 minute) oscillations, we estimate the energy flux at different heights, which seems to decay gradually from the photosphere, in agreement with recent numerical simulations. Furthermore, a comparison of power spectra across the umbral radius highlights an enhancement of high-frequency waves near the umbral center, which does not seem to be related to magnetic field inclination angle effects.
Umbral oscillations as a probe of sunspot
International Nuclear Information System (INIS)
Abdelatif, T.E.H.
1985-01-01
The interaction of the solar five-minute oscillations with a sunspot is thoroughly explored, both on observational and theoretical grounds. Simple theoretical models are developed in order to understand the observations of umbral oscillations. Observations made at the National Solar Observatory detected both the three-minute and five-minute umbral oscillations at photospheric heights. The three-minute oscillations were found to have a kinetic energy density six times higher in the photosphere than in the chromosphere and to be concentrated in the central part of the umbra, supporting the photospheric resonance theory for the three-minute umbral oscillations. The five-minute oscillations are attenuated in the umbra, which appears to act as a filter in selecting some of the peaks in the power spectrum of five-minute oscillations in the surrounding photosphere. The k-omega power spectrum of the umbral oscillations shows a shift of power to longer wavelengths. Theoretical models of the transmission of acoustic waves into a magnetic region explain both observed effects
Complex network approach to characterize the statistical features of the sunspot series
International Nuclear Information System (INIS)
Zou, Yong; Liu, Zonghua; Small, Michael; Kurths, Jürgen
2014-01-01
Complex network approaches have been recently developed as an alternative framework to study the statistical features of time-series data. We perform a visibility-graph analysis on both the daily and monthly sunspot series. Based on the data, we propose two ways to construct the network: one is from the original observable measurements and the other is from a negative-inverse-transformed series. The degree distribution of the derived networks for the strong maxima has clear non-Gaussian properties, while the degree distribution for minima is bimodal. The long-term variation of the cycles is reflected by hubs in the network that span relatively large time intervals. Based on standard network structural measures, we propose to characterize the long-term correlations by waiting times between two subsequent events. The persistence range of the solar cycles has been identified over 15–1000 days by a power-law regime with scaling exponent γ = 2.04 of the occurrence time of two subsequent strong minima. In contrast, a persistent trend is not present in the maximal numbers, although maxima do have significant deviations from an exponential form. Our results suggest some new insights for evaluating existing models. (paper)
Surge-like Oscillations above Sunspot Light Bridges Driven by Magnetoacoustic Shocks
Energy Technology Data Exchange (ETDEWEB)
Zhang, Jingwen; Tian, Hui; He, Jiansen; Wang, Linghua, E-mail: huitian@pku.edu.cn [School of Earth and Space Sciences, Peking University, 100871 Beijing (China)
2017-03-20
High-resolution observations of the solar chromosphere and transition region often reveal surge-like oscillatory activities above sunspot light bridges (LBs). These oscillations are often interpreted as intermittent plasma jets produced by quasi-periodic magnetic reconnection. We have analyzed the oscillations above an LB in a sunspot using data taken by the Interface Region Imaging Spectrograph . The chromospheric 2796 Å images show surge-like activities above the entire LB at any time, forming an oscillating wall. Within the wall we often see that the core of the Mg ii k 2796.35 Å line first experiences a large blueshift, and then gradually decreases to zero shift before increasing to a redshift of comparable magnitude. Such a behavior suggests that the oscillations are highly nonlinear and likely related to shocks. In the 1400 Å passband, which samples emission mainly from the Si iv ion, the most prominent feature is a bright oscillatory front ahead of the surges. We find a positive correlation between the acceleration and maximum velocity of the moving front, which is consistent with numerical simulations of upward propagating slow-mode shock waves. The Si iv 1402.77 Å line profile is generally enhanced and broadened in the bright front, which might be caused by turbulence generated through compression or by the shocks. These results, together with the fact that the oscillation period stays almost unchanged over a long duration, lead us to propose that the surge-like oscillations above LBs are caused by shocked p-mode waves leaked from the underlying photosphere.
Gao, Mingyi; Kurumida, Junya; Namiki, Shu
2011-11-07
For sustainable growth of the Internet, wavelength-tunable optical regeneration is the key to scaling up high energy-efficiency dynamic optical path networks while keeping the flexibility of the network. Wavelength-tunable optical parametric regenerator (T-OPR) based on the gain saturation effect of parametric amplification in a highly nonlinear fiber is promising for noise reduction in phase-shift keying signals. In this paper, we experimentally evaluated the T-OPR performance for ASE-degraded 43-Gb/s RZ-DPSK signals over a 20-nm input wavelength range between 1527 nm and 1547 nm. As a result, we achieved improved power penalty performance for the regenerated idler with a proper pump power range.
Energy Technology Data Exchange (ETDEWEB)
Sanford, T.W.; Mock, R.C.; Marder, B.M.; Nash, T.J.; Spielman, R.B. [Sandia National Laboratories, Albuquerque, New Mexico87185 (United States); Peterson, D.L.; Roderick, N.F. [Los Alamos National Laboratory, Los Alamos, New Mexico87545 (United States); Hammer, J.H.; De Groot, J.S. [Lawrence Livermore National Laboratory, Livermore, California94550 (United States); Mosher, D. [Naval Research Laboratory, Pulsed Power Physics Branch, Washington, District of Columbia20375 (United States); Whitney, K.G.; Apruzese, J.P. [Naval Research Laboratory, Radiation Hydrodynamics Branch, Washington, District of Columbia20375 (United States)
1997-05-01
A systematic study of annular aluminum-wire z-pinches on the Saturn accelerator shows that the quality of the implosion, (as measured by the radial convergence, the radiated energy, pulse width, and power), increases with wire number. Radiation magnetohydrodynamic (RMHC) xy simulations suggest that the implosion transitions from that of individual wire plasmas to that of a continuous plasma shell when the interwire spacing is reduced below {approximately}1.4mm. In this {open_quotes}plasma-shell regime,{close_quotes} many of the global radiation and plasma characteristics are in agreement with those simulated by 2D-RMHC rz simulations. In this regime, measured changes in the radiation pulse width with variations in load mass and array radius are consistent with the simulations and are explained by the development of 2D fluid motion in the rz plane. Associated variations in the K-shell yield are qualitatively explained by simple radiation-scaling models. {copyright} {ital 1997 American Institute of Physics.}
International Nuclear Information System (INIS)
Sanford, T.W.; Mock, R.C.; Marder, B.M.; Nash, T.J.; Spielman, R.B.; Peterson, D.L.; Roderick, N.F.; Hammer, J.H.; De Groot, J.S.; Mosher, D.; Whitney, K.G.; Apruzese, J.P.
1997-01-01
A systematic study of annular aluminum-wire z-pinches on the Saturn accelerator shows that the quality of the implosion, (as measured by the radial convergence, the radiated energy, pulse width, and power), increases with wire number. Radiation magnetohydrodynamic (RMHC) xy simulations suggest that the implosion transitions from that of individual wire plasmas to that of a continuous plasma shell when the interwire spacing is reduced below ∼1.4mm. In this open-quotes plasma-shell regime,close quotes many of the global radiation and plasma characteristics are in agreement with those simulated by 2D-RMHC rz simulations. In this regime, measured changes in the radiation pulse width with variations in load mass and array radius are consistent with the simulations and are explained by the development of 2D fluid motion in the rz plane. Associated variations in the K-shell yield are qualitatively explained by simple radiation-scaling models. copyright 1997 American Institute of Physics
Determination of the Alfvén Speed and Plasma-beta Using the Seismology of Sunspot Umbra
Energy Technology Data Exchange (ETDEWEB)
Cho, I.-H.; Moon, Y.-J.; Nakariakov, V. M.; Park, J.; Choi, S. [Department of Astronomy and Space Science, Kyung Hee University, Yongin 446-701 (Korea, Republic of); Cho, K.-S.; Bong, S.-C.; Baek, J.-H.; Kim, Y.-H.; Lee, J., E-mail: ihjo@khu.ac.kr [Space Science Division, Korea Astronomy and Space Science Institute, Daejeon 305-348 (Korea, Republic of)
2017-03-01
For 478 centrally located sunspots observed in the optical continuum with Solar Dynamics Observatory /Helioseismic Magnetic Imager, we perform seismological diagnostics of the physical parameters of umbral photospheres. The new technique is based on the theory of slow magnetoacoustic waves in a non-isothermally stratified photosphere with a uniform vertical magnetic field. We construct a map of the weighted frequency of three-minute oscillations inside the umbra and use it for the estimation of the Alfvén speed, plasma-beta, and mass density within the umbra. We find the umbral mean Alfvén speed ranges between 10.5 and 7.5 km s{sup −1} and is negatively correlated with magnetic field strength. The umbral mean plasma-beta is found to range approximately between 0.65 and 1.15 and does not vary significantly from pores to mature sunspots. The mean density ranges between (1–6) × 10{sup −4} kg m{sup −3} and shows a strong positive correlation with magnetic field strength.
NARROW-LINE-WIDTH UV BURSTS IN THE TRANSITION REGION ABOVE SUNSPOTS OBSERVED BY IRIS
Energy Technology Data Exchange (ETDEWEB)
Hou, Zhenyong; Huang, Zhenghua; Xia, Lidong; Li, Bo; Madjarska, Maria S.; Fu, Hui; Mou, Chaozhou; Xie, Haixia, E-mail: z.huang@sdu.edu.cn, E-mail: xld@sdu.edu.cn [Shandong Provincial Key Laboratory of Optical Astronomy and Solar-Terrestrial Environment, Institute of Space Sciences, Shandong University, Weihai, 264209 Shandong (China)
2016-10-01
Various small-scale structures abound in the solar atmosphere above active regions, playing an important role in the dynamics and evolution therein. We report on a new class of small-scale transition region structures in active regions, characterized by strong emissions but extremely narrow Si iv line profiles as found in observations taken with the Interface Region Imaging Spectrograph (IRIS). Tentatively named as narrow-line-width UV bursts (NUBs), these structures are located above sunspots and comprise one or multiple compact bright cores at sub-arcsecond scales. We found six NUBs in two data sets (a raster and a sit-and-stare data set). Among these, four events are short-lived with a duration of ∼10 minutes, while two last for more than 36 minutes. All NUBs have Doppler shifts of 15–18 km s{sup −1}, while the NUB found in sit-and-stare data possesses an additional component at ∼50 km s{sup −1} found only in the C ii and Mg ii lines. Given that these events are found to play a role in the local dynamics, it is important to further investigate the physical mechanisms that generate these phenomena and their role in the mass transport in sunspots.
Deming, Drake; Boyle, Robert J.; Jennings, Donald E.; Wiedemann, Gunter
1988-01-01
The use of the extremely Zeeman-sensitive IR emission line Mg I, at 12.32 microns, to study solar magnetic fields. Time series observations of the line in the quiet sun were obtained in order to determine the response time of the line to the five-minute oscillations. Based upon the velocity amplitude and average period measured in the line, it is concluded that it is formed in the temperature minimum region. The magnetic structure of sunspots is investigated by stepping a small field of view in linear 'slices' through the spots. The region of penumbral line formation does not show the Evershed outflow common in photospheric lines. The line intensity is a factor of two greater in sunspot penumbrae than in the photosphere, and at the limb the penumbral emission begins to depart from optical thinness, the line source function increasing with height. For a spot near disk center, the radial decrease in absolute magnetic field strength is steeper than the generally accepted dependence.
THE MYSTERIOUS CASE OF THE SOLAR ARGON ABUNDANCE NEAR SUNSPOTS IN FLARES
International Nuclear Information System (INIS)
Doschek, G. A.; Warren, H. P.
2016-01-01
Recently we discussed an enhancement of the abundance of Ar xiv relative to Ca xiv near a sunspot during a flare, observed in spectra recorded by the Extreme-ultraviolet Imaging Spectrometer (EIS) on the Hinode spacecraft. The observed Ar xiv/Ca xiv ratio yields an argon/calcium abundance ratio seven times greater than expected from the photospheric abundance. Such a large abundance anomaly is unprecedented in the solar atmosphere. We interpreted this result as being due to an inverse first ionization potential (FIP) effect. In the published work, two lines of Ar xiv were observed, and one line was tentatively identified as an Ar xi line. In this paper, we report observing a similar enhancement in a full-CCD EIS flare spectrum in 13 argon lines that lie within the EIS wavelength ranges. The observed lines include two Ar xi lines, four Ar xiii lines, six Ar xiv lines, and one Ar xv line. The enhancement is far less than reported in Doschek et al. but exhibits similar morphology. The argon abundance is close to a photospheric abundance in the enhanced area, and the abundance could be photospheric. This enhancement occurs in association with a sunspot in a small area only a few arcseconds (1″ = about 700 km) in size. There is no enhancement effect observed in the normally high-FIP sulfur and oxygen line ratios relative to lines of low-FIP elements available to EIS. Calculations of path lengths in the strongest enhanced area in Doschek et al. indicate a depletion of low-FIP elements.
International Nuclear Information System (INIS)
Pagaran, J.; Weber, M.; Burrows, J.
2009-01-01
The change of spectral decomposition of the total radiative output on various timescales of solar magnetic activity is of large interest to terrestrial and solar-stellar atmosphere studies. Starting in 2002, SCIAMACHY was the first satellite instrument to observe daily solar spectral irradiance (SSI) continuously from 230 nm (UV) to 1750 nm (near-infrared; near-IR). In order to address the question of how much UV, visible (vis), and IR spectral regions change on 27 day and 11 year timescales, we parameterize short-term SSI variations in terms of faculae brightening (Mg II index) and sunspot darkening (photometric sunspot index) proxies. Although spectral variations above 300 nm are below 1% and, therefore, well below the accuracy of absolute radiometric calibration, relative accuracy for short-term changes is shown to be in the per mill range. This enables us to derive short-term spectral irradiance variations from the UV to the near-IR. During Halloween solar storm in 2003 with a record high sunspot area, we observe a reduction of 0.3% in the near-IR to 0.5% in the vis and near-UV. This is consistent with a 0.4% reduction in total solar irradiance (TSI). Over an entire 11 year solar cycle, SSI variability covering simultaneously the UV, vis, and IR spectral regions have not been directly observed so far. Using variations of solar proxies over solar cycle 23, solar cycle spectral variations have been estimated using scaling factors that best matched short-term variations of SCIAMACHY. In the 300-400 nm region, which strongly contributes to TSI solar cycle change, a contribution of 34% is derived from SCIAMACHY observations, which is lower than the reported values from SUSIM satellite data and the empirical SATIRE model. The total UV contribution (below 400 nm) to TSI solar cycle variations is estimated to be 55%.
Energy Technology Data Exchange (ETDEWEB)
Sanford, T.W.L.; Mock, R.C.; Marder, B.M. [and others
1997-06-01
A systematic study of annular aluminum-wire z-pinches on the Saturn accelerator shows that the quality of the implosion, including the radiated power, increases with wire number. Radiation magnetohydrodynamic (RMEC) xy simulations suggest that the implosion transitions from that of individual wire plasmas to that of a continuous plasma shell when the interwire spacing is reduced below {approximately} 1.4 mm. In the plasma-shell regime, the experimental implosions exhibit 1D- and 2D-code characteristics as evidenced by the presence of a strong first and a weak second radiation pulse that correlates with a strong and weak radial convergence. In this regime, many of the radiation and plasma characteristics are in agreement with those simulated by 2D-RMHC rz simulations. Moreover, measured changes in the radiation pulse width with variations in array mass and radius are consistent with the simulations and are explained by the development of 2D fluid motion in the rz plane. Associated variations in the K-shell yield are qualitatively explained by simple K-shell radiation scaling models.
Oscillations in sunspot umbras due to trapped Alfven waves excited by overstability
International Nuclear Information System (INIS)
Uchida, Yutaka; Sakurai, Takashi.
1975-01-01
Oscillations observed in sunspot umbras are interpreted as a vertical motion in the atmosphere induced by a standing Alfven wave trapped in the region between the overstable layer under the photosphere and the chromosphere-corona transition layer. The Alfven wave motion is considered to be excited by the overstable convection occurring at the bottom of the abovementioned oscillating layer, and waves with special frequencies are selected as eigen-mode waves standing in the ''cavity,'' while other waves which are out of phase with themselves after reflections will disappear. It is shown by solving the eigen-value problem that the fundamental eigen frequency falls in a range around 0.04 rad s -1 (corresponding to 140-180 s) for the condition in the umbra of a typical spot, and also that the eigen frequencies do not depend greatly on the circumstantial physical or geometric parameters of the model atmosphere, such as the temperature in the layer, or the height of the transition layer, etc. The eigen frequencies, however, depend on the Alfven velocity at the base of the oscillating layer (or at the top of the overstable layer), but the latter quantity, which represents the stiffness of the magnetic tube of force against the overturning motion, takes roughly a common value for different sunspots according to SAVAGE's (1969) stability analysis of the umbral atmosphere against thermal convection, and thus gives a comparatively narrow range of resonant frequencies. In addition to the selection mechanism for oscillations of 140-180-s period, some other aspects of the oscillation, such as the relation to the running penumbral waves, are discussed. (auth.)
Solar wind and coronal structure near sunspot minimum: Pioneer and SMM observations from 1985-1987
International Nuclear Information System (INIS)
Mihalov, J.D.; Barnes, A.; Hundhausen, A.J.; Smith, E.J.
1990-01-01
The solar wind speeds observed in the outer heliosphere (20 to 40 AU heliocentric distance, approximately) by Pioneers 10 an 11, and at a heliocentric distance of 0.7 AU by the Pioneer Venus spacecraft, reveal a complex set of changes in the years near the recent sunspot minimum, 1985-1987. The pattern of recurrent solar wind streams, the long-term average speed, and the sector polarity of the interplanetary magnetic field all changed in a manner suggesting both a temporal variation, and a changing dependence on heliographic latitude. Coronal observations made from the Solar Maximum Mission spacecraft during the same epoch show a systematic variation in coronal structure and (by implication) the magnetic structure imposed on the expanding solar wind. These observations suggest interpretation of the solar wind speed variations in terms of the familiar model where the speed increases with distance from a nearly flat interplanetary current sheet (or with heliomagnetic latitude), and where this current sheet becomes aligned with the solar equatorial plane as sunspot minimum approaches, but deviates rapidly from that orientation after minimum. The authors confirm here that this basic organization of the solar wind speed persists in the outer heliosphere with an orientation of the neutral sheet consistent with that inferred at a heliocentric distance of a few solar radii, from the coronal observations
Directory of Open Access Journals (Sweden)
Frédéric Ouattara
2012-01-01
Full Text Available We analyse the variability of foF2 at two West Africa equatorial ionization anomaly stations (Ouagadougou and Dakar during three solar cycles (from cycle 20 to cycle 22, that is, from 1966 to 1998 for Ouagadougou and from 1971 to 1997 for Dakar. We examine the effect of the changing levels of solar extreme ultraviolet radiation with sunspot number. The study shows high correlation between foF2 and sunspot number (Rz. The correlation coefficient decreases from cycle 20 to cycle 21 at both stations. From cycle 21 to cycle 22 it decreases at Ouagadougou station and increases at Dakar station. The best correlation coefficient, 0.990, is obtained for Dakar station during solar cycle 22. The seasonal variation displays equinoctial peaks that are asymmetric between March and September. The percentage deviations of monthly average data from one solar cycle to another display variability with respect to solar cycle phase and show solar ultraviolet radiation variability with solar cycle phase. The diurnal variation shows a noon bite out with a predominant late-afternoon peak except during the maximum phase of the solar cycle. The diurnal Ouagadougou station foF2 data do not show a significant difference between the increasing and decreasing cycle phases, while Dakar station data do show it, particularly for cycle 21. The percentage deviations of diurnal variations from solar-minimum conditions show more ionosphere during solar cycle 21 at both stations for all three of the other phases of the solar cycle. There is no significant variability of ionosphere during increasing and decreasing solar cycle phases at Ouagadougou station, but at Dakar station there is a significant variability of ionosphere during these two solar-cycle phases.
Czech Academy of Sciences Publication Activity Database
Siu-Tapia, A.; Lagg, A.; Solanki, S.K.; van Noort, M.; Jurčák, Jan
2017-01-01
Roč. 607, November (2017), A36/1-A36/17 E-ISSN 1432-0746 Institutional support: RVO:67985815 Keywords : sunspots * photosphere * magnetic fields Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 5.014, year: 2016
Teologia ekonomiczna, rządzenie i neoliberalizm. Lekcje z "Królestwa i Chwały"
Directory of Open Access Journals (Sweden)
German Eduardo Primera
2015-04-01
Full Text Available Celem artykułu jest sprawdzenie Agambenowskich badań w obszarze teologii ekonomicznej w celu podkreślenia ich znaczenia dla krytyki współczesnej polityki neoliberalnej. W pierwszej części autor przedstawia podsumowanie głównych tez zawartych w książce Królestwo i chwała. W szczególności skupia się zarówno na ujęciu oikonomii we wczesnochrześcijańskich debatach na boską trójcą, jak i jej związku z prowidencjalnym paradygmatem rządzenia. Następnie pokazuje, jak ta genealogia oikonomii może być przydatna dla politycznej analizy teraźniejszości. Stanowi to jednocześnie odpowiedź na niektóre z zarzutów postawionych Królestwu i chwale przez Alberta Toscano. W końcowej części autor podsumowuje swoje rozważania, pokazując szczególne znaczenie prac Agambena dla badań nad polityczną racjonalnością neoliberalizmu.
International Nuclear Information System (INIS)
Usikov, D.A.
1975-01-01
A description of a geometrical module used in a program of the ARMONT complex of the Monte Carlo calculations is given. The geometrical module is designed to simulate the particle trajectory in the R-Z geometry. The geometrical module follows the particle trajectory from the start point to the next collision or flight-out points. The flight direction at the scattering point is assumed isotropic in the laboratory coordinate system. In the module the angle between the flight direction before and after collision is not determined. The principles for the module construction are presented alongside with the text-module in the ALGOL language. The module is optimumized as to the counting rate and it is rather compact not to cause difficulties due to the translator limitations in common translation with other program blocks based on the use of the Monte Carlo calculations
Vaquero, J. M.
During the last decades, an effort has been made to improve the sunspot number time-series, one of the more useful data set for space climate stud- ies, using historical solar observations. Moreover, not only the sunspot number can be studied using these early solar records. During the last years, historical sources (i.e., sunspot drawings and solar radius measurements) have been also used to study the space climate. Here, I review some recent progress on these issues. In a hand, there are some periods with very few sunspot records and sunspot numbers are not so reliable in these intervals. I discuss the quality of sunspot records during these interesting periods: (a) 1610-1645, (b) 1721-1761, and (c) 1779-1795. On the other hand, I dis- cuss the reliability of early sunspot drawings, sunspot position data, and solar diameter determinations to study long-term variations in our Sun. Fi- nally, some information on historical documents from Argentina and Chile related with space climate are summarised. FULL TEXT IN SPANISH
On the Theory of Sunspots Proposed by Signor Kirchoff
Directory of Open Access Journals (Sweden)
Secchi A.
2011-07-01
Full Text Available Eileen Reeves (Department of Comparative Literature, Princeton University, Princeton, New Jersey, 08544 and Mary Posani (Department of French and Italian, The Ohio State University, Columbus, Ohio, 43221 provide a translation of Father Pietro Angelo Secchi’s classic work “ Secchi A. Sulla Teoria Delle Macchie Solari: Proposta dal sig. Kirchoff” as it appeared in Bullettino Meteorologico dell’ Osservatorio del Collegio Romano , 31 January 1864, v.3(4, 1–4. This was the first treatise to propose a partic- ulate photosphere floating on the gaseous body of the Sun. The idea would dominate astrophysical thought for the next 50 years. Secchi appears to have drafted the article, as a response to Gustav Kirchhoff’s proposal, echoing early Galilean ideas, that sunspots represented clouds which floated above the photosphere. Other than presenting a new solar model, noteworthy aspects of this work include Secchi’s appropriate insistence that materials do not emit the same light at the same temperature and his gentle rebuke of Kirchhoff relative to commenting on questions of astronomy.
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... The records of sunspot number, sunspot areas and sunspot locations gathered over the centuries by various observatories are reanalysed with the aim of finding as yet undiscovered connections between the different parameters of the sunspot cycle and the butterfly diagram. Preliminary results of such ...
Kırzıoğlu, M. Cemal
2010-01-01
ÖZETMakale, Erzurum Tarihini Araştırma ve Tanıtma Derneği’nin “ Erzurum tarihini yeniden yazma” konusunda: biri Erzurumlu Tarih Hocası Tahsin (Akgün) Aşıroğlu(1911-1984), diğeri M. Fahrettin Kırzıoğlu(1917-2005)’na ait olmak üzere iki ayrı belgeyi ihtiva etmektedir. ABSTRACTThis study includes two separate documents belonged to a history teacher from Erzurum, Tahsin(Akgün) Aşıroğlu(1911-1984), and M. Fahrettin Kırzıoğlu(1917-2005 about rewritin...
MAXIMUM CORONAL MASS EJECTION SPEED AS AN INDICATOR OF SOLAR AND GEOMAGNETIC ACTIVITIES
International Nuclear Information System (INIS)
Kilcik, A.; Yurchyshyn, V. B.; Abramenko, V.; Goode, P. R.; Gopalswamy, N.; Ozguc, A.; Rozelot, J. P.
2011-01-01
We investigate the relationship between the monthly averaged maximal speeds of coronal mass ejections (CMEs), international sunspot number (ISSN), and the geomagnetic Dst and Ap indices covering the 1996-2008 time interval (solar cycle 23). Our new findings are as follows. (1) There is a noteworthy relationship between monthly averaged maximum CME speeds and sunspot numbers, Ap and Dst indices. Various peculiarities in the monthly Dst index are correlated better with the fine structures in the CME speed profile than that in the ISSN data. (2) Unlike the sunspot numbers, the CME speed index does not exhibit a double peak maximum. Instead, the CME speed profile peaks during the declining phase of solar cycle 23. Similar to the Ap index, both CME speed and the Dst indices lag behind the sunspot numbers by several months. (3) The CME number shows a double peak similar to that seen in the sunspot numbers. The CME occurrence rate remained very high even near the minimum of the solar cycle 23, when both the sunspot number and the CME average maximum speed were reaching their minimum values. (4) A well-defined peak of the Ap index between 2002 May and 2004 August was co-temporal with the excess of the mid-latitude coronal holes during solar cycle 23. The above findings suggest that the CME speed index may be a useful indicator of both solar and geomagnetic activities. It may have advantages over the sunspot numbers, because it better reflects the intensity of Earth-directed solar eruptions.
The Relative Phase Asynchronization between Sunspot Numbers ...
Indian Academy of Sciences (India)
of Sciences, P. O. Box 110, 650011 Kunming, People's Republic of China. ... by studying the North–South asymmetry in the predominant rotation periods of ... earth, the polar faculae counts show strong annual variation, and the polar region is.
INTERFERENCE OF THE RUNNING WAVES AT LIGHT BRIDGES OF A SUNSPOT
Energy Technology Data Exchange (ETDEWEB)
Su, J. T.; Priya, T. G.; Yu, S. J.; Zhang, M. [Key Laboratory of Solar Activity, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China); Ji, K. F. [Kunming University of Science and Technology, Kunming 650093 (China); Banerjee, D. [Indian Institute of Astrophysics, Koramangala Bangalore 560034 (India); Cao, W. D. [Big Bear Solar Observatory, 40386 North Shore Lane, Big Bear City, CA 92314 (United States); Zhao, J. S.; Ji, H. S., E-mail: jt@bao.ac.cn [Purple Mountain Observatory, CAS, Nanjing 210008 (China)
2016-01-01
The observations of chromospheric oscillations of two umbral light bridges (LBs) within a sunspot from NOAA Active Region 12127 are presented. It was found that the running umbral waves with periods of 2.2–2.6 minutes underwent very fast damping before approaching umbral boundaries, while those with higher periods (>2.6 minutes) could propagate outside umbrae. On two sides of each LB adjacent to umbrae, the cross-wavelet spectra displayed that the oscillations on them had a common significant power region with dominant frequencies of 2–6 minutes and phase differences of ∼90°. A counterstream of two running umbral waves in the 2–6 minute frequency range propagated toward the LBs, where they encountered each other and gave rise to constructive or even destructive interference on the LBs. In addition, the velocity and density perturbations on the LBs were found in opposite phases suggesting that the perturbations were caused by the downward propagating waves.
International Nuclear Information System (INIS)
Lites, B.W.; Skumanich, A.; Rees, D.E.; Murphy, G.A.; Carlsson, M.; Sydney Univ., Australia; Oslo Universitetet, Norway)
1987-01-01
Observed Stokes profiles of Mg I 4571 A are analyzed as a diagnostic of the magnetic field and thermal structure at the temperature minimum of sunspot umbrae. Multilevel non-LTE transfer calculations of the Mg I-II-III excitation and ionization balance in model umbral atmospheres show: (1) Mg I to be far less ionized in sunspot umbrae than in the quiet sun, leading to greatly enhanced opacity in 4571 A, and (2) LTE excitation of 4571 A. Existing umbral models predict emission cores of the Stokes I profile due to the chromospheric temperature rise. This feature is not present in observed umbral profiles. Moreover, such an emission reversal causes similar anomalous features in the Stokes Q, U, V profiles, which are also not observed. Umbral atmospheres with extended temperature minima are suggested. Implications for chromospheric heating mechanisms and the utility of this line for solar vector magnetic field measurements are discussed. 35 references
The Extreme Solar Activity during October–November 2003 K. M. ...
Indian Academy of Sciences (India)
between occurrence of the abnormal activities of big sunspot groups that ... better statistics, we add the data of the sunspot positional measurements obtained from the ... Ai are the area values of the sunspot group for i number of observations.
Wilson, Robert M.
2013-01-01
Global warming/climate change has been a subject of scientific interest since the early 19th century. In particular, increases in the atmospheric concentration of carbon dioxide (CO2) have long been thought to account for Earth's increased warming, although the lack of a dependable set of observational data was apparent as late as the mid 1950s. However, beginning in the late 1950s, being associated with the International Geophysical Year, the opportunity arose to begin accurate continuous monitoring of the Earth's atmospheric concentration of CO2. Consequently, it is now well established that the atmospheric concentration of CO2, while varying seasonally within any particular year, has steadily increased over time. Associated with this rising trend in the atmospheric concentration of CO2 is a rising trend in the surface-air and sea-surface temperatures (SSTs). This Technical Publication (TP) examines the statistical relationships between 10-year moving averages (10-yma) of the Global Land-Ocean Temperature Index (GLOTI), sunspot number (SSN), the Atlantic Multidecadal Oscillation (AMO) index, and the Mauna Loa CO2 (MLCO2) index for the common interval 1964-2006, where the 10-yma values are used to indicate trends in the data. Scatter plots using the 10-yma values between GLOTI and each of the other parameters are determined, both as single-variate and multivariate fits. Scatter plots are also determined for MLCO2 using single-variate and bivariate (BV) fits, based on the GLOTI alone and the GLOTI in combination with the AMO index. On the basis of the inferred preferential fits for MLCO2, estimates for MLCO2 are determined for the interval 1885-1964, thereby yielding an estimate of the preindustrial level of atmospheric concentration of CO2. Lastly, 10-yma values of MLCO2 are compared against 10-yma estimates of the total carbon emissions (TCE) to determine the likelihood that manmade sources of carbon emissions are indeed responsible for the recent warming now
Solar activity and rainfall pattern in Tamil Nadu during the Northeast monsoon
International Nuclear Information System (INIS)
Reddy, R.S.; Mukherjee, B.K.; Ramana Murty, Bh.V.
1976-01-01
An attempt is made to examine the association, of any, between the rainfall, in Tamil Nadu and sunspot activity and if so, whether similar periodicities are also present in the sunspot activity. The daily relative sunspot numbers for the period Oct.-Dec. during 1961-70 and the daily sunspot means for the period Oct.-Dec. 1889-1938, as well as the rainfall series for the period Oct.-Nov., during 1961-70 have been analysed by power spectrum. An anti-phase relation was noticed between the rainfall and the sunspot activity. The 15-day periodicity in the rainfall was significant. The sunspot activity also showed similar periodicities as rainfall. The 30-day periodicity in the sunspot activity was significant. (author)
Solar activity and rainfall pattern in Tamil Nadu during the Northeast monsoon
Energy Technology Data Exchange (ETDEWEB)
Reddy, R S; Mukherjee, B K; Ramana Murty, Bh V [Indian Inst. of Tropical Meteorology, Pune
1976-12-01
An attempt is made to examine the association, of any, between the rainfall, in Tamil Nadu and sunspot activity and if so, whether similar periodicities are also present in the sunspot activity. The daily relative sunspot numbers for the period Oct.-Dec. during 1961-70 and the daily sunspot means for the period Oct.-Dec. 1889-1938, as well as the rainfall series for the period Oct.-Nov., during 1961-70 have been analysed by power spectrum. An anti-phase relation was noticed between the rainfall and the sunspot activity. The 15-day periodicity in the rainfall was significant. The sunspot activity also showed similar periodicities as rainfall. The 30-day periodicity in the sunspot activity was significant.
EVIDENCE FOR A TRANSITION REGION RESPONSE TO PENUMBRAL MICROJETS IN SUNSPOTS
International Nuclear Information System (INIS)
Vissers, G. J. M.; Rouppe van der Voort, L. H. M.; Carlsson, M.
2015-01-01
Penumbral microjets (PMJs) are short-lived, fine-structured, and bright jets that are generally observed in chromospheric imaging of the penumbra of sunspots. Here we investigate their potential transition region signature by combining observations with the Swedish 1-m Solar Telescope in the Ca ii H and Ca ii 8542 Å lines with ultraviolet imaging and spectroscopy obtained with the Interface Region Imaging Spectrograph (IRIS), which includes the C ii 1334/1335 Å, Si iv 1394/1403 Å, and Mg ii h and k 2803/2796 Å lines. We find a clear corresponding signal in the IRIS Mg ii k, C ii, and Si iv slit-jaw images, typically offset spatially from the Ca ii signature in the direction along the jets: from base to top, the PMJs are predominantly visible in Ca ii, Mg ii k, and C ii/Si iv, suggesting progressive heating to transition region temperatures along the jet extent. Hence, these results support the suggestion from earlier studies that PMJs may heat to transition region temperatures
All-optical 40Gbit/s format conversion from NRZ to RZ based on SFG in a PPLN waveguide
Wang, Jian; Sun, Junqiang
2006-01-01
A novel all-optical 40Gbit/s NRZ-to-RZ data format conversion scheme based on sum-frequency generation (SFG) interaction in a periodically poled LiNbO 3 (PPLN) waveguide is presented for the first time, using a Mach-Zehnder interferometer (MZI). The conversion mechanism relies on the combination of attenuation and nonlinear phase shift Φ NL induced on the signal field. The performance of the conversion is numerically evaluated, with the result showing that it is more effective to yield Φ NL when appropriately phase mismatched for SFG process but Φ NL~0 when quasi-phase-matching (QPM). Compared with the cascaded second-order nonlinear interactions (SHG+DFG) with the influence of walk-off effect, a high conversion efficiency and good performance are achieved with peak power 500mw and width 2ps of the pump, which can be used in super high-speed situation (40Gbit/s and above). Finally, the inverse process of SFG and corresponding walk-off effect are analyzed and the optimum arrangement of power is proposed, showing that proper power, pump width, and waveguide length are necessary for achieving a satisfied conversion effect.
