WorldWideScience

Sample records for sulphate minerals aps

  1. Aluminium phosphate sulphate minerals (APS) associated with proterozoic unconformity-type uranium deposits: crystal-chemical characterisation and petrogenetic significance

    International Nuclear Information System (INIS)

    Gaboreau, St.

    2005-01-01

    Aluminium phosphate sulfate minerals (APS) are particularly widespread and spatially associated with hydrothermal clay alteration in both the East Alligator River Uranium Field (Northern Territory, Australia) and the Athabasca basin (Saskatchewan, Canada), in the environment of proterozoic unconformity-related uranium deposits (URUD). The purpose of this study is both: 1) to characterize the nature and the origin of the APS minerals on both sides of the middle proterozoic unconformity between the overlying sandstones and the underlying metamorphic basement rocks that host the uranium ore bodies, 2) to improve our knowledge on the suitability of these minerals to indicate the paleo-conditions (redox, pH) at which the alteration processes relative to the uranium deposition operated. The APS minerals result from the interaction of oxidising and relatively acidic fluids with aluminous host rocks enriched in monazite. Several APS-bearing clay assemblages and APS crystal-chemistry have also been distinguished as a function of the distance from the uranium ore bodies or from the structural discontinuities which drained the hydrothermal solutions during the mineralisation event. One of the main results of this study is that the index mineral assemblages, used in the recent literature to describe the alteration zones around the uranium ore bodies, can be theoretically predicted by a set of thermodynamic calculations which simulate different steps of fluid-rock interaction processes related to a downward penetrating of hyper-saline, oxidizing and acidic diagenetic fluids through the lower sandstone units of the basins and then into the metamorphic basement rocks. The above considerations and the fact that APS with different crystal-chemical compositions crystallized in a range of fO 2 and pH at which uranium can either be transported in solution or precipitated as uraninite in the host-rocks make these minerals not only good markers of the degree of alteration of the

  2. Aluminium phosphate sulphate minerals (APS) associated with proterozoic unconformity-type uranium deposits: crystal-chemical characterisation and petrogenetic significance; Les sulfates phosphates d'aluminium hydrates (APS) dans l'environnement des gisements d'uranium associes a une discordance proterozoique: caracterisation cristallochimique et signification petrogenetique

    Energy Technology Data Exchange (ETDEWEB)

    Gaboreau, St

    2005-07-01

    Aluminium phosphate sulfate minerals (APS) are particularly widespread and spatially associated with hydrothermal clay alteration in both the East Alligator River Uranium Field (Northern Territory, Australia) and the Athabasca basin (Saskatchewan, Canada), in the environment of proterozoic unconformity-related uranium deposits (URUD). The purpose of this study is both: 1) to characterize the nature and the origin of the APS minerals on both sides of the middle proterozoic unconformity between the overlying sandstones and the underlying metamorphic basement rocks that host the uranium ore bodies, 2) to improve our knowledge on the suitability of these minerals to indicate the paleo-conditions (redox, pH) at which the alteration processes relative to the uranium deposition operated. The APS minerals result from the interaction of oxidising and relatively acidic fluids with aluminous host rocks enriched in monazite. Several APS-bearing clay assemblages and APS crystal-chemistry have also been distinguished as a function of the distance from the uranium ore bodies or from the structural discontinuities which drained the hydrothermal solutions during the mineralisation event. One of the main results of this study is that the index mineral assemblages, used in the recent literature to describe the alteration zones around the uranium ore bodies, can be theoretically predicted by a set of thermodynamic calculations which simulate different steps of fluid-rock interaction processes related to a downward penetrating of hyper-saline, oxidizing and acidic diagenetic fluids through the lower sandstone units of the basins and then into the metamorphic basement rocks. The above considerations and the fact that APS with different crystal-chemical compositions crystallized in a range of fO{sub 2} and pH at which uranium can either be transported in solution or precipitated as uraninite in the host-rocks make these minerals not only good markers of the degree of alteration of the

  3. Origin and nature of the aluminium phosphate-sulfate minerals (APS) associated with uranium mineralization in triassic red-beds (Iberian Range, Spain)

    International Nuclear Information System (INIS)

    Marfil, R.; Iglesia, A. la; Estupinan, J.

    2013-01-01

    This study focuses on the mineralogical and chemical study of an Aluminium-phosphate-sulphate (APS) mineralization that occurs in a classic sequence from the Triassic (Buntsandstein) of the Iberian Range. The deposit is constituted by sandstones, mud stones, and conglomerates with arenaceous matrix, which were deposited in fluvial to shallow-marine environments. In addition to APS minerals, the following diagenetic minerals are present in the classic sequence: quartz, K-feldspar, kaolinite group minerals, illite, Fe-oxides-hydroxides, carbonate-sulphate cement-replacements and secondary uraniferous minerals. APS minerals were identified and characterized by optical microscopy, X-ray diffraction, scanning electron microscopy, and electron microprobe. Microcrystalline APS crystals occur replacing uraniferous minerals, associated with kaolinite, mica and filling pores, in distal fluvial-to-tidal arkoses-subarkoses. Given their Ca, Sr, and Ba contents, the APS minerals can be defined as a solid solution of crandallite- goyacite-gorceixite (0.53 Ca, 0.46 Sr and 0.01 Ba). The chemical composition, low LREE concentration and Sr > S suggest that the APS mineral were originated during the supergene alteration of the Buntsandstein sandstones due to the presence of the mineralizing fluids which causes the development of Ubearing sandstones in a distal alteration area precipitating from partially dissolved and altered detrital minerals. Besides, the occurrence of dickite associated with APS minerals indicates they were precipitated at diagenetic temperatures (higher than 80 degree centigrade), related to the uplifting occurred during the late Cretaceous post-rift thermal stage.(Author)

  4. Sulphate-bicarbonate mineral waters in the treatment of biliary and digestive tract diseases.

    Science.gov (United States)

    Fraioli, A; Menunni, G; Petraccia, L; Fontana, M; Nocchi, S; Grassi, M

    2010-01-01

    The authors point out the therapeutic properties of sulphate-bicarbonate mineral waters. After summarizing the general mechanism of action of mineral waters, the main indications of such waters in thermal treatment are examined including: biliary sand, biliary dyskinesia, functional dyspepsia, irritable colon, chronic primitive constipation. The dysfunctions of biliary and digestive tracts are growing, mainly in the affluent world, because of the increase for stress, dietary habits, modern life style. Now they affect from 2,4% of general population to 7% of men and 20% of women, according to different studies. Mineral waters can improve symptoms and care some physiopathological underlying mechanisms. Authors stress the efficacy of sulphate-bicarbonate mineral waters in the therapy of biliary dyskinesias, namely gallbladder hypokinesia and Oddi's sphincter spasm, caused by their content in SO4 = anion and Mg++ cation and related effects on paracrine-endocrine gastrointestinal system. In addition, they report the effects of sulphate-bicarbonate mineral waters in the lithogenic bile (sand bile), because of their diluting and washing activity. Among the sulphate-bicarbonate mineral waters, the Authors outline the well-documented therapeutic activity of Acqua Santa and Fucoli of Chianciano Terme. Acqua Santa has stimulating effect on cholecystis's motility, as proved by controlled clinical trials. Finally, the therapeutic use of sulphate-bicarbonate mineral water is discussed in functional dyspepsia, chronic primitive constipation and irritable bowel syndrome.

  5. Origin and nature of the aluminium phosphate-sulfate minerals (APS associated with uranium mineralization in triassic red-beds (Iberian Range, Spain

    Directory of Open Access Journals (Sweden)

    Marfil, R.

    2013-06-01

    Full Text Available This study focuses on the mineralogical and chemical study of an Aluminium–phosphate–sulphate (APS mineralization that occurs in a clastic sequence from the Triassic (Buntsandstein of the Iberian Range. The deposit is constituted by sandstones, mudstones, and conglomerates with arenaceous matrix, which were deposited in fluvial to shallow-marine environments. In addition to APS minerals, the following diagenetic minerals are present in the clastic sequence: quartz, K-feldspar, kaolinite group minerals, illite, Fe-oxides-hidroxides, carbonate-sulphate cement-replacements and secondary uraniferous minerals. APS minerals were identified and characterized by optical microscopy, X-ray diffraction, scanning electron microscopy, and electron microprobe. Microcrystalline APS crystals occur replacing uraniferous minerals, associated with kaolinite, mica and filling pores, in distal fluvial-to-tidal arkoses-subarkoses. Given their Ca, Sr, and Ba contents, the APS minerals can be defined as a solid solution of crandallite-goyacite-gorceixite (0.53 Ca, 0.46 Sr and 0.01 Ba. The chemical composition, low LREE concentration and Sr > S suggest that the APS mineral were originated during the supergene alteration of the Buntsandstein sandstones due to the presence of the mineralizing fluids which causes the development of U-bearing sandstones in a distal alteration area precipitating from partially dissolved and altered detrital minerals. Besides, the occurrence of dickite associated with APS minerals indicates they were precipitated at diagenetic temperatures (higher than 80ºC, related to the uplifting occurred during the late Cretaceous post-rift thermal stage.Este trabajo se centra en el estudio de los minerales fosfato-sulfato alumínicos (APS que se producenen una secuencia clástica del Triásico (Buntsandstein de la Cordillera Ibérica. El depósito está constituido por areniscas, lutitas y conglomerados con matriz arenosa, que fueron depositados en

  6. Biosedimentary and geochemical constraints on the precipitation of mineral crusts in shallow sulphate lakes

    Science.gov (United States)

    Cabestrero, Óscar; del Buey, Pablo; Sanz-Montero, M. Esther

    2018-04-01

    Seasonal desiccation of Mg2+-(Na+)-(Ca2+)-SO42--(Cl-) saline lakes in La Mancha (Central Spain) that host microbial mats led to the precipitation of hydrated Na-Mg sulphates and gypsum. Sulphates precipitated in the submerged conditions form extensive biolaminites, whilst in marginal areas they produce thin crusts. Sedimentological, mineralogical, petrographic and high resolution textural studies reveal that the crusts were formed within the benthic microbial mats that thrive at salinities ranging from 160 to 340 g·L-1. The minerals of the crusts are primary bloedite (Na2Mg(SO4)2·4H2O), epsomite (MgSO4·7H2O), gypsum (CaSO4·2H2O) and mirabilite (Na2SO4·10H2O), as well as secondary hexahydrite (MgSO4·6H2O) and thenardite (Na2SO4). Primary bloedite crystals, which form the framework of surficial and submerged crusts are seen to nucleate subaqueously and grow incorporatively within the matgrounds. Displacive and incorporative epsomite grows on previous bloedite crystals and also on the ground. Mirabilite is precipitated rapidly at the brine-air interface over bloedite and epsomite. Hexahydrite and thenardite are formed due to dehydration of epsomite and mirabilite, respectively. Hydrochemical modeling with PHREEQC indicated that evaporitic biolaminites are forming from brines undersaturated with respect to bloedite, epsomite and mirabilite, which suggests that the microorganisms contribute to the heterogeneous nucleation of the sulphates in the microbial mats. Unlike carbonates, the influence of microbes on the growth and morphology of complicated double salts such as bloedite has not been documented previously and provides a new perspective on the formation of hydrated sulphate minerals that are common on Earth as well as other planets.

  7. Bone mineral response to ammonium sulphate offered as a lick supplement in beef calves

    Directory of Open Access Journals (Sweden)

    L.E. Motsei

    2006-06-01

    Full Text Available Sixteen Bonsmara calves (4 males, 12 females between 10 and 18 months of age were blocked according to age and sex and randomly assigned to 2 groups. They were offered licks containing bone meal and salt (50:50 ratio (control and bone meal and ammonium sulphate (NH4SO4 at 1.25, 2.5, 5, 10, 15, and 18 % (treatment to evaluate the effects of dietary anions on bone phosphate (P concentration. Bone P concentration was significantly (P<0.05 higher in the NH4SO4 group compared with the control group, indicating that NH4SO4 was able to increase the P content of bone at each of the 6 concentrations used in the lick relative to the control animals, thereby improving the P status of the animals. Ammonium sulphate at 15% and 18% in the lick also significantly (P <0.05 increased bone P compared with the lower concentrations of NH4SO4. Bone calcium (Ca fluctuated as a result of the acidogenic lick. There was absorption of Ca when P was being resorbed and resorption of Ca when P was being absorbed into and out of bone. Bone Ca:P ratio ranged from 3.2 to 6.4 among the control group and 1.6 to 4.3 among the treatment group. Animals receiving the acidogenic lick had a higher percentage ash compared to the control group for most of the experimental period. Bone magnesium (Mg fluctuated in response to the acidogenic lick, and it was difficult to show a relationship between bone Mg and Ca or P. The overall mean cortical bone thickness was significantly (P < 0.05 greater in treatment (1.60 mm compared with control (1.43 mm calves and this was also true at sampling periods 2, 4, 5 and 6. Bone thickness followed bone P and not bone Ca. Results from this research indicate that the addition of ammonium sulphate to a lick had a beneficial effect in improving the P status by increasing bone P and improving the mineral status of bone by increasing the thickness of cortical bone and percentage ash.

  8. 77 FR 22622 - AP Henderson Group, BPO Management Services, Inc., Capital Mineral Investors, Inc...

    Science.gov (United States)

    2012-04-16

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION AP Henderson Group, BPO Management Services, Inc., Capital Mineral Investors, Inc., CardioVascular... concerning the securities of AP Henderson Group because it has not filed any periodic reports since the...

  9. Thermal decomposition and X-ray diffraction of sulphate efflorescent minerals from El Jaroso Ravine, Sierra Almagrera, Spain

    Energy Technology Data Exchange (ETDEWEB)

    Frost, Ray L. [Inorganic Materials Research Program, School of Physical and Chemical Sciences, Queensland University of Technology, GPO Box 2434, Brisbane, Queensland 4001 (Australia)]. E-mail: r.frost@qut.edu.au; Wain, Daria [Inorganic Materials Research Program, School of Physical and Chemical Sciences, Queensland University of Technology, GPO Box 2434, Brisbane, Queensland 4001 (Australia); Martens, Wayde N. [Inorganic Materials Research Program, School of Physical and Chemical Sciences, Queensland University of Technology, GPO Box 2434, Brisbane, Queensland 4001 (Australia); Locke, Ashley C. [Inorganic Materials Research Program, School of Physical and Chemical Sciences, Queensland University of Technology, GPO Box 2434, Brisbane, Queensland 4001 (Australia); Martinez-Frias, Jesus [Inorganic Materials Research Program, School of Physical and Chemical Sciences, Queensland University of Technology, GPO Box 2434, Brisbane, Queensland 4001 (Australia); Cristalografia y Mineralogia, Unidad Asociada al Centro de Astrobiologia INTA-CSIC, Universidad de Valladolid, 47006 Valladolid (Spain); Rull, Fernando [Inorganic Materials Research Program, School of Physical and Chemical Sciences, Queensland University of Technology, GPO Box 2434, Brisbane, Queensland 4001 (Australia); Cristalografia y Mineralogia, Unidad Asociada al Centro de Astrobiologia INTA-CSIC, Universidad de Valladolid, 47006 Valladolid (Spain)

    2007-08-25

    Two evaporite minerals from the El Jaroso Ravine, Spain have been analysed by thermogravimetry coupled with an evolved gas mass spectrometer. X-ray diffraction results proved the evaporite minerals were a mixture of sulphates including the minerals magnesiocopiapite, coquimbite and possibly alunogen. Thermal decomposition of the unoxidised samples showed steps at 52, 99 and 143 deg. C confirmed by mass spectrometric results and attributed to adsorbed water, interstitial water and chemically bonded water. This evaporite mineral rock showed two higher temperature decomposition steps at 555 and 599 deg. C with mass losses of 19.6 and 7.8%. Slightly different temperatures for the thermal decomposition of the oxadada sample were observed at 52, 64.5 and 100 deg. C. Two higher temperature mass loss steps at 560.5 and 651 deg. C were observed for the oxidised sample. By comparison of the thermal analysis patterns of halotrichite and jarosite it can be shown that the El Jaroso samples are mineral sulphates and not halotrichite or jarosite.

  10. Sources of sulphate minerals in limestone cave-a possible evidence of anthropogenic activity: a case study in Črna Jama Cave (Slovenia).

    Science.gov (United States)

    Jarc, Simona; Miler, Miloš; Šebela, Stanka; Zupančič, Nina

    2017-12-01

    In the caves, the formation of cave minerals is a consequence of a variety of chemical reactions, some of them also due to human activity. There are many caves in Slovenia, but sulphate minerals are not very often reported and analysed. In this study, the presence of sulphate minerals is detected by SEM/EDS analysis of speleothems from Črna Jama, a cave near Kočevje (southern Slovenia). The cave is characterised by its dark, almost black colour on cave walls, floor and speleothems. Anthropogenic influence in the cave is still visible, including the remains of a fireplace, some inscriptions on the walls and wooden containers. The analyses of some of the black-coated speleothems reveal the presence of calcium sulphate, confirmed by XRD as gypsum. Gypsum crystals are around 50 μm in size, and they occur in thin crusts. Additionally, some rare authigenic baryte crystals a few micrometres in size are detected. The sulphates δ 34 S value in gypsum found on dark coloured speleothems is + 10.4‰ Vienna Canyon Diablo Troilite (VCDT), while the sulphate δ 34 S of the bedrock is + 8.6‰ VCDT. The more likely source of sulphate ions is thus biomass burning rather than bedrock. Also, bedrock and biomass ash are a very probable source of calcium and barium. The highly probable pyrogenous origin of sulphates draws attention to human impact on cave mineralogy.

  11. Prediction of Mineral Scale Formation in Geothermal and Oilfield Operations using the Extended UNIQUAC Model. Part I: Sulphate Scaling Minerals

    DEFF Research Database (Denmark)

    Garcia, Ada V.; Thomsen, Kaj; Stenby, Erling Halfdan

    2005-01-01

    Pressure parameters are added to the Extended UNIQUAC model presented by Thomsen and Rasmussen (1999). The improved model has been used for correlation and prediction of solid-liquid equilibrium (SLE) of scaling minerals (CaSO4, CaSO4·2H2O, BaSO4 and SrSO4) at temperatures up to 300°C and pressur...

  12. Molecular characterization of the 30-AA N-terminal mineral interaction domain of the biomineralization protein AP7.

    Science.gov (United States)

    Kim, Il Won; Morse, Daniel E; Evans, John Spencer

    2004-12-21

    The AP7 protein is one of several mollusk shell proteins which are responsible for aragonite polymorph formation and stabilization within the nacre layer of the Pacific red abalone, H. rufescens. Previously, we demonstrated that the 30-AA N-terminal domain of AP7, denoted as AP7-1, exists as an unfolded sequence and possesses the capability of inhibiting calcium carbonate crystal growth in vitro via growth step frustration or interruption. However, very little is known with regard to the interactive capabilities of this sequence with Ca(II) and with calcium carbonates. Using multidisciplinary techniques, we determine that the AP7-1 polypeptide interacts with Ca(II) ions at the -DD- sequence clusters, yet retains its unfolded, conformationally labile structure in the presence of Ca(II) ions. Further, NMR experiments reveal that the extended structured sequence blocks, -GNGM-, -SVRTQG-, and -ISYL, exhibit motional, chemical exchange, and/or backbone geometry perturbations in response to Ca(II) interactions with AP7-1. Solid-state NMR magic angle spinning studies verify that during the course of in vitro calcium carbonate crystal growth, AP7-1 becomes bound to calcite fragments and cannot be entirely displaced from the mineral fragments using competitive Ca(II) washing. Finally, using a scrambled sequence version of the AP7-1 polypeptide, we observe that sequence scrambling does not adversely affect the crystal growth inhibitory activity of AP7-1, suggesting that the amino acid composition of AP7-1 may be more critical to growth step inhibition than the linear ordering of amino acids.

  13. The procedure for analysis of sulphur isotope ratio 34S/32S (δ34S) and determination of origin of dissolved sulphate in Thuan My mineral water

    International Nuclear Information System (INIS)

    Vo Tuong Hanh; Nguyen Hong Thinh; Nguyen Van Hoan; Nguyen Thi Thai; Ha Lan Anh; Dinh Bich Lieu

    2011-01-01

    An analytical procedure for sulphur isotope ratio in sulphate/sulphide (δ 34 S) dissolved in groundwater was developed. The procedure included: 1. SO 4 2- and S 2- precipitation by BaCl 2 and AgNO 3 , respectively; 2. sulphur isotope ratio (δ 34 S) analysis by continuous flow isotope ratio mass spectrometry (CF-IRMS) with on-line combustion of the sulphate/sulphide to form SO 2 . The δ 34 S in the dissolved sulfate of 33 deep (more than 30 m) wells, 20 shallow (less than 30 m) wells, in water from the Da river in the study area, the Hong river, the Hoa Binh lake, and the precipitation collected during both rainy and dry seasons in the Thuan My, Ha Noi and Lang Son regions, as well as in water waste samples were analyzed. The accuracy of the analysis was achieved by the participation in inter-comparison exercises and the precision of the δ 34 S value obtained was usually better than ±0.02%. The SO 4 2- concentration in water from the deep wells is from 674 to 2,197 mg/L and the δ 34 S values in the constituent are in a narrow range of from +1.566 to +1.773%. These values along with chemical data gathered for other constituents presented in the water allow one to explain the source of SO 4 2- in water from the deep wells to be from the dissolution of gypsum minerals (CaSO 4 .2H 2 O). (author)

  14. APS 6BM-B Large Volume High Pressure Beamline: A Workhorse for Rock and Mineral Physics

    Science.gov (United States)

    Chen, H.; Whitaker, M. L.; Baldwin, K. J.; Huebsch, W. R.; Vaughan, M. T.; Weidner, D. J.

    2017-12-01

    With the inheritance of decades of technical innovations at the NSLS X17B2 Beamline, APS 6BM-B Beamline was established in 2015 and is a dedicated beamline for synchrotron-based large volume high pressure research in earth sciences, especially rock and mineral physics. Currently a 250-ton hydraulic press equipped with a D-DIA module is installed and a Rotational Drickamer Apparatus from Yale University is hosted every cycle, covering a pressure range from crust to lower mantle. 6BM-B operates in white beam mode with an effective energy range of 20-100 keV. Energy dispersive X-ray diffraction data is collected using a 10-element solid state Ge array detector arranged in a circular geometry to allow for the real time assessment of stress. Direct radiographic imaging using Prosillica CCD camera and scintillating YAG crystals yields sample strain and strain rate. In addition to applications in phase transitions, equation of states measurements, sound velocity measurements, this setup is ideal for studies of steady state and dynamic deformation process. In this presentation, technical features and strengths of 6BM-B will be discussed. Most recent progress and science highlights of our user community will be showcased.

  15. Sulphate rocks as an arena for karst development

    Directory of Open Access Journals (Sweden)

    Andrejchuk V.

    1996-01-01

    Full Text Available The rocks in which karst systems develop are most commonly composed of carbonate sulphate and chloride minerals. The sulphate minerals are quite numerous, but only gypsum and anhydrite form extensive masses in sedimentary sequences. Other minerals, which represent sulphates of K, Mg and Na, normally occur as minor beds (0.1-5.0 m, or as inclusions associated with chloride rocks. However some minerals precipitated in salt-generating basins, such as mirabilite and glauberite (typically formed in the Kara-Bogaz-Gol Gulf, salt lakes of Siberia and in China, form sequences up to 5-10 m thick where karst may develop. Due to the very high solubility of Na -sulphates, karst processes and features occurring in these rocks resemble salt karst. Thus, the term sulphate karst, although not strictly correct, is used mainly to indicate karst developed in gypsum and anhydrite.

  16. Minerals

    Science.gov (United States)

    Minerals are important for your body to stay healthy. Your body uses minerals for many different jobs, including keeping your bones, muscles, heart, and brain working properly. Minerals are also important for making ...

  17. sodium dodecyl sulphate (SDS)

    Indian Academy of Sciences (India)

    Unknown

    sodium dodecyl sulphate, SDS) showed a marked effect, although there are some reports where cationic (cetyl trimethyl ammonium bromide, CTAB) and neutral (Triton X-100) surfactants have also shown changes in the. *For correspondence ...

  18. The soil sulphate effect and maize plant (Zea mays L.) growth of sulphate reducing bacteria (SRB) inoculation in acid sulfate soils with the different soil water condition

    Science.gov (United States)

    Asmarlaili, S.; Rauf, A.; Hanafiah, D. S.; Sudarno, Y.; Abdi, P.

    2018-02-01

    The objective of the study was to determine the potential application of sulphate reducing bacteria on acid sulfate soil with different water content in the green house. The research was carried out in the Laboratory and Green House, Faculty of Agriculture, Universitas Sumatera Utara. This research used Randomized Block Design with two treatments factors, ie sulphate reducing bacteria (SRB) isolate (control, LK4, LK6, TSM4, TSM3, AP4, AP3, LK4 + TSM3, LK4 + AP4, LK4 + AP3, LK6 + TSM3, LK6 + AP4, LK6 + AP3, TSM4 + TSM3, TSM4 + AP4, TSM4 + AP3) and water condition (100% field capacity and 110% field capacity). The results showed that application of isolate LK4 + AP4 with water condition 110% field capacity decreased the soil sulphate content (27.38 ppm) significantly after 6 weeks. Application of isolate LK4 + AP3 with water condition 110% field capacity increased soil pH (5.58) after-week efficacy 6. Application of isolate LK4 with water condition 110% field capacity increased plant growth (140 cm; 25.74 g) significantly after week 6. The best treatment was application isolate LK4 with water condition 110% field Capacity (SRB population 2.5x108; soil sulphate content 29.10ppm; soil acidity 4.78; plant height 140cm; plant weight 25.74g).

  19. Minerals

    Science.gov (United States)

    ... bit of each one. Trace minerals includes iron, manganese, copper, iodine, zinc, cobalt, fluoride, and selenium. Let's take a closer look at some of the minerals you get from food. Calcium Calcium is the top macromineral when it comes to your bones. This mineral helps build strong bones, so you ...

  20. Bacterial Reduction Of Barium Sulphate By Sulphate-Reducing Bacteria

    Directory of Open Access Journals (Sweden)

    Luptáková Alena

    2015-12-01

    Full Text Available Acid mine drainage (AMD is a worldwide problem leading to contamination of water sources. AMD are characterized by low pH and high content of heavy metals and sulphates. The barium salts application presents one of the methods for the sulphates removing from AMD. Barium chloride, barium hydroxide and barium sulphide are used for the sulphates precipitation in the form of barium sulphate. Because of high investment costs of barium salts, barium sulphide is recycled from barium sulphate precipitates. It can be recycled by thermic or bacterial reduction of barium sulphate. The aim of our study was to verify experimentally the possibility of the bacterial transformation of BaSO4 to BaS by sulphate-reducing bacteria. Applied BaSO4 came from experiments of sulphates removal from Smolnik AMD using BaCl2.

  1. Got AP?

    Science.gov (United States)

    Digby, Joan

    2016-01-01

    Families, especially those considering sending their children to a private four-year university, need all the help they can get in funding college. Annmarie Guzy's essay "AP, Dual Enrollment, and the Survival of Honors Education" in this issue powerfully spells out the financial benefits that accrue from using AP courses to satisfy…

  2. Minerals

    Directory of Open Access Journals (Sweden)

    Vaquero, M. P.

    1998-08-01

    Full Text Available The possible changes in the mineral composition of food during frying could be the consequence of losses by leaching, or changes in concentrations caused by exchanges between the food and culinary fat of other compounds. The net result depends on the type of food, the frying fat used and the frying process. Moreover, the modifications that frying produces in other nutrients could indirectly affect the availability of dietary minerals. The most outstanding ones are those that can take place in the fat or in the protein. With respect to the interactions between frying oils and minerals, we have recent knowledge concerning the effects of consuming vegetable oils used in repeated fryings of potatoes without turnover, on the nutritive utilization of dietary minerals. The experiments have been carried out in pregnant and growing rats, which consumed diets containing, as a sole source of fat, the testing frying oils or unused oils. It seems that the consumption of various frying oils, with a polar compound content lower or close to the maximum limit of 25% accepted for human consumption, does not alter the absorption and metabolism of calcium, phosphorous, iron or copper. Magnesium absorption from diets containing frying oils tends to increase but the urinary excretion of this element increases, resulting imperceptible the variations in the magnesium balance. The urinary excretion of Zn also increased although its balance remained unchanged. Different studies referring to the effects of consuming fried fatty fish on mineral bioavailability will also be presented. On one hand, frying can cause structural changes in fish protein, which are associated with an increase in iron absorption and a decrease in body zinc retention. The nutritive utilization of other elements such as magnesium, calcium and copper seems to be unaffected. On the other hand; it has been described that an excess of fish fatty acids in the diet produces iron depletion, but when fatty

  3. Volcanic lake systems as terrestrial analogue for sulphate-rich terrains on Mars

    NARCIS (Netherlands)

    Rodríguez, A.

    2016-01-01

    Remote-sensing observations and rover missions have documented the abundant presence of sulphate-rich mineral associations on the surface of Mars. Together with widespread occurrences of silica and frequent enrichments of chlorine and bromine in soils and rocks, the sulphate associations are

  4. Investigation of sulphate origins in the Jeffara aquifer, southeastern ...

    Indian Academy of Sciences (India)

    Gypsum, anhydrite, mirabilite and thenardite have been examined as potential sources of sulphate dissolved in groundwater. Since Jeffara groundwater is recharged by the Continental Intercalaire (CI) geothermal water, water temperature decreases from the CI to the Jeffara aquifer. Solubility of the majority of minerals is ...

  5. Fumarolic minerals

    DEFF Research Database (Denmark)

    Balic Zunic, Tonci; Garavelli, Anna; Jakobsson, Sveinn Peter

    2016-01-01

    The fumarolic mineralogy of the Icelandic active volcanoes, the Tyrrhenian volcanic belt (Italy) and the Aegean active arc (Greece) is investigated, and literature data surveyed in order to define the characteristics of the European fumarolic systems. They show broad diversity of mineral associat......The fumarolic mineralogy of the Icelandic active volcanoes, the Tyrrhenian volcanic belt (Italy) and the Aegean active arc (Greece) is investigated, and literature data surveyed in order to define the characteristics of the European fumarolic systems. They show broad diversity of mineral...... associations, with Vesuvius and Vulcano being also among the world localities richest in mineral species. Volcanic systems, which show recession over a longer period, show fumarolic development from the hightemperature alkaline halide/sulphate, calcic sulphate or sulphidic parageneses, synchronous...... with or immediately following the eruptions, through mediumtemperature ammonium minerals, metal chlorides, or fluoride associations to the late low-temperature paragenesis dominated by sulphur, gypsum, alunogen, and other hydrous sulphates. The situation can be different in the systems that are not recessing but show...

  6. Pathways of assimilatory sulphate reduction in plants and microorganisms.

    Science.gov (United States)

    Schiff, J A

    1979-01-01

    Assimilatory sulphate reduction, largely restricted to plants and microorganisms where it provides reduced sulphur for the formation of amino acids and proteins, nucleic acids, and various sulphur-containing coenzymes, begins with the activation of sulphate through reaction with ATP to form adenosine 5'-phosphosulphate (APS) and adenosine 3'-phosphate 5'-phosphosulphate (PAPS). Two pathways of assimilatory sulphate reduction are known. One, found in some blue-green algae (cyanobacteria) and in all oxygen-envolving eukaryotes, begins with APS where the sulpho group is transferred via APS sulphotransferase to a thiol acceptor (glutathione (G-S-) in Chlorella) to form the organic thiosulphate (G-S-SO-3). The organic thiosulphate appears to be reduced further by an organic thiosulphate reductase employing reduced ferredoxin to form G-S-S-. The terminal sulphur is then thought to be reductively transferred to O-acetylserine via O-acetylserine sulphydrase to form cysteine. A second pathway, found in bacteria and fungi, begins with PAPS where the sulpho group is transferred via PAPS sulphotransferase to an acceptor thiol to form an organic thiosulphate. Since thioredoxin is indispensable, this molecule may be the carrier or may serve to reduce the carrier. NADPH via thioredoxin reductase or glutathione and glutathione reductase reduces thioredoxin. These reactions release sulphite which is further reduced to sulphide by sulphite reductase, employing NADPH. Sulphide is then thought to react with O-acetylserine to form cysteine via O-acetylserine sulphydrase. The cellular location and evolution of these pathways is discussed.

  7. Dynamics of nitrogen in an oxic paleudalf soil with the incorporation of 15N-tagged organic nitrogen (maize straw) and 15N-tagged mineral nitrogen (ammonium sulphate)

    International Nuclear Information System (INIS)

    Freitas, J.R. de.

    1984-12-01

    An experiment, carried out under field conditions in 12 lysimeters, each containing 3.0 ton of Oxic Paleudalf soil with four replicates, is described. This objective is labelling soil organic N. Nitrogen was incorporated into soil as maize straw, non-labelled and labelled with 15 N and ammonium sulphate - 15 N. The soil was sampled every 15 days in three different depths. N as NH + 4 , NO - 3 , total-N and (%)C and (%) moisture was analysed. (M.A.C.) [pt

  8. AMENABILITY OF ap (S)

    OpenAIRE

    A.M. Aminpour; Mehrdad Seilani

    2013-01-01

    In this paper, we present an important new theorem for amenability of ap(S). The set of all almost periodic functions on S is denoted by ap(S). We develop the fundamental theory of almost periodic function on a general semitopological semigroup. The principal result is that ap(S) is amenable if and only if ap(S) = Sap(S) ⊕ F0 [Theorem 3.1]. Mathematical society classification:2010 MSC. 18340

  9. Removal heavy metals and sulphate from waste waters by sulphate-reducing bacteria

    Directory of Open Access Journals (Sweden)

    Kušnierová Mária

    2000-09-01

    Krompachy by use of the activity of SRB, mixed strains were isolated, cultivated, and their production of hydrogen sulphide was assessed. The cultures were then tested for the ability to precipitate copper and sulphates from a model solution.The bacteria were isolated from water samples from two localities: Východoslovenské železiarne (works – VSŽ and spring Gajdovka – Gj. Isolation, cultivation and eliminating Cu2+ and SO42- was carried out under following conditions: statically, temperature 30 oC, pH 7,5, nutrient medium by J. Postgate (medium B, C and D and anaerobic conditions. Residual copper in the solution was measured by atomic absorption photometry. The concentracion of sulphates in the solution was measured by the nefelometric method.Our findings from the isolation of SRB from two Slovak water samples and testing the cultures for their ability to remove copper permit the following conclusions: SRB occur in sufficient numbers in sulphur mineral water from natural sources and in industrial waste waters reservoirs, the sulphate-reducing activity can be harnessed for the purification of some industrial waste waters.The nature possesses a great biological potential that can be exploited under certain conditions in the cleanup of environmental pollution resulting from the industrial activity in the past and present.

  10. Sulphate solubility and sulphate diffusion in oxide glasses: implications for the containment of sulphate-bearing nuclear wastes

    International Nuclear Information System (INIS)

    Lenoir, M.

    2009-09-01

    The thesis deals with sulphate solubility and sulphate diffusion in oxide glasses, in order to control sulphate incorporation and sulphate volatilization in nuclear waste glasses. It was conducted on simplified compositions, in the SiO 2 -B 2 O 3 -R 2 O (R = Li, Na, K, Cs), SiO 2 -B 2 O 3 -BaO and V 2 O 5 -B 2 O 3 -BaO systems. These compositions allowed us to study the influence of the nature of network-modifying ions (Li + , Na + , K + , Cs + or Ba 2+ ) and also of former elements (Si, B, V), on structure and properties of glasses. Sulphate volatility is studied in sodium borosilicate melts using an innovative technique of sulphate quantitation with Raman spectroscopy. This technique is useful to obtain kinetic curves of sulphate volatilization. The establishment of a model to fit these curves leads to the determination of diffusion coefficients of sulphate. These diffusion coefficients can thus be compared to diffusion coefficients of other species, determined by other techniques and presented in the literature. They are also linked to diffusion coefficients in relation with the viscosity of the melts. Concerning sulphate solubility in glasses, it depends on glass composition and on the nature of sulphate incorporated. Sulphate incorporation in alkali borosilicate glasses leads to the formation of a sulphate layer floating on top of the melt. Sulphate incorporation in barium borosilicate and boro-vanadate glasses leads to the crystallization of sulphate species inside the vitreous matrix. Moreover, sulphate solubility is higher in these glasses than in alkali borosilicates. Finally, exchanges between cations present in glasses and cations present in the sulphate phase are also studied. (author)

  11. Study of the sulphate expansion phenomenon in concrete: behaviour of the cemented radioactive wastes containing sulphate

    International Nuclear Information System (INIS)

    Li, Guanshu

    1994-01-01

    Sulphate attack is one of the major degradation processes of concrete. It is especially important in storing cemented radioactive wastes containing sulphate. In this thesis, we have thoroughly investigated the degradation mechanisms of cemented radioactive wastes by sulphate. The CaO-Al 2 O 3 -SO 3 -H 2 O systems with and without alkalis are studied. For the system without alkalis, experimental results show that it is the formation of a secondary ettringite under external water supply by steric effect that causes the expansion. For the system with alkalis, the ettringite does not appear while a new mineral called 'U', a sodium-substituted AFm phase is detected. This phase is shown to be responsible for the expansion and destruction of the specimens. The conditions for the formation, the product of solubility and many means of its synthesis are discussed, and a complete list of the inter-reticular distances file is given. The behaviour of the different types of cemented wastes containing sulphate are then studied with a special focus on the U phase on entity which was heretofore very little understood. The following three hypothetical mechanisms of sulphate expansion are proposed: the formation of the secondary U phase, the transformation of the U phase to the ettringite and the topochemical hydration of thenardite into mirabilite. Experiments on a simplified system have demonstrated clearly that the formation of the secondary U phase can induce enormous expansion by steric effect, this justifying the first assumption. Simulation by the mass and volume balances is carried out thereafter and enables us to estimate the expansion induced by the formation of the secondary U phase in the cemented wastes. The second assumption is also well verified by a series of leaching tests in different solutions on mixtures containing the U phase. On the basis of the analysis of the specimens under leaching, it has been assumed that the expansion is associated with the

  12. Sulphate reduction experiment: SURE-1

    International Nuclear Information System (INIS)

    Pedersen, K.; Arlinger, J.; Bengtsson, A.; Edlund, J.; Eriksson, L.; Hallbeck, L.; Johansson, J.; Paeaejaervi, A.; Rabe, L.

    2013-11-01

    It was previously concluded that opposing gradients of sulphate and methane, observations of 16S rDNA sequences displaying great similarity to those of anaerobic methane-oxidizing Archaea, and a peak in sulphide concentration in groundwater from a depth of 250-350 m in Olkiluoto, Finland, indicated proper conditions for methane oxidation with sulphate. In the present research (SURE-1), pressure-resistant, gas-tight circulating systems were constructed to enable the investigation of attached and unattached anaerobic microbial populations from a depth of 327 m in Olkiluoto under in situ pressure (2.4 MPa), diversity, dissolved gas, and hydrochemical conditions of groundwater station ONKPVA6. Three parallel flow cell cabinets were configured to allow observation of the influence on microbial metabolic activity of 11 mM methane, 11 mM methane plus 10 mM H 2 , or 2.1 mM O 2 plus 7.9 mM N 2 (i.e., air). The concentrations of these gases and of organic acids and carbon, sulphur chemistry, pH and E h , ATP, numbers of cultivable microorganisms, and total numbers of cells and bacteriophages were subsequently recorded under batch conditions for 105 d. The system containing H 2 and methane displayed microbial reduction of 0.7 mM sulphate to sulphide, while the system containing only methane produced 0.2 mM reduced sulphate. The system containing added air became inhibited and displayed no signs of microbial activity. Added H 2 and methane induced increasing numbers of lysogenic bacteriophages per cell. It appears possible that a microbial anaerobic methane-oxidizing process coupled to acetate formation and sulphate reduction may be ongoing in aquifers at a depth of 250-350 m in Olkiluoto, but clear evidence of such an AOM process was not obtained. (orig.)

  13. Sulphate reduction experiment: SURE-1

    Energy Technology Data Exchange (ETDEWEB)

    Pedersen, K.; Arlinger, J.; Bengtsson, A.; Edlund, J.; Eriksson, L.; Hallbeck, L.; Johansson, J.; Paeaejaervi, A.; Rabe, L. [Microbial Analytics Sweden AB, Moelnlycke (Sweden)

    2013-11-15

    It was previously concluded that opposing gradients of sulphate and methane, observations of 16S rDNA sequences displaying great similarity to those of anaerobic methane-oxidizing Archaea, and a peak in sulphide concentration in groundwater from a depth of 250-350 m in Olkiluoto, Finland, indicated proper conditions for methane oxidation with sulphate. In the present research (SURE-1), pressure-resistant, gas-tight circulating systems were constructed to enable the investigation of attached and unattached anaerobic microbial populations from a depth of 327 m in Olkiluoto under in situ pressure (2.4 MPa), diversity, dissolved gas, and hydrochemical conditions of groundwater station ONKPVA6. Three parallel flow cell cabinets were configured to allow observation of the influence on microbial metabolic activity of 11 mM methane, 11 mM methane plus 10 mM H{sub 2}, or 2.1 mM O{sub 2} plus 7.9 mM N{sub 2} (i.e., air). The concentrations of these gases and of organic acids and carbon, sulphur chemistry, pH and E{sub h}, ATP, numbers of cultivable microorganisms, and total numbers of cells and bacteriophages were subsequently recorded under batch conditions for 105 d. The system containing H{sub 2} and methane displayed microbial reduction of 0.7 mM sulphate to sulphide, while the system containing only methane produced 0.2 mM reduced sulphate. The system containing added air became inhibited and displayed no signs of microbial activity. Added H{sub 2} and methane induced increasing numbers of lysogenic bacteriophages per cell. It appears possible that a microbial anaerobic methane-oxidizing process coupled to acetate formation and sulphate reduction may be ongoing in aquifers at a depth of 250-350 m in Olkiluoto, but clear evidence of such an AOM process was not obtained. (orig.)

  14. Magnesium sulphate for fetal neuroprotection

    DEFF Research Database (Denmark)

    Bickford, Celeste D; Magee, Laura A; Mitton, Craig

    2013-01-01

    BACKGROUND: The aim of this study was to assess the cost-effectiveness of administering magnesium sulphate to patients in whom preterm birth at ... sensitivity analyses were used to compare the administration of magnesium sulphate with the alternative of no treatment. Two separate cost perspectives were utilized in this series of analyses: a health system and a societal perspective. In addition, two separate measures of effectiveness were utilized: cases...... of cerebral palsy (CP) averted and quality-adjusted life years (QALYs). RESULTS: From a health system and a societal perspective, respectively, a savings of $2,242 and $112,602 is obtained for each QALY gained and a savings of $30,942 and $1,554,198 is obtained for each case of CP averted when magnesium...

  15. Sulphate removal from uraniferous liquors

    International Nuclear Information System (INIS)

    Berger, B.

    1983-01-01

    A process for the recovery of uranium from liquor resulting from the attack of sulphur containing uraniferous ores by an alkaline solution of sodium carbonate and/or sodium bicarbonate is claimed. An ion exchange resin is used to separate the uranium from the solution of sodium carbonate and/or bicarbonate and sodium sulphate. The ion exchange resin is then eluted with a solution of ammonium carbonate and/or bicarbonate to provide an eluate containing ammonium uranyl tricarbonate, ammonium carbonate and/or bicarbonate and ammonium sulphate. The eluate is heated to boiling to convert the ammonium uranyl tricarbonate to ammonium uranate and/or diuranate. Ammonia, carbon dioxide and water vapor are released. The precipitated ammonium uranate and/or diuranate is separated from the remaining liquor and calcined to give uranium trioxide

  16. Intoxication experiments with beryllium sulphate

    International Nuclear Information System (INIS)

    Bucurescu, I.; Stan, T.

    1990-01-01

    The changes in the particular number of animals in two groups of 40 rats each subjected to intoxication experiments with beryllium sulphate was investigated. The two investigations had very different characteristics. In the case of chronic intoxication there was a marked lethality over given time intervals. In the case of subacute intoxication the number of animals decreased with time. It was found empirically that this change can be described by an exponential relationship which lends itself to statistical interpretation. (author)

  17. Sulphate reduction in the Aespoe HRL tunnel

    International Nuclear Information System (INIS)

    Gustafson, G.; Pedersen, K.; Tullborg, E.L.; Wallin, B.; Wikberg, P.

    1995-12-01

    Evidence and indications of sulphate reduction based on geological, hydrogeological, groundwater, isotope and microbial data gathered in and around the Aespoe Hard Rock Laboratory tunnel have been evaluated. This integrated investigation showed that sulphate reduction had taken place in the past but is most likely also an ongoing process. Anaerobic sulphate-reducing bacteria can live in marine sediments, in the tunnel sections under the sea and in deep groundwaters, since there is no access to oxygen. The sulphate-reducing bacteria seem to thrive when the Cl - concentration of the groundwater is 4000-6000 mg/l. Sulphate reduction is an in situ process but the resulting hydrogen-sulphide rich water can be transported to other locations. A more vigorous sulphate reduction takes place when the organic content in the groundwater is high (>10 mg/l DOC) which is the case in the sediments and in the groundwaters under the sea. Some bacteria use hydrogen as an electron donor instead of organic carbon and can therefore live in deep environments where access to organic material is limited. The sulphate-reducing bacteria seem to adapt to changing flow situations caused by the tunnel construction relatively fast. Sulphate reduction seems to have occurred and will probably occur where conditions are favourable for the sulphate-reducing bacteria such as anaerobic brackish groundwater with dissolved sulphate and organic carbon or hydrogen. 59 refs, 37 figs, 6 tabs

  18. [Magnesium sulphate for the management of preeclampsia].

    Science.gov (United States)

    Rozenberg, P

    2006-01-01

    In case of eclampsia, and especially in case of preeclampsia, no consensus exist in order to treat or to prevent convulsions by routine use of magnesium sulphate, at least in France. However, a large, multicentre, randomised trial compared the efficacy of magnesium sulphate with diazepam or phenytoin in eclamptic women. In this trial, magnesium sulphate was associated with a significantly lower rate of recurrent seizures and lower rate of maternal death than that observed with other anticonvulsants. The primary objective of magnesium sulphate prophylaxis in women with preeclampsia is to prevent or reduce the rate of eclampsia and complications associated with eclampsia. There are 3 large randomised controlled trials comparing the use of magnesium sulphate to prevent convulsions in patients with severe preeclampsia: the first one was vs phenytoin, the second vs placebo, and the third vs nimodipine. Patients receiving magnesium sulphate presented a significant lower risk of eclampsia than that observed with other comparison groups, probably by decreasing the cerebral perfusion pressure, thus avoiding a cerebral barotrauma. However, several arguments balance a wide use of magnesium sulphate: the prevalence of eclampsia in the Western world is very low, the use of magnesium sulphate does not affect the neonatal morbidity and mortality, and it is associated with a high rate of side effects, sometimes severe, such as respiratory depression. Thus, the benefit to risk ratio has to guide the use of magnesium sulphate and is directly correlated to the prevalence of eclampsia according to the risk of considered group. 1) The rate of seizures in women with mild preeclampsia not receiving magnesium sulphate is very low. Magnesium sulphate may potentially be associated with a higher number of adverse maternal effects. Therefore, the benefit to risk ratio does not support routine use of magnesium sulphate prophylaxis in this group. 2) On the other hand, the higher rate of

  19. The Metal And Sulphate Removal From Mine Drainage Waters By Biological-Chemical Ways

    Directory of Open Access Journals (Sweden)

    Jenčárová Jana

    2015-06-01

    Full Text Available Mine drainage waters are often characterized by high concentrations of sulphates and metals as a consequence of the mining industry of sulphide minerals. The aims of this work are to prove some biological-chemical processes utilization for the mine drainage water treatment. The studied principles of contamination elimination from these waters include sulphate reduction and metal bioprecipitation by the application of sulphate-reducing bacteria (SRB. Other studied process was metal sorption by prepared biogenic sorbent. Mine drainage waters from Slovak localities Banská Štiavnica and Smolník were used to the pollution removal examination. In Banská Štiavnica water, sulphates decreased below the legislative limit. The elimination of zinc by sorption experiments achieved 84 % and 65 %, respectively.

  20. Removal of sulphates from waste waters by sulphate-reducing bacteria

    Directory of Open Access Journals (Sweden)

    Luptáková Alena

    2002-03-01

    Full Text Available are present in almost all types of water, usually as a simple anion SO42-. The sulphates together with hydrogencarbonates and chlorides are principal anions in natural waters. In typical underground and surface waters, the concentration of sulphates is in the range from ten to hundreds milligrams per litre.Nowadays, the importance of the control of sulphate concentration in waste waters increases. According to the Slovak legislation the limit concentration of sulphates in surface and drinking waters is 250 mg.l-1 . In rivers the contents of sulphates increases mainly by the discharge of waste waters, which are coming mainly from chemical, textile, metallurgical, pharmaceutical, paper and mining industry. The concentration of sulphates in these waters is in the order of grams per litre.Many technologies for the sulphates removal from waste waters exist, including biologico-chemical processes. The principle of one of these methods is the reduction of sulphates by sulphate-reducing bacteria to hydrogen-sulphide.The objective of this work was to study the effect of initial sulphates concentration on the activity of anaerobic sulphate reducers as well as the kinetics of the anaerobic sulphate reduction. The batch reactor was used at temperature of 30°C and pH 7,5. Lactate was used as the carbon source.

  1. Anticoagulant property of sulphated polysaccharides extracted from ...

    African Journals Online (AJOL)

    The marine brown algae: Sargassum tenerrimum, Sargassum wightii, Turbinaria conoides, Turbinaria ornata and Padina tetrastromatica were collected from Mandapam Island, India. The crude sulphated polysaccharides (SPS) were extracted using hot water and examined for anticoagulation activity. The sugar, sulphate ...

  2. Improved sulphate removal rates at increased sulphide ...

    African Journals Online (AJOL)

    The product of the biological sulphate reduction is sulphide. High concentrations of molecular H2S (g) can be inhibitory for microbial activity, especially at a reactor pH of 6 to 7. This paper focuses on the effect of high sulphide concentrations on the sulphate reduction rates. The results of three investigations operating a ...

  3. Ferrous sulphate interacts with captopril

    Science.gov (United States)

    Schaefer, J P; Tam, Y; Hasinoff, B B; Tawfik, S; Peng, Y; Reimche, L; Campbell, N R C

    1998-01-01

    Aims To determine if iron binds strongly to captopril and reduces captopril absorption. Methods A variety of in vitro experiments was conducted to examine iron binding to captopril and a randomized, double-blind, placebo controlled, cross-over study design was used to assess the in vivo interaction. Captopril (25 mg) was coingested with either ferrous sulphate (300 mg) or placebo by seven healthy adult volunteers. Subjects were phlebotomized and had blood pressure measured at 0, 0.25, 0.5, 1, 2, 4, 6, 8, and 12 h post ingestion. A 1 week washout period was used. Results The coingestion of ferrous sulphate and captopril was associated with a 37% (134 ng ml−1 h, 95% CI 41–228 ng ml−1 h, P=0.03) decrease in area under the curve (AUC) for unconjugated plasma captopril. There were no substantial changes in Cmax (mean difference;–32; 95% CI −124–62 ng ml−1(P=0.57)) or in tmax (mean difference; 0; 95% CI −18–18 min (P=0.65)) for unconjugated captopril when captopril was ingested with iron. There was a statistically insignificant increase in AUC for total plasma captopril of 43% (1312 ng ml−1 h, 95% CI −827–3451 ng ml−1 h P=0.27) when captopril was ingested with iron. The addition of ferric chloride to captopril resulted in the initial rapid formation of a soluble blue complex which rapidly disappeared to be replaced by a white precipitant. The white precipitate was identified as captopril disulphide dimer. There were no significant differences in systolic and diastolic blood pressures between the treatment and placebo groups. Conclusions Co-administration of ferrous sulphate and iron results in decreased unconjugated captopril levels likely due to a chemical interaction between ferric ion and captopril in the gastrointestinal tract. Care is required when coprescribing captopril and iron salts. PMID:9803987

  4. Extraction of sulphates by long chain amines

    International Nuclear Information System (INIS)

    Boirie, Ch.

    1959-05-01

    The extraction of sulphuric acid by long chain amines in organic solution has been studied with a view to determining the value of the stability constants of the amine sulphates and bi-sulphates formed. We have concentrated chiefly on uranium sulphate and thorium sulphate. The formulae of the complexes extractable with amines have been established, as well as the corresponding dissociation constants. We have observed that for uranium sulphate the formula of the complex depends only on the nature of the amine, whereas for thorium this formula varies with the amine structure. From the formulae determined and the value of the constants calculated, we have been able to establish the best conditions for uranium and thorium extraction and also for a separation of these two elements. Finally we propose an application of this study to the determination of uranium in ores, where the separation of uranium by this method is particularly easy and complete. (author) [fr

  5. AP Music Theory Applied

    Science.gov (United States)

    Spieker, Matthew H.

    2016-01-01

    Some American high schools include Advanced Placement (AP) Music Theory within their course offerings. Students who pass the AP exam can receive college credit either as a music or humanities credit. An AP class, however, offers music students more than future college credit; it ultimately improves musicianship skills and promotes deeper…

  6. Vibrational spectroscopic study of sulphated silk proteins

    Science.gov (United States)

    Monti, P.; Freddi, G.; Arosio, C.; Tsukada, M.; Arai, T.; Taddei, P.

    2007-05-01

    Degummed Bombyx mori ( B. m.) silk fibroin fabric and mutant naked pupa cocoons (Nd-s) consisting of almost pure silk sericin were treated with chlorosulphonic acid in pyridine and investigated by FT-IR and FT-Raman spectroscopies. Untreated silk fibroin and sericin displayed typical spectral features due to characteristic amino acid composition and molecular conformation (prevailing β-sheet with a less ordered structure in sericin). Upon sulphation, the degree of molecular disorder increased in both proteins and new bands appeared. The IR bands at 1049 and 1014 cm -1 were attributed to vibrations of sulphate salts and that at 1385 cm -1 to the νasSO 2 mode of organic covalent sulphates. In the 1300-1180 cm -1 range various contributions of alkyl and aryl sulphate salts, sulphonamides, sulphoamines and organic covalent sulphates, fell. Fibroin covalently bound sulphate groups through the hydroxyl groups of tyrosine and serine, while sericin through the hydroxyl groups of serine, since the δOH vibrations at 1399 cm -1 in IR and at 1408 cm -1 in Raman disappeared almost completely. Finally, the increase of the I850/ I830 intensity ratio of Raman tyrosine doublet in fibroin suggested a change towards a more exposed state of tyrosine residues, in good agreement with the more disordered conformation taken upon sulphation.