International Nuclear Information System (INIS)
Wang Haimin; Liu Chang; Wang Shuo; Deng Na; Xu Yan; Jing Ju; Cao Wenda
2013-01-01
Rapid, irreversible changes of magnetic topology and sunspot structure associated with flares have been systematically observed in recent years. The most striking features include the increase of the horizontal field at the polarity inversion line (PIL) and the co-spatial penumbral darkening. A likely explanation of the above phenomenon is the back reaction to the coronal restructuring after eruptions: a coronal mass ejection carries the upward momentum while the downward momentum compresses the field lines near the PIL. Previous studies could only use low-resolution (above 1'') magnetograms and white-light images. Therefore, the changes are mostly observed for X-class flares. Taking advantage of the 0.''1 spatial resolution and 15 s temporal cadence of the New Solar Telescope at the Big Bear Solar Observatory, we report in detail the rapid formation of sunspot penumbra at the PIL associated with the C7.4 flare on 2012 July 2. It is unambiguously shown that the solar granulation pattern evolves to an alternating dark and bright fibril structure, the typical pattern of penumbra. Interestingly, the appearance of such a penumbra creates a new δ sunspot. The penumbral formation is also accompanied by the enhancement of the horizontal field observed using vector magnetograms from the Helioseismic and Magnetic Imager. We explain our observations as being due to the eruption of a flux rope following magnetic cancellation at the PIL. Subsequently, the re-closed arcade fields are pushed down toward the surface to form the new penumbra. NLFFF extrapolation clearly shows both the flux rope close to the surface and the overlying fields
Balasubramaniam, K. S.; West, E. A.
1991-01-01
The Marshall Space Flight Center (MSFC) vector magnetograph is a tunable filter magnetograph with a bandpass of 125 mA. Results are presented of the inversion of Stokes polarization profiles observed with the MSFC vector magnetograph centered on a sunspot to recover the vector magnetic field parameters and thermodynamic parameters of the spectral line forming region using the Fe I 5250.2 A spectral line using a nonlinear least-squares fitting technique. As a preliminary investigation, it is also shown that the recovered thermodynamic parameters could be better understood if the fitted parameters like Doppler width, opacity ratio, and damping constant were broken down into more basic quantities like temperature, microturbulent velocity, or density parameter.
TWOTRAN-2, 2-D Multigroup Transport in X-Y, R-Z, R-Theta Geometry with Anisotropic Scattering
International Nuclear Information System (INIS)
Lathrop, K.D.; Brinkley, F.W.
1995-01-01
1 - Description of problem or function: TWOTRAN2 solves the two-dimensional multigroup transport equation in (x,y), (r,theta), and (r,z) geometries. Both regular and adjoint, inhomogeneous and homogeneous (k eff and eigenvalue searches) problems subject to vacuum, reflective, periodic, white or input-specified boundary flux conditions are solved. General anisotropic scattering is allowed and anisotropic inhomogeneous sources are permitted. 2 - Method of solution: The discrete ordinates approximation for the angular variable is used in finite difference form which is solved with the central (diamond) difference approximation. Negative fluxes are eliminated by a local set-to zero and correct algorithm. Standard inner (within-group) and outer iterative cycles are accelerated by a coarse-mesh re-balancing on a coarse mesh which may be independent of the material mesh. 3 - Restrictions on the complexity of the problem: Variable dimensioning is used so that any combination of problem parameters leading to a container array less than MAXLEN can be accommodated. On IBM machines, TWOTRAN2 will execute in the 4-byte mode so that any combination of problem parameters leading to a container array less than MAXLEN can be accommodated. MAXLEN can be several hundred thousand and most problems can be core-contained. On the CDC machines MAXLEN can be slightly greater than 40,000 words and peripheral storage is used for most group-dependent data
ENHANCEMENT OF A SUNSPOT LIGHT WALL WITH EXTERNAL DISTURBANCES
Energy Technology Data Exchange (ETDEWEB)
Yang, Shuhong; Zhang, Jun [Key Laboratory of Solar Activity, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China); Erdélyi, Robert, E-mail: shuhongyang@nao.cas.cn [Solar Physics and Space Plasma Research Centre, School of Mathematics and Statistics, University of Sheffield, Hicks Building, Hounsfield Road, Sheffield S3 7RH (United Kingdom)
2016-12-20
Based on the Interface Region Imaging Spectrograph observations, we study the response of a solar sunspot light wall to external disturbances. A flare occurrence near the light wall caused material to erupt from the lower solar atmosphere into the corona. Some material falls back to the solar surface and hits the light bridge (i.e., the base of the light wall), then sudden brightenings appear at the wall base followed by the rise of wall top, leading to an increase of the wall height. Once the brightness of the wall base fades, the height of the light wall begins to decrease. Five hours later, another nearby flare takes place, and a bright channel is formed that extends from the flare toward the light bridge. Although no obvious material flow along the bright channel is found, some ejected material is conjectured to reach the light bridge. Subsequently, the wall base brightens and the wall height begins to increase again. Once more, when the brightness of the wall base decays, the wall top fluctuates to lower heights. We suggest, based on the observed cases, that the interaction of falling material and ejected flare material with the light wall results in the brightenings of wall base and causes the height of the light wall to increase. Our results reveal that the light wall can be not only powered by the linkage of p -mode from below the photosphere, but may also be enhanced by external disturbances, such as falling material.
The topside ionosphere above Arecibo at equinox during sunspot maximum
International Nuclear Information System (INIS)
Bailey, G.J.
1980-01-01
The coupled time-dependent 0 + and H + continuity and momentum equations and 0 + , H + and electron heat balance equations are solved simultaneously within the L = 1.4 (Arecibo) magnetic flux tube between an altitude of 120 km and the equatorial plane. The results of the calculations are used in a study of the topside ionosphere above Arecibo at equinox during sunspot maximum. Magnetically quiet conditions are assumed. The results of the calculations show that the L = 1.4 magnetic flux tube becomes saturated from an arbitrary state within 2-3 days. During the day the ion content of the magnetic flux tube consists mainly of 0 + whereas 0 + and H + are both important during the night. There is an altitude region in the topside ionosphere during the day where ion-counterstreaming occurs with H + flowing downward and 0 + flowing upward. The conditions causing this ion-counterstreaming are discussed. There is a net chemical gain of H + at the higher altitudes. This H + diffuses both upwards and downwards whilst 0 + diffuses upwards from its solar e.u.v. production source which is most important at the lower altitudes. During the night the calculated 0 + and H + temperatures are very nearly equal whereas during the day there are occasions when the H + temperature exceeds the 0 - temperature by about 300 K. (author)
Performance of Solar Proxy Options of IRI-Plas Model for Equinox Seasons
Sezen, Umut; Gulyaeva, Tamara L.; Arikan, Feza
2018-02-01
International Reference Ionosphere (IRI) is the most acclaimed climatic model of the ionosphere. Since 2009, the range of the IRI model has been extended to the Global Positioning System (GPS) orbital height of 20,000 km in the plasmasphere. The new model, which is called IRI extended to Plasmasphere (IRI-Plas), can input not only the ionosonde foF2 and hmF2 but also the GPS-total electron content (TEC). IRI-Plas has been provided at www.ionolab.org, where online computation of ionospheric parameters is accomplished through a user-friendly interface. The solar proxies that are available in IRI-Plas can be listed as sunspot number (SSN1), SSN2, F10.7, global electron content (GEC), TEC, IG, Mg II, Lyman-α, and GEC_RZ. In this study, ionosonde foF2 data are compared with IRI-Plas foF2 values with the Consultative Committee International Radio (CCIR) and International Union of Radio Science (URSI) model choices for each solar proxy, with or without the GPS-TEC input for the equinox months of October 2011 and March 2015. It has been observed that the best fitting model choices in Root Mean Square (RMS) and Normalized RMS (NRMS) sense are the Jet Propulsion Laboratory global ionospheric maps-TEC input with Lyman-α solar proxy option for both months. The input of TEC definitely lowers the difference between the model and ionosonde foF2 values. The IG and Mg II solar proxies produce similar model foF2 values, and they usually are the second and third best fits to the ionosonde foF2 for the midlatitude ionosphere. In high-latitude regions, Jet Propulsion Laboratory global ionospheric map-TEC inputs to IRI-Plas with Lyman-α, GEC_RZ, and TEC solar proxies are the best choices. In equatorial region, the best fitting solar proxies are IG, Lyman-α, and Mg II.
Observations of Running Penumbral Waves Emerging in a Sunspot
Priya, T. G.; Wenda, Cao; Jiangtao, Su; Jie, Chen; Xinjie, Mao; Yuanyong, Deng; Robert, Erdélyi
2018-01-01
We present results from the investigation of 5 minute umbral oscillations in a single-polarity sunspot of active region NOAA 12132. The spectra of TiO, Hα, and 304 Å are used for corresponding atmospheric heights from the photosphere to lower corona. Power spectrum analysis at the formation height of Hα – 0.6 Å to the Hα center resulted in the detection of 5 minute oscillation signals in intensity interpreted as running waves outside the umbral center, mostly with vertical magnetic field inclination >15°. A phase-speed filter is used to extract the running wave signals with speed v ph > 4 km s‑1, from the time series of Hα – 0.4 Å images, and found twenty-four 3 minute umbral oscillatory events in a duration of one hour. Interestingly, the initial emergence of the 3 minute umbral oscillatory events are noticed closer to or at umbral boundaries. These 3 minute umbral oscillatory events are observed for the first time as propagating from a fraction of preceding running penumbral waves (RPWs). These fractional wavefronts rapidly separate from RPWs and move toward the umbral center, wherein they expand radially outwards suggesting the beginning of a new umbral oscillatory event. We found that most of these umbral oscillatory events develop further into RPWs. We speculate that the waveguides of running waves are twisted in spiral structures and hence the wavefronts are first seen at high latitudes of umbral boundaries and later at lower latitudes of the umbral center.
Solar wind and coronal structure near sunspot minimum - Pioneer and SMM observations from 1985-1987
Mihalov, J. D.; Barnes, A.; Hundhausen, A. J.; Smith, E. J.
1990-01-01
Changes in solar wind speed and magnetic polarity observed at the Pioneer spacecraft are discussed here in terms of the changing magnetic geometry implied by SMM coronagraph observations over the period 1985-1987. The pattern of recurrent solar wind streams, the long-term average speed, and the sector polarity of the interplanetary magnetic field all changed in a manner suggesting both a temporal variation, and a changing dependence on heliographic latitude. Coronal observations during this epoch show a systematic variation in coronal structure and the magnetic structure imposed on the expanding solar wind. These observations suggest interpretation of the solar wind speed variations in terms of the familiar model where the speed increases with distance from a nearly flat interplanetary current sheet, and where this current sheet becomes aligned with the solar equatorial plane as sunspot minimum approaches, but deviates rapidly from that orientation after minimum.
Predictions of Solar Cycle 24: How are We Doing?
Pesnell, William D.
2016-01-01
Predictions of solar activity are an essential part of our Space Weather forecast capability. Users are requiring usable predictions of an upcoming solar cycle to be delivered several years before solar minimum. A set of predictions of the amplitude of Solar Cycle 24 accumulated in 2008 ranged from zero to unprecedented levels of solar activity. The predictions formed an almost normal distribution, centered on the average amplitude of all preceding solar cycles. The average of the current compilation of 105 predictions of the annual-average sunspot number is 106 +/- 31, slightly lower than earlier compilations but still with a wide distribution. Solar Cycle 24 is on track to have a below-average amplitude, peaking at an annual sunspot number of about 80. Our need for solar activity predictions and our desire for those predictions to be made ever earlier in the preceding solar cycle will be discussed. Solar Cycle 24 has been a below-average sunspot cycle. There were peaks in the daily and monthly averaged sunspot number in the Northern Hemisphere in 2011 and in the Southern Hemisphere in 2014. With the rapid increase in solar data and capability of numerical models of the solar convection zone we are developing the ability to forecast the level of the next sunspot cycle. But predictions based only on the statistics of the sunspot number are not adequate for predicting the next solar maximum. I will describe how we did in predicting the amplitude of Solar Cycle 24 and describe how solar polar field predictions could be made more accurate in the future.
Chromospheric Plasma Ejections in a Light Bridge of a Sunspot
Energy Technology Data Exchange (ETDEWEB)
Song, Donguk; Chae, Jongchul; Yang, Heesu; Cho, Kyuhyoun; Kwak, Hannah [Astronomy Program, Department of Physics and Astronomy, Seoul National University, 1 Gwanak-ro, Gwanak-gu, Seoul 08826 (Korea, Republic of); Yurchyshyn, Vasyl [Big Bear Solar Observatory, New Jersey Institute of Technology, 40386 North Shore Lane, Big Bear City, CA 92314-9672 (United States); Lim, Eun-Kyung; Cho, Kyung-Suk, E-mail: dusong@astro.snu.ac.kr [Korea Astronomy and Space Science Institute 776, Daedeokdae-ro, Yuseong-gu, Daejeon 34055 (Korea, Republic of)
2017-02-01
It is well-known that light bridges (LBs) inside a sunspot produce small-scale plasma ejections and transient brightenings in the chromosphere, but the nature and origin of such phenomena are still unclear. Utilizing the high-spatial and high-temporal resolution spectral data taken with the Fast Imaging Solar Spectrograph and the TiO 7057 Å broadband filter images installed at the 1.6 m New Solar Telescope of Big Bear Solar Observatory, we report arcsecond-scale chromospheric plasma ejections (1.″7) inside a LB. Interestingly, the ejections are found to be a manifestation of upwardly propagating shock waves as evidenced by the sawtooth patterns seen in the temporal-spectral plots of the Ca ii 8542 Å and H α intensities. We also found a fine-scale photospheric pattern (1″) diverging with a speed of about 2 km s{sup −1} two minutes before the plasma ejections, which seems to be a manifestation of magnetic flux emergence. As a response to the plasma ejections, the corona displayed small-scale transient brightenings. Based on our findings, we suggest that the shock waves can be excited by the local disturbance caused by magnetic reconnection between the emerging flux inside the LB and the adjacent umbral magnetic field. The disturbance generates slow-mode waves, which soon develop into shock waves, and manifest themselves as the arcsecond-scale plasma ejections. It also appears that the dissipation of mechanical energy in the shock waves can heat the local corona.
Chromospheric Plasma Ejections in a Light Bridge of a Sunspot
Song, Donguk; Chae, Jongchul; Yurchyshyn, Vasyl; Lim, Eun-Kyung; Cho, Kyung-Suk; Yang, Heesu; Cho, Kyuhyoun; Kwak, Hannah
2017-02-01
It is well-known that light bridges (LBs) inside a sunspot produce small-scale plasma ejections and transient brightenings in the chromosphere, but the nature and origin of such phenomena are still unclear. Utilizing the high-spatial and high-temporal resolution spectral data taken with the Fast Imaging Solar Spectrograph and the TiO 7057 Å broadband filter images installed at the 1.6 m New Solar Telescope of Big Bear Solar Observatory, we report arcsecond-scale chromospheric plasma ejections (1.″7) inside a LB. Interestingly, the ejections are found to be a manifestation of upwardly propagating shock waves as evidenced by the sawtooth patterns seen in the temporal-spectral plots of the Ca II 8542 Å and Hα intensities. We also found a fine-scale photospheric pattern (1″) diverging with a speed of about 2 km s-1 two minutes before the plasma ejections, which seems to be a manifestation of magnetic flux emergence. As a response to the plasma ejections, the corona displayed small-scale transient brightenings. Based on our findings, we suggest that the shock waves can be excited by the local disturbance caused by magnetic reconnection between the emerging flux inside the LB and the adjacent umbral magnetic field. The disturbance generates slow-mode waves, which soon develop into shock waves, and manifest themselves as the arcsecond-scale plasma ejections. It also appears that the dissipation of mechanical energy in the shock waves can heat the local corona.
NONLINEAR PREDICTION OF SOLAR CYCLE 24
International Nuclear Information System (INIS)
Kilcik, A.; Anderson, C. N. K.; Ye, H.; Sugihara, G.; Rozelot, J. P.; Ozguc, A.
2009-01-01
Sunspot activity is highly variable and challenging to forecast. Yet forecasts are important, since peak activity has profound effects on major geophysical phenomena including space weather (satellite drag, telecommunications outages) and has even been correlated speculatively with changes in global weather patterns. This paper investigates trends in sunspot activity, using new techniques for decadal-scale prediction of the present solar cycle (cycle 24). First, Hurst exponent H analysis is used to investigate the autocorrelation structure of the putative dynamics; then the Sugihara-May algorithm is used to predict the ascension time and the maximum intensity of the current sunspot cycle. Here we report H = 0.86 for the complete sunspot number data set (1700-2007) and H = 0.88 for the reliable sunspot data set (1848-2007). Using the Sugihara-May algorithm analysis, we forecast that cycle 24 will reach its maximum in 2012 December at approximately 87 sunspot units.
International Nuclear Information System (INIS)
El-Borie, M A; Bishara, A A; Abdel-halim, A A; El-Monier, S Y
2017-01-01
We provide a long epoch study of a set of solar and plasma parameters (sunspot number Rz, total solar irradiance TSI, solar radio flux SF, solar wind speed V , ion density n, dynamic pressure n V 2 , and ion temperature T) covering a temporal range of several decades corresponding to almost four solar cycles. Such data have been organized accordingly with the interplanetary magnetic field (IMF) polarity, i.e. away (A) if the azimuthal component of the IMF points away from the Sun and T if it points towards, to examine the N-S asymmetries between the northern and southern hemispheres. Our results displayed the sign of the N-S asymmetry in solar activity depends on the solar magnetic polarity state (qA>0 or qA<0). The solar flux component of toward field vector was larger in magnitude than those of away field vector during the negative polarity epochs (1986-88 and 2001-08). In addition, the solar wind speeds (SWS) are faster by about 22.11±4.5 km/s for away polarity days than for toward polarity days during the qA<0 epoch (2001-08), where the IMF points away from the Sun. Moreover, during solar cycles 21 st and 24 th the solar plasma is more dense, hotter, and faster south of the HCS. (paper)
Fan-shaped jets above the light bridge of a sunspot driven by reconnection
Robustini, Carolina; Leenaarts, Jorrit; de la Cruz Rodriguez, Jaime; Rouppe van der Voort, Luc
2016-05-01
We report on a fan-shaped set of high-speed jets above a strongly magnetized light bridge (LB) of a sunspot observed in the Hα line. We study the origin, dynamics, and thermal properties of the jets using high-resolution imaging spectroscopy in Hα from the Swedish 1m Solar Telescope and data from the Solar Dynamics Observatory and Hinode. The Hα jets have lengths of 7-38 Mm, are impulsively accelerated to a speed of ~100 km s-1 close to photospheric footpoints in the LB, and exhibit a constant deceleration consistent with solar effective gravity. They are predominantly launched from one edge of the light bridge, and their footpoints appear bright in the Hα wings. Atmospheric Imaging Assembly data indicates elongated brightenings that are nearly co-spatial with the Hα jets. We interpret them as jets of transition region temperatures. The magnetic field in the light bridge has a strength of 0.8-2 kG and it is nearly horizontal. All jet properties are consistent with magnetic reconnection as the driver. Movies associated to Figs. 1 and 2 are available in electronic form at http://www.aanda.org
Polar coronal holes and solar cycles
International Nuclear Information System (INIS)
Simon, P.A.
1979-01-01
The relationship between the geomagnetic activity of the three years preceding a sunspot minimum and the peak of the next sunspot maximum confirms the polar origin of the solar wind during one part of the solar cycle. Pointing out that the polar holes have a very small size or disappear at the time of the polar field reversal, a low latitude origin of the solar-wind at sunspot maximum is suggested and the cycle variation of solar wind and geomagnetic activity is described. In addition a close relationship is noted between the maximum level of the geomagnetic activity reached a few years before a solar minimum and its level at the next sunspot maximum. Studying separately the effects of both the low latitude holes and the solar activity, the possibility of predicting both the level of geomagnetic activity and the sunspot number at the next sunspot maximum is pointed out. As a conclusion the different categories of phenomena contributing to a solar cycle are specified. (Auth.)
Xu, Tao; Gu, Lili; Choi, Min Ji; Kim, Ryeo Jin; Suh, Mi Chung; Kang, Hunseung
2014-01-01
Although the functional roles of zinc finger-containing glycine-rich RNA-binding proteins (RZs) have been characterized in several plant species, including Arabidopsis thaliana and rice (Oryza sativa), the physiological functions of RZs in wheat (Triticum aestivum) remain largely unknown. Here, the functional roles of the three wheat RZ family members, named TaRZ1, TaRZ2, and TaRZ3, were investigated using transgenic Arabidopsis plants under various abiotic stress conditions. Expression of TaRZs was markedly regulated by salt, dehydration, or cold stress. The TaRZ1 and TaRZ3 proteins were localized to the nucleus, whereas the TaRZ2 protein was localized to the nucleus, endoplasmic reticulum, and cytoplasm. Germination of all three TaRZ-expressing transgenic Arabidopsis seeds was retarded compared with that of wild-type seeds under salt stress conditions, whereas germination of TaRZ2- or TaRZ3-expressing transgenic Arabidopsis seeds was retarded under dehydration stress conditions. Seedling growth of TaRZ1-expressing transgenic plants was severely inhibited under cold or salt stress conditions, and seedling growth of TaRZ2-expressing plants was inhibited under salt stress conditions. By contrast, expression of TaRZ3 did not affect seedling growth of transgenic plants under any of the stress conditions. In addition, expression of TaRZ2 conferred freeze tolerance in Arabidopsis. Taken together, these results suggest that different TaRZ family members play various roles in seed germination, seedling growth, and freeze tolerance in plants under abiotic stress.
Sakurai, Takashi; Goossens, Marcel; Hollweg, Joseph V.
1991-01-01
The present method of addressing the resonance problems that emerge in such MHD phenomena as the resonant absorption of waves at the Alfven resonance point avoids solving the fourth-order differential equation of dissipative MHD by recourse to connection formulae across the dissipation layer. In the second part of this investigation, the absorption of solar 5-min oscillations by sunspots is interpreted as the resonant absorption of sounds by a magnetic cylinder. The absorption coefficient is interpreted (1) analytically, under certain simplifying assumptions, and numerically, under more general conditions. The observed absorption coefficient magnitude is explained over suitable parameter ranges.
Analisis Perbandingan Kinerja Mach-Zehnder berdasarkan Ragam Format Modulasi pada Jaringan FTTH
Directory of Open Access Journals (Sweden)
ZULIA NURUL KARIMAH
2017-06-01
Full Text Available ABSTRAKPada jurnal ini dibuat pemodelan link FTTH pada software Optisystem 7.0 untuk mengetahui pengaruh dari Kerr effect dengan membandingkan performansi serat optik kaca dan serat optik plastik berdasarkan format modulasi berupa NRZ, RZ, RZ-DPSK, RZ-DQPSK dan CSRZ. Terdapat dua skenario, dengan skenario pertama, variabel input yang diubah adalah format modulasi pada Mach-zehnder, sedangkan pada skenario kedua, variabel yang diubah adalah pemakaian serat optik yang dipakai, yaitu serat optik bahan kaca, plastik dan hybrid kaca plastik. Hasil simulasi menunjukkan dengan efek linier dan non-linier pada kabel kaca yang menghasilkan performansi jaringan dari yang terbaik, dengan Q factor di atas 6 dan BER di bawah 10-9 adalah NRZ, RZ, RZ-DPSK, CSRZ dan RZ-DQPSK. Sedangkan dengan penggunaan kabel PMMA, yang menunjukkan performansi jaringan yang baik adalah dengan konfigurasi G652D-G652D-PMMA pada format modulasi NRZ, RZ, RZ-DPSK dan RZ-DQPSK. Efek non-linier yang terjadi pada jaringan ini hanya SPM dan XPM.Kata kunci: FTTH, mach-zehnder, format modulasi, efek non-linier, GOF, POF.ABSTRACTIn this journal is creating a FTTH link on Optisystem software 7.0 to determine the effect of Kerr effect by comparing the performance of fiber optic glass and plastic optical fiber based on modulation formats such as NRZ, RZ, RZ-DPSK, RZ-DQPSK and CSRZ. There are two scenarios, first, input variables are changed based on format in Mach-zehnder modulator, while in the second scenario, the changed variable is the material of optical fiber, the materials are optical fiber glass, plastic and hybrid plastic and glass. The simulation results based on comparison with linear and nonlinear effects on glass optical fiber, which produce Q factor above 6 and BER below 10-9 are NRZ, RZ, RZ-DPSK, CSRZ and RZ-DQPSK. While the use of PMMA cable, which indicates good network performance is the configuration G652D-G652D-PMMA on the modulation format NRZ, RZ, RZ-DPSK and RZ
Analisis Perbandingan Kinerja Mach-Zehnder berdasarkan Ragam Format Modulasi pada Jaringan FTTH
Directory of Open Access Journals (Sweden)
ZULIA NURUL KARIMAH
2018-03-01
Full Text Available ABSTRAK Pada jurnal ini dibuat pemodelan link FTTH pada software Optisystem 7.0 untuk mengetahui pengaruh dari Kerr effect dengan membandingkan performansi serat optik kaca dan serat optik plastik berdasarkan format modulasi berupa NRZ, RZ, RZ-DPSK, RZ-DQPSK dan CSRZ. Terdapat dua skenario, dengan skenario pertama, variabel input yang diubah adalah format modulasi pada Mach-zehnder, sedangkan pada skenario kedua, variabel yang diubah adalah pemakaian serat optik yang dipakai, yaitu serat optik bahan kaca, plastik dan hybrid kaca plastik. Hasil simulasi menunjukkan dengan efek linier dan non-linier pada kabel kaca yang menghasilkan performansi jaringan dari yang terbaik, dengan Q factor di atas 6 dan BER di bawah 10-9 adalah NRZ, RZ, RZ-DPSK, CSRZ dan RZ-DQPSK. Sedangkan dengan penggunaan kabel PMMA, yang menunjukkan performansi jaringan yang baik adalah dengan konfigurasi G652D-G652D-PMMA pada format modulasi NRZ, RZ, RZ-DPSK dan RZ-DQPSK. Efek non-linier yang terjadi pada jaringan ini hanya SPM dan XPM. Kata kunci: FTTH, mach-zehnder, format modulasi, efek non-linier, GOF, POF. ABSTRACT In this journal is creating a FTTH link on Optisystem software 7.0 to determine the effect of Kerr effect by comparing the performance of fiber optic glass and plastic optical fiber based on modulation formats such as NRZ, RZ, RZ-DPSK, RZ-DQPSK and CSRZ. There are two scenarios, first, input variables are changed based on format in Mach-zehnder modulator, while in the second scenario, the changed variable is the material of optical fiber, the materials are optical fiber glass, plastic and hybrid plastic and glass. The simulation results based on comparison with linear and nonlinear effects on glass optical fiber, which produce Q factor above 6 and BER below 10-9 are NRZ, RZ, RZ-DPSK, CSRZ and RZ-DQPSK. While the use of PMMA cable, which indicates good network performance is the configuration G652D-G652D-PMMA on the modulation format NRZ, RZ, RZ-DPSK and RZ
International Nuclear Information System (INIS)
Abbasi, A.; Bilal, M.; Hussain, J.; Shah, M. M.; Hassan, A.
2016-01-01
Plant genetic transformation requires robust regeneration system. Plant growth regulators (PGRs) such as cytokinins (CKs) play a pivotal role in organogenesis; however, CKs are the most expensive PGRs. In the current study, an efficient yet economical protocol for regeneration of potato plant was developed. Stem inter-nodal and leaf explants were cultured on different regeneration media supplemented with varying concentration of different CKs such as kinetin and zeatin. Murashige- Skoog media added with zeatin (1, 1.5 mg/L) was designated as RZ1, RZ1.5, respectively or kinetin (1.5, 2 mg/L) was designated as RK1.5 and RK2, respectively, however, concentrations of other hormones such as NAA (1-Naphthaleneacetic acid) and GA3 (Gibberellic acid A3) were kept same. RZ1 and RZ1.5 gave significantly better Results as compared to RK-type media in all aspects studied such as callus initiation, days to first shoot emergence, number of shoots per explants. RZ1 medium was then selected as regeneration media for Agrobacterium-mediated transformation of potato plants with cyanobacterial phosphoenol pyruvate carboxylase gene, which provided multiple putative transformants on selection media. The transformants were further confirmed through PCR. The current protocol is found to be cost effective and efficient for the regeneration of Solanum tuberosum and can be successfully implied for the Agrobacterium-mediated transformation. (author)
Latitude and Power Characteristics of Solar Activity at the End of the Maunder Minimum
Ivanov, V. G.; Miletsky, E. V.
2017-12-01
Two important sources of information about sunspots in the Maunder minimum are the Spörer catalog (Spörer, 1889) and observations of the Paris observatory (Ribes and Nesme-Ribes, 1993), which cover in total the last quarter of the 17th and the first two decades of the 18th century. These data, in particular, contain information about sunspot latitudes. As we showed in (Ivanov et al., 2011; Ivanov and Miletsky, 2016), dispersions of sunspot latitude distributions are tightly related to sunspot indices, and we can estimate the level of solar activity in the past using a method which is not based on direct calculation of sunspots and weakly affected by loss of observational data. The latitude distributions of sunspots in the time of transition from the Maunder minimum to the regular regime of solar activity proved to be wide enough. It gives evidences in favor of, first, not very low cycle no.-3 (1712-1723) with the Wolf number in maximum W = 100 ± 50, and, second, nonzero activity in the maximum of cycle no.-4 (1700-1711) W = 60 ± 45. Therefore, the latitude distributions in the end of the Maunder minimum are in better agreement with the traditional Wolf numbers and new revisited indices of activity SN and GN (Clette et al., 2014; Svalgaard and Schatten, 2016) than with the GSN (Hoyt and Schatten, 1998); the latter provide much lower level of activity in this epoch.
DEFF Research Database (Denmark)
Zeine, R; Heath, D; Owens, T
1993-01-01
The effects of T cell vaccination on peripheral immune responsiveness are not yet fully understood. We have induced resistance to rat spinal cord homogenate (RSCH)-induced experimental allergic encephalomyelitis (EAE) in SJL/J mice by vaccination with four T cell lines (RZ8, RZ15, RZ16, and A51......) which were reactive to myelin basic protein (MBP) but not to proteolipid protein (PLP). The effect was relatively neuroantigen-specific since vaccination with ovalbumin (OVA)-reactive and alloantigen-specific cells did not prevent EAE induction. Alloantigen-reactive cells reduced the rate of relapse....... The number of central nervous system (CNS) infiltrates and mean clinical EAE scores were significantly reduced. This is the first report demonstrating T cell vaccination in the SJL/J mouse, a strain in which PLP is the predominant encephalitogen in RSCH. The vaccinating cells were of the memory/effector (CD...
A SOLAR FLARE DISTURBING A LIGHT WALL ABOVE A SUNSPOT LIGHT BRIDGE
International Nuclear Information System (INIS)
Hou, Yijun; Zhang, Jun; Li, Ting; Yang, Shuhong; Li, Leping; Li, Xiaohong
2016-01-01
With the high-resolution data from the Interface Region Imaging Spectrograph , we detect a light wall above a sunspot light bridge in the NOAA active region (AR) 12403. In the 1330 Å slit-jaw images, the light wall is brighter than the ambient areas while the wall top and base are much brighter than the wall body, and it keeps oscillating above the light bridge. A C8.0 flare caused by a filament activation occurred in this AR with the peak at 02:52 UT on 2015 August 28, and the flare’s one ribbon overlapped the light bridge, which was the observational base of the light wall. Consequently, the oscillation of the light wall was evidently disturbed. The mean projective oscillation amplitude of the light wall increased from 0.5 to 1.6 Mm before the flare and decreased to 0.6 Mm after the flare. We suggest that the light wall shares a group of magnetic field lines with the flare loops, which undergo a magnetic reconnection process, and they constitute a coupled system. When the magnetic field lines are pushed upward at the pre-flare stage, the light wall turns to the vertical direction, resulting in the increase of the light wall’s projective oscillation amplitude. After the magnetic reconnection takes place, a group of new field lines with smaller scales are formed underneath the reconnection site, and the light wall inclines. Thus, the projective amplitude notably decrease at the post-flare stage.
A SOLAR FLARE DISTURBING A LIGHT WALL ABOVE A SUNSPOT LIGHT BRIDGE
Energy Technology Data Exchange (ETDEWEB)
Hou, Yijun; Zhang, Jun; Li, Ting; Yang, Shuhong; Li, Leping; Li, Xiaohong, E-mail: yijunhou@nao.cas.cn [Key Laboratory of Solar Activity, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China)
2016-10-01
With the high-resolution data from the Interface Region Imaging Spectrograph , we detect a light wall above a sunspot light bridge in the NOAA active region (AR) 12403. In the 1330 Å slit-jaw images, the light wall is brighter than the ambient areas while the wall top and base are much brighter than the wall body, and it keeps oscillating above the light bridge. A C8.0 flare caused by a filament activation occurred in this AR with the peak at 02:52 UT on 2015 August 28, and the flare’s one ribbon overlapped the light bridge, which was the observational base of the light wall. Consequently, the oscillation of the light wall was evidently disturbed. The mean projective oscillation amplitude of the light wall increased from 0.5 to 1.6 Mm before the flare and decreased to 0.6 Mm after the flare. We suggest that the light wall shares a group of magnetic field lines with the flare loops, which undergo a magnetic reconnection process, and they constitute a coupled system. When the magnetic field lines are pushed upward at the pre-flare stage, the light wall turns to the vertical direction, resulting in the increase of the light wall’s projective oscillation amplitude. After the magnetic reconnection takes place, a group of new field lines with smaller scales are formed underneath the reconnection site, and the light wall inclines. Thus, the projective amplitude notably decrease at the post-flare stage.
Digital Repository Service at National Institute of Oceanography (India)
Chauhan, O.S.; Vogelsang, E.; Basavaiah, N.; Kader, U.S.A.
concordant trends, we endorse a teleconnection between century scale instabilities at the high latitude as well in SWM during the Late Holocene through an atmospheric connection (Zonneveld et al., 1997). Solar irradiance (Sun spot) vis-à-vis SWM... TSI and sun spot number (Rz); (Bard et al., 2000; Solanki et al., 2004) which is rather good (r=0.79; p=0.01). We have used available sun spot data (spline for 10 y and 5 point running averaged) for a comparison. A reducing trend in Rz has been...
International Nuclear Information System (INIS)
Ambastha, A.; Bhatnagar, A.
1988-01-01
Solar Active Region NOAA 2372 was observed extensively by the Solar Maximum Mission (SMM) satellite and several ground-based observatories during 1980 April 4-13 in the Solar Maximum Year. After its birth around April 4, it underwent a rapid growth and produced a reported 84 flares in the course of its disc passage. In this paper, photospheric and chromospheric observations of this active region have been studied together with Marshall Space Flight Center magnetograms and X-ray data from HXIS aboard the SMM satellite. In particular, the relationship of the flare-productivity with sunspot proper motions and emergence of new regions of magnetic flux in the active region from its birth to its disappearance at the W-limb has been discussed. (author). 7 figures, 2 tables, 29 refs
Lifescience Database Archive (English)
Full Text Available tative uncharacterized protein OS=Vitis... 116 7e-25 tr|Q8RZ67|Q8RZ67_ORYSJ Putative rice retrotransposon retrofit... + Sbjct: 384 ATVRIILSLAVTSGLRLHKLDVKNAFLHGFLNEEVYMEQPPGYTDPY 430 >tr|Q8RZ67|Q8RZ67_ORYSJ Putative rice retrotransposon retrofit
A steady-state supersonic downflow in the transition region above a sunspot umbra
Straus, Thomas; Fleck, Bernhard; Andretta, Vincenzo
2015-10-01
We investigate a small-scale (~1.5 Mm along the slit), supersonic downflow of about 90 km s-1 in the transition region above the lightbridged sunspot umbra in AR 11836. The observations were obtained with the Interface Region Spectrograph (IRIS) on 2013 September 2 from 16:40 to 17:59 UT. The downflow shows up as redshifted "satellite" lines of the Si iv and O iv transition region lines and is remarkably steady over the observing period of nearly 80 min. The downflow is not visible in the chromospheric lines, which only show an intensity enhancement at the location of the downflow. The density inferred from the line ratio of the redshifted satellites of the O iv lines (Ne = 1010.6 ± 0.25 cm-3) is only a factor 2 smaller than the one inferred from the main components (Ne = 1010.95 ± 0.20 cm-3). Consequently, this implies a substantial mass flux (~5 × 10-7 g cm-2 s-1), which would evacuate the overlying corona on timescales close to 10 s. We interpret these findings as evidence of a stationary termination shock of a supersonic siphon flow in a cool loop that is rooted in the central umbra of the spot. The movie is available in electronic form at http://www.aanda.org
On the structure of a magnetic field and its evolution in the vicinity of sunspots
International Nuclear Information System (INIS)
Gopasyuk, S.I.; Kartashova, L.G.