  7. ESR dosimetry with magnesium sulphate

    International Nuclear Information System (INIS)

    Morton, J.R.; Ahlers, F.J.; Schneider, C.C.J.

    1993-01-01

    The aim of the investigation is to enhance the ESR dosemeter sensitivity in the therapy dose range below 10 Gy, where the ESR spectrum of the α-alanine radical becomes increasingly difficult to evaluate for dosimetry. Anhydrous magnesium sulphate, MgSO 4 , appears to be an excellent candidate from the spectrometric point of view. On irradiation with 60 Co γ rays, the stable radical SO 3 - is produced whose ESR signal amplitude increases linearly with dose up to about 10 5 Gy. Ignoring the abundant isotopes 17 O (0.04%) and 33 S (0.74%), the spectrum of SO 3 - is a single line at g = 2.0036 of width 0.5 mT which is stable at temperatures up to at least 120 o C. Using the conventional peak-to-peak method of dosimeter readout, the MgSO 4 dosemeter is somewhat more sensitive than the traditional alanine dosemeter of the same mass. Its main advantage over the alanine dosemeter is, however, the ease of computer enhancement and the possibility of integration which the single-line spectrum offers. (author)

  8. Advanced Photon Source (APS)

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Photon Source (APS) at the U.S. Department of Energy's Argonne National Laboratoryprovides this nation's (in fact, this hemisphere's) brightest storage...

  9. The Reclamation of Industrial Wastes Inclusive Sulphates by Sulphate-Reducing Bacteria

    Directory of Open Access Journals (Sweden)

    Mária Kušnierová

    2004-12-01

    Full Text Available The objective of our study was to verify experimentally the possibility of using coal mine drainage and gypsum from the „stabilizate“ (the final product from the combustion desulphurisation as the source of sulphate for the cultivation of SRB with the prospect of: purging of mine waste waters inclusive sulphates, recycling of desulphurisation agent (limestone and production of elemental sulphur from hydrogen sulphide. The results confirmed the theoretical assumptions on the use of gypsum, which forms the substantial component of „stabilizate“, as the source of sulphate for sulphate-reducing bacteria, which produce hydrogen sulphide in the process of bacterial reduction of sulphates. They also showed the possibility of recycling the desulphurisation agent – limestone, as well as the realistic alternative of using „stabilizate“ in the production of elemental sulphur which still represents an important raw material needed in chemical, paper or other industries.

  10. The Sulphate Effect on Lijiaxia Concrete Dam (China Gallery

    Directory of Open Access Journals (Sweden)

    Xufen Zhu

    2017-01-01

    Full Text Available The concrete degradation is one of the most serious problems for a dam construct during the normal operation, which determines the dam service life. Hence, it is very important to reduce the extent of the dam concrete degradation for the safety of the dam normal operation. Here, Lijiaxia hydroelectric station is taken as an example, and a comprehensive method to assess the sulphate effect on dam gallery is proposed. Eleven samples in total were taken from three difference locations by the drill bore. The microstructural investigations including X-ray fluorescence spectrometry (XRF, X-ray diffraction (XRD, scanning electron microscope (SEM, and energy dispersive spectroscopy (EDS were conducted to assess the sulphate attack and the degradation degree. Meanwhile, the water chemical analysis was applied to reveal the mechanism of concrete degradation. The experimental and analysis results indicate that the concrete degradation degree varies with the location of the samples. The components of the concrete change and the content of SO3 increase dramatically during degradation. Moreover, the mineral facies of the concrete change correspondingly, with the cement paste substituted by the calcite, calcium vitriol, and gypsum. The reinforcement and precaution measures are suggested based on the results of the degradation assessment.

  11. Post traumatic tetanus and role magnesium sulphate

    International Nuclear Information System (INIS)

    Sikendr, R.I.; Samad, B.U.; Memon, M.I.

    2009-01-01

    Tetanus is a life threatening disease. Reported mortality for tetanus is 15-39%. Conventional treatment includes heavy sedation and artificial ventilation. Complications resulting from long term heavy sedation and artificial ventilation contribute to 60% of the total mortality caused by tetanus. In this study magnesium sulphate was used to reduce the need for sedation and artificial ventilation. Objectives of this prospective study were to determine the role of magnesium sulphate in post traumatic tetanus. The study was carried out in surgical Intensive Care at Pakistan Institute of Medical Sciences (PIMS), Islamabad from Jan 2004 to Dec 2007. Forty-four patients presented during this period and 33 patients were included in the study. All patients had tracheostomy done within 48 hours. Every patient was started Magnesium Sulphate therapy for control of spasms after sending baseline investigations. Patients were given ventilatory support when needed. All data was entered in well structured proforma. SPSS-10 was used to analyse data. Thirty-three patients were included in the study and all patients were given magnesium sulphate. Out of these, 45.5% cases were grade 4 tetanus, 73.6% and 63.3% cases did not require artificial ventilation and additional sedation respectively, 51.1% patients remained free of complications of tetanus. Overall mortality was 30.3%. Use of Magnesium Sulphate is safe and reduces the need for sedation and artificial ventilation in high grade tetanus thus contributing to survival benefit in adult post-traumatic tetanus cases. (author)

  12. TiO2 effect on break-down of low-grade tantalum-niobium concentrates in the process of sulphatization

    International Nuclear Information System (INIS)

    Petrova, N.V.; Popov, A.D.; Mulenko, V.N.

    1982-01-01

    The effect of TiO 2 additive or materials containing it on tantalum-niobate decomposition in the process of sulphatization is investigated. It is shown that favourable effect of titanium dioxide in the process of sulphatization is especially noticeable in reprocessing of hard-brokening down tantalum-niobium concentrates with low Nb:Ta ratio etc. Chemical composition and type of tantalum-niobium mineralization of enrichment products used in the given investigation is presented. It is stated that the degree of concentrate break-down under similar sulphatization conditions (t=230 deg C; tau=2 h) essentially depends on the quantity of the introduced titanium dioxide. It is shown that sulphatization in the presence of titanium dioxide additive or materials containing it permits to exercise practically complete break-down of lean tantalum-niobium raw material, to avoid application of complexers in leaching of sulphatization products

  13. Development of a quantitative accelerated sulphate attack test for mine backfill

    Science.gov (United States)

    Shnorhokian, Shahe

    Mining operations produce large amounts of tailings that are either disposed of in surface impoundments or used in the production of backfill to be placed underground. Their mineralogy is determined by the local geology, and it is not uncommon to come across tailings with a relatively high sulphide mineral content, including pyrite and pyrrhotite. Sulphides oxidize in the presence of oxygen and water to produce sulphate and acidity. In the concrete industry, sulphate is known to produce detrimental effects by reacting with the cement paste to produce the minerals ettringite and gypsum. Because mine backfill uses tailings and binders---including cement---it is therefore prone to sulphate attack where the required conditions are met. Currently, laboratory tests on mine backfill mostly measure mechanical properties such as strength parameters, and the study of the chemical aspects is restricted to the impact of tailings on the environment. The potential of sulphate attack in mine backfill has not been studied at length, and no tests are conducted on binders used in backfill for their resistance to attack. Current ASTM guidelines for sulphate attack tests have been deemed inadequate by several authors due to their measurement of only expansion as an indicator of attack. Furthermore, the tests take too long to perform or are restricted to cement mortars only, and not to mixed binders that include pozzolans. Based on these, an accelerated test for sulphate attack was developed in this work through modifying and compiling procedures that had been suggested by different authors. Small cubes of two different binders were fully immersed in daily-monitored sodium sulphate and sulphuric acid solutions for a total of 28 days, after 7 days of accelerated curing at 50°C. In addition, four binders were partially immersed in the same solutions for 8 days for an accelerated attack process. The two procedures were conducted in tandem with leach tests using a mixed solution of

  14. AP statistics crash course

    CERN Document Server

    D'Alessio, Michael

    2012-01-01

    AP Statistics Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Statistics Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Statistics course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: exploring da

  15. APS Science 2006

    International Nuclear Information System (INIS)

    Gibson, J.M.; Fenner, R.B.; Long, G.; Borland, M.; Decker, G.

    2007-01-01

    In my five years as the Director of the Advanced Photon Source (APS), I have been fortunate to see major growth in the scientific impact from the APS. This year I am particularly enthusiastic about prospects for our longer-term future. Every scientific instrument must remain at the cutting edge to flourish. Our plans for the next generation of APS--an APS upgrade--got seriously in gear this year with strong encouragement from our users and sponsors. The most promising avenue that has emerged is the energy-recovery linac (ERL) (see article on page xx), for which we are beginning serious R and D. The ERL(at)APS would offer revolutionary performance, especially for x-ray imaging and ultrafast science, while not seriously disrupting the existing user base. I am very proud of our accelerator physics and engineering staff, who not only keep the current APS at the forefront, but were able to greatly impress our international Machine Advisory Committee with the quality of their work on the possible upgrade option (see page xx). As we prepare for long-term major upgrades, our plans to develop and optimize all the sectors at APS in the near future are advancing. Several new beamlines saw first light this year, including a dedicated powder diffraction beamline (11-BM), two instruments for inelastic x-ray scattering at sector 30, and the Center for Nanoscale Materials (CNM) Nanoprobe beamline at sector 26. Our partnership in the first x-ray free-electron laser (LCLS) to be built at Stanford contributes to revolutionary growth in ultrafast science (see page xx), and we are developing a pulse chirping scheme to get ps pulses at sector 7 of the APS within a year or so. In this report, you will find selected highlights of scientific research at the APS from calendar year 2006. The highlighted work covers diverse disciplines, from fundamental to applied science. In the article on page xx you can see the direct impact of APS research on technology. Several new products have emerged

  16. APS Science 2006.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M.; Fenner, R. B.; Long, G.; Borland, M.; Decker, G.

    2007-05-24

    In my five years as the Director of the Advanced Photon Source (APS), I have been fortunate to see major growth in the scientific impact from the APS. This year I am particularly enthusiastic about prospects for our longer-term future. Every scientific instrument must remain at the cutting edge to flourish. Our plans for the next generation of APS--an APS upgrade--got seriously in gear this year with strong encouragement from our users and sponsors. The most promising avenue that has emerged is the energy-recovery linac (ERL) (see article on page xx), for which we are beginning serious R&D. The ERL{at}APS would offer revolutionary performance, especially for x-ray imaging and ultrafast science, while not seriously disrupting the existing user base. I am very proud of our accelerator physics and engineering staff, who not only keep the current APS at the forefront, but were able to greatly impress our international Machine Advisory Committee with the quality of their work on the possible upgrade option (see page xx). As we prepare for long-term major upgrades, our plans to develop and optimize all the sectors at APS in the near future are advancing. Several new beamlines saw first light this year, including a dedicated powder diffraction beamline (11-BM), two instruments for inelastic x-ray scattering at sector 30, and the Center for Nanoscale Materials (CNM) Nanoprobe beamline at sector 26. Our partnership in the first x-ray free-electron laser (LCLS) to be built at Stanford contributes to revolutionary growth in ultrafast science (see page xx), and we are developing a pulse chirping scheme to get ps pulses at sector 7 of the APS within a year or so. In this report, you will find selected highlights of scientific research at the APS from calendar year 2006. The highlighted work covers diverse disciplines, from fundamental to applied science. In the article on page xx you can see the direct impact of APS research on technology. Several new products have emerged from

  17. Exercício físico regular diminui o estresse oxidativo pulmonar em ratos após exposição aguda ao carvão mineral El ejercicio físico regular reduce la respuesta oxidativa pulmonar en los ratones después de la exhibición afilada al carbón mineral Regular physical exercises decrease the oxidant pulmonary stress in rats after acute exposure to mineral coal

    Directory of Open Access Journals (Sweden)

    Ricardo A. Pinho

    2006-04-01

    Full Text Available Estudos têm apontado o exercício físico regular de baixa a moderada intensidade como um importante agente no combate ao estresse oxidativo. O objetivo deste estudo foi investigar o efeito do exercício físico regular na resposta oxidativa pulmonar após a inalação de pó de carvão mineral. Vinte e quatro ratos Wistar machos (200-250g foram divididos aleatoriamente em dois grupos com respectivos controles (treinado, n = 6 e não-treinado, n = 6. Os animais receberam, por instilação traqueal, pó de carvão mineral (3mg/0,5ml salina, três dias/semana, durante três semanas ou 0,5ml de solução salina 0,9%. Quarenta e oito horas após a última instilação, o grupo treinado foi submetido a um programa de exercício progressivo em esteira durante 12 semanas (até 17m.min-1, 50min.dia-1, 10% de inclinação. Quarenta e oito horas após a última sessão de treinamento, todos os animais foram mortos por decapitação e os pulmões e sóleo foram cirurgicamente removidos para posterior análise bioquímica. A atividade da citrato-sintase foi determinada no músculo sóleo e os danos em lipídios e proteínas foram avaliados nos pulmões pela concentração de TBARS e pela determinação de grupos carbonil, respectivamente. Os resultados mostram que a prática regular de exercício físico reduz significativamente os níveis presentes de TBARS em ratos treinados e diminui os níveis de oxidação em proteínas em ambos os grupos quando comparados com os respectivos controles. Os resultados nos levam a sugerir que o exercício físico regular em esteira é um agente capaz de amenizar os danos oxidativos pulmonares induzidos pela inalação de partículas de carvão mineral.Los estudios han estado apuntando el ejercicio físico regular de intensidad baja a moderada como un agente importante en el combate a la tensión oxidativa. El objetivo de ese estudio era investigar el efecto del ejercicio físico para regular la respuesta oxidativa

  18. Application of Ground Granulate Blast Furnace Slag-Steel Slag Composite Binder in a Massive Concrete Structure under Severe Sulphate Attack

    Directory of Open Access Journals (Sweden)

    Jin Liu

    2017-01-01

    Full Text Available A composite mineral binder was prepared by mixing ground granulate blast furnace slag (GGBS and steel slag (GGBS/steel slag ratios are 1 : 1 or 3 : 2 by mass. The application of a composite binder in a massive concrete structure under severe sulphate attack is discussed by determining the hydration heat, adiabatic temperature increase, compressive strength, elastic modulus, chloride ion permeability, and sulphate attack resistance. The results show that the hydration heat of the composite binder decreases greatly when the cement replacement ratio increases to 50% at 45°C. The adiabatic temperature rise of the concrete containing the composite mineral admixture decreases significantly. Concrete containing the composite mineral admixture has a lower early elastic modulus and satisfactory late-age compressive strength. The composite mineral admixture can improve the resistance to chloride ion permeability and sulphate attack resistance of concrete, especially during temperature match curing.

  19. Experimental study of the replacement of calcite by calcium sulphates

    Science.gov (United States)

    Ruiz-Agudo, E.; Putnis, C. V.; Hövelmann, J.; Álvarez-Lloret, P.; Ibáñez-Velasco, A.; Putnis, A.

    2015-05-01

    Among the most relevant mineral replacement reactions are those involving sulphates and carbonates, which have important geological and technological implications. Here it is shown experimentally that during the interaction of calcite (CaCO3) cleavage surfaces with sulphate-bearing acidic solutions, calcite is ultimately replaced by gypsum (CaSO4 2H2O) and anhydrite (CaSO4), depending on the reaction temperature. Observations suggest that this occurs most likely via an interface-coupled dissolution-precipitation reaction, in which the substrate is replaced pseudomorphically by the product. At 120 and 200 °C gypsum and/or bassanite (CaSO4·0.5H2O) form as precursor phases for the thermodynamically stable anhydrite. Salinity promotes the formation of less hydrated precursor phases during the replacement of calcite by anhydrite. The reaction stops before equilibrium with respect to calcite is reached and during the course of the reaction most of the bulk solutions are undersaturated with respect to the precipitating phase(s). A mechanism consisting of the dissolution of small amounts of solid in a thin layer of fluid at the mineral-fluid interface and the subsequent precipitation of the product phase from this layer is in agreement with these observations. PHREEQC simulations performed in the framework of this mechanism highlight the relevance of transport and surface reaction kinetics on the volume change associated with the CaCO3-CaSO4 replacement. Under our experimental conditions, this reaction occurs with a positive volume change, which ultimately results in passivation of the unreacted substrate before calcite attains equilibrium with respect to the bulk solution.

  20. Autoantibody profiling in APS.

    Science.gov (United States)

    Roggenbuck, D; Somma, V; Schierack, P; Borghi, M O; Meroni, P L

    2014-10-01

    The international consensus for the classification of antiphospholipid syndrome (APS) requires clinical and laboratory criteria to be considered at an equal level for diagnosing APS. Thus, detection of antiphospholipid antibodies (aPL) being a hallmark of APS has been the object of intensive investigation over the past 40 years. However, appropriate detection of aPL still remains a laboratory challenge due to their heterogeneity comprising autoantibodies reactive to different phospholipid-binding plasma proteins, such as beta-2 glycoprotein I (β2GPI) and prothrombin. The relevance of aPL interacting with phospholipids other than cardiolipin (CL, diphosphatidylglycerol), such as phosphatidylserine (PS), remains elusive with regard to the diagnosis of APS. Recently, the concept of aPL profiling has been introduced to assess the risk of thrombotic complications in patients with APS. New assay techniques, apart from enzyme-linked immunosorbent assays (ELISAs) recommended by the international consensus for the classification of APS, have been proposed for multiplexing of aPL testing. Line immunoassays (LIAs) employing a novel hydrophobic solid phase for the simultaneous detection of different aPL seem to be an intriguing alternative. We evaluated a novel multiplex LIA employing a hydrophobic membrane coated with different phospholipid (PL)-binding proteins or PLs. The performance characteristics of this new multiplexing assay technique demonstrated its usefulness for aPL profiling. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  1. Sulphate leaching from diffuse agricultural and forest sources in a large central European catchment during 1900-2010

    Czech Academy of Sciences Publication Activity Database

    Kopáček, Jiří; Hejzlar, Josef; Porcal, Petr; Posch, M.

    470, February (2014), s. 543-550 ISSN 0048-9697 R&D Projects: GA ČR(CZ) GAP504/12/1218; GA ČR(CZ) GA526/09/0567 Institutional support: RVO:60077344 Keywords : modelling * sulphate leaching * sulphur mineralization * diffuse sources Subject RIV: DJ - Water Pollution ; Quality Impact factor: 4.099, year: 2014

  2. APS Science 2009.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M; Mills, D. M.; Gerig, R.

    2010-05-01

    It is my pleasure to introduce the 2009 annual report of the Advanced Photon Source. This was a very good year for us. We operated with high reliability and availability, despite growing problems with obsolete systems, and our users produced a record output of publications. The number of user experiments increased by 14% from 2008 to more than 3600. We congratulate the recipients of the 2009 Nobel Prize in Chemistry-Venkatraman Ramakrishnan (Cambridge Institute for Medical Research), Thomas Steitz (Yale University), and Ada Yonath (Weizmann Institute) - who did a substantial amount of this work at APS beamlines. Thanks to the efforts of our users and staff, and the ongoing counsel of the APS Scientific Advisory Committee, we made major progress in advancing our planning for the upgrade of the APS (APS-U), producing a proposal that was positively reviewed. We hope to get formal approval in 2010 to begin the upgrade. With advocacy from our users and the support of our sponsor, the Office of Basic Energy Sciences in the Department of Energy (DOE) Office of Science, our operating budgets have grown to the level needed to more adequately staff our beamlines. We were also extremely fortunate to have received $7.9 M in American Recovery and Reinvestment Act ('stimulus') funding to acquire new detectors and improve several of our beamlines. The success of the new Linac Coherent Light Source at Stanford, the world's first x-ray free-electron laser, made us particularly proud since the undulators were designed and built by the APS. Among other highlights, we note that more than one-quarter of the 46 Energy Frontier Research Centers, funded competitively across the U.S. in 2009 by the DOE, included the Advanced Photon Source in their proposed work, which shows that synchrotron radiation, and the APS in particular, are central to energy research. While APS research covers everything from fundamental to applied science (reflected by the highlights in this report

  3. Computerised analysis of sulphate action on model concrete piles

    Digital Repository Service at National Institute of Oceanography (India)

    Deshmukh, A.M.; Balasubramanian, S.; Venugopal, C.

    Sulphate action severely affects the durability of marine structures. It is imperative to study precisely the effects of magnesium sulphate on pile foundations in the marine environment. In the present paper an attempt is made to assess and analyse...

  4. Formulation and evaluation and terbutaline sulphate and ...

    African Journals Online (AJOL)

    We report the use of low rugosity lactose, product of controlled crystallization of this carrier, in the formulation of terbutaline sulphate and beclomethasone dipropionate dry powder inhalers. The deposition patterns obtained with inhalation mixtures consisting of the modified lactose and each of the micronised drugs ...

  5. Detecting sulphate aerosol geoengineering with different methods

    Science.gov (United States)

    Lo, Y. T. Eunice; Charlton-Perez, Andrew J.; Lott, Fraser C.; Highwood, Eleanor J.

    2016-12-01

    Sulphate aerosol injection has been widely discussed as a possible way to engineer future climate. Monitoring it would require detecting its effects amidst internal variability and in the presence of other external forcings. We investigate how the use of different detection methods and filtering techniques affects the detectability of sulphate aerosol geoengineering in annual-mean global-mean near-surface air temperature. This is done by assuming a future scenario that injects 5 Tg yr-1 of sulphur dioxide into the stratosphere and cross-comparing simulations from 5 climate models. 64% of the studied comparisons would require 25 years or more for detection when no filter and the multi-variate method that has been extensively used for attributing climate change are used, while 66% of the same comparisons would require fewer than 10 years for detection using a trend-based filter. This highlights the high sensitivity of sulphate aerosol geoengineering detectability to the choice of filter. With the same trend-based filter but a non-stationary method, 80% of the comparisons would require fewer than 10 years for detection. This does not imply sulphate aerosol geoengineering should be deployed, but suggests that both detection methods could be used for monitoring geoengineering in global, annual mean temperature should it be needed.

  6. Solid state reactions of monovalent sulphates with UO2

    International Nuclear Information System (INIS)

    Khandakar, R.R.; Krishnan, K.; Singh Mudher, K.D.; Jayadevan, N.C.

    1986-01-01

    Solid state reactions of sulphates of Na + , K + , Rb + , Cs + and Tl + with UO 2 in presence of (NH 4 ) 2 SO 4 lead to the formation of double sulphates at 400degC. The double sulphates decompose at higher temperatures to give metal uranates. Thermogravimetric, x-ray diffraction and chemical analysis have been used to characterise the compounds. (author). 5 refs

  7. Short communication Sulphate measurement in organic-rich ...

    African Journals Online (AJOL)

    Sulphate measurement using a barium sulphate turbidimetric method in solutions with high concentrations of organic material is shown to be problematic. The organics give background colour, which introduces a positive error to the measured absorption, and inhibit the barium sulphate precipitate, which results in a ...

  8. APS SCIENCE 2016

    Energy Technology Data Exchange (ETDEWEB)

    Fenner, Richard B. [Argonne National Lab. (ANL), Argonne, IL (United States). Advanced Photon Source (APS)

    2017-05-01

    The Advanced Photon Source (APS) occupies an 80-acre site on the Argonne national laboratory campus, about 25 miles from downtown chicago, illinois. it shares the site with the center for nanoscale materials and the Advanced Protein characterization facility. for directions to Argonne, see http://www.anl.gov/directions-and-visitor-information. The APS, a national synchrotron radiation research facility operated by Argonne for the u.S. department of energy (doe) office of Science, provides this nation’s brightest high-energy x-ray beams for science. research by APS users extends from the center of the earth to outer space, from new information on combustion engines and microcircuits to new drugs and nanotechnologies whose scale is measured in billionths of a meter. The APS helps researchers illuminate answers to the challenges of our high-tech world, from developing new forms of energy, to sustaining our nation’s technological and economic competitiveness, to pushing back against the ravages of disease. research at the APS promises to have far-reaching

  9. APS power supply controls

    International Nuclear Information System (INIS)

    Saunders, C.W.; Despe, O.D.

    1994-01-01

    The purpose of this document is to provide comprehensive coverage of the APS power supply control design. This includes application software, embedded controller software, networks, and hardware. The basic components will be introduced first, followed by the requirements driving the overall design. Subsequent sections will address each component of the design one by one. Latter sections will address specific applications

  10. Mineralização de compostos nitrogenados após aplicações de lodos de esgoto em quatro cultivos de milho Nitrogen mineralization after sewage sludge applications to four corn crops

    Directory of Open Access Journals (Sweden)

    Rita Carla Boeira

    2009-02-01

    Full Text Available O teor de N disponível em solos tratados com lodo de esgoto é um dos fatores restritivos à aplicação do resíduo em grandes volumes na agricultura, e deve ser utilizado nas normas que regulamentam seu uso agrícola com o fim de evitar a contaminação ambiental do solo e corpos d'água com nitrato. Quando se aplica o resíduo pela primeira vez em um solo, a disponibilização de N mineral a partir de compostos orgânicos naturais do solo não é diretamente considerada no cálculo da taxa de aplicação máxima, e este procedimento é comum também nas recomendações de adubação mineral. Porém, a aplicação continuada desses resíduos pode causar efeitos residuais acumulativos na geração de N mineral, o que implicaria recomendações específicas para reaplicações em uma mesma área. O objetivo deste trabalho foi avaliar a disponibilidade potencial de N mineral em um Latossolo previamente tratado com lodos de esgoto e com quatro cultivos sucessivos de milho. Amostras de solo da camada de 0-20 cm foram coletadas em subparcelas de um experimento realizado em campo, entre 1999 e 2002, em Jaguariúna (SP, onde foram aplicados 0, 14.716, 29.432, 58.864 e 117.728 kg ha-1 de lodo de origem urbana (Franca, SP e 0, 22.700, 45.400, 90.800 e 181.600 kg ha-1 de lodo produzido a partir de esgotos urbanos e industriais (Barueri, SP. As doses foram parceladas em quatro aplicações anuais consecutivas. Em laboratório, essas amostras foram incubadas durante 15 semanas. As análises iniciais dos solos evidenciaram que houve efeito residual das aplicações prévias dos lodos sobre o acúmulo de N orgânico e de nitrato. No final da incubação, houve acúmulo de N inorgânico no solo e diminuição do pH em função da maior geração de nitrato com as doses crescentes dos lodos de esgoto. O potencial de mineralização estimado pelo modelo exponencial simples foi de 28 mg kg-1 de N no tratamento sem lodo, e crescente, de 28 para 100 mg kg-1 de N

  11. APS Science 2007

    International Nuclear Information System (INIS)

    2008-01-01

    This report provides research highlights from the Advanced Photon Source (APS). Although these highlights represent less than 10% of the published work from the APS in 2007, they give a flavor of the diversity and impact of user research at the facility. In the strategic planning the aim is to foster the growth of existing user communities and foresee new areas of research. This coming year finds the APS engaged in putting together, along with the users, a blueprint for the next five years, and making the case for a set of prioritized investments in beamlines, the accelerator, and infrastructure, each of which will be transformational in terms of scientific impact. As this is written plans are being formulated for an important user workshop on October 20-21, 2008, to prioritize strategic plans. The fruit from past investments can be seen in this report. Examples include the creation of a dedicated beamline for x-ray photon correlation spectroscopy at Sector 8, the evolution of dedicated high-energy x-ray scattering beamlines at sectors 1 and 11, a dedicated imaging beamline at Sector 32, and new beamlines for inelastic scattering and powder diffraction. A single-pulse facility has been built in collaboration with Sector 14 (BioCARS) and Phil Anfinrud at the National Institutes of Health, which will offer exceptionally high flux for single-pulse diffraction. The nanoprobe at Sector 26, built and operated jointly by the Argonne Center for Nanoscale Materials and the X-ray Operations and Research (XOR) section of the APS X-ray Science Division, has come on line to define the state of the art in nanoscience

  12. APS Science 2007.

    Energy Technology Data Exchange (ETDEWEB)

    2008-05-30

    This report provides research highlights from the Advanced Photon Source (APS). Although these highlights represent less than 10% of the published work from the APS in 2007, they give a flavor of the diversity and impact of user research at the facility. In the strategic planning the aim is to foster the growth of existing user communities and foresee new areas of research. This coming year finds the APS engaged in putting together, along with the users, a blueprint for the next five years, and making the case for a set of prioritized investments in beamlines, the accelerator, and infrastructure, each of which will be transformational in terms of scientific impact. As this is written plans are being formulated for an important user workshop on October 20-21, 2008, to prioritize strategic plans. The fruit from past investments can be seen in this report. Examples include the creation of a dedicated beamline for x-ray photon correlation spectroscopy at Sector 8, the evolution of dedicated high-energy x-ray scattering beamlines at sectors 1 and 11, a dedicated imaging beamline at Sector 32, and new beamlines for inelastic scattering and powder diffraction. A single-pulse facility has been built in collaboration with Sector 14 (BioCARS) and Phil Anfinrud at the National Institutes of Health, which will offer exceptionally high flux for single-pulse diffraction. The nanoprobe at Sector 26, built and operated jointly by the Argonne Center for Nanoscale Materials and the X-ray Operations and Research (XOR) section of the APS X-ray Science Division, has come on line to define the state of the art in nanoscience.