1981-01-01
The structure of magnetic field and its evolution around single large sunspots has been studied. For this purpose observational data of the longitudinal magnetic field on the photospheric level and hsub(α) filtergrams for 18 active regions have been used. It is shown that there are characteristic directions corresponding to the transition of the spot field without sign change into an extended region of the same polarity and coinciding with extended (100000-300000 km) systems of filamentary feature chains of the fine chromospheric structure in active region. The horizontal magnetic f+eld component of the spot (systems of filamentary feature chains of the fine chromospheric structure) disappears on an extended region of chromospheric surface in the direction, where the satellite field (the field of opposite polarity) appears near its boundary. On the other hand, when satellite field disappears at some direction from the spot the transversal magnetic field appears on the extended surface region of the chromosphere keeping the same direction. One of the possible causes of disappearance of the transversal magnetic field on an extended region in the chromosphere might be the reconnection of magnetic lines of force [ru
Tandberg-Hassen, E.; Cheng, C. C.; Athay, R. G.; Beckers, J. M.; Brandt, J. C.; Chapman, R. D.; Bruner, E. C.; Henze, W.; Hyder, C. L.; Gurman, J. B.
1981-01-01
New observation with the Ultraviolet Spectrometer and Polarimeter (UVSP) of a number of manifestations of solar activity obtained during the first three months of Solar Maximum Mission operations are presented. Attention is given to polarimetry in sunspots, oscillations above sunspots, density diagnostics of transition-zone plasmas in active regions, and the eruptive prominence - coronal transient link.
International Nuclear Information System (INIS)
Saito, Takao; Oki, Tosio
1989-01-01
The photospheric magnetic field is revealed to rotate with different solar rotation periods depending on its m-number, or its longitudinal range. The m-dependent rotation reveals the unexplained solar cycle variation of the 28-day period of the IMF 2-sector structure in inclining/minimum years and of the 27-day period in the declining/minimum years. The m-dependent rotation reveals also the unexplained 155-day periodicity in the occurrence of solar flare clusters, suggesting a motion of the sunspot field relative to the large-scale field. The IMF sector structure is closely related to recurrent geomagnetic storms, while the flare occurrence is related to sporadic SC storms. Hence, the m-dependent rotation is quite important in the study of the STE forecast. (author)
Ten cycles of solar and geomagnetic activity
International Nuclear Information System (INIS)
Legrand, J.P.
1981-01-01
Series of 110 years of sunspot numbers and indices of geomagnetic activity are used with 17 years of solar wind data in order to study through solar cycles both stream and shock event solar activity. According to their patterns on Bartels diagrams of geomagnetic indices, stable wind streams and transient solar activities are separated from each other. Two classes of stable streams are identified: equatorial streams occurring sporadically, for several months, during the main phase of sunspot cycles and both polar streams established, for several years, at each cycle, before sunspot minimum. Polar streams are the first activity of solar cycles. For study of the relationship between transient geomagnetic phenomena and sunspot activity, we raise the importance of the contribution, at high spot number, of severe storms and, at low spot number, of short lived and unstable streams. Solar wind data are used to check and complete the above results. As a conclusion, we suggest a unified scheme of solar activity evolution with a starting point every eleventh year, a total duration of 17 years and an overlapping of 6 years between the first and the last phase of both successive series of phenomena: first, from polar field reversal to sunspot minimum, a phase of polar wind activity of the beginning cycle is superimposed on the weak contribution of shock events of the ending cycle; secondly, an equatorial phase mostly of shock events is superimposed on a variable contribution of short lived and sporadic stable equatorial stream activities; and thirdly a phase of low latitude shock events is superimposed on the polar stream interval of the following cycle. (orig.)
The Complexity of Solar and Geomagnetic Indices
Pesnell, W. Dean
2017-08-01
How far in advance can the sunspot number be predicted with any degree of confidence? Solar cycle predictions are needed to plan long-term space missions. Fleets of satellites circle the Earth collecting science data, protecting astronauts, and relaying information. All of these satellites are sensitive at some level to solar cycle effects. Statistical and timeseries analyses of the sunspot number are often used to predict solar activity. These methods have not been completely successful as the solar dynamo changes over time and one cycle's sunspots are not a faithful predictor of the next cycle's activity. In some ways, using these techniques is similar to asking whether the stock market can be predicted. It has been shown that the Dow Jones Industrial Average (DJIA) can be more accurately predicted during periods when it obeys certain statistical properties than at other times. The Hurst exponent is one such way to partition the data. Another measure of the complexity of a timeseries is the fractal dimension. We can use these measures of complexity to compare the sunspot number with other solar and geomagnetic indices. Our concentration is on how trends are removed by the various techniques, either internally or externally. Comparisons of the statistical properties of the various solar indices may guide us in understanding how the dynamo manifests in the various indices and the Sun.
Skumanich, A.; Lites, B. W.
1985-01-01
The least square fitting of Stokes observations of sunspots using a Milne-Eddington-Unno model appears to lead, in many circumstances, to various inconsistencies such as anomalously large doppler widths and, hence, small magnetic fields which are significantly below those inferred solely from the Zeeman splitting in the intensity profile. It is found that the introduction of additional physics into the model such as the inclusion of damping wings and magneto-optic birefrigence significantly improves the fit to Stokes parameters. Model fits excluding the intensity profile, i.e., of both magnitude as well as spectral shape of the polarization parameters alone, suggest that parasitic light in the intensity profile may also be a source of inconsistencies. The consequences of the physical changes on the vector properties of the field derived from the Fe I lambda 6173 line for the 17 November 1975 spot as well as on the thermodynamic state are discussed. A Doppler width delta lambda (D) - 25mA is bound to be consistent with a low spot temperature and microturbulence, and a damping constant of a = 0.2.
Munoz-Jaramillo, Andres
2017-08-01
Data products in heliospheric physics are very often provided without clear estimates of uncertainty. From helioseismology in the solar interior, all the way to in situ solar wind measurements beyond 1AU, uncertainty estimates are typically hard for users to find (buried inside long documents that are separate from the data products), or simply non-existent.There are two main reasons why uncertainty measurements are hard to find:1. Understanding instrumental systematic errors is given a much higher priority inside instrumental teams.2. The desire to perfectly understand all sources of uncertainty postpones indefinitely the actual quantification of uncertainty in our measurements.Using the cross calibration of 200 years of sunspot area measurements as a case study, in this presentation we will discuss the negative impact that inadequate measurements of uncertainty have on users, through the appearance of toxic and unnecessary controversies, and data providers, through the creation of unrealistic expectations regarding the information that can be extracted from their data. We will discuss how empirical estimates of uncertainty represent a very good alternative to not providing any estimates at all, and finalize by discussing the bare essentials that should become our standard practice for future instruments and surveys.
Energy Technology Data Exchange (ETDEWEB)
Kleint, L.; Martínez-Sykora, J. [Bay Area Environmental Research Institute, 625 2nd Street, Ste. 209, Petaluma, CA (United States); Antolin, P. [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Tian, H.; Testa, P.; Reeves, K. K.; McKillop, S.; Saar, S.; Golub, L. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Judge, P. [High Altitude Observatory/NCAR, P.O. Box 3000, Boulder, CO 80307 (United States); De Pontieu, B.; Wuelser, J. P.; Boerner, P.; Hurlburt, N.; Lemen, J.; Tarbell, T. D.; Title, A. [Lockheed Martin Solar and Astrophysics Laboratory, 3251 Hanover St., Org. ADBS, Bldg. 252, Palo Alto, CA 94304 (United States); Carlsson, M.; Hansteen, V. [Institute of Theoretical Astrophysics, University of Oslo, P.O. Box 1029, Blindern, NO-0315 Oslo (Norway); Jaeggli, S., E-mail: lucia.kleint@fhnw.ch [Department of Physics, Montana State University, Bozeman, P.O. Box 173840, Bozeman, MT 59717 (United States); and others
2014-07-10
Interface Region Imaging Spectrograph data allow us to study the solar transition region (TR) with an unprecedented spatial resolution of 0.''33. On 2013 August 30, we observed bursts of high Doppler shifts suggesting strong supersonic downflows of up to 200 km s{sup –1} and weaker, slightly slower upflows in the spectral lines Mg II h and k, C II 1336, Si IV 1394 Å, and 1403 Å, that are correlated with brightenings in the slitjaw images (SJIs). The bursty behavior lasts throughout the 2 hr observation, with average burst durations of about 20 s. The locations of these short-lived events appear to be the umbral and penumbral footpoints of EUV loops. Fast apparent downflows are observed along these loops in the SJIs and in the Atmospheric Imaging Assembly, suggesting that the loops are thermally unstable. We interpret the observations as cool material falling from coronal heights, and especially coronal rain produced along the thermally unstable loops, which leads to an increase of intensity at the loop footpoints, probably indicating an increase of density and temperature in the TR. The rain speeds are on the higher end of previously reported speeds for this phenomenon, and possibly higher than the free-fall velocity along the loops. On other observing days, similar bright dots are sometimes aligned into ribbons, resembling small flare ribbons. These observations provide a first insight into small-scale heating events in sunspots in the TR.
He, Jie; Austin, Paul T; Lee, Sing Kong
2010-09-01
Effects of elevated root zone (RZ) CO(2) and air temperature on photosynthesis, productivity, nitrate (NO(3)(-)), and total reduced nitrogen (N) content in aeroponically grown lettuce plants were studied. Three weeks after transplanting, four different RZ [CO(2)] concentrations [ambient (360 ppm) and elevated concentrations of 2000, 10,000, and 50,000 ppm] were imposed on plants grown at two air temperature regimes of 28 degrees C/22 degrees C (day/night) and 36 degrees C/30 degrees C. Photosynthetic CO(2) assimilation (A) and stomatal conductance (g(s)) increased with increasing photosynthetically active radiation (PAR). When grown at 28 degrees C/22 degrees C, all plants accumulated more biomass than at 36 degrees C/30 degrees C. When measured under a PAR >or=600 micromol m(-2) s(-1), elevated RZ [CO(2)] resulted in significantly higher A, lower g(s), and higher midday leaf relative water content in all plants. Under elevated RZ [CO(2)], the increase of biomass was greater in roots than in shoots, causing a lower shoot/root ratio. The percentage increase in growth under elevated RZ [CO(2)] was greater at 36 degrees C/30 degrees C although the total biomass was higher at 28 degrees C/22 degrees C. NO(3)(-) and total reduced N concentrations of shoot and root were significantly higher in all plants under elevated RZ [CO(2)] than under ambient RZ [CO(2)] of 360 ppm at both temperature regimes. At each RZ [CO(2)], NO(3)(-) and total reduced N concentration of shoots were greater at 28 degrees C/22 degrees C than at 36 degrees C/30 degrees C. At all RZ [CO(2)], roots of plants at 36 degrees C/30 degrees C had significantly higher NO(3)(-) and total reduced N concentrations than at 28 degrees C/22 degrees C. Since increased RZ [CO(2)] caused partial stomatal closure, maximal A and maximal g(s) were negatively correlated, with a unique relationship for each air temperature. However, across all RZ [CO(2)] and temperature treatments, there was a close correlation between
International Nuclear Information System (INIS)
Ivanov, K.G.; Evdokimova, L.V.; Mikerina, N.V.
1982-01-01
Occurrences of interplanetary shock waves near the Earth after the powerful isolated flares of 1957-1978 are investigated. The close connection between the occurrences of shock waves and the positions of magnetic axes of bipolar groups of sunspots is suggested on the basis of a statistical study. The shock waves are principally observed when the Earth finds itself near the planes that are projected through the flares in parallel to the appropriate magnetic axes of the nearest bipolar groups. This regularity is interpreted as an indirect argument for a three-dimensional geometry for the interplanetary shock waves which, when projected on these flattened to corresponding planes, are traces of large circular arcs. The typical angular scales of isolated interplanetary shock waves are estimated as approx. equal to 150 0 and approx. equal to 30 0 parallel and perpendicular, respectively, to the magnetic axes correspondingly. (orig.)
Extending Counter-streaming Motion from an Active Region Filament to a Sunspot Light Bridge
Wang, Haimin; Liu, Rui; Li, Qin; Liu, Chang; Deng, Na; Xu, Yan; Jing, Ju; Wang, Yuming; Cao, Wenda
2018-01-01
We analyze high-resolution observations from the 1.6 m telescope at Big Bear Solar Observatory that cover an active region filament. Counter-streaming motions are clearly observed in the filament. The northern end of the counter-streaming motions extends to a light bridge, forming a spectacular circulation pattern around a sunspot, with clockwise motion in the blue wing and counterclockwise motion in the red wing, as observed in the Hα off-bands. The apparent speed of the flow is around 10–60 km s‑1 in the filament, decreasing to 5–20 km s‑1 in the light bridge. The most intriguing results are the magnetic structure and the counter-streaming motions in the light bridge. Similar to those in the filament, the magnetic fields show a dominant transverse component in the light bridge. However, the filament is located between opposed magnetic polarities, while the light bridge is between strong fields of the same polarity. We analyze the power of oscillations with the image sequences of constructed Dopplergrams, and find that the filament’s counter-streaming motion is due to physical mass motion along fibrils, while the light bridge’s counter-streaming motion is due to oscillation in the direction along the line-of-sight. The oscillation power peaks around 4 minutes. However, the section of the light bridge next to the filament also contains a component of the extension of the filament in combination with the oscillation, indicating that some strands of the filament are extended to and rooted in that part of the light bridge.
Energy Technology Data Exchange (ETDEWEB)
Hou, Yijun; Zhang, Jun; Li, Ting; Yang, Shuhong; Li, Xiaohong, E-mail: yijunhou@nao.cas.cn, E-mail: zjun@nao.cas.cn [Key Laboratory of Solar Activity, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China)
2017-10-10
Recent high-resolution observations from the Interface Region Imaging Spectrograph reveal bright wall-shaped structures in active regions (ARs), especially above sunspot light bridges. Their most prominent feature is the bright oscillating front in the 1400/1330 Å channel. These structures are named light walls and are often interpreted to be driven by p-mode waves. Above the light bridge of AR 12222 on 2014 December 06, we observed intermittent ejections superimposed on an oscillating light wall in the 1400 Å passband. At the base location of each ejection, the emission enhancement was detected in the Solar Dynamics Observatory 1600 Å channel. Thus, we suggest that in wall bases (light bridges), in addition to the leaked p-mode waves consistently driving the oscillating light wall, magnetic reconnection could happen intermittently at some locations and eject the heated plasma upward. Similarly, in the second event occurring in AR 12371 on 2015 June 16, a jet was simultaneously detected in addition to the light wall with a wave-shaped bright front above the light bridge. At the footpoint of this jet, lasting brightening was observed, implying magnetic reconnection at the base. We propose that in these events, two mechanisms, p-mode waves and magnetic reconnection, simultaneously play roles in the light bridge, and lead to the distinct kinetic features of the light walls and the ejection-like activities, respectively. To illustrate the two mechanisms and their resulting activities above light bridges, in this study we present a cartoon model.
International Nuclear Information System (INIS)
Chi, Yu-Chieh; Lin, Gong-Ru
2013-01-01
The optical self-injection mode-locking of a semiconductor optical amplifier incorporated fiber ring laser (SOAFL) with spectrally sliced multi-channel carriers is demonstrated for applications. The synthesizer-free SOAFL pulse-train is delivered by optical injection mode-locking with a 10 GHz self-pulsed electro-absorption modulator (EAM). Such a coupled optical and electronic resonator architecture facilitates a self-feedback oscillation with a higher Q-factor and lower phase/intensity noises when compared with conventional approaches. The theoretical model of such an injection-mode-locking SOAFL is derived to improve the self-pulsating performance of the optical return-to-zero (RZ) carrier, thus providing optimized pulsewidth, pulse extinction ratio, effective Q-factor, frequency variation and timing jitter of 11.4 ps, 9.1 dB, 4 × 10 5 , −1 bi-directional WDM transmission network with down-stream RZ binary phase-shift keying (RZ-BPSK) and up-stream re-modulated RZ on–off-keying (RZ-OOK) formats. Under BPSK/OOK bi-directional data transmission, the self-pulsed harmonic mode-locking SOAFL simultaneously provides four to six WDM channels for down-stream RZ-BPSK and up-stream RZ-OOK formats with receiving sensitivities of −17 and −15.2 dBm at a bit error rate of 10 −9 , respectively. (paper)
Hormones and Pod Development in Oilseed Rape (Brassica napus) 1
de Bouille, Pierre; Sotta, Bruno; Miginiac, Emile; Merrien, André
1989-01-01
The endogenous levels of several plant growth substances (indole acetic acid, IAA; abscisic acid, ABA; zeatin, Z; zeatin riboside, [9R]Z; isopentenyladenine, iP; and isopentenyladenosine, [9R]iP were measured during pod development of field grown oilseed Rape (Brassica napus L. var oleifera cv Bienvenu) with high performance liquid chromatography and immunoenzymic (enzyme-linked immunosorbent assay, ELISA) techniques. Results show that pod development is characterized by high levels of Z and [9R]Z in 3 day old fruits and of IAA on the fourth day. During pod maturation, initially a significant increase of IAA and cytokinins was observed, followed by a progressive rise of ABA levels and a concomitant decline of IAA and cytokinin (except iP) levels. The relationship between hormone levels and development, especially pod number, seed number per pod, and seed weight determination, will be discussed. PMID:16666891
Directory of Open Access Journals (Sweden)
A. de Paor
2001-01-01
Full Text Available A new viewpoint on the generation and maintenance of the Earth's magnetic field is put forward, which integrates self-exciting dynamo theory with the possibility of energy coupling along orthogonal axes provided by the Hall effect. A nonlinear third-order system is derived, with a fourth equation serving as an observer of unspecified geophysical processes which could result in field reversal. Lyapunov analysis proves that chaos is not intrinsic to this system. Relative constancy of one of the variables produces pseudo equilibrium in a second order subsystem and allows for self-excitation of the geomagnetic field. Electromagnetic analysis yields expressions for key parameters. Models for secular variations recorded at London, Palermo and at the Cape of Good Hope over the past four hundred years are offered. Offset of the Earth's magnetic axis from the geographic axis is central to time-varying declination, but its causes have not yet been established. Applicability of the model to the explanation of sunspot activity is outlined. A corroborating experiment published by Peter Barlow in 1831 is appended.
Serchan, S. P.; Vidon, P.
2015-12-01
This study measured dissolved greenhouse gas (GHG) concentrations in interstitial water and stream across various "hotspots" in headwater catchments of Archer Creek watershed, New York, USA. Results indicated that stream water was hyper saturated with methane (CH4), and moderately saturated with carbon dioxide (CO2), and nitrous oxide (N2O). The values of dissolved CO2 (88.3 μmol/L), dissolved CH4 (1.2 μmol/L), and dissolved N2O (0.02 μmol/L) found in the stream were 5.8, 432, and 2.3 times in excess of atmospheric equilibrium, respectively. Results of dissolved GHG measured in interstitial water across various sites: riparian dry (RZ-Dry), riparian wet (RZ-Wet), riparian mucky (RZ-Mucky), pool with fine textured bed sediments (IS-fine-sedpool), pool with coarse textured bed sediments (IS-coarse-sed-pool), and riffles (Riffle) indicated high variations in the degree of saturation of all three GHG. RZ-Mucky, RZ-Wet, and IS-fine-sedpool sites were hotspots of CH4 and CO2 relative to other sites. RZ-Dry sites were hotspots of N2O. Multiple linear regression models indicated that dissolved oxygen (D.O.) and dissolved organic carbon (DOC) influenced dissolved CO2 and CH4 at most of the sites. Relationships between dissolved N2O and predictor variables were highly variable across all sites. Patterns of dissolved N2O in relatively oxic RZ-Dry sites (D.O. 5.3 mg/L) were positively correlated with nitrate (NO3) indicating nitrification as a dominant process in N2O production. In contrast, patterns of dissolved N2O were positively correlated with ammonium (NH4+) at RZ-Wet and RZ-Mucky sites where concentrations of D.O. were significantly lower compared to other sites.
Solar irridiance variations and solar activity
International Nuclear Information System (INIS)
Willson, R.C.
1982-01-01
A mean value for the 1 AU total solar irradiance of 1368.2 W/m 2 and a downward trend of 0.05% per year were derived from measurements by the Active Cavity Radiometer Irradiance Monitor (ACRIM) experiment on the Solar Maximum Mission during 1980. Distinct temporary solar irradiance decreases associated with solar activity maxima were observed with a series of nine dips from April to October recurring at fairly regular intervals averaging 24 days. The decreases correlate inversely with sunspot area, 2800-MHz flux, and Zurich sunspot number. Dominant periods common to the irradiance and sunspot area power spectra link the irradiance decreases to sunspot flux deficit in solar active regions. Evidence of significant total irradiance modulation by facular flux excess is cited. A persistent radiative cycle of active regions consistent with the ACRIM irradiance results and the morphology of solar active regions was found. The pattern of regularly recurrent active region maxima between April and October suggests an asymmetry in solar activity generation during this period
PROF. DR. M. FAHRETTİN KIRZIOĞLU’ NUN BAZI MÜCADELELERİ VE MEKTUPLARINDAN İKTİBASLAR
Kırzıoğlu, Banıçiçek
2010-01-01
ÖZETMakale, Türkolog Prof. Dr. M. Fahrettin Kırzıoğlu’nun , kardeşi M. Cemal Kırzıoğlu’na yazdığı bazı mektuplarından alıntılar ile; bu mektuplardan tespit edilebilen bir kısım mücadelelerini ihtiva etmektedir. ABSTRACTThis study includes some quotations from the letters that a Turcologist Prof. Dr. M.Fahrettin Kırzıoğlu wrote to his brother M. Cemal Kırzıoğlu and some of his contention determined through these letters.
Annual reconstruction of the solar cycle from atmospheric 14C variations
International Nuclear Information System (INIS)
Murphy, J.O.
1990-01-01
Initially, the rise and fall components of the 11-year solar sunspot cycle are approximated by separate least-squares polynomials for four cycle classifications, which are determined by the magnitude of the average of the annual sunspot numbers per cycle. Following a method is formulated to generate detailed reconstruction of the annual variation of a solar cycle based on this cycle average, and the results obtained for cycles -4 through to 21 are compared with the annual Zurich values. This procedure is then employed to establish annual sunspot numbers using published average cycle values obtained from atmospheric carbon 14 variations, which have been derived from the chemical analysis of tree ring sections. The reconstructed sequences are correlated with the observed cycle values and with tree ring width index chronologies which exhibit a significant 11-year periodicity. It is anticipated that the long carbon 14 records and parallel dendrochronological data could be employed to obtain a more detailed portrayal of previous periods of strong solar activity than that given by current estimates based on historical records. 17 refs., 2 tabs., 9 figs
Microstructure Formation and Fracturing Characteristics of Grey Cast Iron Repaired Using Laser
Liu, Dan; Shi, Yongjun
2014-01-01
The repairing technology based on laser rapid fusion is becoming an important tool for fixing grey cast iron equipment efficiently. A laser repairing protocol was developed using Fe-based alloy powders as material. The microstructure and fracturing feature of the repaired zone (RZ) were analyzed. The results showed that regionally organized RZ with good density and reliable metallurgical bond can be achieved by laser repairing. At the bottom of RZ, dendrites existed in similar direction and extended to the secondary RZ, making the grains grow extensively with inheritance with isometric grains closer to the surface substrate. The strength of the grey cast iron base material was maintained by laser repairing. The base material and RZ were combined with robust strength and fracture resistance. The prevention and deflection of cracking process were analyzed using a cracking process model and showed that the overall crack toughness of the materials increased. PMID:25032230
Energy Technology Data Exchange (ETDEWEB)
Qu Weizheng; Zhao Jinping; Huang Fei; Deng Shenggui, E-mail: quweizhe@ouc.edu.cn [College of Environment Oceanography, Ocean University of China, Qingdao 266100 (China)
2012-07-15
According to the variation pattern of the solar magnetic field polarity and its relation to the relative sunspot number, we established the time series of the sunspot magnetic field polarity index and analyzed the strength and polarity cycle characteristics of the solar magnetic field. The analysis showed the existence of a cycle with about a 22-year periodicity in the strength and polarity of the solar magnetic field, which proved the Hale proposition that the 11-year sunspot cycle is one-half of the 22-year solar magnetic cycle. By analyzing the atmospheric temperature field, we found that the troposphere and the stratosphere in the middle latitude of both the northern and southern hemispheres exhibited a common 22-year quasicycle in the atmospheric temperature, which is believed to be attributable to the 22-year solar magnetic cycle.
International Nuclear Information System (INIS)
Qu Weizheng; Zhao Jinping; Huang Fei; Deng Shenggui
2012-01-01
According to the variation pattern of the solar magnetic field polarity and its relation to the relative sunspot number, we established the time series of the sunspot magnetic field polarity index and analyzed the strength and polarity cycle characteristics of the solar magnetic field. The analysis showed the existence of a cycle with about a 22-year periodicity in the strength and polarity of the solar magnetic field, which proved the Hale proposition that the 11-year sunspot cycle is one-half of the 22-year solar magnetic cycle. By analyzing the atmospheric temperature field, we found that the troposphere and the stratosphere in the middle latitude of both the northern and southern hemispheres exhibited a common 22-year quasicycle in the atmospheric temperature, which is believed to be attributable to the 22-year solar magnetic cycle.
CORONAL DYNAMIC ACTIVITIES IN THE DECLINING PHASE OF A SOLAR CYCLE
Energy Technology Data Exchange (ETDEWEB)
Jang, Minhwan; Choe, G. S. [Department of Astronomy and Space Science, Kyung Hee University, Yongin 17104 (Korea, Republic of); Woods, T. N. [Laboratory for Atmospheric and Space Physics, University of Colorado, Boulder, CO 80303 (United States); Hong, Sunhak, E-mail: gchoe@khu.ac.kr [School of Space Research, Kyung Hee University, Yongin 17104 (Korea, Republic of)
2016-12-10
It has been known that some solar activity indicators show a double-peak feature in their evolution through a solar cycle, which is not conspicuous in sunspot number. In this Letter, we investigate the high solar dynamic activity in the declining phase of the sunspot cycle by examining the evolution of polar and low-latitude coronal hole (CH) areas, splitting and merging events of CHs, and coronal mass ejections (CMEs) detected by SOHO /LASCO C3 in solar cycle 23. Although the total CH area is at its maximum near the sunspot minimum, in which polar CHs prevail, it shows a comparable second maximum in the declining phase of the cycle, in which low-latitude CHs are dominant. The events of CH splitting or merging, which are attributed to surface motions of magnetic fluxes, are also mostly populated in the declining phase of the cycle. The far-reaching C3 CMEs are also overpopulated in the declining phase of the cycle. From these results we suggest that solar dynamic activities due to the horizontal surface motions of magnetic fluxes extend far in the declining phase of the sunspot cycle.
CORONAL DYNAMIC ACTIVITIES IN THE DECLINING PHASE OF A SOLAR CYCLE
International Nuclear Information System (INIS)
Jang, Minhwan; Choe, G. S.; Woods, T. N.; Hong, Sunhak
2016-01-01
It has been known that some solar activity indicators show a double-peak feature in their evolution through a solar cycle, which is not conspicuous in sunspot number. In this Letter, we investigate the high solar dynamic activity in the declining phase of the sunspot cycle by examining the evolution of polar and low-latitude coronal hole (CH) areas, splitting and merging events of CHs, and coronal mass ejections (CMEs) detected by SOHO /LASCO C3 in solar cycle 23. Although the total CH area is at its maximum near the sunspot minimum, in which polar CHs prevail, it shows a comparable second maximum in the declining phase of the cycle, in which low-latitude CHs are dominant. The events of CH splitting or merging, which are attributed to surface motions of magnetic fluxes, are also mostly populated in the declining phase of the cycle. The far-reaching C3 CMEs are also overpopulated in the declining phase of the cycle. From these results we suggest that solar dynamic activities due to the horizontal surface motions of magnetic fluxes extend far in the declining phase of the sunspot cycle.
Energy Technology Data Exchange (ETDEWEB)
Samanta, Tanmoy; Banerjee, Dipankar [Indian Institute of Astrophysics, Koramangala, Bangalore 560034 (India); Tian, Hui [School of Earth and Space Sciences, Peking University (China); Schanche, Nicole, E-mail: tsamanta@iiap.res.in, E-mail: huitian@pku.edu.cn, E-mail: dipu@iiap.res.in, E-mail: ns81@st-andrews.ac.uk [University of St. Andrews, St. Andrews (United Kingdom)
2017-02-01
Recent high-resolution observations have revealed that subarcsecond bright dots (BDs) with sub-minute lifetimes appear ubiquitously in the transition region (TR) above sunspot penumbra. The presence of penumbral micro-jets (PMJs) in the chromosphere was previously reported. It was proposed that both the PMJs and BDs are formed due to a magnetic reconnection process and may play an important role in heating of the penumbra. Using simultaneous observations of the chromosphere from the Solar Optical Telescope (SOT) on board Hinode and observations of the TR from the Interface Region Imaging Spectrograph , we study the dynamics of BDs and their relation to PMJs. We find two types of BDs, one that is related to PMJs, and another that does not show any visible dynamics in the SOT Ca ii H images. From a statistical analysis we show that these two types have different properties. The BDs that are related to PMJs always appear at the top of the PMJs, the vast majority of which show inward motion and originate before the generation of the PMJs. These results may indicate that the reconnection occurs at the lower coronal/TR height and initiates PMJs at the chromosphere. This formation mechanism is in contrast with the formation of PMJs by reconnection in the (upper) photosphere between differently inclined fields.
Variations in Solar Parameters and Cosmic Rays with Solar Magnetic Polarity
Energy Technology Data Exchange (ETDEWEB)
Oh, S. [Department of Earth Science Education, Chonnam National University, Gwangju, 61186 (Korea, Republic of); Yi, Y., E-mail: suyeonoh@jnu.ac.kr [Department of Astronomy, Space Science and Geology, Chungnam National University, Daejeon, 34134 (Korea, Republic of)
2017-05-01
The sunspot number varies with the 11-year Schwabe cycle, and the solar magnetic polarity reverses every 11 years approximately at the solar maximum. Because of polarity reversal, the difference between odd and even solar cycles is seen in solar activity. In this study, we create the mean solar cycle expressed by phase using the monthly sunspot number for all solar cycles 1–23. We also generate the mean solar cycle for sunspot area, solar radio flux, and cosmic ray flux within the allowance of observational range. The mean solar cycle has one large peak at solar maximum for odd solar cycles and two small peaks for most even solar cycles. The odd and even solar cycles have the statistical difference in value and shape at a confidence level of at least 98%. For solar cycles 19–23, the second peak in the even solar cycle is larger than the first peak. This result is consistent with the frequent solar events during the declining phase after the solar maximum. The difference between odd and even solar cycles can be explained by a combined model of polarity reversal and solar rotation. In the positive/negative polarity, the polar magnetic field introduces angular momentum in the same/opposite direction as/to the solar rotation. Thus the addition/subtraction of angular momentum can increase/decrease the motion of plasma to support the formation of sunspots. Since the polarity reverses at the solar maximum, the opposite phenomenon occurs in the declining phase.
Sudden transitions and grand variations in the solar dynamo, past and future☆
Directory of Open Access Journals (Sweden)
De Jager Cornelis
2012-06-01
Full Text Available The solar dynamo is the exotic dance of the sun’s two major magnetic field components, the poloidal and the toroidal, interacting in anti-phase. On the basis of new data on the geomagnetic aa index, we improve our previous forecast of the properties of the current Schwabe cycle #24. Its maximum will occur in 2013.5 and the maximum sunspot number Rmax will then be 62 ± 12, which is within the bounds of our earlier forecasts. The subsequent analysis, based on a phase diagram, which is a diagram showing the relation between maximum sunspot numbers and minimum geomagnetic aa index values leads to the conclusion that a new Grand Episode in solar activity has started in 2008. From the study of the natural oscillations in the sunspot number time series, as found by an analysis based on suitable wavelet base functions, we predict that this Grand Episode will be of the Regular Oscillations type, which is the kind of oscillations that also occurred between 1724 and 1924. Previous expectations of a Grand (Maunder-type Minimum of solar activity cannot be supported. We stress the significance of the Hallstatt periodicity for determining the character of the forthcoming Grand Episodes. No Grand Minimum is expected to occur during the millennium that has just started.
Kohler, Susanna
2015-09-01
At the end of last year, the Suns large-scale magnetic field suddenly strengthened, reaching its highest value in over two decades. Here, Neil Sheeley and Yi-Ming Wang (both of the Naval Research Laboratory) propose an explanation for why this happened and what it predicts for the next solar cycle.Magnetic StrengtheningUntil midway through 2014, solar cycle 24 the current solar cycle was remarkably quiet. Even at its peak, it averaged only 79 sunspots per year, compared to maximums of up to 190 in recent cycles. Thus it was rather surprising when, toward the end of 2014, the Suns large-scale magnetic field underwent a sudden rejuvenation, with its mean field leaping up to its highest values since 1991 and causing unprecedentedly large numbers of coronal loops to collapse inward.Yet in spite of the increase we observed in the Suns open flux (the magnetic flux leaving the Suns atmosphere, measured from Earth), there was not a significant increase in solar activity, as indicated by sunspot number and the rate of coronal mass ejections. This means that the number of sources of magnetic flux didnt increase so Sheeley and Wang conclude that flux must instead have been emerging from those sources in a more efficient way! But how?Aligned ActivityWSO open flux and the radial component of the interplanetary magnetic field (measures of the magnetic flux leaving the Suns photosphere and heliosphere, respectively), compared to sunspot number (in units of 100 sunspots). A sudden increase in flux is visible after the peak of each of the last four sunspot cycles. Click for a larger view! [Sheeley Wang 2015]The authors show that the active regions on the solar surface in late 2014 lined up in such a way that the emerging flux was enhanced, forming a strong equatorial dipole field that accounts for the sudden rejuvenation observed.Interestingly, this rejuvenation of the Suns open flux wasnt just a one-time thing; similar bursts have occurred shortly after the peak of every sunspot
Variation of the quiet sun at 21 cm - 1981-1987
International Nuclear Information System (INIS)
Bastian, T.S.; Dulk, G.A.
1988-01-01
The sun was imaged at a wavelength of about 21 cm during 1981-1987 using the VLA, the Green Bank 91-m telescope, the Arecibo 305 m telescope, and powerful maximum entropy image reconstruction techniques. There was a systematic decrease in the quiet sun's brightness temperature at 21 cm as the sun declined from sunspot maximum to sunspot minimum; this was accompanied by a systematic decrease in the sun's radius. The two-fold decrease in the electron number density in the solar transition region and low corona could have been the cause of these variations. 7 references
Design and Performance Analysis of 2D OCDMA System with Polarization States
Bharti, Manisha; Sharma, Ajay K.; Kumar, Manoj
2016-12-01
This paper focuses on increasing the number of subscribers in optical code-division multiple access (OCDMA) system by using one of the features of light signal that it can be propagated in two polarization states. The performance of two-dimensional (2D) OCDMA system based on wavelength-time coding scheme by adding polarization state is investigated at varying data rates from 1 GHz to 6 GHz and for various modulation formats. It is reported that with increase in data rate of system, the performance of the system deteriorates due to polarization mode dispersion. Non-return to-zero (RZ), return to-zero (RZ), carrier suppressed return-to-zero (CSRZ) and differential phase shift keying (DPSK) modulation formats are simulated for a single user system with polarization. Investigations reveal that differential phase shift keying (DPSK) modulation format suits best to the proposed system and exhibit the potential to improve the flexibility of system for more number of users. The investigations are reported in terms of Q-factor, BER, received optical power (ROP) and eye diagrams.