  13. Tinospora cordifolia consumption ameliorates changes in kidney chondroitin sulphate/dermatan sulphate in diabetic rats

    OpenAIRE

    Joladarashi, Darukeshwara; Chilkunda, Nandini D.; Salimath, Paramahans V.

    2012-01-01

    Diabetes is known to alter kidney extracellular matrix (ECM) components. Chondroitin sulphate (CS)/dermatan sulphate (DS), an ECM component, which plays an essential role in kidney is altered during diabetes. The focus of this study has been to examine the effect of Tinospora cordifolia (TC) consumption, a potent plant widely used to treat diabetes, on kidney CS/DS. Experimentally induced diabetic rats were fed with diet containing TC at 2·5 and 5 % levels and the effect of it on kidney CS/DS...

  14. Electron microscopy of particles collected at Praia, Cape Verde, during the Saharan Mineral Dust Experiment: particle chemistry, shape, mixing state and complex refractive index

    Science.gov (United States)

    Kandler, K.; Lieke, K.; Benker, N.; Emmel, C.; Küpper, M.; Müller-Ebert, D.; Ebert, M.; Scheuvens, D.; Schladitz, A.; Schütz, L.; Weinbruch, S.

    2011-09-01

    A large field experiment of the Saharan Mineral Dust Experiment (SAMUM) was performed in Praia, Cape Verde, in January and February 2008. The aerosol at Praia is a superposition of mineral dust, sea-salt, sulphates and soot. Particles smaller than 500 nm are mainly mineral dust, mineral dust-sulphate mixtures, sulphates and soot-sulphate mixtures. Particles larger then 2.5 μm consist of mineral dust, sea-salt and few mineral dust-sulphate mixtures. A transition range exists in between. The major internal mixtures are mineral dust-sulphate and soot-sulphate. Mineral dust-sea-salt mixtures occur occasionally, mineral dust-soot mixtures were not observed. The aspect ratio was 1.3-1.4 for dry particles smaller than 500 nm and 1.6-1.7 for larger ones. Parameterizations are given for dry and humid state. Although the real part of the refractive index showed low variation (1.55-1.58 at 532 nm), a multi-modal imaginary part was detected as function of particle size, reflecting the complex composition. Soot mainly influences the absorption for wavelengths longer than the haematite absorption edge, whereas for shorter wavelengths dust is dominating. The refractive index of the aerosol depends on the source region of the mineral dust and on the presence/absence of a marine component.

  15. Electron microscopy of particles collected at Praia, Cape Verde, during the Saharan Mineral Dust Experiment: particle chemistry, shape, mixing state and complex refractive index

    Energy Technology Data Exchange (ETDEWEB)

    Kandler, K.; Lieke, K.; Benker, N. (Institut fur Angewandte Geowissenschaften, Technische Universitaet Darmstadt, Darmstadt (Germany)), e-mail: kzk@gmx.de (and others)

    2011-09-15

    A large field experiment of the Saharan Mineral Dust Experiment (SAMUM) was performed in Praia, Cape Verde, in January and February 2008. The aerosol at Praia is a superposition of mineral dust, sea-salt, sulphates and soot. Particles smaller than 500 nm are mainly mineral dust, mineral dust-sulphate mixtures, sulphates and soot-sulphate mixtures. Particles larger then 2.5mum consist of mineral dust, sea-salt and few mineral dust-sulphate mixtures. A transition range exists in between. The major internal mixtures are mineral dust-sulphate and soot-sulphate. Mineral dust-sea-salt mixtures occur occasionally, mineral dust-soot mixtures were not observed. The aspect ratio was 1.3-1.4 for dry particles smaller than 500 nm and 1.6-1.7 for larger ones. Parameterizations are given for dry and humid state. Although the real part of the refractive index showed low variation (1.55-1.58 at 532 nm), a multi-modal imaginary part was detected as function of particle size, reflecting the complex composition. Soot mainly influences the absorption for wavelengths longer than the haematite absorption edge, whereas for shorter wavelengths dust is dominating. The refractive index of the aerosol depends on the source region of the mineral dust and on the presence/absence of a marine component

  16. Renal involvement in the antiphospholipid syndrome (APS)-APS nephropathy.

    Science.gov (United States)

    Tektonidou, Maria G

    2009-06-01

    Although the kidney represents a major target organ in antiphospholipid syndrome (APS), renal involvement in APS was poorly recognized until recently. The most well-recognized renal manifestations of APS are the renal artery thrombosis/stenosis, renal infarction, hypertension, renal vein thrombosis, end-stage renal disease, increased allograft vascular thrombosis, some types of glomerular disease, and a small-vessel vaso-occlusive nephropathy, recently defined as APS nephropathy. APS nephropathy was first described in primary APS patients, characterized by acute thrombotic lesions in glomeruli and/or arterioles (thrombotic microangiopathy) and chronic vascular lesions such as fibrous intimal hyperplasia of arterioles and interlobular arteries, organized thrombi with or without recanalization, and fibrous arterial and arteriolar occlusions or focal cortical atrophy. APS nephropathy was also detected in further studies including patients with systemic lupus erythematosus (SLE)-related APS and SLE/non-APS patients with positive antiphospholipid antibodies, independently of lupus nephritis. The same histologic lesions, especially thrombotic mictroangiopathy, were also observed in patients with catastrophic APS. The most frequent clinical and laboratory characteristics of APS nephropathy in all the above groups of patients are hypertension (often severe), proteinuria (ranging from mild to nephrotic range), hematuria, and acute or chronic renal insufficiency.

  17. Ferric sulphate leaching process for uranium ore

    International Nuclear Information System (INIS)

    Cai Ximin

    1990-09-01

    A process using the ferric sulphate solution as a leaching agent to the uranium ore which was exploited in the south part of Hunan province was studied. The ore mainly contains uraninite. Comparing with the conventional sulphuric acid leching method, this process reduced the acid consumption about 30∼40%, and dissolved solids 15∼20%. The ferric leaching agent can cyclically be used by the ferrous oxidant bacteria. From the results of six cycles, it indicated that the ferric leaching ageng does not interfere the leaching results of uranium

  18. Structure of sodium alkyl sulphate micelles

    International Nuclear Information System (INIS)

    Vass, Sz.

    1990-05-01

    Micellar aggregation numbers of aggregated sodium octyl, decyl, dodecyl and tetradecyl sulphate molecules obtained from small-angle neutron scattering (SANS) measurements are reported. The surfactant concentration and solution temperature were varied systematically. A survey of the physical models and evaluation algorithms applied for SANS are presented. By utilizing a new least square fitting algorithm, the formation and annihilation parameters of orthopositronium in the micellar pseudophase and in the aqueous solvent is deduced by evaluating positron lifetime spectra measured by conventional technqiues. (R.P.) 157 refs.; 10 figs

  19. Constant current chronopotentiometric stripping of sulphated polysaccharides

    Czech Academy of Sciences Publication Activity Database

    Strmečki, S.; Plavšić, M.; Ćosović, B.; Ostatná, Veronika; Paleček, Emil

    2009-01-01

    Roč. 11, č. 10 (2009), s. 2032-2035 ISSN 1388-2481 R&D Projects: GA ČR(CZ) GA301/07/0490; GA ČR(CZ) GP202/07/P497; GA MŠk(CZ) LC06035 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : sulphated polysaccharides * ióta-carrageenan * catalysis of hydrogen evolution Subject RIV: BO - Biophysics Impact factor: 4.243, year: 2009

  20. Tinospora cordifolia consumption ameliorates changes in kidney chondroitin sulphate/dermatan sulphate in diabetic rats.

    Science.gov (United States)

    Joladarashi, Darukeshwara; Chilkunda, Nandini D; Salimath, Paramahans V

    2012-01-01

    Diabetes is known to alter kidney extracellular matrix (ECM) components. Chondroitin sulphate (CS)/dermatan sulphate (DS), an ECM component, which plays an essential role in kidney is altered during diabetes. The focus of this study has been to examine the effect of Tinospora cordifolia (TC) consumption, a potent plant widely used to treat diabetes, on kidney CS/DS. Experimentally induced diabetic rats were fed with diet containing TC at 2·5 and 5 % levels and the effect of it on kidney CS/DS was examined. The CS/DS content and CS:heparan sulphate ratio which was decreased during diabetic condition were ameliorated in TC-fed groups. Disaccharide composition analysis of CS/DS by HPLC showed that decreases in 'E' units and degree of sulphation were modulated in 5 % TC-fed groups. Apparent molecular weight of purified CS/DS from the control rat kidney was found to be 38 kDa which was decreased to 29 kDa in diabetic rat kidney. Rats in 5 % TC-fed groups showed chain length of 38 kDa akin to control rats. Expression of chondroitin 4-O-sulfotransferase-1, dermatan 4-O-sulfotransferase-1 and N-acetylgalactosamine 4 sulphate 6-O-sulfotransferase, enzymes involved in the synthesis of 'E' units which was reduced during diabetic condition, was significantly contained in the 5 % TC-fed group. Purified CS/DS from 5 % TC-fed group was able to bind higher amounts of ECM components, namely type IV collagen and laminin, when compared with untreated diabetic rats. The present results demonstrate that consumption of a diet containing TC at the 5 % level modulates changes in kidney CS/DS which were due to diabetes.

  1. The AP-1 transcription factor homolog Pf-AP-1 activates transcription of multiple biomineral proteins and potentially participates in Pinctada fucata biomineralization

    Science.gov (United States)

    Zheng, Xiangnan; Cheng, Minzhang; Xiang, Liang; Liang, Jian; Xie, Liping; Zhang, Rongqing

    2015-01-01

    Activator protein-1 (AP-1) is an important bZIP transcription factor that regulates a series of physiological processes by specifically activating transcription of several genes, and one of its well-chartered functions in mammals is participating in bone mineralization. We isolated and cloned the complete cDNA of a Jun/AP-1 homolog from Pinctada fucata and called it Pf-AP-1. Pf-AP-1 had a highly conserved bZIP region and phosphorylation sites compared with those from mammals. A tissue distribution analysis showed that Pf-AP-1 was ubiquitously expressed in P. fucata and the mRNA level of Pf-AP-1 is extremely high in mantle. Pf-AP-1 expression was positively associated with multiple biomineral proteins in the mantle. The luciferase reporter assay in a mammalian cell line showed that Pf-AP-1 significantly up-regulates the transcriptional activity of the promoters of KRMP, Pearlin, and Prisilkin39. Inhibiting the activity of Pf-AP-1 depressed the expression of multiple matrix proteins. Pf-AP-1 showed a unique expression pattern during shell regeneration and pearl sac development, which was similar to the pattern observed for biomineral proteins. These results suggest that the Pf-AP-1 AP-1 homolog is an important transcription factor that regulates transcription of several biomineral proteins simultaneously and plays a role in P. fucata biomineralization, particularly during pearl and shell formation. PMID:26404494

  2. Evidence of pulpotomy in primary teeth comparing MTA, calcium hydroxide, ferric sulphate, and electrosurgery with formocresol.

    Science.gov (United States)

    Stringhini Junior, E; Vitcel, M E B; Oliveira, L B

    2015-08-01

    The aim of this study was to evaluate the scientific evidence of pulpotomy in primary teeth comparing mineral troxide aggregate (MTA), calcium hydroxide, ferric sulphate, and electrosurgery with formocresol. A systematic search using key words was conducted using seven databases up to December 10, 2013. Clinical articles in English, Portuguese and Spanish were selected, which were in accordance with the inclusion and exclusion criteria and the research objective of comparing whether pulpotomy performed with formocresol in primary teeth is more effective than other medicaments or techniques. Out of the 12,515 publication initially identified, 30 clinical articles were included in the systematic review and analysed by four meta-analyses. The success rate of MTA (94.6 %) was higher than that of formocresol (87.4 %), with a statistically significant difference (OR = 0.39; 95 % CI = 0.25-0.62). Formocresol pulpotomy success was not statistically different from ferric sulphate or electrosurgery. MTA was clinically and radiographically superior to formocresol for pulpotomy of primary teeth. The other alternatives to formocresol such as electrosurgery and ferric sulphate can be used instead of formocresol since they showed success similar to formocresol. In addition, there is no evidence to support calcium hydroxide for pulpotomies in primary teeth.

  3. Mineralização de N após incorporação de adubos orgânicos em um Neossolo Regolítico cultivado com milho Nitrogen mineralization after application of organic fertilizers to an Entisol cultivated with maize

    Directory of Open Access Journals (Sweden)

    Rômulo S. C. Menezes

    2007-08-01

    Full Text Available Normalmente, o esterco disponível nas propriedades no Agreste paraibano é insuficiente para a manutenção da fertilidade do solo enquanto a adubação verde com Gliricidia sepium é uma alternativa para aumentar a disponibilidade de nutrientes. Objetivou-se, no presente trabalho, comparar a dinâmica de mineralização de N após a incorporação de esterco bovino ou de ramas de gliricídia a um Neossolo Regolítico em condições de campo e laboratório. O experimento de campo constou de três tratamentos: incorporação de 20 t ha-1 de esterco bovino, de 15 t ha-1de ramas frescas de gliricídia e testemunha sem adições. Logo após as adições semeou-se milho e se acompanhou o N mineralizado in situ no campo, durante 120 dias, na camada de 0-15 cm e o N absorvido pelo milho. A mineralização de N no laboratório foi acompanhada durante 56 dias em amostras de solo das camadas de 0-15, 15-30 e 30-60 cm; as de 0-15 cm receberam esterco ou gliricídia em quantidades equivalentes às de campo. No campo foram mineralizados 74 kg ha-1 de N até a colheita (120 dias, sem diferenças significativas entre tratamentos. No laboratório, a gliricídia levou a uma rápida mineralização líquida de N enquanto o esterco bovino provocou imobilização nos primeiros 14 dias.Farms within the Agreste region of Paraíba often do not have sufficient animal manure to maintain the fertility of the soil and green manures, such as prunings of Gliricidia sepium, are an alternative to increase nutrient supply. The objectives of this work were to compare N mineralization dynamics following additions of cattle manure or Gliricidia sepium prunings to a Entisol, under field and laboratory conditions. In the field experiment, three treatments were established: addition of 20 t ha-1 of cattle manure; addition of 15 t ha-1 of green branches of Gliricidia, or a control without any addition. Maize was sown immediately after the additions. Soil N mineralization in the

  4. INVESTIGATION OF DISSOLVED SULPHATE IN VARIOUS GEOTHERMAL FIELDS OF SUMATRA USING OXYGEN AND SULPHUR ISOTOPES

    Directory of Open Access Journals (Sweden)

    E. Ristin Pujiindiyati

    2010-06-01

    Full Text Available There are at least 30 high temperature systems; eleven active volcanoes, five degassing volcanoes and one caldera volcano controlled by Sumatra Fault Zone over a length of 1700 km. To understand this geothermal field system, some information about geochemistry including isotope composition in its fluid is needed. Sulphur-34 and oxygen-18 isotopes in dissolved sulphate pair have been used to determine the origin of acidic fluid of sulphate and to evaluate the process involved. The fluids from eight hot springs, two fumaroles, four deep wells and crater have been collected in along Sumatra geothermal fields. Sulphur-34 (d 34S (SO4, 0/00 CDT and oxygen-18 (d 18O (SO4, 0/00 SMOW in sulphate is analyzed according to Robinson-Kusakabe and Rafter method, respectively. The d 34S (SO4 values from Sibayak wells are more enriched of 16.8 0/00 to 18.2 0/0 that may indicate the dissolution of anhydrite minerals or isotope partitioning in hydration of SO2. The d 34S (SO4 values from two fumaroles (Pusuk Bukit - North Sumatra and Rantau Dadap - South Sumatra are at depleted value of -0.150/00 and 1.80/00, those are close to d 34S from magmatic sulphur.  In general, the d 34S (SO4 of springs spread in a wide range of 5.250/00 to14.20/00 and show a mixing process between atmospheric sulphate and sulphate from deep wells. The d 18O (SO4 from wells exhibits depleted value around -3.60/00 suggesting that 87.5% of sulphate oxygen is derived from groundwater oxygen and 12.5% is derived from atmospheric molecular oxygen in sulphide oxidation reaction. In the other hand, hot springs (except Semurup, crater and fumaroles have enriched value of d 18O (SO4. These enriched values suggest that a higher percentage of atmospherically derived oxygen compared to those from the depth.   Keywords: isotope, geothermal, Sumatra

  5. CGM ApS Årsberetning til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler.......Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler....

  6. Thrombotic risk assessment in APS: the Global APS Score (GAPSS).

    Science.gov (United States)

    Sciascia, S; Bertolaccini, M L

    2014-10-01

    Recently, we developed a risk score for antiphospholipid syndrome (APS) (Global APS Score or GAPSS). This score derived from the combination of independent risk factors for thrombosis and pregnancy loss, taking into account the antiphospholipid antibodies (aPL) profile (criteria and non-criteria aPL), the conventional cardiovascular risk factors, and the autoimmune antibodies profile. We demonstrate that risk profile in APS can be successfully assessed, suggesting that GAPSS can be a potential quantitative marker of APS-related clinical manifestations. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  7. Development of a kinetic model for biological sulphate reduction ...

    African Journals Online (AJOL)

    The Rhodes BioSUREÆÊ Process is a low-cost active treatment system for acid mine drainage (AMD) waters. Central to this process is biological sulphate reduction (BSR) using primary sewage sludge (PSS) as the electron donor and organic carbon source, with the concomitant reduction of sulphate to sulphide and ...

  8. Anisotropy in elastic properties of lithium sodium sulphate ...

    Indian Academy of Sciences (India)

    Administrator

    Figure 1. Photograph of lithium sodium sulphate hexahydrate. (308 K) and lithium sodium sulphate crystals grown at 313 K,. 315 K, 317 K, 319 K and 323 K. velocities in these crystals in the specified directions are tabulated in table 1. The values of the elastic constants, compliance constants and Poisson's ratios of LSSW.

  9. Screening for childhood anaemia using copper sulphate densitometry

    African Journals Online (AJOL)

    Screening for childhood anaemia using copper sulphate densitometry. M Funk, T Hambrock, G C van Niekerk, D F Wittenberg. Abstract. Objective. To evaluate copper sulphate densitometry to screen for childhood anaemia in a primary care setting, with a view to identifying children requiring definitive diagnostic testing and ...

  10. Inhibition of Bio corrosion of steel coupon by sulphate reducing ...

    African Journals Online (AJOL)

    ADOWIE PERE

    ABSTRACT; The inhibition of biocorrosion of steel coupons by sulphate reducing bacteria (SRB) and Iron oxidizing bacteria (IOB) using Aloe vera (Aloe barbadensis) extract was tested. The water sample revealed a heterotrophic bacterial count of 1.7x103 cfu/ml for the sulphate reducing bacteria and 4.1x103 cfu/ml for the ...

  11. Safety and efficacy of Bolus administration of magnesium sulphate ...

    African Journals Online (AJOL)

    Safety and efficacy of Bolus administration of magnesium sulphate for preeclampsia. ... On-going research is addressing its administration in terms of dosage, duration and safety. Objective: We evaluated a ... Keywords: safety, efficacy, bolus magnesium sulphate, preeclampsia, University of Benin Teaching Hospital

  12. The formulation and evaluation of terbutaline sulphate and dry ...

    African Journals Online (AJOL)

    In this study we report the use of low rugosity lactose, productof controlled crystallization of this carrier, in the formulation of terbutaline sulphate dry powder inhaler. The respirable fraction or the amount of emitted terbutaline sulphate available for deposition in the lungs for therapeutic action is higher in inhalation mixtures ...

  13. Effects of dietary ammonium sulphate (AS) on the performance and ...

    African Journals Online (AJOL)

    Two experiments were designed to investigate the response of broilers to dietary inclusion of ammonium sulphate. In experiment 1, day old chicks were fed diets with 0,1,2 or 3 % ammonium sulphate (AS) during the starter phase (0 –4 weeks). In experiment 2, broilers chicks were raised on a standard diet from 0 – 4 weeks ...

  14. Differential responses of freshwater wetland soils to sulphate pollution

    NARCIS (Netherlands)

    Lamers, L.P.M.; Dolle, ten G.E.; Berg, van den S.T.G.; Delft, van S.P.J.; Roelofs, J.G.M.

    2001-01-01

    Sulphate (SO42-) reduction rates are generally low in freshwater wetlands and are regulated by the scarce availability of the ion. Increased concentrations of this electron acceptor due to sulphur (S) pollution of groundwater and surface water may, however, lead to high sulphate reduction rates now

  15. Redox buffer capacity of sedimentary rocks around uranium deposit. Study of water-mineral-microbe system at the Tono uranium deposit, Japan

    Energy Technology Data Exchange (ETDEWEB)

    Iwatsuki, Teruki; Murakami, Yuki; Hama, Katsuhiro [Japan Nuclear Cycle Development Inst., Toki, Gifu (Japan). Tono Geoscience Center; Naganuma, Takeshi [Hiroshima Univ., Higashi-Hiroshima, Hiroshima (Japan). School of Biosphere Sciences

    2003-06-01

    The redox buffer capacity of the water-mineral-microbe system in and around the Tono uranium deposit, Japan, was studied to evaluate the long-term stability of the redox system. The uranium deposit occurs in the lower part of a Miocene sedimentary rock sequence that unconformably overlies granite. In the groundwater, profiles of redox sensitive solutes such as sulphate and sulphide ions, abundance and viability of microbes, and sulphur isotope ratios of sulphate ions suggest that microbial sulphate reduction involving organic matter and subsequent pyrite precipitation are dominant redox reactions at the depths of the uranium ore bodies. Concentrations of both the sulphate and chloride increase with increasing depth. The dissolved sulphate is surmised to have originated from dissolution of sulphate and sulphide minerals in a geologic marine formation precipitated in marine environments, in the upper part of the sedimentary rocks. Such a redox process in the water-mineral-microbe system is inferred to have continued from the time when the marine formation underwent uplift above sea-level, because sulphate-reducing bacteria can use sulphate ions dissolved in fresh water that infiltrates from the marine formation and organic matter located in the deeper sedimentary rocks. The chloride ion also has a linear relationship with groundwater residence time. from the relationship between sulphate and chloride ion concentrations, the sulphate ion dissolution rates from the marine formation are estimated at about 5.9 x 10{sup -5} mM/yr. Calculations by using the sulphate-S contents of the rocks and the sulphate dissolution rate suggest that microbial sulphate reduction alone could maintain sufficiently reducing conditions to preserve the uranium ore for several hundred thousand years, in the case where a hydrogeological system continues to exist without much change. (author)

  16. Redox buffer capacity of sedimentary rocks around uranium deposit. Study of water-mineral-microbe system at the Tono uranium deposit, Japan

    International Nuclear Information System (INIS)

    Iwatsuki, Teruki; Murakami, Yuki; Hama, Katsuhiro; Naganuma, Takeshi

    2003-01-01

    The redox buffer capacity of the water-mineral-microbe system in and around the Tono uranium deposit, Japan, was studied to evaluate the long-term stability of the redox system. The uranium deposit occurs in the lower part of a Miocene sedimentary rock sequence that unconformably overlies granite. In the groundwater, profiles of redox sensitive solutes such as sulphate and sulphide ions, abundance and viability of microbes, and sulphur isotope ratios of sulphate ions suggest that microbial sulphate reduction involving organic matter and subsequent pyrite precipitation are dominant redox reactions at the depths of the uranium ore bodies. Concentrations of both the sulphate and chloride increase with increasing depth. The dissolved sulphate is surmised to have originated from dissolution of sulphate and sulphide minerals in a geologic marine formation precipitated in marine environments, in the upper part of the sedimentary rocks. Such a redox process in the water-mineral-microbe system is inferred to have continued from the time when the marine formation underwent uplift above sea-level, because sulphate-reducing bacteria can use sulphate ions dissolved in fresh water that infiltrates from the marine formation and organic matter located in the deeper sedimentary rocks. The chloride ion also has a linear relationship with groundwater residence time. from the relationship between sulphate and chloride ion concentrations, the sulphate ion dissolution rates from the marine formation are estimated at about 5.9 x 10 -5 mM/yr. Calculations by using the sulphate-S contents of the rocks and the sulphate dissolution rate suggest that microbial sulphate reduction alone could maintain sufficiently reducing conditions to preserve the uranium ore for several hundred thousand years, in the case where a hydrogeological system continues to exist without much change. (author)

  17. Steroid hormone sulphation in lead workers.

    Science.gov (United States)

    Apostoli, P; Romeo, L; Peroni, E; Ferioli, A; Ferrari, S; Pasini, F; Aprili, F

    1989-01-01

    The metabolism of steroid hormones has been investigated in 10 workers exposed to lead and in 10 non-exposed subjects to determine whether lead interferes with the first or second phase reactions of steroid hormone biotransformation, or both. In the exposed workers blood lead concentrations (PbB) ranged from 45 to 69 micrograms/100 ml; in the controls PbB was less than 25 micrograms/100 ml. No statistical differences were found for the total amount of the urinary hormone metabolites, but a drop of about 50% was observed for the sulphated portion. It is suggested that lead interferes with the mechanisms of sulphoconjugation through an effect on the cytosol enzymes sulphotransferase and sulphokinase. PMID:2930732

  18. Westinghouse AP1000 licensing maturity

    International Nuclear Information System (INIS)

    Schulz, T.; Vijuk, R.P.