Energy Technology Data Exchange (ETDEWEB)
Yang, Ya-Hui [Institute of Space Science, National Central University, Jhongli 32001, Taiwan (China); Hsieh, Min-Shiu [Geophysical Institute, University of Alaska Fairbanks, AK 99775-7320 (United States); Yu, Hsiu-Shan [Center for Astrophysics and Space Sciences, University of California San Diego, CA 92093 (United States); Chen, P. F., E-mail: yhyang@jupiter.ss.ncu.edu.tw, E-mail: mhsieh2@alaska.edu, E-mail: hsyu@ucsd.edu, E-mail: chenpf@nju.edu.cn [School of Astronomy and Space Science, Nanjing University, Nanjing 210023 (China)
2017-01-10
It is often believed that intense flares preferentially originate from the large-size active regions (ARs) with strong magnetic fields and complex magnetic configurations. This work investigates the dependence of flare activity on the AR properties and clarifies the influence of AR magnetic parameters on the flare productivity, based on two data sets of daily sunspot and flare information as well as the GOES soft X-ray measurements and HMI vector magnetograms. By considering the evolution of magnetic complexity, we find that flare behaviors are quite different in the short- and long-lived complex ARs and the ARs with more complex magnetic configurations are likely to host more impulsive and intense flares. Furthermore, we investigate several magnetic quantities and perform the two-sample Kolmogorov–Smirnov test to examine the similarity/difference between two populations in different types of ARs. Our results demonstrate that the total source field strength on the photosphere has a good correlation with the flare activity in complex ARs. It is noted that intense flares tend to occur at the regions of strong source field in combination with an intermediate field-weighted shear angle. This result implies that the magnetic free energy provided by a complex AR could be high enough to trigger a flare eruption even with a moderate magnetic shear on the photosphere. We thus suggest that the magnetic free energy represented by the source field rather than the photospheric magnetic complexity is a better quantity to characterize the flare productivity of an AR, especially for the occurrence of intense flares.
Temporal and Periodic Variations of Sunspot Counts in Flaring and Non-Flaring Active Regions
Kilcik, A.; Yurchyshyn, V.; Donmez, B.; Obridko, V. N.; Ozguc, A.; Rozelot, J. P.
2018-04-01
We analyzed temporal and periodic variations of sunspot counts (SSCs) in flaring (C-, M-, or X-class flares), and non-flaring active regions (ARs) for nearly three solar cycles (1986 through 2016). Our main findings are as follows: i) temporal variations of monthly means of the daily total SSCs in flaring and non-flaring ARs behave differently during a solar cycle and the behavior varies from one cycle to another; during Solar Cycle 23 temporal SSC profiles of non-flaring ARs are wider than those of flaring ARs, while they are almost the same during Solar Cycle 22 and the current Cycle 24. The SSC profiles show a multi-peak structure and the second peak of flaring ARs dominates the current Cycle 24, while the difference between peaks is less pronounced during Solar Cycles 22 and 23. The first and second SSC peaks of non-flaring ARs have comparable magnitude in the current solar cycle, while the first peak is nearly absent in the case of the flaring ARs of the same cycle. ii) Periodic variations observed in the SSCs profiles of flaring and non-flaring ARs derived from the multi-taper method (MTM) spectrum and wavelet scalograms are quite different as well, and they vary from one solar cycle to another. The largest detected period in flaring ARs is 113± 1.6 days while we detected much longer periodicities (327± 13, 312 ± 11, and 256± 8 days) in the non-flaring AR profiles. No meaningful periodicities were detected in the MTM spectrum of flaring ARs exceeding 55± 0.7 days during Solar Cycles 22 and 24, while a 113± 1.3 days period was detected in flaring ARs of Solar Cycle 23. For the non-flaring ARs the largest detected period was only 31± 0.2 days for Cycle 22 and 72± 1.3 days for the current Cycle 24, while the largest measured period was 327± 13 days during Solar Cycle 23.
Pan, Ling
Motivated by the great potential applications of gamma titanium aluminide based alloys and the important effect of diffusion on the properties of gamma-TiAl/alpha2-Ti3Al two-phase lamellar structure, we conduct this thesis research to explore the microstructural evolution and interdiffusion behavior, and their correlations in multi-phase solid state diffusion couples made up of pure titanium and polysynthetically-twinned (PST) Ti-49.3 at.% Al "single" crystal, in the temperature range of 973--1173 K. The diffusion couples are prepared by high vacuum hot-pressing, with the diffusion direction parallel to the lamellar planes. Scanning electron microscopy (SEM), transmission electron microscopy (TEM) and high-resolution transmission electron microscopy (HRTEM) are employed to observe the microstructure at various interfaces/interphases. A reaction zone (RZ) of polycrystalline alpha 2-Ti3Al phase forms along the PST Ti-Al/Ti bonding interface having a wavy interface with the PST crystal and exhibits deeper penetration in alpha2 lamellae, consisting of many fine alpha2 and secondary gamma laths, than in primary gamma lamellae. Direct measurement of the RZ thickness on SEM back-scattered electron images reveals a parabolic growth of the RZ, indicating a macroscopically diffusion-controlled growth. Concentration profiles from Ti, through the RZ, into the alpha2 lamellae of the PST crystal are measured by quantitative energy-dispersive x-ray spectroscopy (EDS) in a scanning transmission electron microscope (STEM). A plateau of composition adjacent to the RZ/(mixed alpha2 lath in PST) interface forms in the deeply penetrated RZ grains, implying a diffusion barrier crossing the interface and some extent of interface control in the RZ grain growth. The interdiffusion coefficient is evaluated both independent of composition and as a function of composition. No significant concentration dependence of the interdiffusion coefficients is observed using Boltzmann-Matano analysis
Directory of Open Access Journals (Sweden)
Yang Xin
Full Text Available This study attempted to clarify the material basis for the detoxification of Rhizoma Zingiberis (RZ on aconitine, an analgesic drug, by quantitatively assessing the influence of RZ on the in vitro intestinal concentration of aconitine using an everted gut sac model and by qualitatively identifying the components in the RZ extract. To quantify aconitine in rat everted gut sacs, both an accurate processing method and a sensitive detection method were required. We developed a three-step sample processing method to protect the components from decomposition and applied ultra-performance liquid chromatography coupled with triple quadrupole mass spectrometry (UPLC/TQMS to quantify aconitine, glucose and digoxin. In addition, ultra-performance liquid chromatography coupled with linear ion trap mass spectrometry (UPLC/ITMS was applied to detect the potential antidotal components in the RZ extract. Finally, the RZ extract reduced the level of aconitine in everted gut sacs, and eleven gingerols were successfully identified, which could be considered potential antidotal components for aconitine. This study demonstrated the application of two UPLC/MS methods for analyzing the material basis for the reciprocity between Chinese medicine components in everted gut sacs.
Correlation between ionospheric potential and the intensity of cosmic rays
International Nuclear Information System (INIS)
Meyerott, R.E.; Reagan, J.B.; Evans, J.E.
1983-01-01
Ionospheric potential variations with a period of about 10 yr have been observed in the data that have been acquired to date. Previous studies have shown that these variations appear to be correlated inversely with sunspot number and with solar wind velocity, and directly with cosmic ray intensity. Since the cosmic ray intensity is inversely correlated with sunspot number and solar wind velocity, these correlations all suggest that the long period variations are of solar origin. In this report it is shown that, over the limited period for which ionospheric potential measurements exist, the long period variations are better correlated with the aerosol burden injected into the stratosphere by large volcanic eruptions than with the intensity of cosmic rays. This result indicates that the long period variations in ionospheric potential are of terrestrial rather than solar origin. 20 references
DEFF Research Database (Denmark)
Maram, Reza; Kong, Deming; Galili, Michael
2016-01-01
We propose a novel approach for all-optical return-to-zero (RZ) to non-return-to-zero (NRZ) telecommunication data format conversion based on linear spectral phase manipulation of an RZ data signal. The operation principle is numerically analyzed and experimentally validated through successful fo...
Directory of Open Access Journals (Sweden)
Abdil KUŞ
2016-06-01
Full Text Available In this study, the machinability characteristics of Al/B4C-Gr hybrid composite were investigated using wire electrical discharge machining (WEDM. In the experiments, the machining parameters of wire speed, pulse-on time and pulse-off time were varied in order to explaiın their effects on machining performance, including the width of slit (kerf and surface roughness values (Rz and Rt. According to the Taguchi quality design concept, a L18 (21×32 orthogonal array was used to determine the S/N ratio, and analysis of variance (ANOVA and the F-test were used to indicate the significant machining parameters affecting the machining performance. From the ANOVA and F-test results, the significant factors were determined for each of the machining performance criteria of kerf, Rz and Rt. The variations of kerf, Rz and Rt with the machining parameters were statistically modeled via the regression analysis method. The optimum levels of the control factors for kerf, Rz and Rt were specified as A1B1C1, A1B1C2 and A1B1C2, respectively. The correlation coefficients of the predictive equations developed for kerf, Rz and Rt were calculated as 0.98, 0.828 and 0.855, respectively.
Evaluation of Fall Planting Dates of Cumin (Cuminum cyminum L. Ecotypes in Mashhad Conditions
Directory of Open Access Journals (Sweden)
Z Khorasani
2012-07-01
Full Text Available In order to study the effects of fall planting dates on yield and yield components of six cumin (Cuminum cyminum L. ecotypes an experiment was arranged in a randomized complete block design as a split-plot with three replications during 2007-08 growing season at the Agricultural Research Station of Ferdowsi University of Mashhad. Three planting dates (18 Oct. (first, 8 Nov. (second and 29 Dec. (third and six cumin ecotypes (Torbat heydarieh, Khaf, Sabzevar, Ghaen, Ghoochan and RZ19 were allocated to main and sub plots, respectively. Results showed that the effects of planting dates, ecotypes and interaction effects of planting dates and cumin ecotypes were significant for yield components (winter survival percentage, number of umbel per plant, number of seeds per umbel and 1000-seed weight and seed yield and biological yield. There was a reduction on yield components (number of umbel per plant, number of seeds per umbel and 1000-seed weight, seed yield and biological yield due to delay planting date from 18 Oct. to 29 Dec. The highest winter survival percentage was achieved on the third planting date. The highest and lowest amount for all of the traits, were achieved in Ghaen and RZ19 ecotypes, respectively. According to the useful results and for the deployment of cumin fall planting in other locations of province, continuation of this study to recommended.
1976-04-01
25,00 oo4 L.S I 1 00 L.S 15 000 L.t. 1 0SIOOO L.S. is 1 3,00l 2 00 ,o000 c.Y. 3.00 27 000 9.000 C.V. 3 27 000 9000 c .. 3.00 - . rZ 27000 N 00...34_ __ 75.00 _45( 6 ea. 75.00 ___ _ 5 6 ea. .0L0 _450 6 0g. .00.~ * 1.00 1s 180 lin.ft. 1.00 190 180 lin.ft. 1.00 ISO 1e0 180 1 .ft. 1.80 1" * 0.30 ___ _ 1 500
The solar activity cycle physical causes and consequences
Hudson, Hugh; Petrovay, Kristóf; Steiger, Rudolf
2015-01-01
A collection of papers edited by four experts in the field, this book sets out to describe the way solar activity is manifested in observations of the solar interior, the photosphere, the chromosphere, the corona and the heliosphere. The 11-year solar activity cycle, more generally known as the sunspot cycle, is a fundamental property of the Sun. This phenomenon is the generation and evolution of magnetic fields in the Sun’s convection zone, the photosphere. It is only by the careful enumeration and description of the phenomena and their variations that one can clarify their interdependences. The sunspot cycle has been tracked back about four centuries, and it has been recognized that to make this data set a really useful tool in understanding how the activity cycle works and how it can be predicted, a very careful and detailed effort is needed to generate sunspot numbers. This book deals with this topic, together with several others that present related phenomena that all indicate the physical pr...
Directory of Open Access Journals (Sweden)
Tsui Wei CHOONG
2016-09-01
Full Text Available Temperate crops cannot grow well in the tropics without rootzone cooling. As cooling increased production costs, this experiment aimed to study the growth of various Lactuca genotypes and propose possible ways of reducing these costs, without compromising productivity. A recombinant inbred line (RIL of lettuce and its parental lines (L. serriola and L. sativa ‘Salinas’ were grown aeroponically in a tropical greenhouse under 24 C cool (C or warm fluctuating 30-36 C ambient (A rootzone temperature (RZT. Their roots were misted with Netherlands standard nutrient solution for 1 min, at intervals of either 5 min (A5, C5 or 10 min (A10, C10 in attempting to reduce electricity consumption and production costs. Lower mortality and higher productivity were observed in all genotypes when grown in C-RZT. Higher shoot fresh weight was observed under C5 than C10, for the RIL and L. serriola. Since ‘Salinas’ had similar shoot fresh weight at both C-RZ treatments, this may indicate it is more sensitive to RZT than water availability. Under A-RZ treatments, higher carotenoid content, with correspondingly higher nonphotochemical quenching, was observed in A10 for the RIL and ‘Salinas’. Further, total chlorophyll content was also highest at this RZ treatment for the RIL though photochemical quenching was contrastingly the lowest. Cumulatively, productivity was compromised at A10 as the RIL seemed to prioritize photoprotection over efficiency in photosynthesis, under conditions of higher RZT and lower water availability. Generally, higher RZ ethylene concentrations accumulated in A10 and C10 than A5 and C5, respectively – probably due to spray frequency exerting a greater effect on RZ ethylene accumulation than RZT. In the C5 RZ treatment, lowest RZ ethylene concentration corresponded with highest shoot fresh weight. As such, further research on ethylene (insensitivity and water use efficiency could be conducted to identify Lactuca cultivars
Energy Technology Data Exchange (ETDEWEB)
Zhao, L.; Landi, E. [Department of Atmospheric, Oceanic, and Space Sciences, University of Michigan, Ann Arbor, MI 48105 (United States); Gibson, S. E., E-mail: lzh@umich.edu [NCAR/HAO, P.O. Box 3000, Boulder, CO 80307-3000 (United States)
2013-08-20
Since the unusually prolonged and weak solar minimum between solar cycles 23 and 24 (2008-2010), the sunspot number is smaller and the overall morphology of the Sun's magnetic field is more complicated (i.e., less of a dipole component and more of a tilted current sheet) compared with the same minimum and ascending phases of the previous cycle. Nearly 13 yr after the last solar maximum ({approx}2000), the monthly sunspot number is currently only at half the highest value of the past cycle's maximum, whereas the polar magnetic field of the Sun is reversing (north pole first). These circumstances make it timely to consider alternatives to the sunspot number for tracking the Sun's magnetic cycle and measuring its complexity. In this study, we introduce two novel parameters, the standard deviation (SD) of the latitude of the heliospheric current sheet (HCS) and the integrated slope (SL) of the HCS, to evaluate the complexity of the Sun's magnetic field and track the solar cycle. SD and SL are obtained from the magnetic synoptic maps calculated by a potential field source surface model. We find that SD and SL are sensitive to the complexity of the HCS: (1) they have low values when the HCS is flat at solar minimum, and high values when the HCS is highly tilted at solar maximum; (2) they respond to the topology of the HCS differently, as a higher SD value indicates that a larger part of the HCS extends to higher latitude, while a higher SL value implies that the HCS is wavier; (3) they are good indicators of magnetically anomalous cycles. Based on the comparison between SD and SL with the normalized sunspot number in the most recent four solar cycles, we find that in 2011 the solar magnetic field had attained a similar complexity as compared to the previous maxima. In addition, in the ascending phase of cycle 24, SD and SL in the northern hemisphere were on the average much greater than in the southern hemisphere, indicating a more tilted and wavier
Efficiency of different protocols for enamel clean-up after bracket debonding: an in vitro study
Directory of Open Access Journals (Sweden)
Lara Carvalho Freitas Sigilião
2015-10-01
Full Text Available Objective: This study aimed to assess the efficiency of six protocols for cleaning-up tooth enamel after bracket debonding.Methods:A total of 60 premolars were divided into six groups, according to the tools used for clean-up: 12-blade bur at low speed (G12L, 12-blade bur at high speed (G12H, 30-blade bur at low speed (G30L, DU10CO ORTHO polisher (GDU, Renew System (GR and Diagloss polisher (GD. Mean roughness (Ra and mean roughness depth (Rz of enamel surface were analyzed with a profilometer. Paired t-test was used to assess Ra and Rz before and after enamel clean-up. ANOVA/Tukey tests were used for intergroup comparison. The duration of removal procedures was recorded. The association between time and variation in enamel roughness (∆Ra, ∆Rz were evaluated by Pearson's correlation test. Enamel topography was assessed by scanning electron microscopy (SEM.Results:In Groups G12L and G12H, original enamel roughness did not change significantly. In Groups G30L, GDU, GR and GD, a smoother surface (p < 0.05 was found after clean-up. In Groups G30L and GD, the protocols used were more time-consuming than those used in the other groups. Negative and moderate correlation was observed between time and (∆Ra, ∆Rz; Ra and (∆Ra, ∆Rz; Rz (r = - 0.445, r = - 0.475, p < 0.01.Conclusion:All enamel clean-up protocols were efficient because they did not result in increased surface roughness. The longer the time spent performing the protocol, the lower the surface roughness.
REGULARITY OF THE NORTH–SOUTH ASYMMETRY OF SOLAR ACTIVITY: REVISITED
International Nuclear Information System (INIS)
Zhang, J.; Feng, W.
2015-01-01
Extended time series of Solar Activity Indices (ESAI) extended the Greenwich series of sunspot area from the year 1874 back to 1821. The ESAI's yearly sunspot area in the northern and southern hemispheres from 1821 to 2013 is utilized to investigate characteristics of the north–south hemispherical asymmetry of sunspot activity. Periodical behavior of about 12 solar cycles is also confirmed from the ESAI data set to exist in dominant hemispheres, linear regression lines of yearly asymmetry values, and cumulative counts of yearly sunspot areas in the hemispheres for solar cycles. The period is also inferred to appear in both the cumulative difference in the yearly sunspot areas in the hemispheres over the entire time interval and in its statistical Student's t-test. The hemispherical bias of sunspot activity should be regarded as an impossible stochastic phenomenon over a long time period
The evolution of flaring and non-flaring active regions
Kilcik, A.; Yurchyshyn, V.; Sahin, S.; Sarp, V.; Obridko, V.; Ozguc, A.; Rozelot, J. P.
2018-06-01
According to the modified Zurich classification, sunspot groups are classified into seven different classes (A, B, C, D, E, F and H) based on their morphology and evolution. In this classification, classes A and B, which are small groups, describe the beginning of sunspot evolution, while classes D, E and F describe the large and evolved groups. Class C describes the middle phase of sunspot evolution and the class H describes the end of sunspot evolution. Here, we compare the lifetime and temporal evolution of flaring and non-flaring active regions (ARs), and the flaring effect on ARs in these groups in detail for the last two solar cycles (1996 through 2016). Our main findings are as follows: (i) Flaring sunspot groups have longer lifetimes than non-flaring ones. (ii) Most of the class A, B and C flaring ARs rapidly evolve to higher classes, while this is not applicable for non-flaring ARs. More than 50 per cent of the flaring A, B and C groups changed morphologically, while the remaining D, E, F and H groups did not change remarkably after the flare activity. (iii) 75 per cent of all flaring sunspot groups are large and complex. (iv) There is a significant increase in the sunspot group area in classes A, B, C, D and H after flaring activity. In contrast, the sunspot group area of classes E and F decreased. The sunspot counts of classes D, E and F decreased as well, while classes A, B, C and H showed an increase.
El-Fatatry, Hamed M; Mabrouk, Mokhtar M; Hewala, Ismail I; Emam, Ehab H
2014-08-01
Two selective stability-indicating HPLC methods are described for determination of rabeprazole sodium (RZ)-mosapride citrate (MR) and RZ-itopride hydrochloride (IO) mixtures in the presence of their ICH-stress formed degradation products. Separations were achieved on X-Bridge C18 column using two mobile phases: the first for RZ-MR mixture consisted of acetonitrile: 0.025 M KH 2 PO 4 solution: TEA (30:69:1 v/v; pH 7.0); the second for RZ-IO mixture was at ratio of 25:74:1 (v/v; pH 9.25). The detection wavelength was 283 nm. The two methods were validated and validation acceptance criteria were met in all cases. Peak purity testing using contrast angle theory, relative absorbance and log A versus the wavelengths plots were presented. The % recoveries of the intact drugs were between 99.1% and 102.2% with RSD% values less than 1.6%. Application of the proposed HPLC methods indicated that the methods could be adopted to follow the stability of their formulations.
CSIR Research Space (South Africa)
Joubert, S
2006-05-01
Full Text Available and Manufacturing TRANSVERSELY ISOTROPIC CYLINDER - 1 φ φ r z a x y Ω P P O u v w z ( )1 1 1 2 1 1 rrr rz rr zr r zrz zz rz u r r z r v r r z r w r r z r ϕ ϕϕ ϕϕ ϕϕ ϕ ϕ σσ σ σ σ ρ ϕ σσ σ σ ρ ϕ σσ σ σ ρ ϕ... ∂ ∂ ∂ + + + − = ∂ ∂ ∂ ∂∂ ∂ + + + = ∂ ∂ ∂ ∂∂ ∂ + + + = ∂ ∂ ∂ && && && 6 CSIR Material Science and Manufacturing TRANSVERSELY ISOTROPIC CYLINDER - 2 ( )1 1 1 2 1 1 rrr rz rr zr r zrz zz rz u r r z r v r r z r w r r z r ϕ ϕϕ ϕϕ ϕϕ ϕ ϕ σσ σ σ σ ρ ϕ σσ σ σ ρ ϕ σσ σ σ ρ ϕ...
Kinematic model of some types of motion of matter in active regions
International Nuclear Information System (INIS)
Platov, Yu.V.
1983-01-01
The kinematics of matter motion in variable magnetic fields of active regions on the Sun in the MHD approximation of a strong field and cold plasma is investigated. It is shown that the variation of sunspot magnetic moments lead to the development of different active phenomena in the solar atmosphere. The development of such phenomena at first can occur at the phase of active region growth, when new sunspots together with developed sunspots emerge in an active region or relative motions take place in a sunspot group
Recent applications of SUPERFISH
International Nuclear Information System (INIS)
Gluckstern, R.L.; Neri, F.
1988-01-01
The program, SUPERFISH, obtains the frequencies and fields for azimuthally symmetric TM or TE modes in azimuthally symmetric cavities. The r-z plane is covered by a triangular mesh and the resulting difference equations for the field component H/sub phi/(TM) or E/sub phi/(TE) at the vertices of the mesh solved by direct matrix inversion. In the present paper, we describe a number of recent modifications of SUPERFISH
Vitaly, Ishkov
A reliable series of the relative numbers of sunspots (14 solar cycles ‒ 165 years) it leads to the only scenario of solar activity cycles - to the alternation of epochs of “increased” (18 ‒ 22 cycles of solar activity) and “lowered” (12 ‒ 16 and 24 ‒ ...) solar activity with the periods of solar magnetic field reconstruction in solar zone of the sunspots formation (11, 12, 23) from one epoch to another. The regime of the produce of magnetic field significantly changes in these periods, providing to the subsequent 5 cycles the stable conditions of solar activity. Space solar research made it possible to sufficiently fully investigate characteristics and parameters of the solar cycles for the epoch of “increased” (20 ‒ 22 cycles) solar activity and period of the reconstruction (22 ‒ 23 cycles) to the epoch of “lowered” solar activity (24 ‒ ... cycles). In this scenario 24 solar cycle is the first solar cycle of the second epoch of “lowered” solar activity. Therefore his development and characteristics roughly must be described in the context of the low solar cycles development (12, 14, and 16). In the current solar cycle the sunspot-forming activity is lowered, the average areas of the sunspot groups correspond to values for epoch of “lowered “solar activity, average magnetic field in the umbra of sunspots was reduced approximately to 700 gauss, and for this time was observed only 4 very large sunspot groups (≥1500 mvh). Flare activity substantially was lowered: for the time of the current solar cycle development it was occurrence of M-class flares M - 368, class X - 32, from which only 2 solar flares of class X> 5. Solar proton events are observed predominantly small intensity; but only 5 from them were the intensity of ≥100 pfu (S2) and 4 - ≥1000 pfu (S3). The first five years of the 24 cycle evolution confirm this assumption and the possibility to give the qualitative forecast of his evolution and development of the
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... The monthly sunspot numbers compiled by Temmer et al. and the monthly polar faculae from observations of the National Astronomical Observatory of Japan, for the interval of March 1954 to March 1996, are used to ... Department of Physics, Dezhou University, 253023 Dezhou, People's Republic of China.
Energy Technology Data Exchange (ETDEWEB)
Bayard, J P; Guillou, A; Lago, B; Bureau du Colombier, M J; Guillou, G; Vasseur, Ch [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1965-02-01
This report describes the specifications of the ALCI programme. This programme resolves the system of difference equations similar to the homogeneous problem of multigroup neutron scattering, with two dimensions in space, in the three geometries XY, RZ, R{theta}. It is possible with this method to calculate geometric and composition criticalities and also to calculate the accessory problem on demand. The maximum number of points dealt with is 6000. The maximum permissible number of groups is 12. The internal iterations are treated by the method of alternating directions. The external iterations are accelerated using the extrapolation method due to Tchebychev. (authors) [French] Ce rapport decrit les specifications du programme ALCI. Ce programme resout le systeme d'equations aux differences approchant le probleme homogene de la diffusion neutronique multigroupe, a deux dimensions d'espace, dans les trois geometries XY, RZ, R{theta}. Il permet des calculs de criticalite geometrique et de composition et calcule sur demande le probleme adjoint. Le nombre maximum de points traites est de 6000. Le nombre maximum de groupes permis est de 12. Les iterations interieure sont traitees par la methode des directions alternees. Les iterations exterieures sont accelerees par la methode d'extrapolation de Tchebychev. (auteurs)
DEFF Research Database (Denmark)
Kjær, Rasmus; Oxenløwe, Leif Katsuo; Palsdottir, Bera
2008-01-01
Simultaneous transient suppression of four transient-impaired 40 Gbit/s RZ-ASK WDM channels is demonstrated. Sensitivity improvements are in excess of 5 dB and transmission penalties are significantly reduced.......Simultaneous transient suppression of four transient-impaired 40 Gbit/s RZ-ASK WDM channels is demonstrated. Sensitivity improvements are in excess of 5 dB and transmission penalties are significantly reduced....
A climatological study of the relations among solar activity, galactic ...
Indian Academy of Sciences (India)
Though correlation study between precipitation and other parameters do not hint any linear relation, still the Fourier and wavelet analyses give an idea of common periodicities. The 9–11 year periodicity of sunspot numbers calculated by Fourier transform is also confirmed by wavelet transform in annual scale. Similarly ...
Indian Academy of Sciences (India)
Barai Paramita The Fate of Dwarf Galaxies in Clusters and the Origin of. Intracluster Stars ... Basu, D. Close Separation Triple System QSO 1009–0252 with Discordant. Redshifts: Is the Spectrum of One Component Blueshifted?, 133. Bhatt Nipa, J. Predicting Maximum Sunspot Number in Solar Cycle 24, 71 ... Universe, 119.
PIC space-charge emission with finite Δt and Δz
International Nuclear Information System (INIS)
Hewett, D.W.; Chen, Yu-Jiuan.
1993-01-01
A new algorithm for space charge emission has been developed to provide the correct (to a few percent) Child-Langmuir steady-state current limits as the number of mesh points in the voltage gap drops to O(10). Further, the transient behavior of such flows compares well with idealized, analytic cases, lending confidence as we extend these algorithms into full RZ geometry with curved emitting surfaces to investigate transient characteristics of realistic injector designs
International Nuclear Information System (INIS)
Zhao Junwei; Kosovichev, Alexander G.; Sekii, Takashi
2010-01-01
We analyze a solar active region observed by the Hinode Ca II H line using the time-distance helioseismology technique, and infer wave-speed perturbation structures and flow fields beneath the active region with a high spatial resolution. The general subsurface wave-speed structure is similar to the previous results obtained from Solar and Heliospheric Observatory/Michelson Doppler Imager observations. The general subsurface flow structure is also similar, and the downward flows beneath the sunspot and the mass circulations around the sunspot are clearly resolved. Below the sunspot, some organized divergent flow cells are observed, and these structures may indicate the existence of mesoscale convective motions. Near the light bridge inside the sunspot, hotter plasma is found beneath, and flows divergent from this area are observed. The Hinode data also allow us to investigate potential uncertainties caused by the use of phase-speed filter for short travel distances. Comparing the measurements with and without the phase-speed filtering, we find out that inside the sunspot, mean acoustic travel times are in basic agreement, but the values are underestimated by a factor of 20%-40% inside the sunspot umbra for measurements with the filtering. The initial acoustic tomography results from Hinode show a great potential of using high-resolution observations for probing the internal structure and dynamics of sunspots.
Cyber-Based Turbulent Combustion Simulation
2012-02-28
in flow-field structures between the laminar and turbulent counter-flowing fuel injection is clearly illustrated in figure 1. As a consequence , it...flame thickness by comparing with benchmark of AFRL/RZ ( UNICORN ) suppressing the oscillatory numerical behavior. These improvements in numerical...fraction with the benchmark results of AFRL/RZ. This validating base is generated by the UNICORN program on the finest mesh available and the local
Directory of Open Access Journals (Sweden)
Zhen-Hui Wang
Full Text Available BACKGROUND: Hybridization between genetically diverged organisms is known as an important avenue that drives plant genome evolution. The possible outcomes of hybridization would be the occurrences of genetic instabilities in the resultant hybrids. It remained under-investigated however whether pollination by alien pollens of a closely related but sexually "incompatible" species could evoke genomic changes and to what extent it may result in phenotypic novelties in the derived progenies. METHODOLOGY/PRINCIPAL FINDINGS: In this study, we have re-sequenced the genomes of Oryza sativa ssp. japonica cv. Matsumae and one of its derived introgressant RZ35 that was obtained from an introgressive hybridization between Matsumae and Zizanialatifolia Griseb. in general, 131 millions 90 base pair (bp paired-end reads were generated which covered 13.2 and 21.9 folds of the Matsumae and RZ35 genomes, respectively. Relative to Matsumae, a total of 41,724 homozygous single nucleotide polymorphisms (SNPs and 17,839 homozygous insertions/deletions (indels were identified in RZ35, of which 3,797 SNPs were nonsynonymous mutations. Furthermore, rampant mobilization of transposable elements (TEs was found in the RZ35 genome. The results of pathogen inoculation revealed that RZ35 exhibited enhanced resistance to blast relative to Matsumae. Notably, one nonsynonymous mutation was found in the known blast resistance gene Pid3/Pi25 and real-time quantitative (q RT-PCR analysis revealed constitutive up-regulation of its expression, suggesting both altered function and expression of Pid3/Pi25 may be responsible for the enhanced resistance to rice blast by RZ35. CONCLUSIONS/SIGNIFICANCE: Our results demonstrate that introgressive hybridization by Zizania has provoked genomewide, extensive genomic changes in the rice genome, and some of which have resulted in important phenotypic novelties. These findings suggest that introgressive hybridization by alien pollens of even a
Hong, Seunghyuck
2015-01-01
© 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved. We investigate the dependence of the recirculation zone (RZ) size and structure on the fuel composition using high-speed particle image velocimetry (PIV) and chemiluminescence measurements for C3H8/H2/air lean premixed flames stabilized in a backward-facing step combustor. Results show an intricate coupling between the flame anchoring and the RZ structure and length. For a fixed fuel composition, at relatively low equivalence ratios, the time-averaged RZ is comprised of two counter rotating eddies: a primary eddy (PE) between the shear layer and the bottom wall; and a secondary eddy (SE) between the vertical step wall and the PE. The flame stabilizes downstream of the saddle point of the dividing streamline between the two eddies. As equivalence ratio is raised, the flame moves upstream, pushing the saddle point with it and reducing the size of the SE. Higher temperature of the products reduces the velocity gradient in the shear layer and thus the reattachment length. As equivalence ratio approaches a critical value, the saddle point reaches the step and the SE collapses while the flame starts to exhibit periodic flapping motions, suggesting a correlation between the RZ structure and flame anchoring. The overall trend in the flow field is the same as we add hydrogen to the fuel at a fixed equivalence ratio, demonstrating the impact of fuel composition on the flow field. We show that the reattachment lengths (LR), which are shown to encapsulate the mean RZ structure, measured over a range of fuel composition and equivalence ratio collapse if plotted against the strained consumption speed (Sc). Results indicate that for the flame to remain anchored, the RZ structure should satisfy lR,isothermal/L R,reacting · S c/U ∞ ∼ 0.1. If this criterion cannot be met, the flame blows off, flashes back or becomes thermoacoustically unstable, suggesting a Damköhler-like criterion for
Kume, T.; Tsuruta, K.; Komatsu, H.; Shinohara, Y.; Otsuki, K.
2011-12-01
Several different methods to assess water use are available, and the sap flux measurement technique is one of the most promising methods, especially in monotonous watershed. Previously, three spatial levels of scaling have been used to obtain bottom-up transpiration estimates based on the sap flux technique: from within-tree to tree, from tree to stand, and from stand to watershed or landscape. Although there are considerable variations that must be taken into account at each step, few studies have examined plot-to-plot variability of stand-scale transpirations. To design optimum sampling method to accurately estimate transpiration at the watershed-scale, it is indispensable to understand heterogeneity of stand-scale transpiration in a forested watershed and the factors determining the heterogeneity. This study was undertaken to clarify differences of stand-scale transpirations within a watershed and the factors determining the differences. To this aim, we conducted sap flux-based transpiration estimates in two plots such as a lower riparian (RZ) and an upper ridge (UZ) zone in a watershed with Japanese cypress plantation, Kyushu, Japan in two years. Tree height and diameter of breast height (DBH) were lager in RZ than those of UZ. The stand sapwood area (As) was lager in RZ than UZ (21.9 cm2h a-1, 16.8 cm2ha-1, respectively). Stand mean sap flux (Js) in RZ was almost same as that of UZ when relatively lower Js, while, Js in RZ was higher than that of UZ when relatively higher Js (i.e., bright days in summer season). Consequently, daily stand-scale transpiration (E), which is the multiple of As and Js, differed by two times between RZ and UZ in summer season. This study found significant heterogeneity of stand-scale transpiration within the watershed and that the differences could be caused by two aspects such as stand structure and sap flux velocity.
Ledesma, José L J; Grabs, Thomas; Bishop, Kevin H; Schiff, Sherry L; Köhler, Stephan J
2015-08-01
Boreal regions store most of the global terrestrial carbon, which can be transferred as dissolved organic carbon (DOC) to inland waters with implications for both aquatic ecology and carbon budgets. Headwater riparian zones (RZ) are important sources of DOC, and often just a narrow 'dominant source layer' (DSL) within the riparian profile is responsible for most of the DOC export. Two important questions arise: how long boreal RZ could sustain lateral DOC fluxes as the sole source of exported carbon and how its hydromorphological variability influences this role. We estimate theoretical turnover times by comparing carbon pools and lateral exports in the DSL of 13 riparian profiles distributed over a 69 km(2) catchment in northern Sweden. The thickness of the DSL was 36 ± 18 (average ± SD) cm. Thus, only about one-third of the 1-m-deep riparian profile contributed 90% of the lateral DOC flux. The 13 RZ exported 8.7 ± 6.5 g C m(-2) year(-1) , covering the whole range of boreal stream DOC exports. The variation could be explained by local hydromorphological characteristics including RZ width (R(2) = 0.90). The estimated theoretical turnover times were hundreds to a few thousands of years, that is there is a potential long-lasting supply of DOC. Estimates of net ecosystem production in the RZ suggest that lateral fluxes, including both organic and inorganic C, could be maintained without drawing down the riparian pools. This was supported by measurements of stream DO(14) C that indicated modern carbon as the predominant fraction exported, including streams disturbed by ditching. The transfer of DOC into boreal inland waters from new and old carbon sources has a major influence on surface water quality and global carbon balances. This study highlights the importance of local variations in RZ hydromorphology and DSL extent for future DOC fluxes under a changing climate. © 2015 The Authors. Global Change Biology Published by John Wiley & Sons Ltd.
Does solar activity affect human happiness?
Kristoufek, Ladislav
2018-03-01
We investigate the direct influence of solar activity (represented by sunspot numbers) on human happiness (represented by the Twitter-based Happiness Index). We construct four models controlling for various statistical and dynamic effects of the analyzed series. The final model gives promising results. First, there is a statistically significant negative influence of solar activity on happiness which holds even after controlling for the other factors. Second, the final model, which is still rather simple, explains around 75% of variance of the Happiness Index. Third, our control variables contribute significantly as well: happiness is higher in no sunspots days, happiness is strongly persistent, there are strong intra-week cycles and happiness peaks during holidays. Our results strongly contribute to the topical literature and they provide evidence of unique utility of the online data.
Delgado-Fernandez, I.; Jackson, D.; Cooper, J. A.; Baas, A. C.; Lynch, K.; Beyers, M.
2010-12-01
Airflow separation, lee-side eddies and secondary flows play an essential role on the formation and maintenance of sand dunes. Downstream from dune crests the flow surface layer detaches from the ground and generates an area characterised by turbulent eddies in the dune lee slope (the wake). At some distance downstream from the dune crest, flow separates into a reversed component directed toward the dune toe and an offshore “re-attached” component. This reattachment zone (RZ) has been documented in fluvial and desert environments, wind tunnel experiments and numerical simulations, but not yet characterised in coastal dunes. This study examines the extent and temporal evolution of the RZ and its implications for beach-dune interaction at Magilligan, Northern Ireland. Wind parameters were measured over a profile extending from an 11 m height dune crest towards the beach, covering a total distance of 65 m cross-shore. Data was collected using an array of nine ultrasonic anemometers (UAs) deployed in April-May 2010, as part of a larger experiment to capture airflow data under a range of incident wind velocities and offshore directions. UAs were located along the profile (5 m tower spacing) over the beach, which allowed a detailed examination of the RZ with empirical data. Numerical modelling using Computational Fluid Dynamics (CFD) software was also conducted with input data from anemometer field measurements, running over a surface mesh generated from LiDAR and DGPS surveys. Results demonstrate that there is a wind threshold of approximately 5-6 ms-1 under which no flow separation exists with offshore winds. As wind speed increases over the threshold, a flow reversal area is quickly formed, with the maximum extent of the RZ at approximately 3.5 dune heights (h). The maximum extent of the RZ increases up to 4.5h with stronger wind speeds of 8-10 ms-1 and remains relatively constant as wind speed further increases. This suggests that the spatial extent of the RZ is
VizieR Online Data Catalog: Solar activity reconstructed for 3 millennia (Usoskin+, 2014)
Usoskin, I. G.; Hulot, G.; Gallet, Y.; Roth, R.; Licht, A.; Joos, F.; Kovaltsov, G. A.; Thebault, E.; Khokhlov, A.
2014-02-01
Indices of solar activity reconstructed from 14C using the m used in the paper. Two indices are provided - the sunspot number and the cosmic ray modulation potential, both with the 95% confidence intervals. The data sets are provided with decadal resolution, thus the individual solar cycles are not resolved. (2 data files).
DEFF Research Database (Denmark)
Peucheret, Christophe; Lorenzen, Michael Rodas; Seoane, Jorge
2008-01-01
Input power dynamic range enhancement and amplitude regeneration of highly distorted signals are demonstrated experimentally for 40 Gbit/s RZ-DPSK in a single-pump fibre parametric amplifier with 22 dB smallsignal gain.......Input power dynamic range enhancement and amplitude regeneration of highly distorted signals are demonstrated experimentally for 40 Gbit/s RZ-DPSK in a single-pump fibre parametric amplifier with 22 dB smallsignal gain....
Specifications for a two-dimensional multi-group scattering code: ALCI
International Nuclear Information System (INIS)
Bayard, J.P.; Guillou, A.; Lago, B.; Bureau du Colombier, M.J.; Guillou, G.; Vasseur, Ch.
1965-02-01
This report describes the specifications of the ALCI programme. This programme resolves the system of difference equations similar to the homogeneous problem of multigroup neutron scattering, with two dimensions in space, in the three geometries XY, RZ, RΘ. It is possible with this method to calculate geometric and composition criticalities and also to calculate the accessory problem on demand. The maximum number of points dealt with is 6000. The maximum permissible number of groups is 12. The internal iterations are treated by the method of alternating directions. The external iterations are accelerated using the extrapolation method due to Tchebychev. (authors) [fr
North–South Asymmetry in Rieger-type Periodicity during Solar Cycles 19–23
International Nuclear Information System (INIS)
Gurgenashvili, Eka; Zaqarashvili, Teimuraz V.; Kukhianidze, Vasil; Oliver, Ramon; Ballester, Jose Luis; Dikpati, Mausumi; McIntosh, Scott W.
2017-01-01
Rieger-type periodicity has been detected in different activity indices over many solar cycles. It was recently shown that the periodicity correlates with solar activity having a shorter period during stronger cycles. Solar activity level is generally asymmetric between northern and southern hemispheres, which could suggest the presence of a similar behavior in the Rieger-type periodicity. We analyze the sunspot area/number and the total magnetic flux data for northern and southern hemispheres during solar cycles 19–23, which had remarkable north–south asymmetry. Using wavelet analysis of sunspot area and number during the north-dominated cycles (19–20), we obtained the periodicity of 160–165 days in the stronger northern hemisphere and 180–190 days in the weaker southern hemisphere. On the other hand, south-dominated cycles (21–23) display the periodicity of 155–160 days in the stronger southern hemisphere and 175–188 days in the weaker northern hemisphere. Therefore, the Rieger-type periodicity has the north–south asymmetry in sunspot area/number data during solar cycles with strong hemispheric asymmetry. We suggest that the periodicity is caused by magnetic Rossby waves in the internal dynamo layer. Using the dispersion relation of magnetic Rossby waves and observed Rieger periodicity, we estimated the magnetic field strength in the layer as 45–49 kG in more active hemispheres (north during cycles 19–20 and south during cycles 21–23) and 33–40 kG in weaker hemispheres. The estimated difference in the hemispheric field strength is around 10 kG, which provides a challenge for dynamo models. Total magnetic flux data during cycles 20–23 reveals no clear north–south asymmetry, which needs to be explained in the future.
LONG-TERM TRENDS IN THE SOLAR WIND PROTON MEASUREMENTS
Energy Technology Data Exchange (ETDEWEB)
Elliott, Heather A.; McComas, David J. [Southwest Research Institute, San Antonio, TX (United States); DeForest, Craig E. [Southwest Research Institute, Boulder, CO (United States)
2016-11-20
We examine the long-term time evolution (1965–2015) of the relationships between solar wind proton temperature ( T {sub p}) and speed ( V {sub p}) and between the proton density ( n {sub p}) and speed using OMNI solar wind observations taken near Earth. We find a long-term decrease in the proton temperature–speed ( T {sub p}– V {sub p}) slope that lasted from 1972 to 2010, but has been trending upward since 2010. Since the solar wind proton density–speed ( n {sub p}– V {sub p}) relationship is not linear like the T {sub p}– V {sub p} relationship, we perform power-law fits for n {sub p}– V {sub p}. The exponent (steepness in the n {sub p}– V {sub p} relationship) is correlated with the solar cycle. This exponent has a stronger correlation with current sheet tilt angle than with sunspot number because the sunspot number maxima vary considerably from cycle to cycle and the tilt angle maxima do not. To understand this finding, we examined the average n {sub p} for different speed ranges, and found that for the slow wind n {sub p} is highly correlated with the sunspot number, with a lag of approximately four years. The fast wind n {sub p} variation was less, but in phase with the cycle. This phase difference may contribute to the n {sub p}– V {sub p} exponent correlation with the solar cycle. These long-term trends are important since empirical formulas based on fits to T {sub p} and V {sub p} data are commonly used to identify interplanetary coronal mass ejections, but these formulas do not include any time dependence. Changes in the solar wind density over a solar cycle will create corresponding changes in the near-Earth space environment and the overall extent of the heliosphere.
North–South Asymmetry in Rieger-type Periodicity during Solar Cycles 19–23
Energy Technology Data Exchange (ETDEWEB)
Gurgenashvili, Eka; Zaqarashvili, Teimuraz V.; Kukhianidze, Vasil [Abastumani Astrophysical Observatory at Ilia State University, Tbilisi, Georgia (United States); Oliver, Ramon; Ballester, Jose Luis [Departament de Física, Universitat de les Illes Balears, E-07122, Palma de Mallorca (Spain); Dikpati, Mausumi; McIntosh, Scott W., E-mail: Eka.gurgenashvili.1@iliauni.edu.ge [High Altitude Observatory, National Center for Atmospheric Research, P.O. Box 3000, Boulder, CO 80307 (United States)
2017-08-20
Rieger-type periodicity has been detected in different activity indices over many solar cycles. It was recently shown that the periodicity correlates with solar activity having a shorter period during stronger cycles. Solar activity level is generally asymmetric between northern and southern hemispheres, which could suggest the presence of a similar behavior in the Rieger-type periodicity. We analyze the sunspot area/number and the total magnetic flux data for northern and southern hemispheres during solar cycles 19–23, which had remarkable north–south asymmetry. Using wavelet analysis of sunspot area and number during the north-dominated cycles (19–20), we obtained the periodicity of 160–165 days in the stronger northern hemisphere and 180–190 days in the weaker southern hemisphere. On the other hand, south-dominated cycles (21–23) display the periodicity of 155–160 days in the stronger southern hemisphere and 175–188 days in the weaker northern hemisphere. Therefore, the Rieger-type periodicity has the north–south asymmetry in sunspot area/number data during solar cycles with strong hemispheric asymmetry. We suggest that the periodicity is caused by magnetic Rossby waves in the internal dynamo layer. Using the dispersion relation of magnetic Rossby waves and observed Rieger periodicity, we estimated the magnetic field strength in the layer as 45–49 kG in more active hemispheres (north during cycles 19–20 and south during cycles 21–23) and 33–40 kG in weaker hemispheres. The estimated difference in the hemispheric field strength is around 10 kG, which provides a challenge for dynamo models. Total magnetic flux data during cycles 20–23 reveals no clear north–south asymmetry, which needs to be explained in the future.
Changed Relation between Solar 10.7-cm Radio Flux and some ...
Indian Academy of Sciences (India)
The time series of monthly average values of sunspot numbers SSN, 10.7 cm flux ... This radio emission comes from the higher part of the chromosphere and .... work elements on the solar surface on one hand and spots on the other hand ... size, their magnetic fields were less composite and characterized by the greater life-.
Changes in meteorological parameters in Nigeria by different ...
African Journals Online (AJOL)
The annual mean solar indices of MgII core to core wing ratio, solar flux 10.7 cm and sunspot number over an eleven (11) year period, 2000 – 2010, were correlated with the annual mean rainfall, maximum temperature, relati-ve humidity, cloud cover and wind speed of 8 meteorological stations in Nigeria. Correlation ...
Solar Open Flux Migration from Pole to Pole: Magnetic Field Reversal.
Huang, G-H; Lin, C-H; Lee, L C
2017-08-25
Coronal holes are solar regions with low soft X-ray or low extreme ultraviolet intensities. The magnetic fields from coronal holes extend far away from the Sun, and thus they are identified as regions with open magnetic field lines. Coronal holes are concentrated in the polar regions during the sunspot minimum phase, and spread to lower latitude during the rising phase of solar activity. In this work, we identify coronal holes with outward and inward open magnetic fluxes being in the opposite poles during solar quiet period. We find that during the sunspot rising phase, the outward and inward open fluxes perform pole-to-pole trans-equatorial migrations in opposite directions. The migration of the open fluxes consists of three parts: open flux areas migrating across the equator, new open flux areas generated in the low latitude and migrating poleward, and new open flux areas locally generated in the polar region. All three components contribute to the reversal of magnetic polarity. The percentage of contribution from each component is different for different solar cycle. Our results also show that the sunspot number is positively correlated with the lower-latitude open magnetic flux area, but negatively correlated with the total open flux area.
THE MEAN-FIELD SOLAR DYNAMO WITH A DOUBLE CELL MERIDIONAL CIRCULATION PATTERN
Energy Technology Data Exchange (ETDEWEB)
Pipin, V. V. [Institute of Solar-Terrestrial Physics, Russian Academy of Sciences, Irkutsk, 664033 (Russian Federation); Kosovichev, A. G. [Hansen Experimental Physics Laboratory, Stanford University, Stanford, CA 94305 (United States)
2013-10-10
Recent helioseismology findings, as well as advances in direct numerical simulations of global dynamics of the Sun, have indicated that in each solar hemisphere meridional circulation may form more than one cell along the radius in the convection zone. In particular, recent helioseismology results revealed a double-cell structure of the meridional circulation. We investigate properties of a mean-field solar dynamo with such double-cell meridional circulation. The dynamo model also includes the realistic profile of solar differential rotation (including the tachocline and subsurface shear layer) and takes into account effects of turbulent pumping, anisotropic turbulent diffusivity, and conservation of magnetic helicity. Contrary to previous flux-transport dynamo models, we find that the dynamo model can robustly reproduce the basic properties of the solar magnetic cycles for a wide range of model parameters and circulation speeds. The best agreement with observations is achieved when the surface meridional circulation speed is about 12 m s{sup –1}. For this circulation speed, the simulated sunspot activity shows good synchronization with the polar magnetic fields. Such synchronization was indeed observed during previous sunspot Cycles 21 and 22. We compare theoretical and observed phase diagrams of the sunspot number and the polar field strength and discuss the peculiar properties of Cycle 23.
STUDY OF THE POYNTING FLUX IN ACTIVE REGION 10930 USING DATA-DRIVEN MAGNETOHYDRODYNAMIC SIMULATION
International Nuclear Information System (INIS)
Fan, Y. L.; Wang, H. N.; He, H.; Zhu, X. S.
2011-01-01
Powerful solar flares are closely related to the evolution of magnetic field configuration on the photosphere. We choose the Poynting flux as a parameter in the study of magnetic field changes. We use time-dependent multidimensional MHD simulations around a flare occurrence to generate the results, with the temporal variation of the bottom boundary conditions being deduced from the projected normal characteristic method. By this method, the photospheric magnetogram could be incorporated self-consistently as the bottom condition of data-driven simulations. The model is first applied to a simulation datum produced by an emerging magnetic flux rope as a test case. Then, the model is used to study NOAA AR 10930, which has an X3.4 flare, the data of which has been obtained by the Hinode/Solar Optical Telescope on 2006 December 13. We compute the magnitude of Poynting flux (S total ), radial Poynting flux (S z ), a proxy for ideal radial Poynting flux (S proxy ), Poynting flux due to plasma surface motion (S sur ), and Poynting flux due to plasma emergence (S emg ) and analyze their extensive properties in four selected areas: the whole sunspot, the positive sunspot, the negative sunspot, and the strong-field polarity inversion line (SPIL) area. It is found that (1) the S total , S z , and S proxy parameters show similar behaviors in the whole sunspot area and in the negative sunspot area. The evolutions of these three parameters in the positive area and the SPIL area are more volatile because of the effect of sunspot rotation and flux emergence. (2) The evolution of S sur is largely influenced by the process of sunspot rotation, especially in the positive sunspot. The evolution of S emg is greatly affected by flux emergence, especially in the SPIL area.
International Nuclear Information System (INIS)
Petris, Adrian I.; Vlad, Valentin I.
2010-03-01
We present a theoretical analysis of open aperture reflection Z-scan in nonlinear media with third-, fifth-, and higher-order nonlinearities. A general analytical expression for the normalized reflectance when third-, fifth- and higher-order optical nonlinearities are excited is derived and its consequences on RZ-scan in media with high-order nonlinearities are discussed. We show that by performing RZ-scan experiments at different incident intensities it is possible to put in evidence the excitation of different order nonlinearities in the medium. Their contributions to the overall nonlinear response can be discriminated by using formulas derived by us. A RZ-scan numerical simulation using these formulas and data taken from literature, measured by another method for the third-, fifth-, and seventh-order nonlinear refractive indices of As 2 S 3 chalcogenide glass, is performed. (author)
DEFF Research Database (Denmark)
Hu, Hao; Laguardia Areal, Janaina; Mulvad, Hans Christian Hansen
2011-01-01
An asynchronous 10G Ethernet packet is synchronized and retimed to a master clock using a time lens. The NRZ packet is converted into an RZ packet and multiplexed with a serial 1.28 Tb/s signal.......An asynchronous 10G Ethernet packet is synchronized and retimed to a master clock using a time lens. The NRZ packet is converted into an RZ packet and multiplexed with a serial 1.28 Tb/s signal....
The evolution of a horizontal scale for oscillatory magnetoconvection
Energy Technology Data Exchange (ETDEWEB)
Murphy, J O [Monash Univ., Clayton (Australia). Dept. of Mathematics; Lopez, J M [Aeronautical Research Labs., Port Melbourne (Australia). Aerodynamics Div.
1989-01-01
Oscillatory convective motions have been observed in the umbrae of sunspots and, in the past, the linear theory of overstability has been used for sunspot models. Here a non-linear model for oscillatory convection has been used to investigate the possibility of a preferred horizontal cell size for these motions, in the presence of a magnetic field. The integration forward in time, from the conductive state, of the non-linear multimode equations governing magnetoconvection when the magnetic Prandtl number is less than one portrays a complex interaction between the evolving magnetic and vertical velocity horizontal scales. Preferred horizontal scales for the convective cells have been established by identifying the modes that substantially contribute to the overall convective heat transport. All other modes, although initially perturbed, in time essentially decay to zero through self interaction. 8 refs., 5 figs.
Cameron, R. H.; Dikpati, M.; Brandenburg, A.
2017-09-01
A brief summary of the various observations and constraints that underlie solar dynamo research are presented. The arguments that indicate that the solar dynamo is an alpha-omega dynamo of the Babcock-Leighton type are then shortly reviewed. The main open questions that remain are concerned with the subsurface dynamics, including why sunspots emerge at preferred latitudes as seen in the familiar butterfly wings, why the cycle is about 11 years long, and why the sunspot groups emerge tilted with respect to the equator (Joy's law). Next, we turn to magnetic helicity, whose conservation property has been identified with the decline of large-scale magnetic fields found in direct numerical simulations at large magnetic Reynolds numbers. However, magnetic helicity fluxes through the solar surface can alleviate this problem and connect theory with observations, as will be discussed.
Propagating Disturbances in Coronal Loops: A Detailed Analysis of Propagation Speeds
Kiddie, G.; De Moortel, I.; Del Zanna, G.; McIntosh, S. W.; Whittaker, I.
2012-08-01
Quasi-periodic disturbances have been observed in the outer solar atmosphere for many years. Although first interpreted as upflows (Schrijver et al., Solar Phys. 187, 261, 1999), they have been widely regarded as slow magneto-acoustic waves, due to their observed velocities and periods. However, recent observations have questioned this interpretation, as periodic disturbances in Doppler velocity, line width, and profile asymmetry were found to be in phase with the intensity oscillations (De Pontieu and McIntosh, Astrophys. J. 722, 1013, 2010; Tian, McIntosh, and De Pontieu, Astrophys. J. Lett. 727, L37, 2011), suggesting that the disturbances could be quasi-periodic upflows. Here we conduct a detailed analysis of the velocities of these disturbances across several wavelengths using the Atmospheric Imaging Assembly (AIA) onboard the Solar Dynamics Observatory (SDO). We analysed 41 examples, including both sunspot and non-sunspot regions of the Sun. We found that the velocities of propagating disturbances (PDs) located at sunspots are more likely to be temperature dependent, whereas the velocities of PDs at non-sunspot locations do not show a clear temperature dependence. This suggests an interpretation in terms of slow magneto-acoustic waves in sunspots but the nature of PDs in non-sunspot (plage) regions remains unclear. We also considered on what scale the underlying driver is affecting the properties of the PDs. Finally, we found that removing the contribution due to the cooler ions in the 193 Å wavelength suggests that a substantial part of the 193 Å emission of sunspot PDs can be attributed to the cool component of 193 Å.
Suppressor Analysis of the Fusogenic Lambda Spanins.
Cahill, Jesse; Rajaure, Manoj; Holt, Ashley; Moreland, Russell; O'Leary, Chandler; Kulkarni, Aneesha; Sloan, Jordan; Young, Ry
2017-07-15
The final step of lysis in phage λ infections of Escherichia coli is mediated by the spanins Rz and Rz1. These proteins form a complex that bridges the cell envelope and that has been proposed to cause fusion of the inner and outer membranes. Accordingly, mutations that block spanin function are found within coiled-coil domains and the proline-rich region, motifs essential in other fusion systems. To gain insight into spanin function, pseudorevertant alleles that restored plaque formation for lysis-defective mutants of Rz and Rz1 were selected. Most second-site suppressors clustered within a coiled-coil domain of Rz near the outer leaflet of the cytoplasmic membrane and were not allele specific. Suppressors largely encoded polar insertions within the hydrophobic core of the coiled-coil interface. Such suppressor changes resulted in decreased proteolytic stability of the Rz double mutants in vivo Unlike the wild type, in which lysis occurs while the cells retain a rod shape, revertant alleles with second-site suppressor mutations supported lysis events that were preceded by spherical cell formation. This suggests that destabilization of the membrane-proximal coiled coil restores function for defective spanin alleles by increasing the conformational freedom of the complex at the cost of its normal, all-or-nothing functionality. IMPORTANCE Caudovirales encode cell envelope-spanning proteins called spanins, which are thought to fuse the inner and outer membranes during phage lysis. Recent genetic analysis identified the functional domains of the lambda spanins, which are similar to class I viral fusion proteins. While the pre- and postfusion structures of model fusion systems have been well characterized, the intermediate structure(s) formed during the fusion reaction remains elusive. Genetic analysis would be expected to identify functional connections between intermediates. Since most membrane fusion systems are not genetically tractable, only few such
VizieR Online Data Catalog: Butterfly diagram wings (Leussu+, 2017)
Leussu, R.; Usoskin, I. G.; Senthamizh Pavai, V.; Diercke, A.; Arlt, R.; Mursula, K.
2016-11-01
fig1data.dat contains the separated wings in a butterfly diagram for sunspot groups from three different origins: Sunspot observations by S.H. Schwabe and G. Spoerer, and the RGO/SOON compilation. The latitudes for sunspot groups from the Schwabe and Spoerer data are given as size-weighted averages from sunspots belonging to each group. Latitudes for the RGO compilation are given as they are stated in the original data. The columns report the year, month, day, date [yr], latitude [deg], cycle, hemisphere, and data set tag. Northern hemisphere wings are tagged with "1" and southern hemisphere wings with "2". The data set tag is "1" for Schwabe data, "2" for Spoerer data and "3" for RGO data. (1 data file).
APLIKASI SOFT COMPUTING PADA PREDIKSI CURAH HUJAN DI KALIMANTAN
Directory of Open Access Journals (Sweden)
Deni Septiadi
2008-11-01
Full Text Available Analisis clustering curah hujan di Kalimantan menggunakan Jaringan Kompetitif Kohonen menghasilkan 5 kelompok wilayah yang disebut Zona Prediksi. Sementara itu spektrum data memperlihatkan sinyal sunspot hadir dalam deret waktu data curah hujan di semua Zona Prediksi dengan magnitude terbesar pada Zona Prediksi 2 yang mengindikasikan bahwa zona tersebut memberikan respon langsung pada fenomena sunspot. Peranan aktivitas matahari pada pembentukan awan tinggi dipercayai berkaitan dengan variabilitas fluks sinar kosmik yang bervariasi terhadap lintang. Prediksi curah hujan bulanan dengan Metode ANFIS maupun Jaringan Neural dilakukan dengan menggunakan 1 Prediktor (curah hujan dan 2 Prediktor (kombinasi antara sinar kosmik dan sunspot dengan panjang data bervariasi yaitu 45 tahun, 30 tahun, dan 15 tahun serta panjang data 46 tahun untuk prediksi tahunan (2007–2020. Secara keseluruhan keluaran Metode ANFIS 1 Prediktor menunjukkan nilai rata-rata RMSE (Root Mean Square Error yang lebih kecil untuk prediksi bulanan. Namun pada prediksi tahunan, Metode ANFIS 2 Prediktor menunjukkan hasil yang lebih baik. Dengan demikian fenomena sunspot dan sinar kosmik sebagai prediktor perlu dipertimbangkan dalam melakukan prediksi jangka panjang karena memberikan akurasi yang lebih baik dibandingkan jika hanya menggunakan curah hujan sebagai prediktor. Clustering analysis of rainfall using competitive neural Kohonen yields 5 groups area called prediction zone. Meanwhile, data spectrum shows that sunspot signal exist in time series of rainfall to all of prediction zone with the biggest magnitude at prediction zone 2 and indicates that zone gives direct response to the sunspot phenomena. Role of sunspot activity to the cloud formation believed relationships to the cosmic rays flux that various at latitude. Monthly rainfall prediction with ANFIS Method and Neural Network done with 1 Predictor (rainfall and 2 Predictors (combine between cosmic rays and sunspot
International Nuclear Information System (INIS)
Ganapathy, R.; Malomed, Boris A.; Porsezian, K.
2006-01-01
Instability of continuous-wave (CW) states is investigated in a system of two parallel-coupled fibers, with a pumped (active) nonlinear dispersive core and a lossy (passive) linear one. Modulational instability (MI) conditions are found from linearized equations for small perturbations, the results being drastically different for the normal and anomalous group-velocity dispersion (GVD) in the active core. Simulations of the full system demonstrate that the development of the MI in the former regime leads to establishment of a regular or chaotic array of pulses, if the MI saturates, or a chain of well-separated peaks with continuously growing amplitudes if the instability does not saturate. In the anomalous-GVD regime, a chain of return-to-zero (RZ) peaks, or a single RZ peak emerge, also with growing amplitudes. The latter can be used as a source of RZ pulses for optical telecommunications
THE FORMATION AND MAGNETIC STRUCTURES OF ACTIVE-REGION FILAMENTS OBSERVED BY NVST, SDO, AND HINODE
Energy Technology Data Exchange (ETDEWEB)
Yan, X. L.; Xue, Z. K.; Wang, J. C.; Xiang, Y. Y.; Kong, D. F.; Yang, L. H. [Yunnan Observatories, Chinese Academy of Sciences, Kunming 650216 (China); Pan, G. M. [College of Mathematics Physics and Information Engineering, Jiaxing University, Jiaxing 314001 (China)
2015-08-15
To better understand the properties of solar active-region filaments, we present a detailed study on the formation and magnetic structures of two active-region filaments in active region NOAA 11884 during a period of four days. It is found that the shearing motion of the opposite magnetic polarities and the rotation of the small sunspots with negative polarity play an important role in the formation of two active-region filaments. During the formation of these two active-region filaments, one foot of the filaments was rooted in a small sunspot with negative polarity. The small sunspot rotated not only around another small sunspot with negative polarity, but also around the center of its umbra. By analyzing the nonlinear force-free field extrapolation using the vector magnetic fields in the photosphere, twisted structures were found in the two active-region filaments prior to their eruptions. These results imply that the magnetic fields were dragged by the shearing motion between opposite magnetic polarities and became more horizontal. The sunspot rotation twisted the horizontal magnetic fields and finally formed the twisted active-region filaments.
Zepf, Stephen E.; Stern, Daniel; Maccarone, Thomas J.; Kundu, Arunav; Kamionkowski, Marc; Rhode, Katherine L.; Salzer, John J.; Ciardullo, Robin; Gronwall, Caryl
2008-08-01
We present Keck LRIS spectroscopy of the black hole-hosting globular cluster RZ 2109 in the Virgo elliptical galaxy NGC 4472. We find that this object has extraordinarily broad [O III] λ5007 and [O III] λ4959 emission lines, with velocity widths of approximately 2000 km s-1. This result has significant implications for the nature of this accreting black hole system and the mass of the globular cluster black hole. We show that the broad [O III] λ5007 emission must arise from material driven at high velocity from the black hole system. This is because the volume available near the black hole is too small by many orders of magnitude to have enough [O III]-emitting atoms to account for the observed L([O III] λ5007) at high velocities, even if this volume is filled with oxygen at the critical density for [O III] λ5007. The Balmer emission is also weak, indicating the observed [O III] is not due to shocks. We therefore conclude that the [O III] λλ4959, 5007 is produced by photoionization of material driven across the cluster. The only known way to drive significant material at high velocity is for a system accreting mass near or above its Eddington limit, which indicates a stellar-mass black hole. Since it is dynamically implausible to form an accreting stellar-mass black hole system in a globular cluster with an intermediate-mass black hole (IMBH), it appears this massive globular cluster does not have an IMBH. We discuss further tests of this conclusion, and its implications for the MBH - Mstellar and MBH - σ relations. Based on observations made at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W. M. Keck Foundation.
Directory of Open Access Journals (Sweden)
Mokhatar Shahrul Niza
2017-01-01
Full Text Available This paper reveals a study performed on reinforced concrete with artificial aggregate concrete block infill composite beams to innovate a lightweight reinforced concrete utilizing polyethylene (PE waste materials, such as waste plastic bags. Six beam specimens of normal reinforced concrete (NRC and different block infill replacement zone positions RCAI (RZ1 beams containing 100% MAPEA with 50, 95, and 1,000 mm width, height, and length, respectively, were provided for the block infill, whereas RCAI (RZ2 with different block infill positions containing a 100% MAPEA with 50, 115, and 1000 mm width, height, and length were provided and tested under low impact load. The steel impactor with blunt nose dropped at 0.6 m height which equivalent to 3.5 m/s. The behaviors of the beams were studied relative to the impact force-time and displacement-time histories, the flexural/ bending cracks, and the impact failure. Results show that the overall failure modes of all the beam specimens were successfully recorded. In addition, the residual displacements of the RZ2 was almost same than those of the RZ1 and the significantly lower than those of the NRC. In the reinforced concrete beams, less stressed concrete near the neutral axis can be replaced by certain light weight material like waste plastic bags as modified artificial polyethylene aggregates to serve as an artificial aggregate.
The solar forcing on the ground 7 Be concentration variability
International Nuclear Information System (INIS)
Talpos, S.; Borsan, D.H.
2002-01-01
7 Be, natural radionuclide, is produced by the interaction of cosmic radiation with oxygen and nitrogen molecules. 7 Be production in atmosphere depends on the intensity of cosmic radiation which is influenced by the Earth's magnetosphere. The magnetosphere shape depends on solar activity. This paper presents the influence of sunspots number (11 years period) on the ground 7 Be concentration variability. (authors)
All-Optical 9.35 Gb/s Wavelength Conversion in an InP Photonic Crystal Nanocavity
DEFF Research Database (Denmark)
Vukovic, Dragana; Yu, Yi; Heuck, Mikkel
2013-01-01
Wavelength conversion of a 9.35 Gb/s RZ signal is demonstrated using an InP photonic crystal H0 nanocavity. A clear eye is observed for the converted signal showing a pre-FEC bit error ratio down to 10-3.......Wavelength conversion of a 9.35 Gb/s RZ signal is demonstrated using an InP photonic crystal H0 nanocavity. A clear eye is observed for the converted signal showing a pre-FEC bit error ratio down to 10-3....
ON THE WEAKENING OF THE POLAR MAGNETIC FIELDS DURING SOLAR CYCLE 23
International Nuclear Information System (INIS)
Wang, Y.-M.; Sheeley, N. R.; Robbrecht, E.
2009-01-01
The Sun's polar fields are currently ∼40% weaker than they were during the previous three sunspot minima. This weakening has been accompanied by a corresponding decrease in the interplanetary magnetic field (IMF) strength, by a ∼20% shrinkage in the polar coronal-hole areas, and by a reduction in the solar-wind mass flux over the poles. It has also been reflected in coronal streamer structure and the heliospheric current sheet, which only showed the expected flattening into the equatorial plane after sunspot numbers fell to unusually low values in mid-2008. From latitude-time plots of the photospheric field, it has long been apparent that the polar fields are formed through the transport of trailing-polarity flux from the sunspot latitudes to the poles. To address the question of why the polar fields are now so weak, we simulate the evolution of the photospheric field and radial IMF strength from 1965 to the present, employing a surface transport model that includes the effects of active region emergence, differential rotation, supergranular convection, and a poleward bulk flow. We find that the observed evolution can be reproduced if the amplitude of the surface meridional flow is varied by as little as 15% (between 14.5 and 17 m s -1 ), with the higher average speeds being required during the long cycles 20 and 23.
Secular variation of cosmic ray intensity recorded in the radiocarbon concentration of tree rings
International Nuclear Information System (INIS)
Kigoshi, K.
1978-01-01
Study of the secular variations of cosmic ray intensity on the basis of the secular variations of atmospheric radiocarbon concentration in 8000 years is considered. The data on the radiocarbon concentration is received by three laboratories using the dendrochronologically dated tree ring samples. In order to use the data the variations due to geochemical process must be eliminated. From this point of view the climatic effect on the atmospheric radiocarbon concenttration is estimated using the data on sunspot number and global surface temperature during 1650-1800 y. The barge influence of climate on the atmospheric radiocarbon concentration syggests the small contribution of change of radiocarbon production rate to the short-period fluctuations in the atmospheric radiocarbon concentration. Elimination of variations caused by climate and sunspot activities from the variations in atmospheric radiocarbon concentration gives a long-term scale of its concentration which agrees well to the observed paleo-geomagnetic data
Osaliya, R.; Kansiime, F.; Oryem-Origa, H.; Kateyo, E.
During the operation of the Kilembe Mines (copper mining) a cobaltiferous stockpile was constructed, which began to erode after the closure of the mines in the early 1970s. The erosion of the pyrite stockpile resulted in a large acid trail all the way to Lake George (a Ramsar site). The acid trail contaminated a large area of Queen Elizabeth National Park (QENP) resulting in the death of most of the shallow-rooted vegetation. Processes and conditions created by storm water and effluent from a constructed wetland were assessed for vegetation regeneration in the degraded QENP pyrite trail. Cynodon dactylon, Imperata cylindrica and Hyparrhenia filipendula dominated the regeneration zone (RZ) where storm water and effluent from a constructed wetland was flowing; and the adjacent unpolluted area (UP) with importance value indices of 186.4 and 83.3 respectively. Typha latifolia and C. dactylon formed two distinct vegetation sub-zones within the RZ with the former inhabiting areas with a higher water table. Soil pH was significantly higher in the RZ, followed by UP and bare pyrite trail (BPT) at both 0-15 cm and 16-30 cm depths. Soil electrical conductivity was not significantly different in the RZ and BPT but significantly higher than that in UP for both depths. For 0-15 cm depth, RZ had significantly higher concentrations of copper than BPT and UP which had similar concentrations. Still at this depth (0-15 cm), the unpolluted area had significantly higher concentrations of total phosphorus and total nitrogen than the regeneration zone and the bare pyrite trail which had similar concentrations. The RZ dominated by Typha had significantly higher concentrations of TP and TN compared to the RZ dominated by Cynodon. The concentrations of NH 4-N were significantly lower in Typha regeneration zone than in CRZ at 0-15 cm depth but similar at 16-30 cm depth. At 16-30 cm depth, concentrations of copper were significantly higher in the regeneration zone followed by the bare pyrite
A 80 km reach fully passive WDM-PON based on reflective ONUs
DEFF Research Database (Denmark)
Presi, Marco; Proietti, Roberto; Prince, Kamau
2008-01-01
We propose a novel line coding combination (Inverse RZ coding in downlink and RZ in uplink) that extends the reach of WDM Passive Optical Networks based on Reflective SOAs with no in-line amplification. We achieved full downstream remodulation even when feeding the reflective SOA with power level...... as low as -35dBm, thus increasing the system power budget. We experimentally assessed this scheme for a fully passive, full-duplex and symmetrical 1.25Gb/s WDM-PON over a 80km G.652 feeder....
Capital-labor substitution and competitive non-linear endogenous business cycles
Grandmont, J.M.; Pintus, P.; de Vilder, R.