    2005-01-01

    The Westinghouse AP1000 Program is aimed at making available a nuclear power plant that is economical in the U.S deregulated electrical power industry in the near-term. The AP1000 is two-loop 1000 MWe pressurizer water reactor (PWR). It is an up rated version of the AP600. The AP1000 uses passive safety systems to provide significant and measurable improvements in plant simplification, safety, reliability, investment protection and plant costs. The AP1000 uses proven technology, which builds on over 35 years of operating PWR experience. The AP1000 received Final Design Approval by the United States Nuclear Regulatory Commission (U.S. NRC) in September 2004. The AP1000 meets the US utility requirements. The AP1000 and its sister plant the AP600 have gone through a very through and complete licensing review. This paper describes the U.S. NRC review efforts of both the AP600 and the AP1000. The detail of the review and the independent calculations, evaluations and testing is discussed. The AP600 licensing documentation was submitted in 1992. The U.S. NRC granted Final Design Approval in 1999. During the intervening 7 years, the U.S. NRC asked thousands of questions, performed independent safety analysis, audited Westinghouse calculations and analysis, and performed independent testing. The more significant areas of discussion will be described. For the AP1000 Westinghouse first engaged the U.S. NRC in pre-certification discussions to define the extent of the review required, since the design is so similar to the AP600. The AP1000 licensing documentation was submitted in March 2002. The U.S. NRC granted Final Design Approval in September 2004. During the intervening 2 1/2 years, the U.S. NRC asked hundreds of questions, performed independent safety analysis, audited Westinghouse calculations and analysis, and performed independent testing. The more significant areas of discussion will be described. The implications of this review and approval on AP1000 applications in

  19. Center for Geometrisk Metrologi, CGM ApS

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2002. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000...

  20. Sulphate Incorporation in Borosilicate Glasses and Melts: a Kinetic Approach

    Energy Technology Data Exchange (ETDEWEB)

    Lenoir, M. [CEA, DEN, Laboratoire d' etude et de Developpement de Matrices de Conditionnement, Centre de Marcoule, 30207 Bagnols-sur-Ceze (France); Physique des Mineraux et Magmas, UMR 7047, CNRS- Institut de Physique du Globe de Paris, 7 place Jussieu, 75252 Paris 05 (France); Grandjean, A. [Institut de Chimie Separative de Marcoule, UMR 5257, Laboratoire des Nanomateriaux Autoreparants, Marcoule, 30207 Bagnols-sur-Ceze (France); Dussossoy, J.L. [CEA, DEN, Laboratoire d' etude et de Developpement de Matrices de Conditionnement, Centre de Marcoule, 30207 Bagnols-sur-Ceze (France); Neuville, D.R. [Physique des Mineraux et Magmas, UMR 7047, CNRS- Institut de Physique du Globe de Paris, 7 place Jussieu, 75252 Paris 05 (France)

    2008-07-01

    The kinetics of sulphate departure in a sodium borosilicate melt were studied using in situ Raman spectroscopy. This technique allows the quantification of the amount of sulphate dissolved in a borosilicate glass as a function of heating time by comparison with measurements obtained by microprobe wavelength dispersive spectrometry. To quantify the sulphate content obtained with Raman spectroscopy, the integrated intensity of the sulphate band at 990 cm{sup -1} was scaled to the sum of the integrated bands between 800 and 1200 cm{sup -1}, bands that are assigned to Qn silica units on the basis of previous literature. Calibration curves were then determined for two different samples. An evaluation of the kinetics of departure of sulphate could thus be made as a function of the viscosity of the borosilicate glass, showing that the kinetics were controlled by the diffusion of sulphate and its volatilization from the melt. This experimental method allows in situ measurements of sulphate content at high temperature which cannot be obtained by any other simple technique. (authors)

  1. AP1000 Design for Security

    International Nuclear Information System (INIS)

    Long, L.B.; Cummins, W.E.; Winters, J.W.

    2006-01-01

    Nuclear power plants are protected from potential security threats through a combination of robust structures around the primary system and other vital equipment, security systems and equipment, and defensive strategy. The overall objective for nuclear power plant security is to protect public health and safety by ensuring that attacks or sabotage do not challenge the ability to safely shutdown the plant or protect from radiological releases. In addition, plants have systems, features and operational strategies to cope with external conditions, such as loss of offsite power, which could be created as part of an attack. Westinghouse considered potential security threats during design of the AP1000 PWR. The differences in plant configuration, safety system design, and safe shutdown equipment between existing plants and AP1000 affect potential vulnerabilities. This paper provides an evaluation of AP1000 with respect to vulnerabilities to security threats. The AP1000 design differs from the design of operating PWRs in the US in the configuration and the functional requirements for safety systems. These differences are intentional departures from conventional PWR designs which simplify plant design and enhance overall safety. The differences between the AP1000 PWR and conventional PWRs can impact vulnerabilities to security threats. The NRC addressed security concerns as part of their reviews for AP1000 Design Certification, and did not identify any security issues of concern. However, much of the detailed security design information for the AP1000 was deferred to the combined Construction and Operating License (COL) phase as many of the security issues are site-specific. Therefore, NRC review of security issues related to the AP1000 is not necessarily complete. Further, since the AP1000 plant design differs from existing PWRs, it is not obvious that the analyses and assessments prepared for existing plants also apply to the AP1000. We conclude that, overall, the AP1000

  2. AP1000. The PWR revisited

    International Nuclear Information System (INIS)

    The distinguishing features of Westinghouse's AP1000 advanced passive pressurized water reactor are highlighted. In particular, the AP1000's passive safety features are described as well as their implications for simplifying the design, construction, and operation of this design compared to currently operating plants, and significantly increasing safety margins over current plants as well. The AP1000 design specifically incorporates the knowledge acquired from the substantial accumulation of power reactor operating experience and benefits from the application of the Probabilistic Risk Assessment in the design process itself. The AP1000 design has been certified by the US Nuclear Regulatory Commission under its new rules for licensing new nuclear plants, 10 CFR Part 52, and is the subject of six combined Construction and Operating License applications now being developed. Currently the AP1000 design is being assessed against the EUR Rev C requirements for new nuclear power plants in Europe. (author)

  3. Autoimmune polyglandular syndrome type 3 (APS-3) among patients with premature ovarian insufficiency (POI).

    Science.gov (United States)

    Szlendak-Sauer, Katarzyna; Jakubik, Daniel; Kunicki, Michał; Skórska, Jolanta; Smolarczyk, Roman

    2016-08-01

    , dehydroepiandrostendione sulphate in comparison to controls. Women with POI/APS-3(+) could have hyperinsulinemia and should be carefully evaluated for metabolic disorders. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  4. Sulphate removal from sodium sulphate-rich brine and recovery of barium as a barium salt mixture.

    Science.gov (United States)

    Vadapalli, Viswanath R K; Zvimba, John N; Mulopo, Jean; Motaung, Solly

    2013-01-01

    Sulphate removal from sodium sulphate-rich brine using barium hydroxide and recovery of the barium salts has been investigated. The sodium sulphate-rich brine treated with different dosages of barium hydroxide to precipitate barium sulphate showed sulphate removal from 13.5 g/L to less than 400 mg/L over 60 min using a barium to sulphate molar ratio of 1.1. The thermal conversion of precipitated barium sulphate to barium sulphide achieved a conversion yield of 85% using coal as both a reducing agent and an energy source. The recovery of a pure mixture of barium salts from barium sulphide, which involved dissolution of barium sulphide and reaction with ammonium hydroxide resulted in recovery of a mixture of barium carbonate (62%) and barium hydroxide (38%), which is a critical input raw material for barium salts based acid mine drainage (AMD) desalination technologies. Under alkaline conditions of this barium salt mixture recovery process, ammonia gas is given off, while hydrogen sulfide is retained in solution as bisulfide species, and this provides basis for ammonium hydroxide separation and recovery for reuse, with hydrogen sulfide also recoverable for further industrial applications such as sulfur production by subsequent stripping.

  5. New french uranium mineral species

    International Nuclear Information System (INIS)

    Branche, G.; Chervet, J.; Guillemin, C.

    1952-01-01

    In this work, the authors study the french new uranium minerals: parsonsite and renardite, hydrated phosphates of lead and uranium; kasolite: silicate hydrated of uranium and lead uranopilite: sulphate of uranium hydrated; bayleyite: carbonate of uranium and of hydrated magnesium; β uranolite: silicate of uranium and of calcium hydrated. For all these minerals, the authors give the crystallographic, optic characters, and the quantitative chemical analyses. On the other hand, the following species, very rare in the french lodgings, didn't permit to do quantitative analyses. These are: the lanthinite: hydrated uranate oxide; the α uranotile: silicate of uranium and of calcium hydrated; the bassetite: uranium phosphate and of hydrated iron; the hosphuranylite: hydrated uranium phosphate; the becquerelite: hydrated uranium oxide; the curite: oxide of uranium and lead hydrated. Finally, the authors present at the end of this survey a primary mineral: the brannerite, complex of uranium titanate. (author) [fr

  6. Short communication: Use of calcium sulphate dihydrate as an ...

    African Journals Online (AJOL)

    flocculant alternative to the conventional use of aluminium sulphate in the primary treatment of wastewater was evaluated using a jar test apparatus. Samples from the State Water Commission (CEA) in Queretaro, Mexico, were collected for the ...

  7. Sulphate solubility and sulphate diffusion in oxide glasses: implications for the containment of sulphate-bearing nuclear wastes; Solubilite et cinetiques de diffusion des sulfates dans differents verres d'oxydes: application au conditionnement des dechets nucleaires sulfates

    Energy Technology Data Exchange (ETDEWEB)

    Lenoir, M.

    2009-09-15

    The thesis deals with sulphate solubility and sulphate diffusion in oxide glasses, in order to control sulphate incorporation and sulphate volatilization in nuclear waste glasses. It was conducted on simplified compositions, in the SiO{sub 2}-B{sub 2}O{sub 3}-R{sub 2}O (R = Li, Na, K, Cs), SiO{sub 2}-B{sub 2}O{sub 3}-BaO and V{sub 2}O{sub 5}-B{sub 2}O{sub 3}-BaO systems. These compositions allowed us to study the influence of the nature of network-modifying ions (Li{sup +}, Na{sup +}, K{sup +}, Cs{sup +} or Ba{sup 2+}) and also of former elements (Si, B, V), on structure and properties of glasses. Sulphate volatility is studied in sodium borosilicate melts using an innovative technique of sulphate quantitation with Raman spectroscopy. This technique is useful to obtain kinetic curves of sulphate volatilization. The establishment of a model to fit these curves leads to the determination of diffusion coefficients of sulphate. These diffusion coefficients can thus be compared to diffusion coefficients of other species, determined by other techniques and presented in the literature. They are also linked to diffusion coefficients in relation with the viscosity of the melts. Concerning sulphate solubility in glasses, it depends on glass composition and on the nature of sulphate incorporated. Sulphate incorporation in alkali borosilicate glasses leads to the formation of a sulphate layer floating on top of the melt. Sulphate incorporation in barium borosilicate and boro-vanadate glasses leads to the crystallization of sulphate species inside the vitreous matrix. Moreover, sulphate solubility is higher in these glasses than in alkali borosilicates. Finally, exchanges between cations present in glasses and cations present in the sulphate phase are also studied. (author)

  8. Development of melt compositions for sulphate bearing high level waste

    International Nuclear Information System (INIS)

    Jahagirdar, P.B.; Wattal, P.K.

    1997-09-01

    The report deals with the development and characterization of vitreous matrices for sulphate bearing high level waste. Studies were conducted in sodium borosilicate and lead borosilicate systems with the introduction of CaO, BaO, MgO etc. Lead borosilicate system was found to be compatible with sulphate bearing high level wastes. Detailed product evaluation carried on selected formulations is also described. (author)

  9. Meet the APS Editors Reception

    Science.gov (United States)

    2014-03-01

    The APS Journal Editors invite you to join them for conversation and light refreshments. The Editors will be available to answer questions, discuss your ideas, and listen to your comments about the journals. All are welcome to attend.

  10. Demonstration of immunogenic keratan sulphate in commercial chondroitin 6-sulphate from shark cartilage. Implications for ELISA assays

    DEFF Research Database (Denmark)

    Møller, H J; Møller-Pedersen, T; Damsgaard, T E

    1995-01-01

    The prototype monoclonal keratan sulphate (KS) antibody 5D4 that is widely used for detection of KS in tissues and biological fluids reacts strongly with commercial low grade shark cartilage chondroitin 6-sulphate. Characterization of the immunogenic material by chondroitinase ABC digestion, ELISA...... inhibition studies, immunoblotting and HPLC analyses confirmed the presence of substantial amounts of KS, probably as a large proteoglycan (> 120 kDa). Commercial and heterogenic glycosaminoglycan preparations therefore must be used with great caution in immunological analyses. On the other hand the shark...... cartilage chondroitin 6-sulphate is an easy accessible source of immunogenic KS that can be used as a reference standard and as coating antigen in KS-ELISAs. The concentration of immunogenic KS in synovial fluid measured with an ELISA based solely on reagents of shark cartilage chondroitin 6-sulphate...

  11. AP1000TM plant modularization

    International Nuclear Information System (INIS)

    Cantarero L, C.; Demetri, K. J.; Quintero C, F. P.

    2016-09-01

    The AP1000 TM plant is an 1100 M We pressurized water reactor (PWR) with passive safety features and extensive plant simplifications that enhance construction, operation, maintenance and safety. Modules are used extensively in the design of the AP1000 plant nuclear island. The AP1000 plant uses modern, modular-construction techniques for plant construction. The design incorporates vendor-designed skids and equipment packages, as well as large, multi-ton structural modules and special equipment modules. Modularization allows traditionally sequential construction tasks to be completed simultaneously. Factory-built modules can be installed at the site in a planned construction schedule. The modularized AP1000 plant allows many more construction activities to proceed in parallel. This reduces plant construction calendar time, thus lowering the costs of plant financing. Furthermore, performing less work onsite significantly reduces the amount of skilled field-craft labor, which costs more than shop labor. In addition to labor cost savings, doing more welding and fabrication in a factory environment raises the quality of work, allowing more scheduling flexibility and reducing the amount of specialized tools required onsite. The site layout for the AP1000 plant has been established to support modular construction and efficient operations during construction. The plant layout is compact, using less space than previous conventional plant layouts. This paper provides and overview of the AP1000 plant modules with an emphasis on structural modules. Currently the Westinghouse AP1000 plant has four units under construction in China and four units under construction in the United States. All have shown successful fabrication and installation of various AP1000 plant modules. (Author)

  12. EFEITOS QUALITATIVO E QUANTITATIVO DE APLICAÇÃO DO ZINCO NO CAPIM TANZÂNIA-1 QUALITIVE AND QUANTITATIVE EFFECTS OF THE ZINC SULPHATE APPLICATION ON TANZÂNIA-1 GRASS

    Directory of Open Access Journals (Sweden)

    Cideon Donizete de Faria

    2007-09-01

    latosol, having as objective to evaluate the effect of the doses 0, 10, 20, 40 and 80 kg ha-1 of zinc sulphate in the productivity, quality and leaf chemical composition of the Tanzânia-1 grass. The soil was prepared with a heavy grade bar in the beginning of the rainy station. As basic fertilization were applied 20 kg of N, 50 kg of P2O5 and 30 kg of K2O ha-1 as ammonium sulphate, commercial Yoorin and potassium chloride, respectively. The plant height and number of budding, gross protein, and fiber in neutral detergent and leaf mineral nutrient were determined just after were evaluated at 60 days after germination. Green mass, dry matter, gross the crop. Although no significant, the dose of 20 kg ha-1 of zinc sulphate influenced qualitative and quantitatively the forage produced.

    KEY-WORDS: Pasture; soil; fertility; sudding; dry matter.

  13. Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations (I): catastrophic APS, APS nephropathy and heart valve lesions.

    Science.gov (United States)

    Cervera, R; Tektonidou, M G; Espinosa, G; Cabral, A R; González, E B; Erkan, D; Vadya, S; Adrogué, H E; Solomon, M; Zandman-Goddard, G; Shoenfeld, Y

    2011-02-01

    The objectives of the 'Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations' were to assess the clinical utility of the international consensus statement on classification criteria and treatment guidelines for the catastrophic APS, to identify and grade the studies that analyse the relationship between the antiphospholipid antibodies and the non-criteria APS manifestations and to present the current evidence regarding the accuracy of these non-criteria APS manifestations for the detection of patients with APS. This article summarizes the studies analysed on the catastrophic APS, APS nephropathy and heart valve lesions, and presents the recommendations elaborated by the Task Force after this analysis.

  14. Mineralization of Nitrogen in Hydromorphic Soils Amended with ...

    African Journals Online (AJOL)

    ... to 320.00 mg kg-1 for Mangrove soil (mangal acid sulphate soils). The order of cumulative nitrogen released in the waste amended soil followed the order: sewage sludge>kitchen waste> poultry manure> oil palm waste> cow manure. Total mineralized N indicated negative correlation with total organic N and C:N ratio ...

  15. Classification of mineral water types and comparison with drinking water standards

    NARCIS (Netherlands)

    Aa, NGFM van der

    2003-01-01

    In a study of 291 mineral waters from 41 different countries, 9-20% exceeded the Dutch drinking water standards for chloride, calcium, magnesium, kalium, sodium, sulphate and fluorine. The mineral water quality cannot be qualified as bad since the standards for these compounds with the exception of

  16. APS Education and Diversity Efforts

    Science.gov (United States)

    Prestridge, Katherine; Hodapp, Theodore

    2015-11-01

    American Physical Society (APS) has a wide range of education and diversity programs and activities, including programs that improve physics education, increase diversity, provide outreach to the public, and impact public policy. We present the latest programs spearheaded by the Committee on the Status of Women in Physics (CSWP), with highlights from other diversity and education efforts. The CSWP is working to increase the fraction of women in physics, understand and implement solutions for gender-specific issues, enhance professional development opportunities for women in physics, and remedy issues that impact gender inequality in physics. The Conferences for Undergraduate Women in Physics, Professional Skills Development Workshops, and our new Professional Skills program for students and postdocs are all working towards meeting these goals. The CSWP also has site visit and conversation visit programs, where department chairs request that the APS assess the climate for women in their departments or facilitate climate discussions. APS also has two significant programs to increase participation by underrepresented minorities (URM). The newest program, the APS National Mentoring Community, is working to provide mentoring to URM undergraduates, and the APS Bridge Program is an established effort that is dramatically increasing the number of URM PhDs in physics.

  17. [Apheresis in antiphospholipid syndrome (APS)].

    Science.gov (United States)

    De Silvestro, Giustina; Tison, Tiziana; Marson, Piero

    2012-01-01

    Antiphospholipid syndrome (APS) is a rare clinical disorder characterized by thromboembolic manifestations and/or obstetric complications. Along with the clinical symptoms and signs, serum antiphospholipid antibodies have to be detected. APS can be primary, i.e., without any concomitant disorders, or secondary to other autoimmune diseases, particularly systemic lupus erythematosus. Criteria for the diagnosis of APS have been clearly established. Hyperacute APS (or catastrophic antiphospholipid syndrome), often with a poor prognosis, must meet four criteria: involvement of three or more organs, rapid evolution of clinical manifestations, microangiopathic occlusion of small blood vessels at biopsy, and presence of antiphospholipid antibodies. The rationale for apheresis treatment is the removal of pathogenetic antibodies involved in the development of tissue damage. Our experience includes 23 patients, in particular 15 women treated for 19 pregnancies. According to the National Guidelines Program, the effectiveness of apheresis in catastrophic syndrome has a level of evidence of V/VI, with a strength of recommendation A; in highrisk pregnancy it has a level of evidence of V with a strength of recommendation B. It will be necessary to better define the prognosis of various categories of pregnant patients with APS, as well as useful laboratory parameters to monitor its clinical course and anticipate any complications of pregnancy.

  18. Extraction of Iron and Manganese from Pyrolusite Absorption Residue by Ammonium Sulphate Roasting–Leaching Process

    Directory of Open Access Journals (Sweden)

    Lin Deng

    2018-01-01

    Full Text Available The residue from desulfurization and denitrification of exhaust gas treatment process with pyrolusite ore as absorbent is regarded as a potential source of iron and manganese. In this study, an extraction process is proposed for recovery of iron and manganese with ammonium sulphate roasting followed by sulphuric acid leaching. Firstly, the conversion mechanism was analyzed through mineral phase analysis of roasting products at different roasting temperature by means of X-ray diffraction (XRD technology. Then, the parameters of the roasting procedure such as roasting temperature and time, ammonium sulphate dosage, leaching temperature, leaching time, and sulphuric acid concentration are examined. The results implicate that the iron oxide and manganese dioxide in the residue are firstly converted into the water-soluble ( NH 4 3 Fe ( SO 4 3 and ( NH 4 2 Mn 2 ( SO 4 3 at 200–350 °C, and then the more stable NH 4 Fe ( SO 4 2 and MnSO 4 are formed, at temperature higher than 350 °C. Under optimum conditions, 95.2% Fe and 97.0% Mn can be extracted. Reactant diffusion through inert layer of silicon dioxide was considered as the rate-limiting step for iron extraction with an activation energy of 20.56 kJ/mol, while, the recovery process of Mn was controlled by both reactant diffusion and chemical reaction with an activation energy of 29.52 kJ/mol.

  19. Treatment with magnesium sulphate in pre-term birth

    DEFF Research Database (Denmark)

    Wolf, Hans; Hegaard, H K; Greisen, G

    2012-01-01

    Premature birth increases a child's risk of cerebral palsy and death. The aim of this work is to investigate the association between treatment with magnesium sulphate during premature deliveries and infants' cerebral palsy and mortality through a meta-analysis of observational studies. A comprehe......Premature birth increases a child's risk of cerebral palsy and death. The aim of this work is to investigate the association between treatment with magnesium sulphate during premature deliveries and infants' cerebral palsy and mortality through a meta-analysis of observational studies....... A comprehensive search of the Cochrane Library, EMBASE and the PubMed database from their inceptions to 1 October, 2010 using the keywords 'magnesium sulphate, children/infant/pre-term/premature and cerebral palsy/mortality/morbidity/adverse effects/outcome' identified 11 reports of observational studies. Two...... authors working independently extracted the data. A meta-analysis of the data found an association between magnesium sulphate treatment and a significantly reduced risk of mortality (RR 0.73; 95% CI 0.61-0.89) and cerebral palsy (OR 0.64; 95% CI 0.47-0.89). Antenatal treatment with magnesium sulphate...

  20. Uranium and sulphate values from carbonate leach process

    International Nuclear Information System (INIS)

    Berger, B.

    1983-01-01

    The process concerns the recovery of uraniferous and sulphur values from liquor resulting from the attack of sulphur containing uraniferous ores by an alkaline solution of sodium carbonate and/or bicarbonate. Ammonia is introduced into the liquor to convert any HCO 3 - to CO 3 2- . The neutralised liquor from this step is then contacted with an anion exchange resin to fix the uranium and sulphate ions, leaving a liquor containing ammonia, sodium carbonate and/or bicarbonate in solution. Uranium and sulphate ions are eluted with an ammonia carbonate and/or bicarbonate solution to yield a solution of ammonium uranyl carbonate complex and ammonium sulphate. The solution is subjected to thermal treatment until a suspension of precipitated ammonium uranate and/or diuranate is obtained in a solution of the ammonium sulphate. Carbon dioxide, ammonia and water vapor are driven off. The precipitated ammonium uranate and/or diuranate is then separated from the solution of ammonium sulphate and the precipitate is calcined to yield uranium trioxide and ammonia

  1. AP Human Geography and Success on the AP Test

    Science.gov (United States)

    Roncone, John; Newhalfen, Nate

    2013-01-01

    Classroom projects that explore culture and globalization enhance the curriculum and help students see how geography directly connects to their lives. These authors contend that a project-based approach can supplement the teaching of an AP Human Geography course, and visualize this course as an essential tool for students to truly understand how…

  2. Uptake of 35S sulphate by Xenopus cartilage

    International Nuclear Information System (INIS)

    Ishii, Takehisa; Kikuyama, Sakae

    1984-01-01

    Hypohysectomized juvenile Xenopus were injected with growth hormone (GH) or prolactin (PRL) of either ovine or bullfrog origin and the growthpromoting activity of these hormones was measured by monitoring the uptake of 35 S sulphate by the xiphisternal cartilage in vitro. Analysis of the labelled cartilage revealed that the acid mucopolysaccharide fraction contained about 60 - 80 % of the label and that most of them were incorporated into chondroitin sulphates. All of the hormones tested enhaced the 35 S sulphate uptake dose-dependently. Among them bullfrog GH was most effective, then followed ovine GH and ovine PRL. Bullfrog PRL was far less effective than other three. The sensitive assay for frog GH developed in the present experiment may be applicable to the assay for somatomedin-like activity and contribute to the analysis of the mode of action of GH in amphibians. (author)

  3. Corrosion Performance of Inconel 625 in High Sulphate Content

    Science.gov (United States)

    Ismail, Azzura

    2016-05-01

    Inconel 625 (UNS N06625) is a type of nickel-chromium-molybdenum alloy with excellent corrosion resistance in a wide range of corrosive media, being especially resistant to pitting and crevice corrosion. However, in aggressive environment, Inconel 625 will suffer corrosion attack like other metals. This research compared the corrosion performance of Inconel 625 when exposed to higher sulphate content compared to real seawater. The results reveal that Inconel 625 is excellent in resist the corrosion attack in seawater. However, at increasing temperature, the corrosion resistance of this metal decrease. The performance is same in seawater with high sulphate content at increasing temperature. It can be concluded that sulphate promote perforation on Inconel 625 and become aggressive agents that accelerate the corrosion attack.

  4. How sulphate-reducing microorganisms cope with stress: Lessons from systems biology

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, J.; He, Q.; Hemme, C.L.; Mukhopadhyay, A.; Hillesland, K.; Zhou, A.; He, Z.; Nostrand, J.D. Van; Hazen, T.C.; Stahl, D.A.; Wall, J.D.; Arkin, A.P.

    2011-04-01

    Sulphate-reducing microorganisms (SRMs) are a phylogenetically diverse group of anaerobes encompassing distinct physiologies with a broad ecological distribution. As SRMs have important roles in the biogeochemical cycling of carbon, nitrogen, sulphur and various metals, an understanding of how these organisms respond to environmental stresses is of fundamental and practical importance. In this Review, we highlight recent applications of systems biology tools in studying the stress responses of SRMs, particularly Desulfovibrio spp., at the cell, population, community and ecosystem levels. The syntrophic lifestyle of SRMs is also discussed, with a focus on system-level analyses of adaptive mechanisms. Such information is important for understanding the microbiology of the global sulphur cycle and for developing biotechnological applications of SRMs for environmental remediation, energy production, biocorrosion control, wastewater treatment and mineral recovery.

  5. Study of thermoluminescence properties of Eppawala apatite mineral and its suitability as a dosimetric material

    CERN Document Server

    Jayalath, A

    2000-01-01

    This study reports TL properties and the dosimetric properties of natural apatite mineral obtained from Eppawala Apatite ore in Sri Lanka. This mineral was used to study glow curve characteristics by using (a) the powder form of the raw mineral (b) sieved raw mineral and (c) the magnetically separated mineral. The glow curves of magnetically separated apatite showed two peaks. Low temperature peak at 120C, and a high temperature peak at 240C. The emission wavelength of the glow curve is 360 nm. The intensity of the 240C peak become stronger after annealing the mineral to about 180C. Apatite has glow peaks similar to other commonly used TL materials, such as synthetically prepared calcium sulphate:Dy and calcium sulphate:Tm show high intensity peak at 220C and low intensity peaks at 80C and 120C. However, the emission wavelengths of the main peaks are at 428nm and 452 nm for calcium sulphate:Dy and calcium sulphate: Tm respectively. Eppawala apatite mineral showed a linear response to both gamma and beta radia...

  6. APS beamline standard components handbook

    Energy Technology Data Exchange (ETDEWEB)

    Kuzay, T.M.