1998-01-01
We develop simple geometrical methods to study local indeterminacy, bifurcations, and stochastic (sunspot) equilibria near a steady state, in nonlinear two dimensional economic models. We present in particular a simple, constructive, geometrical characterization of the support of stochastic sunspot
Wire array Z-pinch insights for enhanced x-ray production
Sanford, T. W. L.; Mock, R. C.; Spielman, R. B.; Haines, M. G.; Chittenden, J. P.; Whitney, K. G.; Apruzese, J. P.; Peterson, D. L.; Greenly, J. B.; Sinars, D. B.; Reisman, D. B.; Mosher, D.
1999-05-01
Comparisons of measured total radiated x-ray power from annular wire-array z-pinches with a variety of models as a function of wire number, array mass, and load radius are reviewed. The data, which are comprehensive, have provided important insights into the features of wire-array dynamics that are critical for high x-ray power generation. Collectively, the comparisons of the data with the model calculations suggest that a number of underlying dynamical mechanisms involving cylindrical asymmetries and plasma instabilities contribute to the measured characteristics. For example, under the general assumption that the measured risetime of the total-radiated-power pulse is related to the thickness of the plasma shell formed on axis, the Heuristic Model [IEEE Trans. Plasma Sci. 26, 1275 (1998)] agrees with the measured risetime under a number of specific assumptions about the way the breakdown of the wires, the wire-plasma expansion, and the Rayleigh-Taylor instability in the r-z plane, develop. Likewise, in the high wire-number regime (where the wires are calculated to form a plasma shell prior to significant radial motion of the shell) the comparisons show that the variation in the power of the radiation generated as a function of load mass and array radius can be simulated by the two-dimensional Eulerian-radiation- magnetohydrodynamics code (E-RMHC) [Phys. Plasmas 3, 368 (1996)], using a single random-density perturbation that seeds the Rayleigh-Taylor instability in the r-z plane. For a given pulse-power generator, the comparisons suggest that (1) the smallest interwire gaps compatible with practical load construction and (2) the minimum implosion time consistent with the optimum required energy coupling of the generator to the load should produce the highest total-radiated-power levels.
Wire Array Z-Pinch Insights for Enhanced X-Ray Production
Energy Technology Data Exchange (ETDEWEB)
Apruzese, J.P.; Chittenden, J.P.; Greenly, J.B.; Haines, M.G.; Mock, R.C.; Mosher, D.; Peterson, D.L.; Reisman, D.B.; Sanford, T.W.L.; Sinars, D.B.; Spielman, R.B.; Whitnery, K.G.
1999-01-04
Comparisons of measured total radiated x-ray power from annular wire-array z-pinches with a variety of models as a function of wire number, array mass, and load radius are reviewed. The data, which are comprehensive, have provided important insights into the features of wire-array dynamics that are critical for high x-ray power generation. Collectively, the comparisons of the data with the model calculations suggest that a number of underlying dynamical mechanisms involving cylindrical asymmetries and plasma instabilities contribute to the measured characteristics. For example, under the general assumption that the measured risetime of the total-radiated-power pulse is related to the thickness of the plasma shell formed on axis, the Heuristic Model [IEEE Trans. Plasma Sci., 26, 1275 (1998)] agrees with the measured risetime under a number of specific assumptions about the way the breakdown of the wires, the wire-plasma expansion, and the Rayleigh-Taylor instability in the r-z plane, interact. Likewise, in the high wire-number regime (where the wires are calculated to form a plasma shell prior to significant radial motion of the shell) the comparisons show that the variation in the power of the radiation generated as a function of load mass and array radius can be simulated by the 2-D Eulerian-radiation-magnetohydrodynamics code (E-RMHC) [Phys. Plasmas 3, 368 (1996)], using a single random-density perturbation that seeds the Rayleigh-Taylor instability in the r-z plane. For a given pulse-power generator, the comparisons suggest that (1) the smallest interwire gaps compatible with practical load construction and (2) the minimum implosion time consistent with the optimum required energy coupling of the generator to the load should produce the highest total-radiated-power levels.
Wire Array Z-Pinch Insights for Enhanced X-Ray Production
International Nuclear Information System (INIS)
Apruzese, J.P.; Chittenden, J.P.; Greenly, J.B.; Haines, M.G.; Mock, R.C.; Mosher, D.; Peterson, D.L.; Reisman, D.B.; Sanford, T.W.L.; Sinars, D.B.; Spielman, R.B.; Whitnery, K.G.
1999-01-01
Comparisons of measured total radiated x-ray power from annular wire-array z-pinches with a variety of models as a function of wire number, array mass, and load radius are reviewed. The data, which are comprehensive, have provided important insights into the features of wire-array dynamics that are critical for high x-ray power generation. Collectively, the comparisons of the data with the model calculations suggest that a number of underlying dynamical mechanisms involving cylindrical asymmetries and plasma instabilities contribute to the measured characteristics. For example, under the general assumption that the measured risetime of the total-radiated-power pulse is related to the thickness of the plasma shell formed on axis, the Heuristic Model [IEEE Trans. Plasma Sci., 26, 1275 (1998)] agrees with the measured risetime under a number of specific assumptions about the way the breakdown of the wires, the wire-plasma expansion, and the Rayleigh-Taylor instability in the r-z plane, interact. Likewise, in the high wire-number regime (where the wires are calculated to form a plasma shell prior to significant radial motion of the shell) the comparisons show that the variation in the power of the radiation generated as a function of load mass and array radius can be simulated by the 2-D Eulerian-radiation-magnetohydrodynamics code (E-RMHC) [Phys. Plasmas 3, 368 (1996)], using a single random-density perturbation that seeds the Rayleigh-Taylor instability in the r-z plane. For a given pulse-power generator, the comparisons suggest that (1) the smallest interwire gaps compatible with practical load construction and (2) the minimum implosion time consistent with the optimum required energy coupling of the generator to the load should produce the highest total-radiated-power levels
Prediction of solar activity from solar background magnetic field variations in cycles 21-23
International Nuclear Information System (INIS)
Shepherd, Simon J.; Zharkov, Sergei I.; Zharkova, Valentina V.
2014-01-01
A comprehensive spectral analysis of both the solar background magnetic field (SBMF) in cycles 21-23 and the sunspot magnetic field in cycle 23 reported in our recent paper showed the presence of two principal components (PCs) of SBMF having opposite polarity, e.g., originating in the northern and southern hemispheres, respectively. Over a duration of one solar cycle, both waves are found to travel with an increasing phase shift toward the northern hemisphere in odd cycles 21 and 23 and to the southern hemisphere in even cycle 22. These waves were linked to solar dynamo waves assumed to form in different layers of the solar interior. In this paper, for the first time, the PCs of SBMF in cycles 21-23 are analyzed with the symbolic regression technique using Hamiltonian principles, allowing us to uncover the underlying mathematical laws governing these complex waves in the SBMF presented by PCs and to extrapolate these PCs to cycles 24-26. The PCs predicted for cycle 24 very closely fit (with an accuracy better than 98%) the PCs derived from the SBMF observations in this cycle. This approach also predicts a strong reduction of the SBMF in cycles 25 and 26 and, thus, a reduction of the resulting solar activity. This decrease is accompanied by an increasing phase shift between the two predicted PCs (magnetic waves) in cycle 25 leading to their full separation into the opposite hemispheres in cycle 26. The variations of the modulus summary of the two PCs in SBMF reveals a remarkable resemblance to the average number of sunspots in cycles 21-24 and to predictions of reduced sunspot numbers compared to cycle 24: 80% in cycle 25 and 40% in cycle 26.
On proton events of different solar activity cycles
International Nuclear Information System (INIS)
Sattarov, I.; Sherdanov, Ch.; Sattarov, B.
1997-01-01
In solar activity cycle N21 and N22 the latitude distribution of the proton large flares and sunspot groups is being studied. It was found that higher proton activity of cycle N22 is connected with its higher latitude sunspot activity (author)
What's So Peculiar about the Cycle 23/24 Solar Minimum?
Sheeley, N. R., Jr.
2010-06-01
Traditionally, solar physicists become anxious around solar minimum, as they await the high-latitude sunspot groups of the new cycle. Now, we are in an extended sunspot minimum with conditions not seen in recent memory, and interest in the sunspot cycle has increased again. In this paper, I will describe some of the characteristics of the current solar minimum, including its great depth, its extended duration, its weak polar magnetic fields, and its small amount of open flux. Flux transport simulations suggest that these characteristics are a consequence of temporal variations of the Sun's large-scale meridional circulation.
Numerical simulations of annular wire-array z-pinches in (x,y), (r,θ), and (r,z) geometries
International Nuclear Information System (INIS)
Marder, B.M.; Sanford, T.W.L.; Allshouse, G.O.
1997-12-01
The Total Immersion PIC (TIP) code has been used in several two-dimensional geometries to understand better the measured dynamics of annular, aluminum wire-array z-pinches. The areas investigated include the formation of the plasma sheath from current-induced individual wire explosions, the effects of wire number and symmetry on the implosion dynamics, and the dependence of the Rayleigh-Taylor instability growth on initial sheath thickness. A qualitative change in the dynamics with increasing wire number was observed, corresponding to a transition between a z-pinch composed of non-merging, self-pinching individual wires, and one characterized by the rapid formation and subsequent implosion of a continuous plasma sheath. A sharp increase in radiated power with increasing wire number has been observed experimentally near this calculated transition. Although two-dimensional codes have correctly simulated observed power pulse durations, there are indications that three dimensional effects are important in understanding the actual mechanism by which these pulse lengths are produced
Role of the Coronal Alfvén Speed in Modulating the Solar-wind Helium Abundance
Wang, Y.-M.
2016-12-01
The helium abundance He/H in the solar wind is relatively constant at ˜0.04 in high-speed streams, but varies in phase with the sunspot number in slow wind, from ˜0.01 at solar minimum to ˜0.04 at maximum. Suggested mechanisms for helium fractionation have included frictional coupling to protons and resonant interactions with high-frequency Alfvénic fluctuations. We compare He/H measurements during 1995-2015 with coronal parameters derived from source-surface extrapolations of photospheric field maps. We find that the near-Earth helium abundance is an increasing function of the magnetic field strength and Alfvén speed v A in the outer corona, while being only weakly correlated with the proton flux density. Throughout the solar cycle, fast wind is associated with short-term increases in v A near the source surface; resonance with Alfvén waves, with v A and the relative speed of α-particles and protons decreasing with increasing heliocentric distance, may then lead to enhanced He/H at 1 au. The modulation of helium in slow wind reflects the tendency for the associated coronal Alfvén speeds to rise steeply from sunspot minimum, when this wind is concentrated around the source-surface neutral line, to sunspot maximum, when the source-surface field attains its peak strengths. The helium abundance near the source surface may represent a balance between collisional decoupling from protons and Alfvén wave acceleration.
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... The positional measurements of sunspots from the Kodaikanal Observatory and Solar Geophysical data are used to study the association between occurrence of the abnormal activities of big sunspot groups that were observed during the period of October–November 2003 and occurrence of the flares.
Blow-off characteristics of turbulent premixed flames in curved-wall Jet Burner
Mansour, Morkous S.
2015-08-02
This study concerns the flame dynamics of a curved-wall jet (CWJ) stabilized turbulent premixed flame as it approaches blow-off conditions. Time resolved OH planar laser-induced fluorescence (PLIF) delineated reaction zone contours and simultaneously stereoscopic particle image velocimetry (SPIV) quantified the turbulent flow field features. Ethylene/air flames were stabilized in CWJ burner to determine the sequence of events leading to blowoff. For stably burning flames far from blowoff, flames are characterized with a recirculation zone (RZ) upstream for flame stabilization followed by an intense turbulent interaction jet (IJ) and merged-jet regions downstream; the flame front counterparts the shear layer vortices. Near blowoff, as the velocity of reactants increases, high local stretch rates exceed the extinction stretch rates instantaneously resulting in localized flame extinction along the IJ region. As Reynolds number (Re) increases, flames become shorter and are entrained by larger amounts of cold reactants. The increased strain rates together with heat loss effects result in further fragmentation of the flame, eventually leading to the complete quenching of the flame. This is explained in terms of local turbulent Karlovitz stretch factor (K) and principal flow strain rates associated with C contours. Hydrogen addition and increasing the RZ size lessen the tendency of flames to be locally extinguished.
Directory of Open Access Journals (Sweden)
Sten Hagberg
2012-01-01
Full Text Available During the night between 21 and 22 March 2012, a group of young military officers overthrew Mali’s president, Amadou Toumani Touré. The group justified the coup by citing the inability of the regime to both deal with the crisis in the North and provide the army with the appropriate material and manpower to defend the national territory. The coup plunged Mali into violence, and caused a de facto partition of the country. The socio-political turmoil pitting different political and armed factions against each other has continued unabated and has been accompanied by intense mass media debates. In this report we focus on the Malian public debate. By looking at the political class, the international community, and the partition of the country, we analyse representations and stereotypes prevailing in this debate.In der Nacht vom 21. zum 22. März 2012 wurde der Präsident Malis, Amadou Toumani Touré, durch eine Gruppe junger Offiziere gestürzt. Die Gruppe rechtfertigte den Putsch, indem sie auf die Unfähigkeit des Regimes verwies, die Krise im Norden zu bewältigen und die Armee personell und materiell angemessen auszustatten, um die Grenzen das Landes verteidigen zu können. Der Staatsstreich stürzte Mali in eine gewaltsame Auseinandersetzung und führte zu einer faktischen Teilung des Landes. Die sozio-politischen Turbulenzen, in denen verschiedene politische und bewaffnete Gruppierungen gegeneinander antraten, haben seither unvermindert angehalten und wurden von intensiven Debatten in den Massenmedien begleitet. Der vorliegende Bericht konzentriert sich auf die öffentliche Debatte in Mali. Vor dem Hintergrund der politischen Entwicklung des Landes, der Positionen der internationalen Gemeinschaft und der Ursachen für die Teilung des Landes stellen die Autoren die Darstellungsweisen und Stereotypen dar, die in dieser Debatte Verwendung finden.
Sharma, L K; Agarwal, D; Rathore, S S; Malhotra, S K; Saxena, S N
2016-06-01
Effect of cryogenic grinding on recovery of volatile oil, fatty oil percentage and their constituents in two cumin (Cuminum cyminum L.) genotypes have been analyzed. Cryogenic grinding not only retains the volatiles but enhanced the recovery by 33.9 % in GC 4 and 43.5 % in RZ 209. A significant increase (29.9 %) over normal grinding in oil percentage was also observed in genotype RZ 209. This increase was, however, less (15.4 %) in genotype GC 4. Nineteen major compounds were identified in the essential oil of both genotypes. The two grinding techniques had significant effects on dependent variables, viz., volatile oil and monoterpenes. Cuminaldehyde was the main constituent in both genotypes, content of which increased from 48.2 to 56.1 % in GC 4 on cryo grinding. Content of terpines were found to decrease in cryo ground samples of GC 4 and either decrease or no change was found in RZ 209. Organoleptic test showed more pleasant aroma in cryo ground seeds of both the genotypes. Significant increase was also reported in fatty oil yield due to cryogenic grinding. Fatty acid methyl ester (FAME) analysis showed oleic acid as major FAME content of which increased from 88.1 to 94.9 % in RZ 209 and from 88.2 to 90.1 % in GC 4 on cryogenic grinding. Other prominent FAME were palmitic, palmitoleic and stearic acid. Results indicated commercial potential of cryogenic grinding technology for cumin in general and spices in particular for better retention of flavour and quality in spices.
DEFF Research Database (Denmark)
Hu, Hao; Laguardia Areal, Janaina; Palushani, Evarist
2010-01-01
A 10-G Ethernet packet with maximum packet size of 1518 bytes is synchronized to a master clock with 200-kHz frequency offset using a time lens. The input 10-Gb/s non-return-to-zero packet is at the same time converted into a return-to-zero (RZ) packet with a pulsewidth of 10 ps and then time......-division multiplexed with four 10-Gb/s optical time-division-multiplexing (OTDM) channels, thus constituting a 50-Gb/s OTDM serial signal. Error-free performances of the synchronized RZ packet and demultiplexed packet from the aggregated 50-Gb/s OTDM signal are achieved....
Recovery from Maunder-like Grand Minima in a Babcock–Leighton Solar Dynamo Model
Karak, Bidya Binay; Miesch, Mark
2018-06-01
The Sun occasionally goes through Maunder-like extended grand minima when its magnetic activity drops considerably from the normal activity level for several decades. Many possible theories have been proposed to explain the origin of these minima. However, how the Sun managed to recover from such inactive phases every time is even more enigmatic. The Babcock–Leighton type dynamos, which are successful in explaining many features of the solar cycle remarkably well, are not expected to operate during grand minima due to the lack of a sufficient number of sunspots. In this Letter, we explore the question of how the Sun could recover from grand minima through the Babcock–Leighton dynamo. In our three-dimensional dynamo model, grand minima are produced spontaneously as a result of random variations in the tilt angle of emerging active regions. We find that the Babcock–Leighton process can still operate during grand minima with only a minimal number of sunspots, and that the model can emerge from such phases without the need for an additional generation mechanism for the poloidal field. The essential ingredient in our model is a downward magnetic pumping, which inhibits the diffusion of the magnetic flux across the solar surface.
Directory of Open Access Journals (Sweden)
Göker Ü.D.
2017-01-01
Full Text Available A study of variations of solar spectral irradiance (SSI in the wave-length ranges 121.5 nm-300.5 nm for the period 1981-2009 is presented. We used various data for ultraviolet (UV spectral lines and international sunspot number (ISSN from interactive data centers such as SME (NSSDC, UARS (GDAAC, SORCE (LISIRD and SIDC, respectively. We reduced these data by using the MATLsoftware package. In this respect, we revealed negative correlations of intensities of UV (289.5 nm-300.5 nm spectral lines originating in the solar chromosphere with the ISSN index during the unusually prolonged minimum between the solar activity cycles (SACs 23 and 24. We also compared our results with the variations of solar activity indices obtained by the ground-based telescopes. Therefore, we found that plage regions decrease while facular areas are increasing in SAC 23. However, the decrease in plage regions is seen in small sunspot groups (SGs, contrary to this, these regions in large SGs are comparable to previous SACs or even larger as is also seen in facular areas. Nevertheless, negative correlations between ISSN and SSI data indicate that these variations are in close connection with the classes of sunspots/SGs, faculae and plage regions. Finally, we applied the time series analysis of spectral lines corresponding to the wavelengths 121.5 nm-300.5 nm and made comparisons with the ISSN data. We found an unexpected increase in the 298.5 nm line for the Fe II ion. The variability of Fe II ion 298.5 nm line is in close connection with the facular areas and plage regions, and the sizes of these solar surface indices play an important role for the SSI variability, as well. So, we compared the connection between the sizes of faculae and plage regions, sunspots/SGs, chemical elements and SSI variability. Our future work will be the theoretical study of this connection and developing of a corresponding model.
Number Sense on the Number Line
Woods, Dawn Marie; Ketterlin Geller, Leanne; Basaraba, Deni
2018-01-01
A strong foundation in early number concepts is critical for students' future success in mathematics. Research suggests that visual representations, like a number line, support students' development of number sense by helping them create a mental representation of the order and magnitude of numbers. In addition, explicitly sequencing instruction…
Magnetic Properties of Solar Active Regions that Govern Large Solar Flares and Eruptions
Toriumi, Shin; Schrijver, Carolus J.; Harra, Louise; Hudson, Hugh S.; Nagashima, Kaori
2017-08-01
Strong flares and CMEs are often produced from active regions (ARs). In order to better understand the magnetic properties and evolutions of such ARs, we conducted statistical investigations on the SDO/HMI and AIA data of all flare events with GOES levels >M5.0 within 45 deg from the disk center for 6 years from May 2010 (from the beginning to the declining phase of solar cycle 24). Out of the total of 51 flares from 29 ARs, more than 80% have delta-sunspots and about 15% violate Hale’s polarity rule. We obtained several key findings including (1) the flare duration is linearly proportional to the separation of the flare ribbons (i.e., scale of reconnecting magnetic fields) and (2) CME-eruptive events have smaller sunspot areas. Depending on the magnetic properties, flaring ARs can be categorized into several groups, such as spot-spot, in which a highly-sheared polarity inversion line is formed between two large sunspots, and spot-satellite, where a newly-emerging flux next to a mature sunspot triggers a compact flare event. These results point to the possibility that magnetic structures of the ARs determine the characteristics of flares and CMEs. In the presentation, we will also show new results from the systematic flux emergence simulations of delta-sunspot formation and discuss the evolution processes of flaring ARs.
Indexes and parameters of activity in solar-terrestrial physics
International Nuclear Information System (INIS)
Minasyants, G.S.; Minasyants, T.M.
2005-01-01
The daily variation of different indexes and parameters of the solar-terrestrial physics at the 23 cycle were considered to find the most important from them for the forecast of geomagnetic activity. The validity of application of the Wolf numbers in quality of the characteristic of solar activity at sunspots is confirmed. The best geo-effective parameter in the arrival of the interplanetary shock from coronal mass ejection to an orbit of the Earth. (author)
Effects of Faraday Rotation Observed in Filter Magnetograph Data
Hagyard, Mona J.; Adams, Mitzi L.; Smith, J. E.; West, Edward A.
1999-01-01
In this paper we analyze the effects of Faraday rotation on the azimuth of the transverse magnetic field from observations taken with the Marshall Space Flight Center's vector magnetograph for a simple sunspot observed on June 9, 1985. Vector magnetograms were obtained over the wavelength interval of 170 mA redward of line center of the Fe I 5250.22 A spectral line to 170 mA to the blue, in steps of 10 mA. These data were analyzed to produce the variation of the azimuth as a function of wavelength at each pixel over the field of vi ew of the sunspot. At selected locations in the sunspot, curves of the observed variation of azimuth with wavelength were compared with model calculations for the amount of Faraday rotation of the azimuth. From these comparisons we derived the amount of rotation as functions of bo th the magnitude and inclination of the sunspot's field and deduced the ranges of these field values for which Faraday rotation presents a significant problem in observations taken near the center of a spectral line.
Ruždjak, Domagoj; Sudar, Davor; Brajša, Roman; Skokić, Ivica; Poljančić Beljan, Ivana; Jurdana-Šepić, Rajka; Hanslmeier, Arnold; Veronig, Astrid; Pötzi, Werner
2018-04-01
Sunspot position data obtained from Kanzelhöhe Observatory for Solar and Environmental Research (KSO) sunspot drawings and white light images in the period 1964 to 2016 were used to calculate the rotational and meridional velocities of the solar plasma. Velocities were calculated from daily shifts of sunspot groups and an iterative process of calculation of the differential rotation profiles was used to discard outliers. We found a differential rotation profile and meridional motions in agreement with previous studies using sunspots as tracers and conclude that the quality of the KSO data is appropriate for analysis of solar velocity patterns. By analyzing the correlation and covariance of meridional velocities and rotation rate residuals we found that the angular momentum is transported towards the solar equator. The magnitude and latitudinal dependence of the horizontal component of the Reynolds stress tensor calculated is sufficient to maintain the observed solar differential rotation profile. Therefore, our results confirm that the Reynolds stress is the dominant mechanism responsible for transport of angular momentum towards the solar equator.
Wire array z-pinch insights for high X-ray power generation
International Nuclear Information System (INIS)
Sanford, T.W.L.; Marder, B.M.; Desjarlais, M.P.
1998-01-01
The discovery that the use of very large numbers of wires enables high x-ray power to be generated from wire-array z-pinches represents a breakthrough in load design for large pulsed power generators, and has permitted high temperatures to be generated in radiation cavities on Saturn and Z. In this paper, changes in x-ray emission characteristics as a function of wire number, array mass, and load radius, for 20-mm-long aluminum arrays on Saturn that led to these breakthrough hohlraum results, are discussed and compared with a few related emission characteristics of high-wire-number aluminum and tungsten arrays on Z. X-ray measurement comparisons with analytic models and 2-D radiation-magnetohydrodynamic (RMHC) code simulations in the x-y and r-z planes provide confidence in the ability of the models and codes to predict future x-ray performance with very-large-number wire arrays
Wire array z-pinch insights for high X-ray power generation
Energy Technology Data Exchange (ETDEWEB)
Sanford, T.W.L.; Marder, B.M.; Desjarlais, M.P. [and others
1998-12-31
The discovery that the use of very large numbers of wires enables high x-ray power to be generated from wire-array z-pinches represents a breakthrough in load design for large pulsed power generators, and has permitted high temperatures to be generated in radiation cavities on Saturn and Z. In this paper, changes in x-ray emission characteristics as a function of wire number, array mass, and load radius, for 20-mm-long aluminum arrays on Saturn that led to these breakthrough hohlraum results, are discussed and compared with a few related emission characteristics of high-wire-number aluminum and tungsten arrays on Z. X-ray measurement comparisons with analytic models and 2-D radiation-magnetohydrodynamic (RMHC) code simulations in the x-y and r-z planes provide confidence in the ability of the models and codes to predict future x-ray performance with very-large-number wire arrays.
Wire array z-pinch insights for high x-ray power generation
Energy Technology Data Exchange (ETDEWEB)
Sanford, T.W.L.; Mock, R.C.; Marder, B.M. [and others
1997-12-31
The discovery that the use of very large numbers of wires enables high x-ray power to be generated from wire-array z-pinches represents a breakthrough in load design for large pulsed power generators, and has permitted high temperatures to be generated in radiation cavities on Saturn and Z. In this paper, changes in x-ray emission characteristics as a function of wire number, array mass, and load radius, for 20-mm-long aluminum arrays on Saturn that led to these breakthrough hohlraum results, are discussed and compared with a few related emission characteristics of high-wire-number aluminum and tungsten arrays on Z. X-ray measurement comparisons with analytic models and 2-D radiation-magnetohydrodynamic (RMHC) code simulations in the x-y and r-z planes provide confidence in the ability of the models and codes to predict future x-ray performance with very-large-number wire arrays.
Wire array z-pinch insights for high x-ray power generation
Energy Technology Data Exchange (ETDEWEB)
Sanford, T.W.L.; Mock, R.C.; Nash, T.J. [and others
1998-08-01
The discovery that the use of very large numbers of wires enables high x-ray power to be generated from wire-array z-pinches represents a breakthrough in load design for large pulsed power generators, and has permitted high temperatures to be generated in radiation cavities on Saturn. In this paper, changes in x-ray emission characteristics as a function of wire number, array mass, and load radius, for 20-mm-long aluminum arrays on Saturn that led to these breakthrough hohlraum results, are discussed and compared with a few related emission characteristics of high-wire-number aluminum and tungsten arrays on Z. X=ray measurement comparisons with analytic models and 2-D radiation-magnetohydrodynamic (RMHC) code simulations in the x-y and r-z planes provide confidence in the ability of the models and codes to predict future x-ray performance with very-large-number wire arrays.
Wire array z-pinch insights for high x-ray power generation
International Nuclear Information System (INIS)
Sanford, T.W.L.; Mock, R.C.; Marder, B.M.
1998-08-01
The discovery that the use of very large numbers of wires enables high x-ray power to be generated from wire-array z-pinches represents a breakthrough in load design for large pulsed power generators, and has permitted high temperatures to be generated in radiation cavities on Saturn and Z. In this paper, changes in x-ray emission characteristics as a function of wire number, array mass, and load radius, for 20-mm-long aluminum arrays on Saturn that led to these breakthrough hohlraum results, are discussed and compared with a few related emission characteristics of high-wire-number aluminum and tungsten arrays on Z. X=ray measurement comparisons with analytic models and 2-D radiation-magnetohydrodynamic (RMHC) code simulations in the x-y and r-z planes provide confidence in the ability of the models and codes to predict future x-ray performance with very-large-number wire arrays
ROLE OF THE CORONAL ALFVÉN SPEED IN MODULATING THE SOLAR-WIND HELIUM ABUNDANCE
Energy Technology Data Exchange (ETDEWEB)
Wang, Y.-M., E-mail: yi.wang@nrl.navy.mil [Space Science Division, Naval Research Laboratory, Washington, DC 20375 (United States)
2016-12-20
The helium abundance He/H in the solar wind is relatively constant at ∼0.04 in high-speed streams, but varies in phase with the sunspot number in slow wind, from ∼0.01 at solar minimum to ∼0.04 at maximum. Suggested mechanisms for helium fractionation have included frictional coupling to protons and resonant interactions with high-frequency Alfvénic fluctuations. We compare He/H measurements during 1995–2015 with coronal parameters derived from source-surface extrapolations of photospheric field maps. We find that the near-Earth helium abundance is an increasing function of the magnetic field strength and Alfvén speed v {sub A} in the outer corona, while being only weakly correlated with the proton flux density. Throughout the solar cycle, fast wind is associated with short-term increases in v {sub A} near the source surface; resonance with Alfvén waves, with v {sub A} and the relative speed of α -particles and protons decreasing with increasing heliocentric distance, may then lead to enhanced He/H at 1 au. The modulation of helium in slow wind reflects the tendency for the associated coronal Alfvén speeds to rise steeply from sunspot minimum, when this wind is concentrated around the source-surface neutral line, to sunspot maximum, when the source-surface field attains its peak strengths. The helium abundance near the source surface may represent a balance between collisional decoupling from protons and Alfvén wave acceleration.
Prediction of the Length of Upcoming Solar Cycles
Kakad, Bharati; Kakad, Amar; Ramesh, Durbha Sai
2017-12-01
The forecast of solar cycle (SC) characteristics is crucial particularly for several space-based missions. In the present study, we propose a new model for predicting the length of the SC. The model uses the information of the width of an autocorrelation function that is derived from the daily sunspot data for each SC. We tested the model on Versions 1 and 2 of the daily international sunspot number data for SCs 10 - 24. We found that the autocorrelation width Aw n of SC n during the second half of its ascending phase correlates well with the modified length that is defined as T_{cy}^{n+2} - Tan. Here T_{cy}^{n+2} and T_{ a}n are the length and ascent time of SCs n+2 and n, respectively. The estimated correlation coefficient between the model parameters is 0.93 (0.91) for Version 1 (Version 2) sunspot series. The standard errors in the observed and predicted lengths of the SCs for Version 1 and Version 2 data are 0.38 and 0.44 years, respectively. The advantage of the proposed model is that the predictions of the length of the upcoming two SCs ( i.e., n+1, n+2) are readily available at the time of the peak of SC n. The present model gives a forecast of 11.01, 10.52, and 11.91 years (11.01, 12.20, and 11.68 years) for the length of SCs 24, 25, and 26, respectively, for Version 1 (Version 2).
Solar cycle dependence of the radial gradient of cosmic ray intensity
International Nuclear Information System (INIS)
Allen, J.A.V.
1988-01-01
Observation of the interplanetary intensity of cosmic rays (E/sub p/>80 MeV) by Pioneers 10 and 11 now spans a sixteen-year time period 1972--1988 and heliocentric radial distances, r/sub 10/ and r/sub 11/, out to 43.7 AU for Pioneer 10 and 25.8 AU for Pioneer 11. Solar modulation continues to be present at the current distances of both spacecraft. The radial gradient of intensity is measured continuously over the slowly varying, outward moving radial segment Δr = r/sub 10/--r/sub 11/. The 50-day mean values of the gradient G vary systematically and cyclically in phase with solar activity as measured by sunspot number, with a maximum value of about 2.1 percent (AU)/sup -1/ at sunspot maximum and a miminum value of about 1.2 percent (AU)/sup -1/ at sunspot minimum. Thus, the apparent scale size of the heliospheric modulation region as measured by 1/G is about 48 AU at solar max and about 83 AU at solar min: a result that is the inverse of the conjectural inference of Randall and Van Allen [1986] using most of the same body of data but a different analytical point of view. There is persuasive evidence that G is independent of radial distance over the range 2.5 to 34 AU in the mid-point of the segment Δr. No dependence of G on heliographic latitude is evident, but this result does not lend itself to a quantitative statement. copyright American Geophysical Union 1988
Model Adequacy Analysis of Matching Record Versions in Nosql Databases
Directory of Open Access Journals (Sweden)
E. V. Tsviashchenko
2015-01-01
Full Text Available The article investigates a model of matching record versions. The goal of this work is to analyse the model adequacy. This model allows estimating a user’s processing time distribution of the record versions and a distribution of the record versions count. The second option of the model was used, according to which, for a client the time to process record versions depends explicitly on the number of updates, performed by the other users between the sequential updates performed by a current client. In order to prove the model adequacy the real experiment was conducted in the cloud cluster. The cluster contains 10 virtual nodes, provided by DigitalOcean Company. The Ubuntu Server 14.04 was used as an operating system (OS. The NoSQL system Riak was chosen for experiments. In the Riak 2.0 version and later provide “dotted vector versions” (DVV option, which is an extension of the classic vector clock. Their use guarantees, that the versions count, simultaneously stored in DB, will not exceed the count of clients, operating in parallel with a record. This is very important while conducting experiments. For developing the application the java library, provided by Riak, was used. The processes run directly on the nodes. In experiment two records were used. They are: Z – the record, versions of which are handled by clients; RZ – service record, which contains record update counters. The application algorithm can be briefly described as follows: every client reads versions of the record Z, processes its updates using the RZ record counters, and saves treated record in database while old versions are deleted form DB. Then, a client rereads the RZ record and increments counters of updates for the other clients. After that, a client rereads the Z record, saves necessary statistics, and deliberates the results of processing. In the case of emerging conflict because of simultaneous updates of the RZ record, the client obtains all versions of that
Directory of Open Access Journals (Sweden)
Sait Dundar Sofuoglu
2015-08-01
Full Text Available An artificial neural network (ANN approach was employed for the prediction and control of surface roughness (Ra and Rz in a computer numerical control (CNC machine. Experiments were performed on a CNC machine to obtain data used for the training and testing of an ANN. Experimental studies were conducted, and a model based on the experimental results was set up. Five machining parameters (cutter type, tool clearance strategy, spindle speed, feed rate, and depth of cut were used. One hidden layer was used for all models, while there were five neurons in the hidden layer of the Ra and Rz models. The RMSE values were calculated as 1.05 and 3.70. The mean absolute percentage error (MAPE values were calculated as 20.18 and 15.14, which can be considered as a good prediction. The results of the ANN approach were compared with the measured values. It was shown that the ANN prediction model obtained is a useful and effective tool for modeling the Ra and Rz of wood. The results of the present research can be applied in the wood machining industry to reduce energy, time, and cost.
Farming of Vegetables in Space-Limited Environments
He, Jie
2015-10-01
Vegetables that contain most of the essential components of human nutrition are perishable and cannot be stocked. To secure vegetable supply in space limited cities such as Singapore, there are different farming methods to produce vegetables. These include low-cost urban community gardening and innovative rooftop and vertical farms integrated with various technologies such as hydroponics, aquaponics and aeroponics. However, for large-scale vegetable production in space-limited Singapore, we need to develop farming systems that not only increase productivity many-fold per unit of land but also produce all types of vegetable, all year-round for today and the future. This could be resolved through integrated vertical aeroponic farming system. Manipulation of root-zone (RZ) environments such as cooling the RZ, modifying mineral nutrients and introducing elevated RZ CO2 using aeroponics can further boost crop productivity beyond what can be achieved from more efficient use of land area. We could also adopt energy saving light emitting diodes (LEDs) for vertical aeroponic farming system to promote uniform growth and to improve the utilisation of limited space via shortening the growth cycle, thus improving vegetable production in a cost-effective manner.
Studies of LMFBR: method of analysis and some results
International Nuclear Information System (INIS)
Ishiguro, Y.; Dias, A.F.; Nascimento, J.A. do.
1983-01-01
Some results of recent studies of LMFBR characteristics are summarized. A two-dimensional model of the LMFBR is taken from a publication and used as the base model for the analysis. Axial structures are added to the base model and a three-dimensional (Δ - Z) calculation has been done. Two dimensional (Δ and RZ) calculations are compared with the three-dimensional and published results. The eigenvalue, flux and power distributions, breeding characteristics, control rod worth, sodium-void and Doppler reactivities are analysed. Calculations are done by CITATION using six-group cross sections collapsed regionwise by EXPANDA in one-dimensional geometries from the 70-group JFS library. Burnup calculations of a simplified thorium-cycle LMFBR have also been done in the RZ geometry. Principal results of the studies are: (1) the JFS library appears adequate for predicting overall characteristics of an LMFBR, (2) the sodium void reactivity is negative within - 25 cm from the outer boundary of the core, (3) the halflife of Pa-233 must be considered explicitly in burnup analyses, and (4) two-dimensional (RZ and Δ) calculations can be used iteratively to analyze three-dimensional reactor systems. (Author) [pt
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... Sunspots consist of a dark umbra, surrounded by a lighter penumbra. Study of umbra–penumbra area ratio can be used to give a rough idea as to how the convective energy of the Sun is transported from the interior, as the sunspot's thermal structure is related to this convective medium. An algorithm to ...
Results from Kodaikanal Synoptic Observations
Indian Academy of Sciences (India)
tribpo
the global solar activity, the first component being the well known sunspot activity and the butterfly diagram. These two components occur at different latitude belts each lasting for about 11 years but with a phase difference of 5-6 years, the polar faculae leading the sunspot activity (see Fig. 2). This gives rise to the concept of ...
Implications of Extended Solar Minima
Adams, Mitzi L.; Davis, J. M.
2009-01-01
Since the discovery of periodicity in the solar cycle, the historical record of sunspot number has been carefully examined, attempting to make predictions about the next cycle. Much emphasis has been on predicting the maximum amplitude and length of the next cycle. Because current space-based and suborbital instruments are designed to study active phenomena, there is considerable interest in estimating the length and depth of the current minimum. We have developed criteria for the definition of a minimum and applied it to the historical sunspot record starting in 1749. In doing so, we find that 1) the current minimum is not yet unusually long and 2) there is no obvious way of predicting when, using our definition, the current minimum may end. However, by grouping the data into 22- year cycles there is an interesting pattern of extended minima that recurs every fourth or fifth 22-year cycle. A preliminary comparison of this pattern with other records, suggests the possibility of a correlation between extended minima and lower levels of solar irradiance.
Prediction of solar cycle 24 using fourier series analysis
International Nuclear Information System (INIS)
Khalid, M.; Sultana, M.; Zaidi, F.
2014-01-01
Predicting the behavior of solar activity has become very significant. It is due to its influence on Earth and the surrounding environment. Apt predictions of the amplitude and timing of the next solar cycle will aid in the estimation of the several results of Space Weather. In the past, many prediction procedures have been used and have been successful to various degrees in the field of solar activity forecast. In this study, Solar cycle 24 is forecasted by the Fourier series method. Comparative analysis has been made by auto regressive integrated moving averages method. From sources, January 2008 was the minimum preceding solar cycle 24, the amplitude and shape of solar cycle 24 is approximate on monthly number of sunspots. This forecast framework approximates a mean solar cycle 24, with the maximum appearing during May 2014 (+- 8 months), with most sunspot of 98 +- 10. Solar cycle 24 will be ending in June 2020 (+- 7 months). The difference between two consecutive peak values of solar cycles (i.e. solar cycle 23 and 24 ) is 165 months(+- 6 months). (author)
The Sun and the Earth's Climate
Directory of Open Access Journals (Sweden)
Haigh Joanna D.
2007-10-01
Full Text Available Variations in solar activity, at least as observed in numbers of sunspots, have been apparent since ancient times but to what extent solar variability may affect global climate has been far more controversial. The subject had been in and out of fashion for at least two centuries but the current need to distinguish between natural and anthropogenic causes of climate change has brought it again to the forefront of meteorological research. The absolute radiometers carried by satellites since the late 1970s have produced indisputable evidence that total solar irradiance varies systematically over the 11-year sunspot cycle, relegating to history the term “solar constant”, but it is difficult to explain how the apparent response to the Sun, seen in many climate records, can be brought about by these rather small changes in radiation. This article reviews some of the evidence for a solar influence on the lower atmosphere and discusses some of the mechanisms whereby the Sun may produce more significant impacts than might be surmised from a consideration only of variations in total solar irradiance.
Number names and number understanding
DEFF Research Database (Denmark)
Ejersbo, Lisser Rye; Misfeldt, Morten
2014-01-01
This paper concerns the results from the first year of a three-year research project involving the relationship between Danish number names and their corresponding digits in the canonical base 10 system. The project aims to develop a system to help the students’ understanding of the base 10 syste...... the Danish number names are more complicated than in other languages. Keywords: A research project in grade 0 and 1th in a Danish school, Base-10 system, two-digit number names, semiotic, cognitive perspectives....
EVOLUTION OF SPINNING AND BRAIDING HELICITY FLUXES IN SOLAR ACTIVE REGION NOAA 10930
Energy Technology Data Exchange (ETDEWEB)
Ravindra, B. [Indian Institute of Astrophysics, Koramangala, Bangalore 560 034 (India); Yoshimura, Keiji [Department of Physics, Montana State University Bozeman, MT 59717 (United States); Dasso, Sergio, E-mail: ravindra@iiap.res.in, E-mail: yosimura@solar.physics.montana.edu, E-mail: dasso@df.uba.ar [Instituto de Astronomia y Fisica del Espacio (CONICET-UBA), 1428 Buenos Aires (Argentina)
2011-12-10
The line-of-sight magnetograms from Solar Optical Telescope Narrowband Filter Imager observations of NOAA Active Region 10930 have been used to study the evolution of spinning and braiding helicities over a period of five days starting from 2006 December 9. The north (N) polarity sunspot was the follower and the south (S) polarity sunspot was the leader. The N-polarity sunspot in the active region was rotating in the counterclockwise direction. The rate of rotation was small during the first two days of observations and it increased up to 8 Degree-Sign hr{sup -1} on the third day of the observations. On the fourth and fifth days it remained at 4 Degree-Sign hr{sup -1} with small undulations in its magnitude. The sunspot rotated about 260 Degree-Sign in the last three days. The S-polarity sunspot did not complete more than 20 Degree-Sign in five days. However, it changed its direction of rotation five times over a period of five days and injected both the positive and negative type of spin helicity fluxes into the corona. Through the five days, both the positive and negative sunspot regions injected equal amounts of spin helicity. The total injected helicity is predominantly negative in sign. However, the sign of the spin and braiding helicity fluxes computed over all the regions were reversed from negative to positive five times during the five-day period of observations. The reversal in spinning helicity flux was found before the onset of the X3.4-class flare, too. Though, the rotating sunspot has been observed in this active region, the braiding helicity has contributed more to the total accumulated helicity than the spinning helicity. The accumulated helicity is in excess of -7 Multiplication-Sign 10{sup 43} Mx{sup 2} over a period of five days. Before the X3.4-class flare that occurred on 2006 December 13, the rotation speed and spin helicity flux increased in the S-polarity sunspot. Before the flare, the total injected helicity was larger than -6
White light coronal structures and flattening during six total solar eclipses
Directory of Open Access Journals (Sweden)
B.A. Marzouk
2016-12-01
Flattening index is the first quantitative parameter introduced for analyses of the global structure of the solar corona. It varies with respect to the phase of the solar activity and sunspot number. In this paper we study the solar corona during the 1990, 1999, 2006, 2008, 2009 and 2012 total solar eclipses. We obtain flattening coefficients for all the six eclipses by using a new computer program. Our results are in a good agreement with published results.
Catalog of Air Force Weather Technical Documents 1941-2008
2008-06-19
Meteorological Rocketsonde Network, by Lt. Col. Walter I. Christensen, Maj. Terrell D. McCorry, and CMSgt. Ernest Fisher, June 1972, 24pp. Study presents...Biddulph, May 1989, 14pp. Inspired by Ann Besson, a reporter for the Kaiserslautern American, a newspaper that uses these summaries in a monthly “Weather...Asheville NC 28801-5002 DSN 673-9019. 4WW TM 70-2 (AD-None) Relationship Between 10 CM Solar Flux and Sunspot Number, by MSgt. Terrell S. Birch
Relative phase asynchrony and long-range correlation of long-term solar magnetic activity
Deng, Linhua
2017-07-01
Statistical signal processing is one of the most important tasks in a large amount of areas of scientific studies, such as astrophysics, geophysics, and space physics. Phase recurrence analysis and long-range persistence are the two dynamical structures of the underlying processes for the given natural phenomenon. Linear and nonlinear time series analysis approaches (cross-correlation analysis, cross-recurrence plot, wavelet coherent transform, and Hurst analysis) are combined to investigate the relative phase interconnection and long-range correlation between solar activity and geomagnetic activity for the time interval from 1932 January to 2017 January. The following prominent results are found: (1) geomagnetic activity lags behind sunspot numbers with a phase shift of 21 months, and they have a high level of asynchronous behavior; (2) their relative phase interconnections are in phase for the periodic scales during 8-16 years, but have a mixing behavior for the periodic belts below 8 years; (3) both sunspot numbers and geomagnetic activity can not be regarded as a stochastic phenomenon because their dynamical behaviors display a long-term correlation and a fractal nature. We believe that the presented conclusions could provide further information on understanding the dynamical coupling of solar dynamo process with geomagnetic activity variation, and the crucial role of solar and geomagnetic activity in the long-term climate change.
Interpretation of vector magnetograph data including magneto-optic effects. Pt. 1
International Nuclear Information System (INIS)
West, E.A.; Hagyard, J.; National Aeronautics and Space Administration, Huntsville, AL
1983-01-01
In this paper, the presence of Faraday rotation in measurements of orientation of a sunspot's transvese magnetic field is investigated. Using observations obtained with the Marshall Space Flight Center's (MSFC) vector magnetograph, the derived vector magnetic field of a simple, symmetric sunspot is used to calculate the degree of Faraday rotation in the azimuth of the transverse field as a function of wavelength from analytical expressions for the Stokes parameters. These results are then compared with the observed rotation of the field's azimuth which is derived from observations at different wavelengths within the Fe sub(I) 5250 A spectral line. From these comparisons, we find: the observed rotation of the azimuth is simulated to a reasonable degree by the theoretical formulations if the line-formation parameter eta 0 is varied over the sunspot; these variations in eta 0 are substantiated by the line-intensity data; for the MSFC system, Faraday rotation can be neglected for field strengths less than 1800 G and field inclinations greater than 45 0 ; to minimize the effects of Faraday rotation in sunspot umbrae, MSFC magnetograph measurements must be made in the far wings of the Zeeman-sensitive spectral line. (orig.)
CYLFUX, Fast Reactor Reactivity Transients Simulation in LWR by 2-D 2 Group Diffusion
International Nuclear Information System (INIS)
Schmidt, A.
1973-01-01
1 - Nature of physical problem solved: A 2-dimensional calculation of the 2-group, space-dependent neutron diffusion equations is performed in r-z geometry using an arbitrary number of groups of delayed neutron precursors. The program is designed to simulate fast reactivity excursions in light water reactors taking into account Doppler feedback via adiabatic heatup of fuel. Axial motions of control rods may be considered including scram action on option. 2 - Method of solution: The differential equations are solved at each time step by an explicit finite difference method using two time levels. The stationary distributions are obtained by using the same algorithm. 3 - Restrictions on the complexity of the problem: No restriction to the number of space points and delayed neutron energy groups besides the computer size
ALMA Discovery of Solar Umbral Brightness Enhancement at λ = 3 mm
Energy Technology Data Exchange (ETDEWEB)
Iwai, Kazumasa [Institute for Space-Earth Environmental Research, Nagoya University, Furo-cho, Chikusa-ku, Nagoya, 464-8601 (Japan); Loukitcheva, Maria [Center for Solar-Terrestrial Research, New Jersey Institute of Technology, 323 Martin Luther King Boulevard, Newark, NJ 07102 (United States); Shimojo, Masumi [Chile Observatory, National Astronomical Observatory of Japan, Mitaka, Tokyo 181-8588 (Japan); Solanki, Sami K. [Max Planck Institute for Solar System Research, Justus-von-Liebig-Weg 3, D-37073 Göttingen (Germany); White, Stephen M., E-mail: k.iwai@isee.nagoya-u.ac.jp [Space Vehicles Directorate, Air Force Research Laboratory, Albuquerque, NM (United States)
2017-06-01
We report the discovery of a brightness enhancement in the center of a large sunspot umbra at a wavelength of 3 mm using the Atacama Large Millimeter/sub-millimeter Array (ALMA). Sunspots are among the most prominent features on the solar surface, but many of their aspects are surprisingly poorly understood. We analyzed a λ = 3 mm (100 GHz) mosaic image obtained by ALMA that includes a large sunspot within the active region AR12470, on 2015 December 16. The 3 mm map has a 300″ × 300″ field of view and 4.″9 × 2.″2 spatial resolution, which is the highest spatial resolution map of an entire sunspot in this frequency range. We find a gradient of 3 mm brightness from a high value in the outer penumbra to a low value in the inner penumbra/outer umbra. Within the inner umbra, there is a marked increase in 3 mm brightness temperature, which we call an umbral brightness enhancement. This enhanced emission corresponds to a temperature excess of 800 K relative to the surrounding inner penumbral region and coincides with excess brightness in the 1330 and 1400 Å slit-jaw images of the Interface Region Imaging Spectrograph ( IRIS ), adjacent to a partial lightbridge. This λ = 3 mm brightness enhancement may be an intrinsic feature of the sunspot umbra at chromospheric heights, such as a manifestation of umbral flashes, or it could be related to a coronal plume, since the brightness enhancement was coincident with the footpoint of a coronal loop observed at 171 Å.
Cosmic numbers the numbers that define our universe
Stein, James D
2011-01-01
Our fascination with numbers begins when we are children and continues throughout our lives. We start counting our fingers and toes and end up balancing checkbooks and calculating risk. So powerful is the appeal of numbers that many people ascribe to them a mystical significance. Other numbers go beyond the supernatural, working to explain our universe and how it behaves. In Cosmic Numbers , mathematics professor James D. Stein traces the discovery, evolution, and interrelationships of the numbers that define our world. Everyone knows about the speed of light and absolute zero, but numbers lik
Ocena dokładności wyznaczania przestrzennego położenia punktów metodą biegunową
Preweda, Edward
1997-01-01
Położenie, wymiary czy też kształt wielu obiektów przemysłowych określa się na podstawie wyników pomiarów geodezyjnych. Kontrolowane obiekty reprezentowane są przez zbiory punktów położonych na ich powierzchni. Jedną z metod wyznaczania współrzędnych przestrzennych punktów jest metoda biegunową. W pracy wyprowadzono zależności określające macierz kowariancji dla współrzędnych punktów wyznaczanych tą metodą. Positions, dimensions or shape of many industrial objects are determined on the bas...
Experiments for IFR fuel criticality in ZPPR-21
International Nuclear Information System (INIS)
Olsen, D.N.; Collins, P.J.; Carpenter, S.G.
1991-01-01
A series of benchmark measurements was made in ZPPR-21 to validate criticality calculations for fuel processing operations for Argonne's Integral Fast Reactor program. Six different mixtures of Pu/U/Zr fuel with a graphite reflector were built and criticality was determined by period measurements. The assemblies were isolated from room return neutrons by a lithium hydride shield. Analysis was done using a fully-detailed model with the VIM Monte Carlo code and ENDF/B-V.2 data. Sensitivity analysis was used to validate the measurements against other benchmark data. A simple RZ model was defined and used with the KENO code. Corrections to the RZ model were provided by the VIM calculations with low statistical uncertainty. (Author)
International Nuclear Information System (INIS)
Jachic, J.
1985-01-01
It is presented the ONEDM neutronic simulator for RZ spatial calculation, two energy groups, aiming at researching and optimization of a low power fast reactor design. The simulator's methodology is based in RZ calculation from radial and axial calculation iteractively coupled and in macroscopic cross sections corrected by power density and asymmetry of the spectrum in the feedback process with phase library for reference neutronic state. The transversal area which are determined by energy groups and material region in the iteration are introduced in the spatial calculation. The simulator efficiency is tested and compared with the CITATION and 2DB codes. The cross sections are generated by 1DX code. (M.C.K.) [pt
[Intel random number generator-based true random number generator].
Huang, Feng; Shen, Hong
2004-09-01
To establish a true random number generator on the basis of certain Intel chips. The random numbers were acquired by programming using Microsoft Visual C++ 6.0 via register reading from the random number generator (RNG) unit of an Intel 815 chipset-based computer with Intel Security Driver (ISD). We tested the generator with 500 random numbers in NIST FIPS 140-1 and X(2) R-Squared test, and the result showed that the random number it generated satisfied the demand of independence and uniform distribution. We also compared the random numbers generated by Intel RNG-based true random number generator and those from the random number table statistically, by using the same amount of 7500 random numbers in the same value domain, which showed that the SD, SE and CV of Intel RNG-based random number generator were less than those of the random number table. The result of u test of two CVs revealed no significant difference between the two methods. Intel RNG-based random number generator can produce high-quality random numbers with good independence and uniform distribution, and solves some problems with random number table in acquisition of the random numbers.
Magnetohydrodynamic stability of tokamak plasmas with poloidal mode coupling
International Nuclear Information System (INIS)
Shigueoka, H.; Sakanaka, P.H.
1987-01-01
The stability behavior with respect to internal modes is examined for a class of tokamak equilibria with non-circular cross sections. The surfaces of the constant poloidal magnetic flux ψ (R,Z) are obtained numerically by solving the Grad-Shafranov's equation with a specified shape for the outmost plasma surface. The equation of motion for ideal MHD stability is written in a ortogonal coordinate system (ψ, χ, φ). Th e stability analysis is performance numerically in a truncated set of coupled m (poloidal wave number) equations. The calculations involve no approximations, and so all parameters of the equilibrium solution can be arbitrarily varied. (author) [pt
The Mental Number Line in Dyscalculia: Impaired Number Sense or Access from Symbolic Numbers?
Lafay, Anne; St-Pierre, Marie-Catherine; Macoir, Joël
2017-01-01
Numbers may be manipulated and represented mentally over a compressible number line oriented from left to right. According to numerous studies, one of the primary reasons for dyscalculia is related to improper understanding of the mental number line. Children with dyscalculia usually show difficulty when they have to place Arabic numbers on a…
Charvátová, Ivanka; Hejda, Pavel
2016-04-01
During several latest years, a behavior of the Sun is slightly unusual (hibernation stage?). Our prediction of cycle 24 height and of geomagnetic index aa (Charvátová, 2011) was confirmed in two basic points: the cycle 24 height is around 100 W (predicted value according to a close similarity between the SIMs in the years 1840-1905 and 1980-2045 was 140(100) W). (Other predictions for cycle 24 were between 40 W and 185 W.) As concerns aa-index of geomagnetic activity, predicted great depression bellow 10 nT appeared, but before the predicted year. Although the continuation of our SIMs prediction shows lower future sunspot cycles 25(65 W), 26 (80 W), 27 (60 W), the values are much higher than during the Maunder minimum. These cycles could be longer, up to 12 years. A future course of geomagnetic index aa could follow its course after 1880. In aa-index and also in sunspot numbers, the cycle of 1.6 years, dominant period in the SIM due to the inner planets (synodic period of Venus and Earth), is permanently seen, including in distances between two peaks of sunspot cycles. We can use this for prediction of higher values of these both phenomena - it can occur in the years 2016.42, 2018.02, 2019.62. During the interval 1840-1905 also higher volcanic activity occurred - up to force of Krakatoa (1883, DVI=400). Since 1980, several great volcanic events appeared again (e.g. Mt. Pinatubo (1991), DVI=350). Survey and comparison of volcanic indices DVI and AI in the two corresponding mentioned intervals will be also presented.
Small Coronal Holes Near Active Regions as Sources of Slow Solar Wind
Energy Technology Data Exchange (ETDEWEB)
Wang, Y.-M., E-mail: yi.wang@nrl.navy.mil [Space Science Division, Naval Research Laboratory, Washington, DC 20375 (United States)
2017-06-01
We discuss the nature of the small areas of rapidly diverging, open magnetic flux that form in the strong unipolar fields at the peripheries of active regions (ARs), according to coronal extrapolations of photospheric field measurements. Because such regions usually have dark counterparts in extreme-ultraviolet (EUV) images, we refer to them as coronal holes, even when they appear as narrow lanes or contain sunspots. Revisiting previously identified “AR sources” of slow solar wind from 1998 and 1999, we find that they are all associated with EUV coronal holes; the absence of well-defined He i 1083.0 nm counterparts to some of these holes is attributed to the large flux of photoionizing radiation from neighboring AR loops. Examining a number of AR-associated EUV holes during the 2014 activity maximum, we confirm that they are characterized by wind speeds of ∼300–450 km s{sup −1}, O{sup 7+}/O{sup 6+} ratios of ∼0.05–0.4, and footpoint field strengths typically of order 30 G. The close spacing between ARs at sunspot maximum limits the widths of unipolar regions and their embedded holes, while the continual emergence of new flux leads to rapid changes in the hole boundaries. Because of the highly nonradial nature of AR fields, the smaller EUV holes are often masked by the overlying canopy of loops, and may be more visible toward one solar limb than at central meridian. As sunspot activity declines, the AR remnants merge to form much larger, weaker, and longer-lived unipolar regions, which harbor the “classical” coronal holes that produce recurrent high-speed streams.
Measuring Solar Radiation Incident on Earth: Solar Constant-3 (SOLCON-3)
Crommelynck, Dominique; Joukoff, Alexandre; Dewitte, Steven
2002-01-01
Life on Earth is possible because the climate conditions on Earth are relatively mild. One element of the climate on Earth, the temperature, is determined by the heat exchanges between the Earth and its surroundings, outer space. The heat exchanges take place in the form of electromagnetic radiation. The Earth gains energy because it absorbs solar radiation, and it loses energy because it emits thermal infrared radiation to cold space. The heat exchanges are in balance: the heat gained by the Earth through solar radiation equals the heat lost through thermal radiation. When the balance is perturbed, a temperature change and hence a climate change of the Earth will occur. One possible perturbation of the balance is the CO2 greenhouse effect: when the amount of CO2 in the atmosphere increases, this will reduce the loss of thermal infrared radiation to cold space. Earth will gain more heat and hence the temperature will rise. Another perturbation of the balance can occur through variation of the amount of energy emitted by the sun. When the sun emits more energy, this will directly cause a rise of temperature on Earth. For a long time scientists believed that the energy emitted by the sun was constant. The 'solar constant' is defined as the amount of solar energy received per unit surface at a distance of one astronomical unit (the average distance of Earth's orbit) from the sun. Accurate measurements of the variations of the solar constant have been made since 1978. From these we know that the solar constant varies approximately with the 11-year solar cycle observed in other solar phenomena, such as the occurrence of sunspots, dark spots that are sometimes visible on the solar surface. When a sunspot occurs on the sun, since the spot is dark, the radiation (light) emitted by the sun drops instantaneously. Oddly, periods of high solar activity, when a lot of sunspot numbers increase, correspond to periods when the average solar constant is high. This indicates that
Wu, Chunsen; Zhou, Xing; Wei, Benxi; Li, Hongyan; Tian, Yaoqi; Ali, Barkat; Xu, Xueming; Jin, Zhengyu
2015-03-01
Normal maize starch was hydrolyzed by the glucan 1,4-alpha-maltotriohydrolase (AMTS), and the changes in molecular characteristics and digestibility of starch were evaluated. Upon hydrolysis, maltotriose purity could be modified via controlled AMTS action. The transglycosylation of AMTS possibly happened during the extensive hydrolysis of starch. No single linear association between the z-average radius of gyration (Rz), conformation exponent (ν), apparent molecular density (ρ) and weight average molar mass (Mw) of the starch molecules could be established in the entire process of AMTS hydrolysis. Under mild hydrolysis (≤240 min), Rz and ρ displayed linear relationships with Mw. However, transitions of ν, Rz and ρ appeared after extensive hydrolysis (>240 min), due to the increase in the amount of short chains [degree of polymerization (DP)≤5]. The spherical starch molecule tends toward less compact and a structure between sphere and random coil after extensive hydrolysis. And the increase in the amount of DP≤12 chains and reduction of molecular dimension after AMTS hydrolysis restrict the digestibility of starch. The results of this study suggest that normal maize starch can be modulated by AMTS to produce the desired maltotriose syrup, starch molecular characteristics, and starch digestibility. Copyright © 2014 Elsevier B.V. All rights reserved.
QTL and QTL x environment effects on agronomic and nitrogen acquisition traits in rice.
Senthilvel, Senapathy; Vinod, Kunnummal Kurungara; Malarvizhi, Palaniappan; Maheswaran, Marappa
2008-09-01
Agricultural environments deteriorate due to excess nitrogen application. Breeding for low nitrogen responsive genotypes can reduce soil nitrogen input. Rice genotypes respond variably to soil available nitrogen. The present study attempted quantification of genotype x nitrogen level interaction and mapping of quantitative trait loci (QTLs) associated with nitrogen use efficiency (NUE) and other associated agronomic traits. Twelve parameters were observed across a set of 82 double haploid (DH) lines derived from IR64/Azucena. Three nitrogen regimes namely, native (0 kg/ha; no nitrogen applied), optimum (100 kg/ha) and high (200 kg/ha) replicated thrice were the environments. The parents and DH lines were significantly varying for all traits under different nitrogen regimes. All traits except plant height recorded significant genotype x environment interaction. Individual plant yield was positively correlated with nitrogen use efficiency and nitrogen uptake. Sixteen QTLs were detected by composite interval mapping. Eleven QTLs showed significant QTL x environment interactions. On chromosome 3, seven QTLs were detected associated with nitrogen use, plant yield and associated traits. A QTL region between markers RZ678, RZ574 and RZ284 was associated with nitrogen use and yield. This chromosomal region was enriched with expressed gene sequences of known key nitrogen assimilation genes.
ON MAGNETIC ACTIVITY BAND OVERLAP, INTERACTION, AND THE FORMATION OF COMPLEX SOLAR ACTIVE REGIONS
Energy Technology Data Exchange (ETDEWEB)
McIntosh, Scott W. [High Altitude Observatory, National Center for Atmospheric Research, P.O. Box 3000, Boulder, CO 80307 (United States); Leamon, Robert J., E-mail: mscott@hao.ucar.edu [Department of Physics, Montana State University, Bozeman, MT 59717 (United States)
2014-11-20
Recent work has revealed a phenomenological picture of the how the ∼11 yr sunspot cycle of the Sun arises. The production and destruction of sunspots is a consequence of the latitudinal-temporal overlap and interaction of the toroidal magnetic flux systems that belong to the 22 yr magnetic activity cycle and are rooted deep in the Sun's convective interior. We present a conceptually simple extension of this work, presenting a hypothesis on how complex active regions can form as a direct consequence of the intra- and extra-hemispheric interaction taking place in the solar interior. Furthermore, during specific portions of the sunspot cycle, we anticipate that those complex active regions may be particularly susceptible to profoundly catastrophic breakdown, producing flares and coronal mass ejections of the most severe magnitude.
Alves, Mauro A.; Lyra, Cássia S.
2008-12-01
The Newcomb-Benford's Law (LNB) of first digits is introduced to high school students in an extracurricular activity through the study of sunspots. The LNB establishes that the first digits of various sets of data describing natural occurrences are not distributed uniformly, but according to a logarithmic distribution of probability. The LNB is counter-intuitive and is a good example of how mathematics applied to the study of natural phenomena can provide surprising and unexpected results serving also as a motivating agent in the study of physical sciences. En este trabajo se describe una actividad extracurricular donde se presenta a los estudiantes la ley de los primeros dígitos de Newcomb-Benford (LNB) con el estudio de manchas solares. La LNB establece que los primeros dígitos de algunos tipos de dados de ocurrencia natural no están distribuidos en manera uniforme, pero sí de acuerdo con una distribución logarítmica de probabilidad. La LNB es contra-intuitiva y es un excelente ejemplo de como las matemáticas aplicadas al estudio de fenómenos naturales pueden sorprender al estudiante, sirviendo también como elemento motivador en la educación de ciencias y de matemáticas. Este trabalho descreve uma atividade extracurricular na qual a lei dos primeiros dígitos de Newcomb-Benford (LNB) é introduzida a estudantes através do estudo de manchas solares. A LNB estabelece que os primeiros dígitos de vários tipos de conjunto de dados de ocorrência natural não são distribuídos de maneira uniforme, mas sim de acordo com uma distribuição logarítmica de probabilidade. A LNB é contra-intuitiva e é um ótimo exemplo de como a matemática aplicada ao estudo de fenômenos naturais pode fornecer resultados surpreendentes e inesperados, servindo também como um agente motivador no ensino de ciências e matemática.
THE RELATIONSHIP BETWEEN NUMBER NAMES AND NUMBER CONCEPTS
DEFF Research Database (Denmark)
Ejersbo, Lisser Rye; Misfeldt, Morten
Different countries have different names for numbers. These names are often related in a regular way to the base-10 place value system used for writing numbers as digits. However, in several languages, this regularity breaks down (e.g., between 10 and 20), and there is limited knowledge of how th......, a second, regular set of number names is introduced in primary school. The study’s findings suggest that the regularity of number names influences the development of number concepts and creates a positive impact on the understanding of the base-10 system....
Directory of Open Access Journals (Sweden)
J. Y. Kang
2013-01-01
Full Text Available Recently, many mathematicians have studied different kinds of the Euler, Bernoulli, and Genocchi numbers and polynomials. In this paper, we give another definition of polynomials Ũn(x. We observe an interesting phenomenon of “scattering” of the zeros of the polynomials Ũn(x in complex plane. We find out some identities and properties related to polynomials Ũn(x. Finally, we also derive interesting relations between polynomials Ũn(x, Stirling numbers, central factorial numbers, and Euler numbers.
Directory of Open Access Journals (Sweden)
Jeannett Martin
2012-01-01
Full Text Available This report summarizes the contributions and debates from a conference on German–Beninese cooperation in social science research (8–10 March 2012, University of Bayreuth. In drawing on the experiences from more than three decades of social science research on this West African country, it refers to examples from the past and present of African Studies in Germany, as well as describing the potential for German–African cooperation in this field in the future. Aside from this, it raises the question of whether and how social science cooperation is possible given the economic and power disparities. It is argued that cooperation “on equal terms” will not be easy to achieve but must be consistently striven for – personally as well as politically.Dieser Bericht fasst die Beiträge und Debatten einer Konferenz zur deutsch-beninischen Kooperation in der Sozialforschung (Universität Bayreuth, 8.-10. März 2012 zusammen. Indem Erfahrungen aus drei Jahrzehnten Sozialforschung zu diesem westafrikanischen Land skizziert werden, entsteht beispielhaft ein Bild der Afrikaforschung in Deutschland. Die Potenziale deutsch-afrikanischer Zusammenarbeit in diesem Bereich werden deutlich. Gleichzeitig wird die Frage beleuchtet, ob und wie angesichts der vorhandenen wirtschaftlichen Unterschiede und hierarchischen Strukturen eine Kooperation in der sozialwissenschaftlichen Forschung möglich ist. Die Autorinnen halten eine Zusammenarbeit zu gleichen Bedingungen für schwer erreichbar, plädieren aber dafür, sich kontinuierlich dafür einzusetzen – persönlich und politisch.
International Nuclear Information System (INIS)
Kafizas, Andreas; Mills, Andrew; Parkin, Ivan P.
2010-01-01
degradation over the 196 positions analysed for both Rz (Red colour deviation = 19% UVA, 8% Solar; Green colour deviation = 17% UVA, 12% Solar) and DCIP (Red colour deviation = 22% UVA, 16% Solar) inks was seen in both UVA and solar experiments, demonstrating the consistency of the self-cleaning titania layer on Activ TM . The method presented provides a good solution for the high-throughput photocatalytic screening of a number of homogenous photocatalytically active materials simultaneously or numerous positions on a single film; both useful in assessing the homogeneity of a film or determining the best combination of reaction components to produce the optimum performance photocatalytic film.
Straight flavor of Binary Number in Decimal Number System
MD. Abdul Awal Ansary; Sushanta Acharjee
2012-01-01
Different number systems are available on the basis of their base numbers. For instance, decimal number system is of base 10, hexadecimal number system which base is 16 and, Binary number system which base is 2 etc. Some numbers systems are easy to understand by the human being and some are easy to understand by electronics machine for instance digital computers. Computers only can understand data and instructions that are stored in binary form, though we input the data and instruction in dec...
Energy Technology Data Exchange (ETDEWEB)
Hazra, Gopal; Choudhuri, Arnab Rai [Department of Physics, Indian Institute of Science, Bangalore, 560012 (India); Miesch, Mark S., E-mail: ghazra@physics.iisc.ernet.in, E-mail: arnab@physics.iisc.ernet.in, E-mail: miesch@ucar.edu [High Altitude Observatory, National Center for Atmospheric Research, Boulder, CO 80301 (United States)
2017-01-20
We develop a three-dimensional kinematic self-sustaining model of the solar dynamo in which the poloidal field generation is from tilted bipolar sunspot pairs placed on the solar surface above regions of strong toroidal field by using the SpotMaker algorithm, and then the transport of this poloidal field to the tachocline is primarily caused by turbulent diffusion. We obtain a dipolar solution within a certain range of parameters. We use this model to study the build-up of the polar magnetic field and show that some insights obtained from surface flux transport models have to be revised. We present results obtained by putting a single bipolar sunspot pair in a hemisphere and two symmetrical sunspot pairs in two hemispheres. We find that the polar fields produced by them disappear due to the upward advection of poloidal flux at low latitudes, which emerges as oppositely signed radial flux and which is then advected poleward by the meridional flow. We also study the effect that a large sunspot pair, violating Hale’s polarity law, would have on the polar field. We find that there would be some effect—especially if the anti-Hale pair appears at high latitudes in the mid-phase of the cycle—though the effect is not very dramatic.
MULTI-WAVELENGTH STUDY OF A DELTA-SPOT. I. A REGION OF VERY STRONG, HORIZONTAL MAGNETIC FIELD
Energy Technology Data Exchange (ETDEWEB)
Jaeggli, S. A., E-mail: sarah.jaeggli@nasa.gov [NASA Goddard Space Flight Center, Solar Physics Laboratory, Code 671, Greenbelt, MD 20771 (United States)
2016-02-10
Active region NOAA 11035 appeared in 2009 December, early in the new solar activity cycle. This region achieved a delta sunspot (δ spot) configuration when parasitic flux emerged near the rotationally leading magnetic polarity and traveled through the penumbra of the largest sunspot in the group. Both visible and infrared imaging spectropolarimetry of the magnetically sensitive Fe i line pairs at 6302 and 15650 Å show large Zeeman splitting in the penumbra between the parasitic umbra and the main sunspot umbra. The polarized Stokes spectra in the strongest field region display anomalous profiles, and strong blueshifts are seen in an adjacent region. Analysis of the profiles is carried out using a Milne–Eddington inversion code capable of fitting either a single magnetic component with stray light or two independent magnetic components to verify the field strength. The inversion results show that the anomalous profiles cannot be produced by the combination of two profiles with moderate magnetic fields. The largest field strengths are 3500–3800 G in close proximity to blueshifts as strong as 3.8 km s{sup −1}. The strong, nearly horizontal magnetic field seen near the polarity inversion line in this region is difficult to understand in the context of a standard model of sunspot magnetohydrostatic equilibrium.
MULTI-WAVELENGTH STUDY OF A DELTA-SPOT. I. A REGION OF VERY STRONG, HORIZONTAL MAGNETIC FIELD
International Nuclear Information System (INIS)
Jaeggli, S. A.