    1992-01-01

    It is clear that most Advanced Photon Source (APS) Collaborative Access Team (CAT) members would like to concentrate on designing specialized equipment related to their scientific programs rather than on routine or standard beamline components. Thus, an effort is in progress at the APS to identify standard and modular components of APS beamlines. Identifying standard components is a nontrivial task because these components should support diverse beamline objectives. To assist with this effort, the APS has obtained advice and help from a Beamline Standardization and Modularization Committee consisting of experts in beamline design, construction, and operation. The staff of the Experimental Facilities Division identified various components thought to be standard items for beamlines, regardless of the specific scientific objective of a particular beamline. A generic beamline layout formed the basis for this identification. This layout is based on a double-crystal monochromator as the first optical element, with the possibility of other elements to follow. Pre-engineering designs were then made of the identified standard components. The Beamline Standardization and Modularization Committee has reviewed these designs and provided very useful input regarding the specifications of these components. We realize that there will be other configurations that may require special or modified components. This Handbook in its current version (1.1) contains descriptions, specifications, and pre-engineering design drawings of these standard components. In the future, the APS plans to add engineering drawings of identified standard beamline components. Use of standard components should result in major cost reductions for CATs in the areas of beamline design and construction.

  7. APS beamline standard components handbook

    International Nuclear Information System (INIS)

    Kuzay, T.M.

    1992-01-01

    It is clear that most Advanced Photon Source (APS) Collaborative Access Team (CAT) members would like to concentrate on designing specialized equipment related to their scientific programs rather than on routine or standard beamline components. Thus, an effort is in progress at the APS to identify standard and modular components of APS beamlines. Identifying standard components is a nontrivial task because these components should support diverse beamline objectives. To assist with this effort, the APS has obtained advice and help from a Beamline Standardization and Modularization Committee consisting of experts in beamline design, construction, and operation. The staff of the Experimental Facilities Division identified various components thought to be standard items for beamlines, regardless of the specific scientific objective of a particular beamline. A generic beamline layout formed the basis for this identification. This layout is based on a double-crystal monochromator as the first optical element, with the possibility of other elements to follow. Pre-engineering designs were then made of the identified standard components. The Beamline Standardization and Modularization Committee has reviewed these designs and provided very useful input regarding the specifications of these components. We realize that there will be other configurations that may require special or modified components. This Handbook in its current version (1.1) contains descriptions, specifications, and pre-engineering design drawings of these standard components. In the future, the APS plans to add engineering drawings of identified standard beamline components. Use of standard components should result in major cost reductions for CATs in the areas of beamline design and construction

  8. Sulphate and chloride aerosols during Holocene and last glacial periods preserved in the Talos Dome Ice Core, a peripheral region of Antarctica

    Directory of Open Access Journals (Sweden)

    Yoshinori Iizuka

    2013-04-01

    Full Text Available Antarctic ice cores preserve the record of past aerosols, an important proxy of past atmospheric chemistry. Here we present the aerosol compositions of sulphate and chloride particles in the Talos Dome (TD ice core from the Holocene and Last Glacial Period. We find that the main salt types of both periods are NaCl, Na2SO4 and CaSO4, indicating that TD ice contains relatively abundant sea salt (NaCl from marine primary particles. By evaluating the molar ratio of NaCl to Na2SO4, we show that about half of the sea salt does not undergo sulphatisation during late Holocene. Compared to in inland Antarctica, the lower sulphatisation rate at TD is probably due to relatively little contact between sea salt and sulphuric acid. This low contact rate can be related to a reduced time of reaction for marine-sourced aerosol before reaching TD and/or to a reduced post-depositional effect from the higher accumulation rate at TD. Many sulphate and chloride salts are adhered to silicate minerals. The ratio of sulphate-adhered mineral to particle mass and the corresponding ratio of chloride-adhered mineral both increase with increasing dust concentration. Also, the TD ice appears to contain Ca(NO32 or CaCO3 particles, thus differing from aerosol compositions in inland Antarctica, and indicating the proximity of peripheral regions to marine aerosols.

  9. Thermodynamic study of copper sulphate and zinc sulphate in water and binary aqueous mixtures of propylene glycol

    OpenAIRE

    R. C. Thakur; Ravi Sharma; Meenakshi; Ashish Kumar

    2015-01-01

    Partial molar volumes of copper sulphate and zinc sulphate have been determined in water and binary aqueous mixtures of propylene glycol (2,4,6 and 8% by weight of propylene glycol) at 303.15 K with the help of density measurements. Effect of temperature on the partial molar volumes was also analysed for these salts in water and binary aqueous mixtures of propylene glycol. Results obtained have been analysed by Masson’s equation and the experimental values of slopes and partial molar volumes ...

  10. Radiation effects on active pixel sensors (APS)

    International Nuclear Information System (INIS)

    Cohen, M.; David, J.P.

    1999-01-01

    Active pixel sensor (APS) is a new generation of image sensors which presents several advantages relatively to charge coupled devices (CCDs) particularly for space applications (APS requires only 1 voltage to operate which reduces considerably current consumption). Irradiation was performed using 60 Co gamma radiation at room temperature and at a dose rate of 150 Gy(Si)/h. 2 types of APS have been tested: photodiode-APS and photoMOS-APS. The results show that photoMOS-APS is more sensitive to radiation effects than photodiode-APS. Important parameters of image sensors like dark currents increase sharply with dose levels. Nevertheless photodiode-APS sensitivity is one hundred time lower than photoMOS-APS sensitivity

  11. Interdependent action of nickel sulphate and X-rays on human lymphoblastoid leukeamic cells

    International Nuclear Information System (INIS)

    Bensimon, Jacques

    1977-01-01

    In a first experiment, cells were cultured in media supplemented by nickel sulphate, irradiated in same media and cultured in same media after irradiation. In a second experiment, cells were cultured during 18hrs. in media supplemented by nickel sulphate, and then cells were washed and cultured in normal media where they were irradiated. The nickel sulphate toxicity appears as a creasing function of the nickel sulphate concentration and the nickel sulphate action endurance. The nickel sulphate toxic effect is amplified by X-rays. This amplification is a time function that depends on the X-ray dose, nickel sulphate concentration and period of time from the outset of culture to the irradiation. The nickel sulphate toxic effect appears faster when nickel works after X-rays [fr

  12. Improved sulphate removal rates at increased sulphide concentration in the sulphidogenic bioreactor

    CSIR Research Space (South Africa)

    Greben, HA

    2005-07-01

    Full Text Available on the sulphate reduction rates. The results of three investigations operating a continuous reactor, a column reactor and batch-test reactors have shown that increased sulphide concentrations have resulted in improved biological sulphate reduction. In all...

  13. Gastrointestinal tract wall visualization and distention during abdominal and pelvic multidetector CT with a neutral barium sulphate suspension: comparison with positive barium sulphate suspension and with water.

    Science.gov (United States)

    Oliva, M R; Erturk, S M; Ichikawa, T; Rocha, T; Ros, P R; Silverman, S G; Mortele, K J

    2012-01-01

    When examining patients with contrast-enhanced multidetector-row CT, we determined if the stomach and small bowel were visualized and distended better with a neutral barium sulphate suspension than with positive barium sulphate suspension or water. After obtaining approval from our institutional review board, 156 patients (women: 84; mean age: 54 yrs) with no history of gastrointestinal tract disease were randomized prospectively to receive orally either 900 ml of neutral (0.1% w/v) barium sulphate suspension (n = 53), 900 ml of positive (2.1% w/v) barium sulphate suspension (n = 53), or 900 ml of water (n = 50), prior to undergoing contrast-enhanced abdominal and pelvic multidetector-row CT. Two independent radiologists evaluated the stomach, and small bowel, for luminal distension and wall visualization, using a five point scale. Results were compared using Kruskal-Wallis and Mann-Whitney U tests. The walls of the stomach, and small bowel were visualized better in patients who were administered neutral barium sulphate suspension than those who were administered either positive barium sulphate suspension (p barium sulphate suspension, the stomach and small bowel were distended better compared to patients administered water (p barium sulphate suspension (p contrast-enhanced abdominal and pelvic multidetector-row CT, orally administered neutral barium sulphate suspension allows the gastrointestinal tract to be visualized and distended better than either positive barium sulphate suspension, or water.

  14. Contribution of sodium dodecyl sulphate and sodium lauric acid in ...

    Indian Academy of Sciences (India)

    Contribution of sodium dodecyl sulphate and sodium lauric acid in the one-pot synthesis of intercalated ... chain length but different anion groups were used together as intercalates to prepare intercalated ZnAl–layered double hydroxides ... assembly method, LDHs layers and surfactants are closely interconnected.

  15. Crystallisation of mixtures of ammonium nitrate, ammonium sulphate and soot

    NARCIS (Netherlands)

    Dougle, P.G.; Veefkind, J.P.; Brink, H.M. ten

    1998-01-01

    Crystallisation of laboratory aerosols of ammonium nitrate and of internal mixtures of this salt with ammonium sulphate were investigated using humidity controlled nephelometry. The aerosol was produced via nebulizing of solutions and then dried to 25% RH, which is a realistic minimum value for

  16. Single crystal neutron diffraction study of triglycine sulphate revisited

    Indian Academy of Sciences (India)

    Abstract. In order to get the exact hydrogen-bonding scheme in triglycine sulphate. (TGS), which is an important hydrogen bonded ferroelectric, a single crystal neutron diffraction study was undertaken. The structure was refined to an R-factor of R[F2] = 0.034. Earlier neutron structure of TGS was reported with a very limited ...

  17. Biological sulphate reduction with primary sewage sludge in an ...

    African Journals Online (AJOL)

    The experimental results indicate that high treatment efficiency was achieved at more than 90% sulphate reduction at a liquid hydraulic retention time (HRT) of 13.5 h. In this ... From these results, it can be concluded that the UASB configuration using PSS as energy source would be a viable method for the BSR of AMD.

  18. Density and viscosity of magnesium sulphate in formamide + ...

    Indian Academy of Sciences (India)

    Abstract. Densities (ρ) and viscosities (η) of different strengths of magnesium sulphate (MgSO4) in varying proportions of formamide (FA) + ethylene glycol as mixed solvents were measured at room temperature. The experimental values of ρ and η were used to calculate the values of the apparent molar volume, (φv), partial ...

  19. Effect of anhydrous magnesium sulphate fertilizer and cutting ...

    African Journals Online (AJOL)

    Effect of anhydrous magnesium sulphate fertilizer on Panicum maximum yield and chemical composition of the resultant herbage harvested at 3, 4 and 5 weeks of age was investigated. The treatments were labeled T1 to T6. T1 was fertilized and harvested at 3 weeks cutting interval, T2 was fertilized and harvested at 4 ...

  20. Decolourisation and degradation of textile dyes using a sulphate ...

    African Journals Online (AJOL)

    Successful decolourisation and degradation of textile dyes was achieved in a biosulphidogenic batch reactor using biodigester sludge from a local municipality waste treatment plant as a source of carbon and microflora that augmented a sulphate reducing bacteria (SRB) consortium. Orange II (O II) was decolourised by ...

  1. Decolourisation and degradation of reactive blue 2 by sulphate ...

    African Journals Online (AJOL)

    This work was performed to determine the influence of heat treatment on sewage sludge and addition of zero valent iron (ZVI) on the degradation and decolourisation of an anthraquinone dye, reactive blue 2 (RB 2). A consortium of sulphate reducing bacteria (SRB) in a biosulphidogenic batch reactor with biodigester ...

  2. Microstructural Effects of Sulphate Attack in Sustainable Grouts for Micropiles

    Directory of Open Access Journals (Sweden)

    José Marcos Ortega Álvarez

    2016-11-01

    Full Text Available Nowadays, the use of micropiles has undergone a great development. In general, they are made with cement grout, reinforced with steel tubing. In Spain, these grouts are prepared using OPC, although the standards do not forbid the use of other cements, like sustainable ones. Micropiles are in contact with soils and groundwater, in which the presence of sulphates is common. Their deleterious effects firstly affect to the microstructure. Then, the aim of this research is to study the effects of sulphate attack in the microstructure of micropiles grouts, prepared with OPC, fly ash and slag commercial cements, compared to their behaviour when they are exposed to an optimum hardening condition. The microstructure evolution has been studied with the non-destructive impedance spectroscopy technique, which has never been used for detecting the effects of sulphate attack when slag and fly ash cements are used. Its results have been contrasted with mercury intrusion porosimetry and “Wenner” resistivity ones. The 28-day compressive strength of grouts has been also determined. The results of microstructure characterization techniques are in agreement, although impedance spectroscopy is the most sensitive for following the changes in the porous network of grouts. The results showed that micropiles made using fly ash and slag cements could have a good performance in contact with aggressive sodium sulphate media, even better than OPC ones.

  3. Impact of ammonia and sulphate concentration on thermophilic anaerobic digestion.

    Science.gov (United States)

    Siles, J A; Brekelmans, J; Martín, M A; Chica, A F; Martín, A

    2010-12-01

    The effect of increasing concentrations of ammonia and sulphate on thermophilic anaerobic digestion (52 degrees C) was studied at laboratory-scale. The substrate consisted of a synthetic solution supplemented with ammonia and sodium sulphate. In terms of biogas production, the results showed that the C/N and C/SO(4)(2-) thresholds were 4.40 and 1.60, respectively, corresponding to 620 mg FA (free ammonia)/L and 1400 mg SO(4)(2-)/L. No reduction in biogas production was observed until reaching the above concentration of sulphate in the sulphate toxicity test. However, when the concentration of ammonia was increased to 620 mg FA/L in the ammonia toxicity test, a gradual decrease of 21% was observed for the biogas. In order to characterise each set of experiments kinetically, a biogas production first-order kinetic model was used to fit the experimental data. The proposed model accurately predicted the behaviour of the microorganisms affecting the thermophilic anaerobic digestion, allowing its evolution to be predicted. 2010 Elsevier Ltd. All rights reserved.

  4. Kinetic and Thermodynamic Studies on Adsorption of Sulphate from ...

    African Journals Online (AJOL)

    DELL USER

    Kinetic and Thermodynamic Studies on Adsorption of Sulphate from Aqueous Solution by. Magnetite, Activated .... membrane separation, reverse osmosis, chemical ... removal, high energy consumption, reagents cost, disposal of large volume of organic solvents and inefficiency when the metal concentrations are 10 mg/l. 6.

  5. Kinetics and mechanism of protection of thymine from sulphate ...

    Indian Academy of Sciences (India)

    The rates of photooxidation of thymine in presence of peroxydisulphate (PDS) have been determined by measuring the absorbance of thymine at 264 nm spectrophotometrically. The rates and the quantum yields () of oxidation of thymine by sulphate radical anion have been determined in the presence of different ...

  6. Sodium-dodecyl-sulphate-assisted synthesis of Ni nanoparticles ...

    Indian Academy of Sciences (India)

    Stabilized nickel nanoparticles (SNNPs) were prepared using Ni(acac) 2 (acac = acetylacetonate) via a simplesolvothermal method. The synthesis of the nickel nanoparticles was performed in the presence of sodium dodecyl sulphate(SDS) of different concentrations (mole ratios of SDS:Ni(acac) 2 = 1:1, 2:1 and 4:1), as the ...

  7. Growth morphology of zinc tris (thiourea) sulphate crystals

    Indian Academy of Sciences (India)

    The growth morphology of crystals of zinc tris(thiourea) sulphate (ZTS) is investigated experimentally, and computed using the Hartman–Perdok approach. Attachment energies of the observed habit faces are calculated for determining their relative morphological importance. A computer code is developed for carrying out ...

  8. Sodium-dodecyl-sulphate-assisted synthesis of Ni nanoparticles ...

    Indian Academy of Sciences (India)

    2017-11-20

    Nov 20, 2017 ... The synthesis of the nickel nanoparticles was performed in the presence of sodium dodecyl sulphate. (SDS) of different concentrations ... fields of chemical catalysis, rechargeable batteries, catalysis superconductors, magnetic ..... polar group in SDS arrangement and Ni2+ ions were obtained, with the ...

  9. Anisotropy in elastic properties of lithium sodium sulphate ...

    Indian Academy of Sciences (India)

    Anisotropy in elastic properties of lithium sodium sulphate hexahydrate single crystal—An ultrasonic study. GEORGE VARUGHESE. ,∗. , A S KUMAR†, J PHILIP†† and GODFREY LOUIS#. Department of Physics, Catholicate College, Pathanamthitta 689 648, India. †SPAP, M.G. University, Kottayam 686 560, India. ††STIC ...

  10. Sodium-dodecyl-sulphate-assisted synthesis of Ni nanoparticles ...

    Indian Academy of Sciences (India)

    2017-11-20

    Nov 20, 2017 ... Abstract. Stabilized nickel nanoparticles (SNNPs) were prepared using Ni(acac)2 (acac = acetylacetonate) via a simple solvothermal method. The synthesis of the nickel nanoparticles was performed in the presence of sodium dodecyl sulphate. (SDS) of different concentrations (mole ratios of SDS:Ni(acac)2 ...

  11. Mechanism of interaction of vincristine sulphate and rifampicin with ...

    Indian Academy of Sciences (India)

    The mechanism of interaction of vincristine sulphate (VS) and rifampicin (RF) with bovine serum albumin (BSA) has been studied by quenching of BSA fluorescence by RF/VS. The Stern-Volmer plot indicates the presence of a static component in the quenching mechanism. Results also show that both the tryptophan ...

  12. calcium sulphate hemihydrate and bioactive glass composites for ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 41; Issue 2. In vitro bioactivity evaluation of α -calcium sulphate hemihydrate and bioactive glass composites for their potential use in bone regeneration. YANYAN ZHENG CHENGDONG XIONG DUJUAN ZHANG LIFANG ZHANG. Volume 41 Issue 2 April 2018 Article ID ...

  13. Sensitivity and specificity of copper sulphate test in determining ...

    African Journals Online (AJOL)

    Background: The accuracy of the copper sulphate method for the rapid screening of prospective blood donors has been questioned because this rapid screening method may lead to false deferral of truly eligible prospective blood donors. Objective: This study was aimed at determining the sensitivity and specificity of copper ...

  14. The effect of water on the sulphation of limestone

    Energy Technology Data Exchange (ETDEWEB)

    Chunbo Wang; Lufei Jia; Yewen Tan; E.J. Anthony [North China Electric Power University, Baoding City (China). School of Energy and Power Engineering

    2010-09-15

    A series of tests was conducted in a thermogravimetric analyzer (TGA) to study the sulphation behaviour of limestone in the presence of water over the temperature range of 800-850{sup o}C. Four different Canadian limestones, all with a particle size range of 75-425 {mu}m, were sulphated using a synthetic flue gas with a composition of 15% CO{sub 2}, 3% O{sub 2}, 0% or 10% H{sub 2}O, 1750 ppm SO{sub 2} and the balance N{sub 2}. Water was shown to have a significant promotional effect on sulphation, especially in the diffusion-controlled stage. However, the effect of water during the kinetic-controlled stage appeared to be much less pronounced. Based on these results, it is proposed that the presence of water leads to the transient formation of Ca(OH){sub 2} as an intermediate, which in turn reacts with SO{sub 2} at a faster rate than CaO does. Alternatively stated, it appears that H{sub 2}O acts as catalyst for the sulphation reaction of CaO. 30 refs., 8 figs., 3 tabs.

  15. Green chemical incorporation of sulphate into polyoxoanions of ...

    Indian Academy of Sciences (India)

    Green chemical incorporation of sulphate into polyoxoanions of molybdenum to nano level ... Keywords. Polyoxometalate; green synthesis; nanostructures; surfactant. ... The effects of reaction parameters such as concentration of surfactant, temperature and pH of solution on the synthesis of nanospheres were investigated.

  16. Ovarian steroid sulphate functions as priming pheromone in male ...

    Indian Academy of Sciences (India)

    Unknown

    The study reveals that pre-ovulatory females of the fish Barilius bendelisis (Ham.) release sex steroids and their conjugates into the water and that a steroid sulphate of these compounds functions as a potent sex pheromone which stimulates milt production in conspecific males prior to spawning. Since males exposed to the ...

  17. Contribution of sodium dodecyl sulphate and sodium lauric acid in ...

    Indian Academy of Sciences (India)

    Abstract. Anion surfactants, sodium dodecyl sulphate (SDS) and sodium lauric acid (SLA), with almost the same chain length but different anion groups were used together as intercalates to prepare intercalated ZnAl–layered double hydroxides (ZnAl–LDHs). Their composition, structure and morphology were characterized ...

  18. Anodically generated manganese(III) sulphate for the oxidation of ...

    Indian Academy of Sciences (India)

    Unknown

    room temperature. After evaporating DMF under reduced pressure, the residue was taken up by chlo- roform and extracted with 10% citric acid, water,. 5% sodium bicarbonate, water and dried over sodium sulphate. The solvent was removed under reduced pressure and recrystallized from ether/ethyl acetate to obtain 6⋅34 ...

  19. Investigation of sulphate origins in the Jeffara aquifer, southeastern ...

    Indian Academy of Sciences (India)

    abundant in the study area and incongruent dissolution of dolomite. Gypsum, anhydrite, mirabilite and thenardite have been examined as potential sources of sulphate dissolved in groundwater. Since Jeffara groundwater is recharged by the Continental Intercalaire (CI) geothermal water, water temperature decreases from ...

  20. Growth morphology of zinc tris(thiourea) sulphate crystals

    Indian Academy of Sciences (India)

    Abstract. The growth morphology of crystals of zinc tris(thiourea) sulphate (ZTS) is investigated experimentally, and computed using the Hartman–Perdok approach. Attachment energies of the observed habit faces are calculated for determining their relative morphological importance. A com- puter code is developed for ...

  1. Structure transitions between copper-sulphate and copper-chloride ...

    Indian Academy of Sciences (India)

    Administrator

    Abstract. Structure transitions between copper UPD adlayers on Au(111)–(1 × 1) in sulfuric acid and chloride containing electrolyte were investigated by in situ scanning tunnelling microscopy. We demon- strate that co-adsorbed sulphate ions in the (√3 × √3)R30° UPD adlayer are replaced by chloride ions and,.

  2. 21 CFR 520.62 - Aminopentamide hydrogen sulphate tablets.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Aminopentamide hydrogen sulphate tablets. 520.62 Section 520.62 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... tablets may be preceded by subcutaneous or intramuscular use of the injectable form of the drug. (3) For...

  3. Inhibition of bio corrosion of steel coupon by sulphate reducing ...

    African Journals Online (AJOL)

    SRB) and Iron oxidizing bacteria (IOB) using Aloe vera (Aloe barbadensis) extract was tested. The water sample revealed a heterotrophic bacterial count of 1.7x103 cfu/ml for the sulphate reducing bacteria and 4.1x103 cfu/ml for the Iron oxidizing ...

  4. Electrochemical study in the molten sodium acid sulphate - potassium acid sulphate eutectic

    International Nuclear Information System (INIS)

    Le Ber, F.

    1964-01-01

    The general properties of the NaHSO 4 - KHSO 4 molten eutectic resemble those of neutral sulphates and those of concentrated H 2 SO 4 . We have been able to show the existence in solution of the ions HSO - 4 SO 2- 4 , and H 3 O + , these last being formed by the action of the HSO - 4 ions on dissolved H 2 O. The electro-active zone with a polished platinum electrode is limited in oxidation by the ions H 3 O + and SO 2- 4 , and in reduction by the protons of HSO - 4 . We have compared the electro-active zones obtained with different electrodes (Ag-Au-graphite-mercury). We have considered the dissolution of a few metallic oxides and halides. This work shows the role as O 2- ion acceptors of HSO - 4 ions. We have undertaken an electro-chemical study of a few oxido-reduction Systems: H + / H 2 , Ag↓ / Ag (1), the vanadium and uranium Systems, those of mercury Hg↓ / Hg 2- 2 and of gold Au/Au 3+ , then of the attack by the solvent of a few common metals such as aluminium, iron, copper and nickel. The study of silver Systems has made it possible to obtain the solubility products of AgCl and AgBr and to consider the possibility of coulometric titration Cl - ions with Ag + ions. We have shown the existence of various chemical species of vanadium which may exist in the molten eutectic. (author) [fr

  5. The hypobranchial mucin of the whelk Buccinum undatum L. The polysaccharide sulphate component.

    Science.gov (United States)

    Hunt, S; Jevons, F R

    1966-02-01

    1. A polysaccharide sulphate has been isolated from the hypobranchial mucin of the whelk Buccinum undatum. 2. The molecular weight of this polysaccharide, which is a glucan carrying one ester sulphate group per monosaccharide residue, is 1.7x10(5). 3. Some investigations bearing on the location of the ester sulphate groups are reported. 4. The viscosity of the whole mucin has been shown to depend mainly on the glucan sulphate.

  6. Treatment of acid and sulphate-rich effluents in an integrated ...

    African Journals Online (AJOL)

    A novel chemical/biological process is described in which sulphate and sulphide are removed simultaneously during biological treatment. Partial sulphate removal is achieved during chemical pre-treatment. In the biological stage sulphate is reduced to sulphide in a complete-mixed reactor through addition of sucrose or ...

  7. Effects of electron acceptors on sulphate reduction activity in activated sludge processes

    NARCIS (Netherlands)

    Rubio-Rincón, Francisco; Lopez-Vazquez, Carlos; Welles, L.; van den Brand, Tessa; Abbas, B.A.; van Loosdrecht, Mark C.M.; Brdanovic, Damir

    2017-01-01

    The concentration of sulphate present in wastewater can vary from 10 to 500 mg SO4 2−/L. During anaerobic conditions, sulphate is reduced to sulphide by sulphate-reducing bacteria (SRB). Sulphide generation is undesired in wastewater treatment plants (WWTPs). Previous

  8. Natural mineral waters: chemical characteristics and health effects

    Science.gov (United States)

    Quattrini, Sara; Pampaloni, Barbara; Brandi, Maria Luisa

    2016-01-01

    Summary Water contributes significantly to health and a daily intake of 1.5 to 2 liters of water should be guaranteed, because a good hydration is essential to maintain the body water equilibrium, although needs may vary among people. However, worldwide population is far from the Recommended Allowance for water intake. Among the waters for human uses, there are ‘waters (treated or not), intended for drinking, used for the food and beverages preparation or for other domestic purposes’ and natural mineral waters, that are ‘originated from an aquifer or underground reservoir, spring from one or more natural or bore sources and have specific hygienic features and, eventually, healthy properties’. According to the European Legislation (2009/54/EC Directive), physical and chemical characterization is used to make a classification of the different mineral waters, basing on the analysis of main parameters. Mineral composition enables to classify natural mineral waters as bicarbonate mineral waters, sulphate mineral waters, chloride mineral waters, calcic mineral waters, magnesiac mineral waters, fluorurate mineral waters, ferrous mineral waters and sodium-rich mineral waters. Although the concerns about bottled mineral waters (due to plasticizers and endocrine disruptors), many are the health effects of natural mineral waters and several studies explored their properties and their role in different physiological and pathological conditions. PMID:28228777

  9. An AP Calculus Classroom Amusement Park

    Science.gov (United States)

    Ferguson, Sarah

    2016-01-01

    Throughout the school year, AP Calculus teachers strive to teach course content comprehensively and swiftly in an effort to finish all required material before the AP Calculus exam. As early May approaches and the AP Calculus test looms, students and teachers nervously complete lessons, assignments, and assessments to ensure student preparation.…

  10. Molecular evolution of the AP2 subfamily.

    Science.gov (United States)

    Shigyo, Mikao; Hasebe, Mitsuyasu; Ito, Motomi

    2006-02-01

    The AP2 (APETALA2)/EREBP (Ethylene Responsive Element Binding Protein) multigene family includes developmentally and physiologically important transcription factors. AP2/EREBP genes are divided into two subfamilies: AP2 genes with two AP2 domains and EREBP genes with a single AP2/ERF (Ethylene Responsive Element Binding Factor) domain. Based on previous phylogenetic analyses, AP2 genes can be divided into two clades, AP2 and ANT groups. To clarify the molecular evolution of the AP2 subfamily, we isolated and sequenced genes with two AP2 domains from three gymnosperms, Cycas revoluta, Ginkgo biloba, and Gnetum parvifolium,as well as from the moss Physcomitrella patens. Expressions of AP2-like genes, including AP2, in Arabidopsis thaliana are regulated by the microRNA miR172. We found that the target site of miR172 is significantly conserved in gymnosperm AP2 homologs, suggesting that regulatory mechanisms of gene expression using microRNA have been conserved over the three hundred million years since the divergence of gymnosperm and flowering plant lineages. We inferred a phylogenetic relationship of these genes with the green alga Chlamydomonas reinhardtii and seed-plant genes available in public DNA databases. The phylogenetic tree showed that the AP2 subfamily diverged into the AP2 and ANT groups before the last common ancestor of land plants and after C. reinhardtii diverged from the land-plant lineage. The tree also indicated that each AP2 and ANT group further diverged into several clades through gene duplications prior to the divergence of gymnosperms and angiosperms.