2016-01-01
Active region NOAA 11035 appeared in 2009 December, early in the new solar activity cycle. This region achieved a delta sunspot (δ spot) configuration when parasitic flux emerged near the rotationally leading magnetic polarity and traveled through the penumbra of the largest sunspot in the group. Both visible and infrared imaging spectropolarimetry of the magnetically sensitive Fe i line pairs at 6302 and 15650 Å show large Zeeman splitting in the penumbra between the parasitic umbra and the main sunspot umbra. The polarized Stokes spectra in the strongest field region display anomalous profiles, and strong blueshifts are seen in an adjacent region. Analysis of the profiles is carried out using a Milne–Eddington inversion code capable of fitting either a single magnetic component with stray light or two independent magnetic components to verify the field strength. The inversion results show that the anomalous profiles cannot be produced by the combination of two profiles with moderate magnetic fields. The largest field strengths are 3500–3800 G in close proximity to blueshifts as strong as 3.8 km s −1 . The strong, nearly horizontal magnetic field seen near the polarity inversion line in this region is difficult to understand in the context of a standard model of sunspot magnetohydrostatic equilibrium
Observations of Space Weather and Space Climate Over the Past 15 Years From SABER (And Longer!)
Mlynczak, Marty; Hunt, Linda; Russell, James M., III
2016-01-01
The global infrared (IR) energy budget of the thermosphere has been reconstructed back 70 years (to 1947). IR cooling, integrated over a solar cycle, is relatively constant over the 5 complete cycles (19 -23) studied. Result implies that solar energy (particles and photons) has similar, small (< 7%) variation from one cycle to next. From Earth's upper atmosphere perspective, solar cycles are really more similar than different, over their length. No consistent relationship between peak of IR cooling and sunspot number peak. Results submitted to GRL 8/2016.
On the possible relations between solar activities and global seismicity in the solar cycle 20 to 23
Energy Technology Data Exchange (ETDEWEB)
Herdiwijaya, Dhani, E-mail: dhani@as.itb.ac.id [Astronomy Research Division and Bosscha Observatory, Faculty of Mathematics and Natural Sciences, Bandung Institute of Technology, Ganesha 10, Bandung, Indonesia 40132 (Indonesia); Arif, Johan [Geology Research Division, Faculty of Earth Sciences and Technology, Bandung Institute of Technology, Ganesha 10, Bandung, Indonesia 40132 (Indonesia); Nurzaman, Muhamad Zamzam; Astuti, Isna Kusuma Dewi [Astronomy Study Program, Faculty of Mathematics and Natural Sciences, Bandung Institute of Technology, Ganesha 10, Bandung, Indonesia 40132 (Indonesia)
2015-09-30
Solar activities consist of high energetic particle streams, electromagnetic radiation, magnetic and orbital gravitational forces. The well-know solar activity main indicator is the existence of sunspot which has mean variation in 11 years, named by solar cycle, allow for the above fluctuations. Solar activities are also related to the space weather affecting all planetary atmospheric variability, moreover to the Earth’s climate variability. Large extreme space and geophysical events (high magnitude earthquakes, explosive volcanic eruptions, magnetic storms, etc.) are hazards for humankind, infrastructure, economies, technology and the activities of civilization. With a growing world population, and with modern reliance on delicate technological systems, human society is becoming increasingly vulnerable to natural hazardous events. The big question arises to the relation between solar forcing energy to the Earth’s global seismic activities. Estimates are needed for the long term occurrence-rate probabilities of these extreme natural hazardous events. We studied connectivity from yearly seismic activities that refer to and sunspot number within the solar cycle 20 to 23 of year 1960 to 2013 (53 years). We found clear evidences that in general high magnitude earthquake events and their depth were related to the low solar activity.
On the possible relations between solar activities and global seismicity in the solar cycle 20 to 23
Herdiwijaya, Dhani; Arif, Johan; Nurzaman, Muhamad Zamzam; Astuti, Isna Kusuma Dewi
2015-09-01
Solar activities consist of high energetic particle streams, electromagnetic radiation, magnetic and orbital gravitational forces. The well-know solar activity main indicator is the existence of sunspot which has mean variation in 11 years, named by solar cycle, allow for the above fluctuations. Solar activities are also related to the space weather affecting all planetary atmospheric variability, moreover to the Earth's climate variability. Large extreme space and geophysical events (high magnitude earthquakes, explosive volcanic eruptions, magnetic storms, etc.) are hazards for humankind, infrastructure, economies, technology and the activities of civilization. With a growing world population, and with modern reliance on delicate technological systems, human society is becoming increasingly vulnerable to natural hazardous events. The big question arises to the relation between solar forcing energy to the Earth's global seismic activities. Estimates are needed for the long term occurrence-rate probabilities of these extreme natural hazardous events. We studied connectivity from yearly seismic activities that refer to and sunspot number within the solar cycle 20 to 23 of year 1960 to 2013 (53 years). We found clear evidences that in general high magnitude earthquake events and their depth were related to the low solar activity.
JTEL Winter School for Advanced Technologically Enhanced Learning
Glahn, Christian; Gruber, Marion
2010-01-01
Glahn, C., & Gruber, M. (2010). JTEL Winter School for Advanced Technologically Enhanced Learning. In ~mail. Das Magazin des Tiroler Bildungsinstituts, 01/10, März (p. 3-4). Innsbruck: Grillhof, Medienzentrum.
International Nuclear Information System (INIS)
Shaposhnikova, E.F.
1979-01-01
The observations of proton solar flares have been carried out in 1950-1958 using the extrablackout coronograph of the Crimea astrophysical observatory. The experiments permit to determine two characteristic features of flares: the directed motion of plasma injection flux from the solar depths and the appearance of a shock wave moving from the place of the injection along the solar surface. The appearance of the shock wave is accompanied by some phenomena occuring both in the sunspot zone and out of it. The consistent flash of proton flares in the other groups of spots, the disappearance of fibres and the appearance of eruptive prominences is accomplished in the sunspot zone. Beyond the sunspot zone the flares occur above spots, the fibres disintegrate partially or completely and the eruptive prominences appear in the regions close to the pole
Francile, C.; Luoni, M. L.
We present a prediction of the time series of the Wolf number R of sunspots using "time lagged feed forward neural networks". We use two types of networks: the focused and distributed ones which were trained with the back propagation of errors algorithm and the temporal back propagation algorithm respectively. As inputs to neural networks we use the time series of the number R averaged annually and monthly with the method IR5. As data sets for training and test we choose certain intervals of the time series similar to other works, in order to compare the results. Finally we discuss the topology of the networks used, the number of delays used, the number of neurons per layer, the number of hidden layers and the results in the prediction of the series between one and six steps ahead. FULL TEXT IN SPANISH
Cassandre : a two-dimensional multigroup diffusion code for reactor transient analysis
International Nuclear Information System (INIS)
Arien, B.; Daniels, J.
1986-12-01
CASSANDRE is a two-dimensional (x-y or r-z) finite element neutronics code with thermohydraulics feedback for reactor dynamics prior to the disassembly phase. It uses the multigroup neutron diffusion theory. Its main characteristics are the use of a generalized quasistatic model, the use of a flexible multigroup point-kinetics algorithm allowing for spectral matching and the use of a finite element description. The code was conceived in order to be coupled with any thermohydraulics module, although thermohydraulics feedback is only considered in r-z geometry. In steady state criticality search is possible either by control rod insertion or by homogeneous poisoning of the coolant. This report describes the main characterstics of the code structure and provides all the information needed to use the code. (Author)
Experiments for IFR fuel criticality in ZPPR-21
International Nuclear Information System (INIS)
Olsen, D.N.; Collins, P.J.; Carpenter, S.G.
1991-01-01
A series of benchmark measurements was made in ZPPR-21 to validate criticality calculations for fuel operations in Argonne's Integral Fast Reactor. Six different mixtures of Pu/U/Zr fuel with a graphite reflector were built and criticality was determined by period measurements. The assemblies were isolated from room return problems by a lithium hydride shield. Analysis was done using a fully-detailed model with the VIM Monte Carlo code and ENDF/B-V.2 data. Sensitivity analysis was used to validate the measurements against other benchmark data. A simple RZ model was defined the used with the KENO code. Corrections to the RZ model were provided by the VIM calculations with low statistical uncertainty. 7 refs., 5 figs., 5 tabs
Mendonça, J. Ricardo G.
2012-01-01
We define a new class of numbers based on the first occurrence of certain patterns of zeros and ones in the expansion of irracional numbers in a given basis and call them Sagan numbers, since they were first mentioned, in a special case, by the North-american astronomer Carl E. Sagan in his science-fiction novel "Contact." Sagan numbers hold connections with a wealth of mathematical ideas. We describe some properties of the newly defined numbers and indicate directions for further amusement.
DEFF Research Database (Denmark)
Busato, Francesco; Marchetti, Enrico
This paper explores the ability of a class of one-sector,multi-input models to generate indeterminate equilibrium paths, andendogenous cycles, without relying on factors' hoarding. The modelpresents a novel theoretical economic mechanism that supportssunspot-driven expansions without requiring...
Bernoulli-Carlitz and Cauchy-Carlitz numbers with Stirling-Carlitz numbers
Kaneko, Hajime; Komatsu, Takao
2017-01-01
Recently, the Cauchy-Carlitz number was defined as the counterpart of the Bernoulli-Carlitz number. Both numbers can be expressed explicitly in terms of so-called Stirling-Carlitz numbers. In this paper, we study the second analogue of Stirling-Carlitz numbers and give some general formulae, including Bernoulli and Cauchy numbers in formal power series with complex coefficients, and Bernoulli-Carlitz and Cauchy-Carlitz numbers in function fields. We also give some applications of Hasse-Teichm...
International Nuclear Information System (INIS)
Kasper, J. C.; Stevens, M. L.; Korreck, K. E.; Maruca, B. A.; Kiefer, K. K.; Schwadron, N. A.; Lepri, S. T.
2012-01-01
The changing relationships between solar wind speed, helium abundance, and minor ion charge state are examined over solar cycle 23. Observations of the abundance of helium relative to hydrogen (A He ≡ 100 × n He /n H ) by the Wind spacecraft are used to examine the dependence of A He on solar wind speed and solar activity between 1994 and 2010. This work updates an earlier study of A He from 1994 to 2004 to include the recent extreme solar minimum and broadly confirms our previous result that A He in slow wind is strongly correlated with sunspot number, reaching its lowest values in each solar minima. During the last minimum, as sunspot numbers reached their lowest levels in recent history, A He continued to decrease, falling to half the levels observed in slow wind during the previous minimum and, for the first time observed, decreasing even in the fastest solar wind. We have also extended our previous analysis by adding measurements of the mean carbon and oxygen charge states observed with the Advanced Composition Explorer spacecraft since 1998. We find that as solar activity decreased, the mean charge states of oxygen and carbon for solar wind of a given speed also fell, implying that the wind was formed in cooler regions in the corona during the recent solar minimum. The physical processes in the coronal responsible for establishing the mean charge state and speed of the solar wind have evolved with solar activity and time.
Photon number projection using non-number-resolving detectors
International Nuclear Information System (INIS)
Rohde, Peter P; Webb, James G; Huntington, Elanor H; Ralph, Timothy C
2007-01-01
Number-resolving photo-detection is necessary for many quantum optics experiments, especially in the application of entangled state preparation. Several schemes have been proposed for approximating number-resolving photo-detection using non-number-resolving detectors. Such techniques include multi-port detection and time-division multiplexing. We provide a detailed analysis and comparison of different number-resolving detection schemes, with a view to creating a useful reference for experimentalists. We show that the ideal architecture for projective measurements is a function of the detector's dark count and efficiency parameters. We also describe a process for selecting an appropriate topology given actual experimental component parameters
Directory of Open Access Journals (Sweden)
Rasheed Atif
2016-07-01
Full Text Available Influence of topographical features on mechanical properties of 0.1 wt % Multi-Layer Graphene (MLG/clay-epoxy nanocomposites has been studied. Three different compositions were made: (1 0.1 wt % MLG-EP; (2 0.1 wt % clay-EP and (3 0.05 wt % MLG-0.05 wt % clay-EP. The objective of making hybrid nanocomposites was to determine whether synergistic effects are prominent at low weight fraction of 0.1 wt % causing an improvement in mechanical properties. The topographical features studied include waviness (Wa, roughness average (Ra, root mean square value (Rq and maximum roughness height (Rmax or Rz. The Rz of as-cast 0.1 wt % MLG-EP, clay-EP and 0.05 wt % MLG-0.05 wt % clay-EP nanocomposites were 43.52, 48.43 and 41.8 µm respectively. A decrease in Rz values was observed by treating the samples with velvet cloth and abrasive paper 1200P while increased by treating with abrasive papers 320P and 60P. A weight loss of up to 16% was observed in samples after the treatment with the abrasive papers. It was observed that MLG is more effective in improving the mechanical properties of epoxy than nanoclay. In addition, no significant improvement in mechanical properties was observed in hybrid nanocomposites indicating that 0.1 wt % is not sufficient to generate conspicuous synergistic effects.
An integrated nonlinear optical loop mirror in silicon photonics for all-optical signal processing
Directory of Open Access Journals (Sweden)
Zifei Wang
2018-02-01
Full Text Available The nonlinear optical loop mirror (NOLM has been studied for several decades and has attracted considerable attention for applications in high data rate optical communications and all-optical signal processing. The majority of NOLM research has focused on silica fiber-based implementations. While various fiber designs have been considered to increase the nonlinearity and manage dispersion, several meters to hundreds of meters of fiber are still required. On the other hand, there is increasing interest in developing photonic integrated circuits for realizing signal processing functions. In this paper, we realize the first-ever passive integrated NOLM in silicon photonics and demonstrate its application for all-optical signal processing. In particular, we show wavelength conversion of 10 Gb/s return-to-zero on-off keying (RZ-OOK signals over a wavelength range of 30 nm with error-free operation and a power penalty of less than 2.5 dB, we achieve error-free nonreturn to zero (NRZ-to-RZ modulation format conversion at 10 Gb/s also with a power penalty of less than 2.8 dB, and we obtain error-free all-optical time-division demultiplexing of a 40 Gb/s RZ-OOK data signal into its 10 Gb/s tributary channels with a maximum power penalty of 3.5 dB.
Changes in Regional t2 Relaxation in Compressed Cartilage: a Microscopic MRI (µMRI) Study
Alhadlaq, Hisham; Xia, Yang
2004-10-01
T2-anisotropy of articular cartilage in magnetic field has its origin on the proton dipolar interactions and the collagen matrix organization, which influences T2 with a dependency as (3s^2(θ)-1). Seven specimens from a beagle humeral head were compressed at 12% and 20% strain values in μMRI experiments. T2 mappings at two orientations (0r and 55r) before and during compression were conducted on a Bruker AMX 300 NMR. Under load, the 2D cartilage maps at the magic angle lost its usual homogenous appearance. T2 values were averaged at the superficial zone (SZ), the transitional zone (TZ), and the radial zone (RZ). At 0r and relative to uncompressed tissue, SZ T2 was significantly lower, and RZ T2 increased significantly at both strain rates (12% and 20%). At 55r and relative to uncompressed tissue, ``bulk'' T2 and RZ T2 were significantly lower at only 20% strain. However, SZ T2 and TZ T2 were significantly lower at both strain rates. In addition, relative to 12% strain, SZ T2 was significantly lower at 0r; and ``bulk'' T2 and TZ T2 were significantly lower at 55r. The results demonstrate the modifications in collagen fiber organization as the dipolar interaction is altered due to tissue compression.
International Nuclear Information System (INIS)
Basu, S.; Valladares, C.E.; Basu, S.; Eastes, R.; Huffman, R.E.; Daniell, R.E.; Chaturvedi, P.K.; Livingston, R.C.
1993-01-01
The unique capability of the Polar BEAR satellite to simultaneously image auroral luminosities at multiple ultraviolet (UV) wavelengths and to remote sense large-scale (hundreds to tens of kilometers) and small-scale (kilometers to hundreds of meters) plasma density structures with its multifrequency beacon package is utilized to probe the auroral E region in the vicinity of the incoherent scatter radar (ISR) facility near Sondrestrom. In particular, we present coordinated observations on two nights obtained during the sunspot minimum (sunspot number < 10) January-February 1987 period when good spatial and temporal conjunction was obtained between Polar BEAR overflights and Sondrestrom ISR measurements. With careful coordinated observations we were able to confirm that the energetic particle precipitation responsible for the UV emissions causes the electron density increases in the E region. The integrations up to the topside of these ISR electron density profiles were consistent with the total electron content (TEC) measured by the Polar BEAR satellite. An electron transport model was utilized to determine quantitatively the electron density profiles which could be produced by the particle precipitation, which also produced multiple UV emissions measured by the imager; these profiles were found to be in good agreement with the observed ISR profiles in the E region. This outer scale size is also consistent with the measured phase to amplitude scintillation ratio. An estimate of the linear growth rate of the gradient-drift instability in the E region shows that these plasma density irregularities could have been generated by this process. The mutual consistency of these different sets of measurements provides confidence in the ability of the different techniques to remote sense large- and small-scale plasma density structures in the E region at least during sunspot minimum when the convection-dominated high-latitude F region is fairly weak. 56 refs., 16 figs
Asymmetric information and bank runs
Gu, Chao
2007-01-01
It is known that sunspots can trigger panic-based bank runs and that the optimal banking contract can tolerate panic-based runs. The existing literature assumes that these sunspots are based on a publicly observed extrinsic randomizing device. In this paper, I extend the analysis of panic-based runs to include an asymmetric-information, extrinsic randomizing device. Depositors observe different, but correlated, signals on the stability of the bank. I find that if the signals that depositors o...
Resonance of about-weekly human heart rate rhythm with solar activity change.
Cornelissen, G; Halberg, F; Wendt, H W; Bingham, C; Sothern, R B; Haus, E; Kleitman, E; Kleitman, N; Revilla, M A; Revilla, M; Breus, T K; Pimenov, K; Grigoriev, A E; Mitish, M D; Yatsyk, G V; Syutkina, E V
1996-12-01
In several human adults, certain solar activity rhythms may influence an about 7-day rhythm in heart rate. When no about-weekly feature was found in the rate of change in sunspot area, a measure of solar activity, the double amplitude of a circadian heart rate rhythm, approximated by the fit of a 7-day cosine curve, was lower, as was heart rate corresponds to about-weekly features in solar activity and/or relates to a sunspot cycle.
Prediction of meteorological parameters - 3: Rainfall and droughts
International Nuclear Information System (INIS)
Njau, E.C.
1990-11-01
We describe two new methods by which rainfall and hence meteorological droughts at any location on the earth may be predicted. The first method is based upon well supported observations that rainfall distribution at a given location during any local sunspot-related temperature/heat cycle is approximately similar to the distribution during another cycle associated with approximately similar sunspot cycle provided that the two temperature/heat cycles involved are immediately preceded by approximately similar sunspot cycles. The second method is based upon the fact that rainfall belts or patterns seem to be closely related to certain spatial and time-dependent temperature/heat patterns in the earth-atmosphere system. Reasonable predictions of these temperature/heat patterns may be made, and hence the associated rainfall patterns or belts may correspondingly be predicted. Specific examples are given to illustrate the two prediction methods. (author). 12 refs, 11 figs, 1 tab
High-resolution imaging and near-infrared spectroscopy of penumbral decay
Verma, M.; Denker, C.; Balthasar, H.; Kuckein, C.; Rezaei, R.; Sobotka, M.; Deng, N.; Wang, H.; Tritschler, A.; Collados, M.; Diercke, A.; Manrique, S. J. González
2018-06-01
Aims: Combining high-resolution spectropolarimetric and imaging data is key to understanding the decay process of sunspots as it allows us to scrutinize the velocity and magnetic fields of sunspots and their surroundings. Methods: Active region NOAA 12597 was observed on 2016 September 24 with the 1.5-meter GREGOR solar telescope using high-spatial-resolution imaging as well as imaging spectroscopy and near-infrared (NIR) spectropolarimetry. Horizontal proper motions were estimated with local correlation tracking, whereas line-of-sight (LOS) velocities were computed with spectral line fitting methods. The magnetic field properties were inferred with the "Stokes Inversions based on Response functions" (SIR) code for the Si I and Ca I NIR lines. Results: At the time of the GREGOR observations, the leading sunspot had two light bridges indicating the onset of its decay. One of the light bridges disappeared, and an elongated, dark umbral core at its edge appeared in a decaying penumbral sector facing the newly emerging flux. The flow and magnetic field properties of this penumbral sector exhibited weak Evershed flow, moat flow, and horizontal magnetic field. The penumbral gap adjacent to the elongated umbral core and the penumbra in that penumbral sector displayed LOS velocities similar to granulation. The separating polarities of a new flux system interacted with the leading and central part of the already established active region. As a consequence, the leading spot rotated 55° clockwise over 12 h. Conclusions: In the high-resolution observations of a decaying sunspot, the penumbral filaments facing the flux emergence site contained a darkened area resembling an umbral core filled with umbral dots. This umbral core had velocity and magnetic field properties similar to the sunspot umbra. This implies that the horizontal magnetic fields in the decaying penumbra became vertical as observed in flare-induced rapid penumbral decay, but on a very different time-scale.
The Evolution of the Solar Magnetic Field: A Comparative Analysis of Two Models
McMichael, K. D.; Karak, B. B.; Upton, L.; Miesch, M. S.; Vierkens, O.
2017-12-01
Understanding the complexity of the solar magnetic cycle is a task that has plagued scientists for decades. However, with the help of computer simulations, we have begun to gain more insight into possible solutions to the plethora of questions inside the Sun. STABLE (Surface Transport and Babcock Leighton) is a newly developed 3D dynamo model that can reproduce features of the solar cycle. In this model, the tilted bipolar sunspots are formed on the surface (based on the toroidal field at the bottom of the convection zone) and then decay and disperse, producing the poloidal field. Since STABLE is a 3D model, it is able to solve the full induction equation in the entirety of the solar convection zone as well as incorporate many free parameters (such as spot depth and turbulent diffusion) which are difficult to observe. In an attempt to constrain some of these free parameters, we compare STABLE to a surface flux transport model called AFT (Advective Flux Transport) which solves the radial component of the magnetic field on the solar surface. AFT is a state-of-the-art surface flux transport model that has a proven record of being able to reproduce solar observations with great accuracy. In this project, we implement synthetic bipolar sunspots into both models, using identical surface parameters, and run the models for comparison. We demonstrate that the 3D structure of the sunspots in the interior and the vertical diffusion of the sunspot magnetic field play an important role in establishing the surface magnetic field in STABLE. We found that when a sufficient amount of downward magnetic pumping is included in STABLE, the surface magnetic field from this model becomes insensitive to the internal structure of the sunspot and more consistent with that of AFT.
1984-01-01
magnetic changes. For instan ce, tile hard x -ar •:- i-., Q 1 mes , peak sunspot number is typically 100 times the flux inca - ;, .i"ic’,, , sunspo t...activity aecalled "magnetic stors(o"ub 11_7i11 fl u illler events). Th-se are periods when the magnetic field Inca - ti _caith’s surfacd fluctuates...iabili Iv and ( liuzatc is c lcarl of !rea practi- * ! nIc ethecajuse !h e wkater supply and alg, cultura ! Svsteinils of’ the, wo id, xi s fIhcm.l app
Solar and lunar daily geomagnetic variations at Dourbes
International Nuclear Information System (INIS)
De Meyer, F.
1980-01-01
Spectral analysis of the Dourbes H component hourly data from the period 1960-1978 revealed the existence of a number of minor terms, in addition to the main solar and lunar peaks. The relative amplitudes of oscillations in the geomagnetic spectrum are unrelated with those predicted through lunar tide theory. The minor terms agree more closely with the 27-day amplitude modulation mechanism. A high frequency resolution power spectrum clearly shows the splitting of the solar diurnal and semi-diurnal line, and even of the lunar semi-diurnal line by the annual variation and its harmonics. The correlation between the amplitude of the M 2 wave and the mean sunspot number is of no significance. (author)
Barnes, John
2016-01-01
In this intriguing book, John Barnes takes us on a journey through aspects of numbers much as he took us on a geometrical journey in Gems of Geometry. Similarly originating from a series of lectures for adult students at Reading and Oxford University, this book touches a variety of amusing and fascinating topics regarding numbers and their uses both ancient and modern. The author intrigues and challenges his audience with both fundamental number topics such as prime numbers and cryptography, and themes of daily needs and pleasures such as counting one's assets, keeping track of time, and enjoying music. Puzzles and exercises at the end of each lecture offer additional inspiration, and numerous illustrations accompany the reader. Furthermore, a number of appendices provides in-depth insights into diverse topics such as Pascal’s triangle, the Rubik cube, Mersenne’s curious keyboards, and many others. A theme running through is the thought of what is our favourite number. Written in an engaging and witty sty...
Petersen, T Kyle
2015-01-01
This text presents the Eulerian numbers in the context of modern enumerative, algebraic, and geometric combinatorics. The book first studies Eulerian numbers from a purely combinatorial point of view, then embarks on a tour of how these numbers arise in the study of hyperplane arrangements, polytopes, and simplicial complexes. Some topics include a thorough discussion of gamma-nonnegativity and real-rootedness for Eulerian polynomials, as well as the weak order and the shard intersection order of the symmetric group. The book also includes a parallel story of Catalan combinatorics, wherein the Eulerian numbers are replaced with Narayana numbers. Again there is a progression from combinatorics to geometry, including discussion of the associahedron and the lattice of noncrossing partitions. The final chapters discuss how both the Eulerian and Narayana numbers have analogues in any finite Coxeter group, with many of the same enumerative and geometric properties. There are four supplemental chapters throughout, ...
Directory of Open Access Journals (Sweden)
T. Pathinathan
2015-01-01
Full Text Available In this paper we define diamond fuzzy number with the help of triangular fuzzy number. We include basic arithmetic operations like addition, subtraction of diamond fuzzy numbers with examples. We define diamond fuzzy matrix with some matrix properties. We have defined Nested diamond fuzzy number and Linked diamond fuzzy number. We have further classified Right Linked Diamond Fuzzy number and Left Linked Diamond Fuzzy number. Finally we have verified the arithmetic operations for the above mentioned types of Diamond Fuzzy Numbers.
Directory of Open Access Journals (Sweden)
Schwarzweller Christoph
2015-02-01
Full Text Available In this article we introduce Proth numbers and prove two theorems on such numbers being prime [3]. We also give revised versions of Pocklington’s theorem and of the Legendre symbol. Finally, we prove Pepin’s theorem and that the fifth Fermat number is not prime.
Rational-number comparison across notation: Fractions, decimals, and whole numbers.
Hurst, Michelle; Cordes, Sara
2016-02-01
Although fractions, decimals, and whole numbers can be used to represent the same rational-number values, it is unclear whether adults conceive of these rational-number magnitudes as lying along the same ordered mental continuum. In the current study, we investigated whether adults' processing of rational-number magnitudes in fraction, decimal, and whole-number notation show systematic ratio-dependent responding characteristic of an integrated mental continuum. Both reaction time (RT) and eye-tracking data from a number-magnitude comparison task revealed ratio-dependent performance when adults compared the relative magnitudes of rational numbers, both within the same notation (e.g., fractions vs. fractions) and across different notations (e.g., fractions vs. decimals), pointing to an integrated mental continuum for rational numbers across notation types. In addition, eye-tracking analyses provided evidence of an implicit whole-number bias when we compared values in fraction notation, and individual differences in this whole-number bias were related to the individual's performance on a fraction arithmetic task. Implications of our results for both cognitive development research and math education are discussed. (PsycINFO Database Record (c) 2016 APA, all rights reserved).
η-INVARIANT AND CHERN-SIMONS CURRENT
Institute of Scientific and Technical Information of China (English)
ZHANG WEIPING
2005-01-01
The author presents an alternate proof of the Bismut-Zhang localization formula of ηinvariants, when the target manifold is a sphere, by using ideas of mod k index theory instead of the difficult analytic localization techniques of Bismut-Lebeau. As a consequence, it is shown that the R/Z part of the aualytically defined η invariant of Atiyah-Patodi-Singer for a Dirac operator on an odd dimensional closed spin manifold can be expressed purely geometrically through a stable Chern-Simons current on a higher dimensional sphere. As a preliminary application, the author discusses the relation with the Atiyah-Patodi-Singer R/Z index theorem for unitary flat vector bundles,and proves an R refinement in the case where the Dirac operator is replaced by the Signature operator.
All-optical XOR logic gate using intersubband transition in III-V quantum well materials.
Feng, Jijun; Akimoto, Ryoichi; Gozu, Shin-ichiro; Mozume, Teruo
2014-06-02
A monolithically integrated all-optical exclusive-OR (XOR) logic gate is experimentally demonstrated based on a Michelson interferometer (MI) gating device in InGaAs/AlAsSb coupled double quantum wells (CDQWs). The MI arms can convert the pump data with return-to-zero ON-OFF keying (RZ OOK) to binary phase-shift keying (BPSK) format, then two BPSK signals can interfere with each other for realizing a desired logical operation. All-optical format conversion from the RZ OOK to BPSK is based on the cross-phase modulation to the transverse electric (TE) probe wave, which is caused by the intersubband transition excited by the transverse magnetic (TM) pump light. Bit error rate measurements show that error free operation for both BPSK format conversion and XOR logical operation can be achieved.
Koninck, Jean-Marie De
2009-01-01
Who would have thought that listing the positive integers along with their most remarkable properties could end up being such an engaging and stimulating adventure? The author uses this approach to explore elementary and advanced topics in classical number theory. A large variety of numbers are contemplated: Fermat numbers, Mersenne primes, powerful numbers, sublime numbers, Wieferich primes, insolite numbers, Sastry numbers, voracious numbers, to name only a few. The author also presents short proofs of miscellaneous results and constantly challenges the reader with a variety of old and new n
Indian Academy of Sciences (India)
Admin
Triangular number, figurate num- ber, rangoli, Brahmagupta–Pell equation, Jacobi triple product identity. Figure 1. The first four triangular numbers. Left: Anuradha S Garge completed her PhD from. Pune University in 2008 under the supervision of Prof. S A Katre. Her research interests include K-theory and number theory.
Role of LLD, a new locus for leaflet/pinna morphogenesis in Pisum ...
Indian Academy of Sciences (India)
Unknown
*National Centre for Plant Genome Research, JNU Campus, New Delhi 110 067, India. †Corresponding author (Fax ... those of RZ elongate the stem (Lenhard and Laux 1999). ...... involved in growth and differentiation of vascular strand.
Generalized Bernoulli-Hurwitz numbers and the universal Bernoulli numbers
International Nuclear Information System (INIS)
Ônishi, Yoshihiro
2011-01-01
The three fundamental properties of the Bernoulli numbers, namely, the von Staudt-Clausen theorem, von Staudt's second theorem, and Kummer's original congruence, are generalized to new numbers that we call generalized Bernoulli-Hurwitz numbers. These are coefficients in the power series expansion of a higher-genus algebraic function with respect to a suitable variable. Our generalization differs strongly from previous works. Indeed, the order of the power of the modulus prime in our Kummer-type congruences is exactly the same as in the trigonometric function case (namely, Kummer's own congruence for the original Bernoulli numbers), and as in the elliptic function case (namely, H. Lang's extension for the Hurwitz numbers). However, in other past results on higher-genus algebraic functions, the modulus was at most half of its value in these classical cases. This contrast is clarified by investigating the analogue of the three properties above for the universal Bernoulli numbers. Bibliography: 34 titles.
Generalized Bernoulli-Hurwitz numbers and the universal Bernoulli numbers
Energy Technology Data Exchange (ETDEWEB)
Onishi, Yoshihiro [Faculty of Education Human Sciences, University of Yamanashi, Takeda, Kofu (Japan)
2011-10-31
The three fundamental properties of the Bernoulli numbers, namely, the von Staudt-Clausen theorem, von Staudt's second theorem, and Kummer's original congruence, are generalized to new numbers that we call generalized Bernoulli-Hurwitz numbers. These are coefficients in the power series expansion of a higher-genus algebraic function with respect to a suitable variable. Our generalization differs strongly from previous works. Indeed, the order of the power of the modulus prime in our Kummer-type congruences is exactly the same as in the trigonometric function case (namely, Kummer's own congruence for the original Bernoulli numbers), and as in the elliptic function case (namely, H. Lang's extension for the Hurwitz numbers). However, in other past results on higher-genus algebraic functions, the modulus was at most half of its value in these classical cases. This contrast is clarified by investigating the analogue of the three properties above for the universal Bernoulli numbers. Bibliography: 34 titles.
Digital Repository Service at National Institute of Oceanography (India)
Thamban, M.; Kawahata, H.; Rao, V.P.
., 2005). Recently a 11,000 yr reconstruction of sunspots using tree ring ∆ 14 C data revealed exceptional changes in sunspot activity within the Holocene (Solanki et al., 2004). Since sun is the principal source of energy, changes in solar energy output... seem to be stimulated by the sun, suggest- ing the importance of small changes in solar activity lead- ing to perceptible changes in monsoon conditions. Acknowledgements We thank the Directors of National Centre for Ant- arctic and Ocean Research (NCAOR...
Magneto-Fluid Dynamics Fundamentals and Case Studies of Natural Phenomena
Lorrain, Paul; Houle, Stéphane
2006-01-01
This book concerns the generation of electric currents and of electric space charges inside conducting media that move in magnetic fields. The authors postulate nothing but the Maxwell equations. They discuss at length the disk dynamo, which serves as a model for the natural self-excited dynamos that generate magnetic fields such as that of sunspots. There are 36 Examples and 13 Case Studies. The Case Studies concern solar phenomena -- magnetic elements, sunspots, spicules, coronal loops -- and the Earth's magnetic field.
Bennett, Ruth, Ed.; And Others
An introduction to the Hupa number system is provided in this workbook, one in a series of numerous materials developed to promote the use of the Hupa language. The book is written in English with Hupa terms used only for the names of numbers. The opening pages present the numbers from 1-10, giving the numeral, the Hupa word, the English word, and…
Approximation of complex algebraic numbers by algebraic numbers of bounded degree
Bugeaud, Yann; Evertse, Jan-Hendrik
2007-01-01
We investigate how well complex algebraic numbers can be approximated by algebraic numbers of degree at most n. We also investigate how well complex algebraic numbers can be approximated by algebraic integers of degree at most n+1. It follows from our investigations that for every positive integer n there are complex algebraic numbers of degree larger than n that are better approximable by algebraic numbers of degree at most n than almost all complex numbers. As it turns out, these numbers ar...
Diamond, Harold G; Cheung, Man Ping
2016-01-01
"Generalized numbers" is a multiplicative structure introduced by A. Beurling to study how independent prime number theory is from the additivity of the natural numbers. The results and techniques of this theory apply to other systems having the character of prime numbers and integers; for example, it is used in the study of the prime number theorem (PNT) for ideals of algebraic number fields. Using both analytic and elementary methods, this book presents many old and new theorems, including several of the authors' results, and many examples of extremal behavior of g-number systems. Also, the authors give detailed accounts of the L^2 PNT theorem of J. P. Kahane and of the example created with H. L. Montgomery, showing that additive structure is needed for proving the Riemann hypothesis. Other interesting topics discussed are propositions "equivalent" to the PNT, the role of multiplicative convolution and Chebyshev's prime number formula for g-numbers, and how Beurling theory provides an interpretation of the ...
Effect of surface roughness on grain growth and sintering of alumina
Indian Academy of Sciences (India)
Administrator
Variation in surface roughness properties are also correlated with grain size. Rz ... ceramic product having accurate size and shape with per- fect flatness .... Figure 1. Variation in Ra with temperature: (a) fine, (b) intermediate and (c) coarse.
Grešak, Rozalija
2015-01-01
The field of real numbers is usually constructed using Dedekind cuts. In these thesis we focus on the construction of the field of real numbers using metric completion of rational numbers using Cauchy sequences. In a similar manner we construct the field of p-adic numbers, describe some of their basic and topological properties. We follow by a construction of complex p-adic numbers and we compare them with the ordinary complex numbers. We conclude the thesis by giving a motivation for the int...
International Nuclear Information System (INIS)
Zirin, H.; Tanaka, K.
1981-01-01
We present data on magnetic transients (mgtr's) observed in flares on 1980 July 1 and 5 with Big Bear videomagnetograph (VMG). The 1980 July 1 event was a white light flare in which a strong bipolar mgtr was observed, and a definite change in the sunspots occurred at the time of the flare. In the 1980 July 5 flare, a mgtr was observed in only one polarity, and, although no sunspot changes occurred simultaneous with the flare, major spot changes occurred in a period of hours