  11. Antioxidant and antibacterial activities of sulphated polysaccharides from Pleurotus eryngii and Streptococcus thermophilus ASCC 1275.

    Science.gov (United States)

    Li, Siqian; Shah, Nagendra P

    2014-12-15

    Polysaccharides from Pleurotus eryngii (PEPS) and exopolysaccharides from Streptococcus thermophilus ASCC 1275 (ST1275 EPS) were sulphated, and antioxidant and antibacterial activities of sulphated and crude polysaccharides were determined. Degree of sulphonation of PEPS and ST1275 EPS was 0.69 and 0.31, respectively. Characteristic bands in FT-IR spectra indicated that the sulphate group was at the C6 position of the galactose skeleton. Antioxidant activities of PEPS and ST1275 EPS were significantly (PPEPS had the largest inhibition zone against Escherichia coli ATCC 25922 and Staphylococcus aureus CMCC 26003 while sulphated ST1275 EPS had the largest inhibition zone against Listeria monocytogenes CMCC 54001. Furthermore, sulphated PEPS had the lowest minimum inhibitory concentration (MIC) for E. coli ATCC 25922, and both sulphated PEPS and sulphated ST1275 EPS had the lowest MICs on S. aureus CMCC 26003 and L. monocytogenes CMCC 54001. Copyright © 2014 Elsevier Ltd. All rights reserved.

  12. The effect of magnesium on partial sulphate removal from mine water as gypsum.

    Science.gov (United States)

    Tolonen, Emma-Tuulia; Rämö, Jaakko; Lassi, Ulla

    2015-08-15

    The aim of this research was to investigate the effect of magnesium on the removal efficiency of sulphate as gypsum from mine water. The precipitation conditions were simulated with MINEQL + software and the simulation results were compared with the results from laboratory jar test experiments. Both the simulation and the laboratory results showed that magnesium in the mine water was maintaining sulphate in a soluble form as magnesium sulphate (MgSO4) at pH 9.6. Thus magnesium was preventing the removal of sulphate as gypsum (CaSO4·2H2O). However, change in the lime precipitation pH from 9.6 to 12.5 resulted in magnesium hydroxide (Mg(OH)2) precipitation and improved sulphate removal. Additionally, magnesium hydroxide could act as seed crystals for gypsum precipitation or co-precipitate sulphate further enhancing the removal of sulphate from mine water. Copyright © 2015 Elsevier Ltd. All rights reserved.

  13. Fellow's Apéro

    CERN Document Server

    Staff Association

    2017-01-01

    Let's get together, meet each other, exchange experiences and ideas, and share useful information on CERN and the Staff Association. Join us for Fellow's Apéro, organised by the Staff Association on Tuesday 21 February at 16.30 in Restaurant 1. There will be drinks and snacks for everybody! We look forward to seeing you there! Please confirm your participation on Doodle http://doodle.com/poll/skvm7ucm2z78i6bt or alternatively on Facebook https://www.facebook.com/events/1862757017340069/. Your delegates in the Staff Association, Barbora & Jiri

  14. Testing of Solar Heated Domestic Hot Water System for Solahart Scandinavia ApS

    DEFF Research Database (Denmark)

    Andersen, Elsa

    1997-01-01

    The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report.......The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report....

  15. Performance of Fly ash Based Geopolymer Mortars in Sulphate Solution

    Directory of Open Access Journals (Sweden)

    P. Ghosh

    2010-01-01

    Full Text Available An experimental investigation was conducted to study the performance of fly ash based geopolymer mortar specimens inMagnesium Sulphate solution. Specimens were manufactured from low calcium fly ash by activation with a mixture of SodiumHydroxide and Sodium Silicate solution and cured thermally. 10% by weight Magnesium Sulphate solution was usedto soak the specimen up to 24 weeks. Performance of the specimens was evaluated in terms of visual appearance, variationof pH of solution, change in weight, and change in compressive strength over the exposure period. White deposits occurredon the surface of specimen which was initially soft but later converted to hard crystals. pH of solution increased noticeablyduring the initial weeks which indicate migration of alkalis from mortar specimens. At the end of 24 weeks samples experiencedvery little weight gain and recorded a loss of compressive strength by up to 56%.

  16. Magnesium sulphate salts and the history of water on Mars.

    Science.gov (United States)

    Vaniman, David T; Bish, David L; Chipera, Steve J; Fialips, Claire I; Carey, J William; Feldman, William C

    2004-10-07

    Recent reports of approximately 30 wt% of sulphate within saline sediments on Mars--probably occurring in hydrated form--suggest a role for sulphates in accounting for equatorial H2O observed in a global survey by the Odyssey spacecraft. Among salt hydrates likely to be present, those of the MgSO4*nH2O series have many hydration states. Here we report the exposure of several of these phases to varied temperature, pressure and humidity to constrain their possible H2O contents under martian surface conditions. We found that crystalline structure and H2O content are dependent on temperature-pressure history, that an amorphous hydrated phase with slow dehydration kinetics forms at water on Mars. However, their ease of transformation implies that salt hydrates collected on Mars will not be returned to Earth unmodified, and that accurate in situ analysis is imperative.

  17. Solid state reactions of potassium uranates with ammonium sulphates

    International Nuclear Information System (INIS)

    Singh Mudher, K.D.; Keskar, Meera; Krishnan, K.; Venugopal, V.

    1995-01-01

    Solid state reactions of potassium uranates with (NH 4 ) 2 SO 4 were studied with a view to understand the nature of the reaction products formed at different temperatures. The hexavalent uranates K 2 U 2 O 7 and K 2 U 4 O 13 formed double sulphates of U(VI) at 380 degC, whereas pentavalent KUO 3 and mixed valent K 2 U 4 O 12 reacted at the above temperature to form mixtures of potassium uranium double sulphates containing both U(IV) and U(VI). Thermal, x-ray and chemical methods were used to identify and characterise the products. (author). 4 refs., 1 fig., 1 tab

  18. EFFECT OF IRRIGATION WITH SEWAGE WASTEWATER ON NITROGEN UPTAKE AND TRANSLOCATION BY NAVEL ORANGE TRANSPLANTS USING 15N-LABELLED AMMONIUM SULPHATE

    International Nuclear Information System (INIS)

    EL-MOTAIUM, R.A.; SHARAF, A.N.; HASHEM, M.E.; HEGAZI, E.S.; BADAWY, S.H.

    2009-01-01

    An isotope aided study using 15 N-labelled ammonium sulphate was applied to investigate nitrogen uptake and translocation from sewage water by one year old Navel orange transplants. The investigation was conducted in a pot experiment at the greenhouse for two successive seasons (2005 and 2006). Ammonium sulphate was applied to the soil at a rate of 6 g/pot. The treatments included irrigation with canal water and sewage water. Half strength Hoagland nutrient solution, nitrogen depleted, was applied to provide the required nutrients for healthy growth of the transplants. The pots were irrigated to maintain the soil moisture content at field capacity.The results indicated that there is an increase in the transplants biomass irrigated with sewage water than using canal water. A substantial increase in mineral fertilizer nitrogen ( 15 N) uptake by plant roots and translocation into shoots was observed using canal water than sewage water. The nitrogen percent derived from sewage water was higher (26.1-49.5%) than that derived from 15 N-labelled ammonium sulphate (4.9-12.7%). Fertilizer nitrogen recovery was higher under canal water than under sewage water irrigation regime, although the plant biomass was higher under sewage water. Using sewage water alone can provide the orange transplants with their nitrogen requirements with no need for application of mineral fertilizer

  19. Unusual pattern of leukoencephalopathy after morphine sulphate intoxication

    Energy Technology Data Exchange (ETDEWEB)

    Nanan, R.; Stockhausen, H.B. von; Petersen, B. [Children' s Hospital, University of Wuerzburg (Germany); Solymosi, L.; Warmuth-Metz, M. [Department for Neuroradiology, University of Wuerzburg (Germany)

    2000-11-01

    We report a 14-year-old girl with an unusual pattern of leukoencephalopathy after intentional intoxication with morphine sulphate tablets. Toxicological analysis showed exceedingly high levels of morphine and its metabolites. MRI disclosed a leukoencephalopathy with high signal from the centrum semiovale, corpus callosum and cerebellar white matter on T2-weighted images. These findings could be only partially explained by a hypoxic-ischaemic event; neurotoxic effects must be considered in this atypical leukoencephalopathy. (orig.)

  20. Structure transitions between copper-sulphate and copper-chloride ...

    Indian Academy of Sciences (India)

    Administrator

    strate that co-adsorbed sulphate ions in the (√3 × √3)R30° UPD adlayer are replaced by chloride ions and, ..... phase 1 by the (5 × 5)-like chlo- ride phase 2 was mentioned in. 45,46,48,56 but not stud- ied in detail. These authors suggested that the replacement of SO. 2. 4. – .... A nonlinear regression fit of (1) to the experi-.

  1. EFFECT OF SULPHATE ON LOW-TEMPERATURE ANAEROBIC DIGESTION

    Directory of Open Access Journals (Sweden)

    Padhraig eMadden

    2014-07-01

    Full Text Available The effect of sulphate addition on the stability of, and microbial community behaviour in, low-temperature anaerobic expanded granular sludge bed-based bioreactors was investigated at 15°C. Efficient bioreactor performance was observed, with chemical oxygen demand removal efficiencies of >90%, and a mean SO42- removal rate of 98.3%. In situ methanogensis appeared unaffected at a COD:SO42- influent ratio of 8:1, and subsequently of 3:1, and was impacted marginally only when the COD: SO42- ratio was 1:2. . Specific methanogenic activity assays indicated a complex set of interactions between sulphate-reducing bacteria (SRB, methanogens and homoacetogenic bacteria. SO42- addition resulted in predominantly acetoclastic, rather than hydrogenotrophic, methanogenesis until >600 days of SO42--influenced bioreactor operation. Temporal microbial community development was monitored by denaturation gradient gel electrophoresis (DGGE of 16S rRNA genes. Fluorescence in situ hybridisations (FISH, qPCR and microsensor analysis were combined to investigate the distribution of microbial groups, and particularly SRB and methanogens, along the structure of granular biofilms. qPCR data indicated that sulphidogenic genes were present in methanogenic and sulfidogenic biofilms, indicating the potential for sulphate reduction even in bioreactors not exposed to SO42-. Although the architecture of methanogenic and sulphidogenic granules was similar, indicating the presence of SRB even in methanogenic systems, FISH with rRNA targets found that the SRB were more abundant in the sulphidogenic biofilms. Methanosaeta species were the predominant, keystone members of the archaeal community, with the complete absence of the Methanosarcina species in the experimental bioreactor by trial conclusion. Microsensor data suggested the ordered distribution of sulphate reduction and sulphide accumulation, even in methanogenic granules.

  2. Biological sulphate reduction with primary sewage sludge in an ...

    African Journals Online (AJOL)

    2009-07-31

    Jul 31, 2009 ... The success of the UASB reactor depends largely on the settling properties and stability of the sludge bed which comprises the anaerobic active biomass. The solid-liquid separation behaviour of the sludge bed in 2 UASB reactors (R1 at 35oC and. R2 at 20oC) fed with primary sewage sludge and sulphate ...

  3. Sulphate and desertification signals in Middle Eastern temperature trends

    International Nuclear Information System (INIS)

    Nasrallah, H.A.; Balling, R.C. Jr.

    1994-01-01

    Analysis of Middle Eastern annual temperature anomalies over the past 40 years reveals statistically significant warming over this time period of 0.07 C per decade. The warming is most pronounced over the spring season and least apparent in the winter season. Spatial analysis reveals a positive relationship between Middle Eastern warming and the degree of human-induced desertification and a negative relationship between local warming and the atmospheric concentration of sulphate

  4. APS high heat load monochromator

    International Nuclear Information System (INIS)

    Lee, W.K.; Mills, D.

    1993-02-01

    This document contains the design specifications of the APS high heat load (HHL) monochromator and associated accessories as of February 1993. It should be noted that work is continuing on many parts of the monochromator including the mechanical design, crystal cooling designs, etc. Where appropriate, we have tried to add supporting documentation, references to published papers, and calculations from which we based our decisions. The underlying philosophy behind performance specifications of this monochromator was to fabricate a device that would be useful to as many APS users as possible, that is, the design should be as generic as possible. In other words, we believe that this design will be capable of operating on both bending magnet and ID beamlines (with the appropriate changes to the cooling and crystals) with both flat and inclined crystal geometries and with a variety of coolants. It was strongly felt that this monochromator should have good energy scanning capabilities over the classical energy range of about 4 to 20 keywith Si (111) crystals. For this reason, a design incorporating one rotation stage to drive both the first and second crystals was considered most promising. Separate rotary stages for the first and second crystals can sometimes provide more flexibility in their capacities to carry heavy loads (for heavily cooled first crystals or sagittal benders of second crystals), but their tuning capabilities were considered inferior to the single axis approach

  5. APS high heat load monochromator

    Energy Technology Data Exchange (ETDEWEB)

    Lee, W.K.; Mills, D.

    1993-02-01

    This document contains the design specifications of the APS high heat load (HHL) monochromator and associated accessories as of February 1993. It should be noted that work is continuing on many parts of the monochromator including the mechanical design, crystal cooling designs, etc. Where appropriate, we have tried to add supporting documentation, references to published papers, and calculations from which we based our decisions. The underlying philosophy behind performance specifications of this monochromator was to fabricate a device that would be useful to as many APS users as possible, that is, the design should be as generic as possible. In other words, we believe that this design will be capable of operating on both bending magnet and ID beamlines (with the appropriate changes to the cooling and crystals) with both flat and inclined crystal geometries and with a variety of coolants. It was strongly felt that this monochromator should have good energy scanning capabilities over the classical energy range of about 4 to 20 keywith Si (111) crystals. For this reason, a design incorporating one rotation stage to drive both the first and second crystals was considered most promising. Separate rotary stages for the first and second crystals can sometimes provide more flexibility in their capacities to carry heavy loads (for heavily cooled first crystals or sagittal benders of second crystals), but their tuning capabilities were considered inferior to the single axis approach.

  6. Molecular structure of dextran sulphate sodium in aqueous environment

    Science.gov (United States)

    Yu, Miao; Every, Hayley A.; Jiskoot, Wim; Witkamp, Geert-Jan; Buijs, Wim

    2018-03-01

    Here we propose a 3D-molecular structural model for dextran sulphate sodium (DSS) in a neutral aqueous environment based on the results of a molecular modelling study. The DSS structure is dominated by the stereochemistry of the 1,6-linked α-glucose units and the presence of two sulphate groups on each α-glucose unit. The structure of DSS can be best described as a helix with various patterns of di-sulphate substitution on the glucose rings. The presence of a side chain does not alter the 3D-structure of the linear main chain much, but affects the overall spatial dimension of the polymer. The simulated polymers have a diameter similar to or in some cases even larger than model α-hemolysin nano-pores for macromolecule transport in many biological processes, indicating a size-limited translocation through such pores. All results of the molecular modelling study are in line with previously reported experimental data. This study establishes the three-dimensional structure of DSS and summarizes the spatial dimension of the polymer, serving as the basis for a better understanding on the molecular level of DSS-involved electrostatic interaction processes with biological components like proteins and cell pores.

  7. Physicochemical properties, cytotoxicity, and antimicrobial activity of sulphated zirconia nanoparticles

    Science.gov (United States)

    Mftah, Ae; Alhassan, Fatah H; Al-Qubaisi, Mothanna Sadiq; El Zowalaty, Mohamed Ezzat; Webster, Thomas J; Sh-eldin, Mohammed; Rasedee, Abdullah; Taufiq-Yap, Yun Hin; Rashid, Shah Samiur

    2015-01-01

    Nanoparticle sulphated zirconia with Brønsted acidic sites were prepared here by an impregnation reaction followed by calcination at 600°C for 3 hours. The characterization was completed using X-ray diffraction, thermal gravimetric analysis, Fourier transform infrared spectroscopy, Brunner-Emmett-Teller surface area measurements, scanning electron microscopy with energy dispersive X-ray spectroscopy, and transmission electron microscopy. Moreover, the anticancer and antimicrobial effects were investigated for the first time. This study showed for the first time that the exposure of cancer cells to sulphated zirconia nanoparticles (3.9–1,000 μg/mL for 24 hours) resulted in a dose-dependent inhibition of cell growth, as determined by (4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assays. Similar promising results were observed for reducing bacteria functions. In this manner, this study demonstrated that sulphated zirconia nanoparticles with Brønsted acidic sites should be further studied for a wide range of anticancer and antibacterial applications. PMID:25632233

  8. The microbial communities and potential greenhouse gas production in boreal acid sulphate, non-acid sulphate, and reedy sulphidic soils

    Czech Academy of Sciences Publication Activity Database

    Šimek, Miloslav; Virtanen, S.; Simojoki, A.; Chroňáková, Alica; Elhottová, Dana; Krištůfek, Václav; Yli-Halla, M.

    2014-01-01

    Roč. 466, January (2014), s. 663-672 ISSN 0048-9697 R&D Projects: GA ČR GA526/09/1570; GA MŠk LC06066 Grant - others:GAJU(CZ) GAJU 138/2010/P Institutional support: RVO:60077344 Keywords : acid sulphate soil * carbon * CARD-FISH * microorganisms * nitrogen * PLFA Subject RIV: EE - Microbiology, Virology Impact factor: 4.099, year: 2014

  9. A comparison of glycosaminoglycan distributions, keratan sulphate sulphation patterns and collagen fibril architecture from central to peripheral regions of the bovine cornea.

    Science.gov (United States)

    Ho, Leona T Y; Harris, Anthony M; Tanioka, Hidetoshi; Yagi, Naoto; Kinoshita, Shigeru; Caterson, Bruce; Quantock, Andrew J; Young, Robert D; Meek, Keith M

    2014-09-01

    This study investigated changes in collagen fibril architecture and the sulphation status of keratan sulphate (KS) glycosaminoglycan (GAG) epitopes from central to peripheral corneal regions. Freshly excised adult bovine corneal tissue was examined as a function of radial position from the centre of the cornea outwards. Corneal thickness, tissue hydration, hydroxyproline content, and the total amount of sulphated GAG were all measured. High and low-sulphated epitopes of keratan sulphate were studied by immunohistochemistry and quantified by ELISA. Chondroitin sulphate (CS) and dermatan sulphate (DS) distributions were observed by immunohistochemistry following specific enzyme digestions. Electron microscopy and X-ray fibre diffraction were used to ascertain collagen fibril architecture. The bovine cornea was 1021±5.42 μm thick at its outer periphery, defined as 9-12 mm from the corneal centre, compared to 844±8.10 μm at the centre. The outer periphery of the cornea was marginally, but not significantly, more hydrated than the centre (H=4.3 vs. H=3.7), and was more abundant in hydroxyproline (0.12 vs. 0.06 mg/mg dry weight of cornea). DMMB assays indicated no change in the total amount of sulphated GAG across the cornea. Immunohistochemistry revealed the presence of both high- and low-sulphated epitopes of KS, as well as DS, throughout the cornea, and CS only in the peripheral cornea before the limbus. Quantification by ELISA, disclosed that although both high- and low-sulphated KS remained constant throughout stromal depth at different radial positions, high-sulphated epitopes remained constant from the corneal centre to outer-periphery, whereas low-sulphated epitopes increased significantly. Both small angle X-ray diffraction and TEM analysis revealed that collagen fibril diameter remained relatively constant until the outer periphery was reached, after which fibrils became more widely spaced (from small angle x-ray diffraction analysis) and of larger diameter

  10. Chemical sulphate removal for treatment of construction and demolition debris leachate.

    Science.gov (United States)

    Kijjanapanich, Pimluck; Annachhatre, Ajit P; Esposito, Giovanni; Lens, Piet N L

    2014-08-01

    Construction and demolition debris (CDD) is a product of construction, renovation or demolition activities. It has a high gypsum content (52.4% of total gypsum), concentrated in the CDD sand (CDDS) fraction. To comply with the posed limit of the maximum amount of sulphate present in building sand, excess sulphate needs to be removed. In order to enable reuse of CDDS, a novel treatment process is developed based on washing of the CDDS to remove most of the gypsum, and subsequent sulphate removal from the sulphate-rich CDDS leachate. This study aims to assess chemical techniques, i.e. precipitation and adsorption, for sulphate removal from the CDDS leachate. Good sulphate removal efficiencies (up to 99.9%) from the CDDS leachate can be achieved by precipitation with barium chloride (BaCl2) and lead(II) nitrate (Pb(NO3)2). Precipitation with calcium chloride (CaCl2), calcium carbonate (CaCO3) and calcium oxide (CaO) gave less efficient sulphate removal. Adsorption of sulphate to aluminium oxide (Al2O3) yielded a 50% sulphate removal efficiency, whereas iron oxide-coated sand as adsorbent gave only poor (10%) sulphate removal efficiencies.

  11. Transcriptional response of Medicago truncatula sulphate transporters to arbuscular mycorrhizal symbiosis with and without sulphur stress.

    Science.gov (United States)

    Casieri, Leonardo; Gallardo, Karine; Wipf, Daniel

    2012-06-01

    Sulphur is an essential macronutrient for plant growth, development and response to various abiotic and biotic stresses due to its key role in the biosynthesis of many S-containing compounds. Sulphate represents a very small portion of soil S pull and it is the only form that plant roots can uptake and mobilize through H(+)-dependent co-transport processes implying sulphate transporters. Unlike the other organically bound forms of S, sulphate is normally leached from soils due to its solubility in water, thus reducing its availability to plants. Although our knowledge of plant sulphate transporters has been growing significantly in the past decades, little is still known about the effect of the arbuscular mycorrhiza interaction on sulphur uptake. Carbon, nitrogen and sulphur measurements in plant parts and expression analysis of genes encoding putative Medicago sulphate transporters (MtSULTRs) were performed to better understand the beneficial effects of mycorrhizal interaction on Medicago truncatula plants colonized by Glomus intraradices at different sulphate concentrations. Mycorrhization significantly promoted plant growth and sulphur content, suggesting increased sulphate absorption. In silico analyses allowed identifying eight putative MtSULTRs phylogenetically distributed over the four sulphate transporter groups. Some putative MtSULTRs were transcribed differentially in roots and leaves and affected by sulphate concentration, while others were more constitutively transcribed. Mycorrhizal-inducible and -repressed MtSULTRs transcripts were identified allowing to shed light on the role of mycorrhizal interaction in sulphate uptake.

  12. The action of diazoxide and minoxidil sulphate on rat blood vessels: a comparison with cromakalim.

    Science.gov (United States)

    Newgreen, D. T.; Bray, K. M.; McHarg, A. D.; Weston, A. H.; Duty, S.; Brown, B. S.; Kay, P. B.; Edwards, G.; Longmore, J.; Southerton, J. S.

    1990-01-01

    1. The actions of diazoxide and minoxidil sulphate have been compared with those of cromakalim in rat aorta and portal vein. 2. Diazoxide and minoxidil sulphate hyperpolarized the rat portal vein in a similar manner to cromakalim. 3. Cromakalim, diazoxide and minoxidil sulphate increased 42K and 86Rb efflux from rat portal vein, although minoxidil sulphate had only a small effect on 86Rb efflux. 4. Cromakalim, diazoxide and minoxidil sulphate increased 42K efflux from rat aorta but only cromakalim and diazoxide increased 86Rb efflux from this tissue. 5. Glibenclamide inhibited the relaxant actions of cromakalim, diazoxide and minoxidil sulphate on rat aorta and the increase in 42K efflux produced by these agents in this tissue. 6. Diazoxide relaxed an 80 mM KCl-induced contraction of rat aorta, whilst cromakalim and minoxidil sulphate were without effect. 7. Cromakalim, diazoxide and minoxidil sulphate had no effect on cyclic AMP or cyclic GMP concentrations in rat aorta. 8. It is concluded that diazoxide and minoxidil sulphate like cromakalim exhibit K+ channel opening properties in vascular smooth muscle. Diazoxide exerts an additional inhibitory action not related to the production of cyclic AMP or cyclic GMP. The action of minoxidil sulphate may be primarily located at a K+ channel which is relatively impermeable to 86Rb. PMID:2167738

  13. Sulphate reduction and vertical distribution of sulphate-reducing bacteria quantified by rRNA slot-blot hybridization in a coastal marine sediment

    DEFF Research Database (Denmark)

    Sahm, K.; MacGregor, BJ; Jørgensen, BB

    1999-01-01

    In the past, enumeration of sulphate-reducing bacteria (SRB) by cultivation-based methods generally contradicted measurements of sulphate reduction, suggesting unrealistically high respiration rates per cell. Here, we report evidence that quantification of SRB rRNA by slot-blot hybridization...... between 18% and 25% to the prokaryotic rRNA pool. The dominant SRB were related to complete oxidizing genera (Desulphococcus, Desulphosarcina and Desulphobacterium), while Desulpho-bacter could not be detected. The vertical profile and quantity of rRNA from SRB was compared with sulphate reduction rates......, directly above the sulphate reduction maximum. Cell numbers calculated by converting the relative contribution of SRB rRNA to the percentage of DAPI-stained cells indicated a population size for SRB of 2.4-6.1 x 10(8) cells cm(-3) wet sediment. Cellular sulphate reduction rates calculated on the basis...

  14. Submitting to the APS Journals

    Science.gov (United States)

    Hall, Donavan; Johnson, Brant; Kim-Zajonz, Julie; Ucko, Daniel

    2006-03-01

    This session will contain a short presentation of policies, practices and general advice for authors submitting to APS journals. For both the Physical Review and Physical Review Letters, it will focus on such things as the importance of a properly written introduction; our current drive for increased accessibility in the Phys. Rev. journals; how a well written cover letter and how suggesting referees will aid your manuscript in the review process. We shall also discuss responding to referees and offer advice on resubmitting your manuscript. In addition there will be information on technical details such as web submission and the Author Status Information Service (ASIS). The presentation will then be followed by a moderated panel discussion, where editors from PRL, PRB and PRE will answer questions from the audience on author issues.

  15. APS: Lighting up the future

    International Nuclear Information System (INIS)

    Potent, V.J.

    1993-01-01

    Work on the Advanced Photon Source (APS) at Argonne National Laboratory (ANL) involves the construction and supporting research and development for a national user facility for synchrotron radiation research in the x-ray region. The facility, when operational in 1997, will provide super-intense x-ray beams for many areas of basic research and will serve the entire US x-ray research community of several thousand users. This paper describes the pertinent features of the design, construction and planned operation of the facility; and the impact quality has had in these areas. In addition, the introduction of several quality management techniques such as total quality management, reliability/availability planning, and user interface are discussed concerning their status and success

  16. Magnesium sulphate’s influence on calcium carbonate minerals

    DEFF Research Database (Denmark)

    Nielsen, Mia Rohde

    The purpose of this PhD thesis was to explore the influence of magnesium sulphate (MgSO4 (aq)) on calcium carbonate (CaCO3) minerals and what role the MgSO40 ion pair had. CaCO3 minerals are abundant and widespread on Earth, particularly in marine environments, and have been so throughout Earth......’s history. CaCO3 are formed by many ocean living organisms resulting in a wide variety of biominerals. In biomineralisation the growth behaviour of CaCO3 is influenced by organic molecules and inorganic ions. The inorganic ions, magnesium (Mg2+) and sulphate (SO42-), are common seawater ions and both...

  17. AP calculus AB & BC crash course

    CERN Document Server

    Rosebush, J

    2012-01-01

    AP Calculus AB & BC Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Calculus AB & BC Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Calculus AB & BC course description outline and actual AP test questions. It covers only the information tested on the exams, so you can make the most of your valuable study time. Written by experienced math teachers, our

  18. [Type 2 autoimmune polyendocrine syndromes (APS-2)].

    Science.gov (United States)

    Vialettes, Bernard; Dubois-Leonardon, Noémie

    2013-01-01

    Type 2 autoimmune polyendocrine syndromes (APS-2) are the most frequent disorders associating several organ-specific autoimmune diseases. Their high prevalence is due to the fact that the main manifestations of APS-2, such as thyroidal autoimmunity, type 1 diabetes, autoimmune gastric atrophy and vitiligo, are common diseases. APS-2 represents a clinical model that can serve to help unravel the mechanisms underlying autoimmunity. Diagnosis of APS-2 is a challenge for the clinician, especially in poorly symptomatic forms, and may require systematic screening based on measurement of autoantibodies and functional markers.

  19. Aggregate and Mineral Resources - Minerals

    Data.gov (United States)

    NSGIC State | GIS Inventory — This point occurrence data set represents the current mineral and selected energy resources of Utah. The data set coordinates were derived from USGS topographic maps...

  20. Unintended consequences of atmospheric injection of sulphate aerosols.

    Energy Technology Data Exchange (ETDEWEB)

    Brady, Patrick Vane; Kobos, Peter Holmes; Goldstein, Barry

    2010-10-01

    Most climate scientists believe that climate geoengineering is best considered as a potential complement to the mitigation of CO{sub 2} emissions, rather than as an alternative to it. Strong mitigation could achieve the equivalent of up to -4Wm{sup -2} radiative forcing on the century timescale, relative to a worst case scenario for rising CO{sub 2}. However, to tackle the remaining 3Wm{sup -2}, which are likely even in a best case scenario of strongly mitigated CO{sub 2} releases, a number of geoengineering options show promise. Injecting stratospheric aerosols is one of the least expensive and, potentially, most effective approaches and for that reason an examination of the possible unintended consequences of the implementation of atmospheric injections of sulphate aerosols was made. Chief among these are: reductions in rainfall, slowing of atmospheric ozone rebound, and differential changes in weather patterns. At the same time, there will be an increase in plant productivity. Lastly, because atmospheric sulphate injection would not mitigate ocean acidification, another side effect of fossil fuel burning, it would provide only a partial solution. Future research should aim at ameliorating the possible negative unintended consequences of atmospheric injections of sulphate injection. This might include modeling the optimum rate and particle type and size of aerosol injection, as well as the latitudinal, longitudinal and altitude of injection sites, to balance radiative forcing to decrease negative regional impacts. Similarly, future research might include modeling the optimum rate of decrease and location of injection sites to be closed to reduce or slow rapid warming upon aerosol injection cessation. A fruitful area for future research might be system modeling to enhance the possible positive increases in agricultural productivity. All such modeling must be supported by data collection and laboratory and field testing to enable iterative modeling to increase the

  1. Nanofiltration renovation of mineral water

    Directory of Open Access Journals (Sweden)

    Bodzek Michał

    2017-06-01

    Full Text Available There is often a need to improve the taste of mineral water by reducing the sulphate ion content. It was found that for such an effect, nanofiltration (NF process can be used. In the case, the proposed formula was assumed obtaining a mineral water with reduction of H2S and SO42- content through the following processes: stripping - UF/MF or rapid fi ltration - nanofiltration - mixing with raw water or filtration through calcium bed. The paper shows the results of the tests, with use of mineral waters and nanofiltration. Commercial nanofiltration membranes NF-270 Dow Filmtec and NF-DK GE Infrastructure Water&Process Technologies were applied. NF was carried out for mixed water from both water intakes (1 and 2, recovery of 50%, at transmembrane pressure of 0.8-1.2 MPa in the dead-end fi ltration mode. In addition, the permeate obtained in NF was filtered through a column fi lled with 1.0-3.0 mm limestone rock, in order to improve the composition of mineral water. The tested mineral water is the sulphate-chloride-sodium-calcium-magnesium in nature and contains 991 mg/L of SO42- and 2398 mg/L of TDS, while the permeate after NF showed the chloride - sodium hydrogeochemical type (TDS: 780-1470 mg/L, sulfate 10-202.7 mg/L, calcium 23-39.7 mg/L, magnesium 11-28 mg/L. As a result of water treatment in the NF process, high reduction of SO42- ions was obtained (79-98.7%, while the TDS was reduced in 51-64%. Because the process of NF allows for relatively high reduction of bivalent ions, a significant reduction in calcium ion content (84-88% and magnesium (84-89% has been also obtained. Monovalent ions were reduced to a lesser extent, i.e. sodium in 46% and bicarbonates in 39-64.1%. Despite obtaining the positive effect of the sulphate ions content reduction, the NF process significantly changed the mineralogy composition of water. The permeate filtration (DK-NF membrane on the CaCO3 deposit led to a correction of the hydrogeochemical type of water from

  2. Consumo de antimicrobianos en APS

    Directory of Open Access Journals (Sweden)

    María Cristina Lara Bastanzuri

    2003-08-01

    Full Text Available Con el propósito de describir el patrón de uso de los medicamentos para el tratamiento con antimicrobianos en APS en Cuba en el período de 1989 al 2000, se diseñó un estudio descriptivo, observacional y retrospectivo clasificado dentro de los estudios de utilización de medicamentos como de consumo. Para ello se calcularon las dosis diarias definidas cada día de determinado fármaco de los grupos clasificados según ATC como tetraciclinas, anfenicoles, penicilinas de amplio espectro, cefalosporinas, sulfonamidas y trimetoprim, macrólidos, estreptomicinas y quinolonas. Además, se tomaron las cifras de pacientes inscriptos a penicilina benzatínica y se comparó con la población expuesta obtenida a partir de las DHD. Las penicilinas son las de mayor consumo con tendencia al aumento, igual que los aminoglucósidos, mientras que la tetraciclina presenta cifras mayores de DHD. La tendencia del cloranfenicol es a disminuir. La población expuesta está muy por debajo de los pacientes inscriptos en penicilina benzatínica y las líneas de tendencia no son similares. Excepto la docixiclina, el resto de los antimicrobianos recomendados en la Guía Terapéutica para APS se encuentran en el Listado Básico de Medicamentos del país para el nivel primario de atención médica.With the objective of describing the pattern of drug use in antimicrobial-based treatment in the primary health care in Cuba from 1989 to 2000, we designed a retrospective descriptive and observational study, classified into the study of drug use as consumption. To this end, the daily doses of certain drugs from the ATC-classified groups were calculated, which included tetracycline, amphenicols, broad spectrum penicilins, cephalosporins, sulfonamides, trimethoprim, macrolides, streptomycin and quinolones. Also, the number of patients registered as benzathine peniciline consumers was taken and compared to the exposed population data obtained from the DHD. Penicillins are the

  3. Transformations of calcium sulphates in solidified carbonated volatile fluidized ashes

    Directory of Open Access Journals (Sweden)

    Marian Jacek Łączny

    2017-01-01

    During the investigation it was assumed that calcium carbonate, being poorly water-soluble, would not react with the remaining components of the porous water of the volatile fluidized ash. Crystalline phases of calcium sulphates, anhydrite, gypsum and bassanite occurring in bound volatile fluidized ashes after carbonation demonstrate the possibility of crystallization in the presence of calcium carbonate. In particular, a change in the concentration of bassanite indicates that this phase, as a precursor to the crystallization of gypsum, may play a significant role in the process of binding carbonated volatile ashes.

  4. Development and characterization of mucoadhesive buccal patches of salbutamol sulphate.

    Science.gov (United States)

    Patel, Rajesh Singh; Poddar, S S

    2009-01-01

    Mucoadhesive patch releasing the drug in the oral cavity at predetermined rate may present distinct advantages over traditional dosage forms such as tablets, gels and solutions. The present study was concerned with the preparation and evaluation of mucoadhesive buccal patches for the controlled systemic delivery of Salbutamol sulphate to avoid first pass hepatic metabolism. The developed patches were evaluated for the physicochemical, mechanical and drug release characteristics. The patches showed desired mechanical and physicochemical properties to withstand environment of oral cavity. The in-vitro release study showed that patches could deliver drug to the oral mucosa for a period of 7 h. the patches exhibited adequate stability when tested under accelerated conditions.

  5. Recovery of uranium from sulphate solutions containing molybdenum

    International Nuclear Information System (INIS)

    Weir, D.R.; Genik-Sas-Berezowsky, R.M.

    1983-01-01

    A process for recovering uranium from a sulphate solution containing dissolved uranium and molybdenum includes reacting the solution with ammonia (pH 8 to 10), the pH of the original solution must not exceed 5.5 and after the addition of ammonia the pH must not be in the vicinity of 7 for a significant time. The resultant uranium precipitate is relatively uncontaminated by molybdenum. The precipitate is then separated from the remaining solution while the pH is maintained within the stated range

  6. Effect of radiation on activity of sulphate reducing bacteria

    International Nuclear Information System (INIS)

    Agaev, N.M.; Smorodin, A.E.; Gusejnov, M.M.

    1985-01-01

    The effect of γ-radiation on activity of sulphate reducing bacteria has been studied. Concentration of biogenic hydrogen, generated in the medium, is the main criterion, characterizing corrosion activity of the bacteria studied. The developed method of suppression of active development of sulfate reducing bacteria considerably reduces, and at lethal doses of γ-radiation eliminates altogether the bacteria activity and formation of the main corrosion agent-hydrogen sulphide-in the medium and that, in its turn, liquidates hydrogen sulphide corrosion

  7. Transformation of external sulphate and its effect on phosphorus mobilization in Lake Moshui, Wuhan, China.

    Science.gov (United States)

    Yu, Fenfang; Zou, Jiajia; Hua, Yumei; Zhang, Shaohui; Liu, Guanglong; Zhu, Duanwei

    2015-11-01

    Average concentrations of sulphate in lakes continue to increase sharply. The response of phosphorus to sulphate input is of great importance due to the relationship between eutrophication and ecological health. A four-week experiment was conducted under simulated conditions using samples from a heavily polluted lake, Lake Moshui, in Wuhan, China, to examine the influence of external sulphate on phosphorus release and the transformation of sulphate. The results showed that the diffusion of sulphate into the sediments promoted the proliferation of sulphate-reducing bacteria (SRB) and the reduction of sulphate. Acetic acid was consumed due to sulphate reduction. The soluble reactive phosphorus (SRP) and soluble Fe measured with diffusive equilibration in thin-films (DET) probes increased significantly after the input of sulphate. The content of SRP was consistent with the variation in both the SRB number and the S(0) content in the sediments. The maximum SRP concentration of 100.43 mg L(-1) was recorded 3 cm below the sediment-water interface on the 29th d, which was more than twice the value of the control. There was a positive correlation between concentrations of Fe and SRP in the overlying water and the pore water of the sediments. Copyright © 2015 Elsevier Ltd. All rights reserved.

  8. Serum and urinary oestrone sulphate in pregnancy and delivery measured by a direct radioimmunoassay

    International Nuclear Information System (INIS)

    Honjo, Hideo; Kitawaki, Jo; Itoh, Masafumi; Yasuda, Jinsuke; Yamamoto, Takara; Yamamoto, Takao; Okada, Hiroji; Ohkubo, Tadashi; Nambara, Toshio

    1986-01-01

    Serum and urinary levels of oestrone sulphate in pregnancy and delivery were measured by a direct radioimmunoassay without hydrolysis. the serum and urinary oestrone sulphate increased as pregnancy progressed. the mean level of serum oestrone sulphate increased to the highest peak of 494 pmol/ml at the 35th gestational week and then decreased. The mean level of urinary oestrone sulphate increased to the highest peak of 1.28 μmol/l at the 34th gestational week and the decreased. At vaginal deliveries, the mean level of maternal peripheral serum oestrone sulphate increased hourly at as high a level as 979 pmol/ml. The mean serum level of oestrone sulphate was 204 pmol/ml in the umbilical artery and 145 pmol/ml in the umbilical vein. At Caesarean section, on the other hand, the maternal peripheral serum level of oestrone sulphate averaged 362 pmol/ml. The mean serum levels of oestrone sulphate wre 90.7 pmol/ml and 171 pmol/ml in the umbilical artery and umbilical vein, respectively. These results suggest a maternal origin of oestrone sulphate in pregnancy, with fluctuations in the levels being of interest in relation to labour pain. (author)

  9. Effectiveness and harmful effects of removal sulphated black crust from granite using Nd:YAG nanosecond pulsed laser

    Energy Technology Data Exchange (ETDEWEB)

    Pozo, S. [Dpto. Ingeniería de los Recursos Naturales y Medio Ambiente, ETSI Minas, University of Vigo, 36310 (Spain); Barreiro, P. [Dpto. Física Aplicada, E.T.S.I. Industriales, University of Vigo, 36310 (Spain); Rivas, T. [Dpto. Ingeniería de los Recursos Naturales y Medio Ambiente, ETSI Minas, University of Vigo, 36310 (Spain); González, P. [Dpto. Física Aplicada, E.T.S.I. Industriales, University of Vigo, 36310 (Spain); Fiorucci, M.P. [Centro de Investigacións Tecnolóxicas (CIT), University of A Coruña, 15403, Ferrol (Spain)

    2014-05-01

    Sulphated black crust is a common form of deterioration affecting stone used in monuments, usually occurs in contaminated atmospheres or urban environments. Its origin and cleaning have been studied extensively, for decades, in the case of carbonate rocks. Recent studies show that this form of alteration also affects granites. Scientific research on laser removal effectiveness of gypsum-rich black crust on granites needs to be scientifically addressed considering the inexistent references. This paper assesses the removal by laser of sulphate-rich black crusts on granite using the different harmonics of a Nd:YAG nanosecond pulsed laser (266 nm, 355 nm, 532 nm and 1064 nm). Effectiveness was evaluated using Scanning Electron Microscopy with Energy Dispersive X-ray Spectrometry (SEM–EDS), X-Ray Diffraction (XRD) and Attenuated Total Reflection-Fourier Infrared Transform Spectroscopy (ATR-FTIR). We also evaluated the effect of the radiation on granite-forming minerals and on the colour of the stone using Scanning Electron Microscopy and spectrophotometry colour measurements respectively. SEM–EDS, XRD and ATR-FTIR analyses show that the higher the wavelength, the more efficient the cleaning, so samples cleaned using 1064 nm pulsed laser recovered its original colour. Nevertheless, the Nd:YAG laser did not completely eliminate the crust, and gypsum crystals remaining on the rock surface are observed, even at the most effective wavelength.

  10. Effectiveness and harmful effects of removal sulphated black crust from granite using Nd:YAG nanosecond pulsed laser

    International Nuclear Information System (INIS)

    Pozo, S.; Barreiro, P.; Rivas, T.; González, P.; Fiorucci, M.P.

    2014-01-01

    Sulphated black crust is a common form of deterioration affecting stone used in monuments, usually occurs in contaminated atmospheres or urban environments. Its origin and cleaning have been studied extensively, for decades, in the case of carbonate rocks. Recent studies show that this form of alteration also affects granites. Scientific research on laser removal effectiveness of gypsum-rich black crust on granites needs to be scientifically addressed considering the inexistent references. This paper assesses the removal by laser of sulphate-rich black crusts on granite using the different harmonics of a Nd:YAG nanosecond pulsed laser (266 nm, 355 nm, 532 nm and 1064 nm). Effectiveness was evaluated using Scanning Electron Microscopy with Energy Dispersive X-ray Spectrometry (SEM–EDS), X-Ray Diffraction (XRD) and Attenuated Total Reflection-Fourier Infrared Transform Spectroscopy (ATR-FTIR). We also evaluated the effect of the radiation on granite-forming minerals and on the colour of the stone using Scanning Electron Microscopy and spectrophotometry colour measurements respectively. SEM–EDS, XRD and ATR-FTIR analyses show that the higher the wavelength, the more efficient the cleaning, so samples cleaned using 1064 nm pulsed laser recovered its original colour. Nevertheless, the Nd:YAG laser did not completely eliminate the crust, and gypsum crystals remaining on the rock surface are observed, even at the most effective wavelength.

  11. Advanced APS Impacts on Vehicle Payloads

    Science.gov (United States)

    Schneider, Steven J.; Reed, Brian D.

    1989-01-01

    Advanced auxiliary propulsion system (APS) technology has the potential to both, increase the payload capability of earth-to-orbit (ETO) vehicles by reducing APS propellant mass, and simplify ground operations and logistics by reducing the number of fluids on the vehicle and eliminating toxic, corrosive propellants. The impact of integrated cryogenic APS on vehicle payloads is addressed. In this system, launch propulsion system residuals are scavenged from integral launch propulsion tanks for use in the APS. Sufficient propellant is preloaded into the APS to return to earth with margin and noncomplete scavenging assumed. No propellant conditioning is required by the APS, but ambient heat soak is accommodated. High temperature rocket materials enable the use of the unconditioned hydrogen/oxygen in the APS and are estimated to give APS rockets specific impulse of up to about 444 sec. The payload benefits are quantified and compared with an uprated monomethyl hydrazine/nitrogen tetroxide system in a conservative fashion, by assuming a 25.5 percent weight growth for the hydrogen/oxygen system and a 0 percent weight growth for the uprated system. The combination and scavenging and high performance gives payload impacts which are highly mission specific. A payload benefit of 861 kg (1898 lbm) was estimated for a Space Station Freedom rendezvous mission and 2099 kg (4626 lbm) for a sortie mission, with payload impacts varying with the amount of launch propulsion residual propellants. Missions without liquid propellant scavenging were estimated to have payload penalties, however, operational benefits were still possible.

  12. Coaching Strategies for AP: Building a Successful AP European History Program

    Science.gov (United States)

    Fornaciari, Jim

    2014-01-01

    The October 2013 special issue of "Social Education" dealt with almost all AP social studies subjects, but omitted AP European History. This is one of the most fascinating AP subjects for students and teachers alike. In this article, the author shares his experiences since hewas given the responsibility of building his school's Advanced…

  13. Acid sulphate soil disturbance and metals in groundwater: Implications for human exposure through home grown produce

    International Nuclear Information System (INIS)

    Hinwood, Andrea Lee; Horwitz, Pierre; Appleyard, Steve; Barton, Caroline; Wajrak, Magda

    2006-01-01

    A significant emerging environmental problem is the disturbance and oxidation of soils with high levels of iron sulphide minerals resulting in acidification and causing the mobilization of metals into groundwater. This process is occurring in many parts of the world. In Western Australia, impacted groundwater is extracted by residents for domestic use. We sought to establish domestic use patterns of bore water and the concentration of metals. Sixty-seven domestic bore water samples clearly indicated oxidation of sulphidic materials with heavy metal concentrations ranging for aluminium (< DL-37.0 mg/L), arsenic (< DL-6.6 mg/L), iron (< DL-1200 mg/L), cadmium (< DL-0.021 mg/L), lead (< DL-0.040 mg/L), selenium (< DL-0.006 mg/L). A high proportion of residents used bore water on home grown produce. The study suggests that there is potential for human exposure to heavy metals via the consumption of home grown produce. This warrants further investigation in light of increasing acid sulphate soil disturbance in many locations. - Acidified bore water may introduce metals into produce for home consumption

  14. Mobility of sulphate in experimentally acidified soils from Galicia (NW Spain)

    Energy Technology Data Exchange (ETDEWEB)

    Merino, A.; Garcia-Rodeja, E. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain). Dept. de Eda`fologia y Quimica Agricola

    1996-02-01

    Retention of SO{sub 4}{sup 2-} was investigated in Galician soils throughout an intense regime of acidification. Experiments consisted of the addition of an H{sub 2}SO{sub 4} solution (pH 2.7) to columns of 6 soils of contrasting properties over 1,2 or 5 months. Leachates were obtained continuously throughout the experiment for analysis, and analysis made of the solid fractions after 1, 2 or 5 months. The greatest capacities for retention of SO{sub 4}{sup 2-} were found in soil developed from serpentine and micaschist; the lowest in soils from granite, slate and sandy sediments. The surface horizons, especially those rich in organic matter, displayed low retention of SO{sub 4}{sup 2-}. The amount of SO{sub 4}{sup 2-} adsorbed throughout the experiment depended on the content of crystalline forms of Fe and with the Fe and Al extracted with dithionite-citrate. The low retention of SO{sub 4}{sup 2-} in the organic horizons and the slightly negative relation with the organic matter suggest an inhibitory effect of the organic matter on the SO{sub 4}{sup 2-} retention process. Results of the study show that, under conditions of moderate acidity, SO{sub 4}{sup 2-} retention occurs in the form of adsorption; in strongly acidic conditions, the precipitation of aluminium-sulphate minerals may provide an additional retention mechanism. 41 refs., 3 figs., 4 tabs.

  15. Investigation of lithium sulphate for high temperature thermal energy storage

    Science.gov (United States)

    Bayon, Alicia; Liu, Ming; Bruno, Frank; Hinkley, Jim

    2017-06-01

    Lithium sulphate (Li2SO4) was evaluated as a solid-solid PCM material to be coupled with concentrated solar power (CSP) technologies. The energy is stored in a cubic crystalline phase that is formed at temperatures above 576°C and can potentially be discharged at temperatures as low as 150°C, providing both sensible and latent thermal energy storage in a hybrid sensible-latent system. These operational conditions are appropriate for current CSP technologies based on subcritical steam Rankine power cycles. Results from thermal cycling experiments in air showed no change in energy storage capacity after 15 cycles. There was up to a 5% reduction in latent thermal capacity and 0.95% in total thermal capacity after 150 cycles in air. In our paper, we evaluate a hybrid sensible-latent thermal energy storage system based on lithium sulphate from an economic and technical performance point of view, demonstrating its potential as a high temperature thermal energy storage material.

  16. ELECTROCHEMICAL CORROSION TESTING OF TANKS 241-AN-102 & 241-AP-107 & 241-AP-108 IN SUPPORT OF ULTRASONIC TESTING

    Energy Technology Data Exchange (ETDEWEB)

    WYRWAS RB; DUNCAN JB

    2008-11-20

    This report presents the results of the corrosion rates that were measured using electrochemical methods for tanks 241-AN-102 (AN-102), 241-AP-107 (AP 107), and 241-AP-108 (AP-108) performed under test plant RPP-PLAN-38215. The steel used as materials of construction for AN and AP tank farms was A537 Class 1. Test coupons of A537 Class 1 carbon steel were used for corrosion testing in the AN-107, AP-107, and AP-108 tank waste. Supernate will be tested from AN-102, AP-107, and Ap-108. Saltcake testing was performed on AP-108 only.

  17. The solvent extraction of cerium from sulphate solution - mini plant trials

    International Nuclear Information System (INIS)

    Soldenhoff, K.; Wilkins, D.; Ring, R.

    1998-01-01

    Full text: The Mt. Weld deposit in Western Australia has a complex rare earth mineralisation. The rare earth phosphate minerals, which include monazite, are amenable to conventional caustic cracking followed by hydrochloric acid dissolution of the trivalent rare earths. The presence of the mineral cerianite in the ore, which is unaffected by the alkali attack, results in rejection of a considerable proportion of the cerium to the acid leach residue. The recovery of cerium from a sulphate solution, resulting from the processing of such a residue, is the subject of the current paper. The liquor treated by solvent extraction contained 63 g L -1 rare earths and the cerium to total rare earth ratio was 75%. Other impurities, including Fe and Th, totalled 2000 ppm. A solvent mixture of commercially available extractants in a low aromatic content diluent was used to extract Ce 4+ selectively over the trivalent rare earths. Partial co-extraction of Fe and Th occurred but it was found that these elements were not easily stripped and therefore selective back extraction of cerium was possible. The cerium was stripped from the organic phase by hydrochloric acid and hydrogen peroxide. In continuous counter-current trials two extraction stages and three strip stages were used. In order to produce two grades of strip liquor, stripping was divided into two circuits. The first strip circuit consisting of a single stage, contained proportionally more of the trivalent rare earths. The second strip circuit, consisting of two stages, removed the remaining cerium with proportionally less of the rare earths. A bleed solvent stream was treated for removal of impurities to prevent build-up in the solvent. In the continuous counter current trials, 95% Ce 4+ extraction was achieved and the Ce to total rare earth ratio was upgraded to > 99%

  18. Avaliação do fluxo salivar total não estimulado, após o emprego do lauril-dietileno-glicol-éter-sulfato de sódio associado ao hidróxido de cálcio em pacientes irradiados com carcinoma espinocelular da boca e orofaringe Total salivary non stimulated flow evaluation, after radiotherapy for patients with mouth and oropharynx squamous cell carcinoma with the association of lauryl-dietylene-glycol-ether sodium sulphate and calcium hydroxide

    Directory of Open Access Journals (Sweden)

    Christiano M. Correia

    2001-09-01

    Full Text Available Introdução: Avaliar quantitativamente o índice de fluxo salivar total não estimulado de pacientes portadores de carcinoma espinocelular de boca e orofaringe, após tratamento radioterápico, exclusivo, tratados com a associação de lauril-dietileno-glicol-éter-sulfato de sódio e hidróxido de cálcio. Forma de estudo: Prospectivo clínico não randomizado. Método: o fluxo salivar foi avaliado em 11 pacientes (n=11 em três fases: 1ª. durante sete semanas, quando foram submetidos à telecobaltoterapia na dose total de 7.000 cGy, sem utilização de medicamento para estimular a salivação; 2ª. em seguida, durante oito semanas após o tratamento radioterápico, quando os pacientes utilizaram a associação medicamentosa como estimulante da salivação; 3ª. finalmente, durante oito semanas após ter sido interrompido o tratamento com a associação de drogas. Resultados: os valores obtidos foram analisados com vistas a avaliação da eficácia da medicação utilizada para evitar a hipofunção salivar no período pós-radioterapia. Dos 11 pacientes, 10 apresentaram melhora significante dos índices de fluxo salivar com o uso da associação de drogas, em relação aos valores do período final do tratamento radioterápico, e mantiveram esses índices mesmo com a suspensão do medicamento. Conclusões: a associação de drogas foi eficaz no tratamento da hipofunção salivar, e proporcionou aumento do índice salivar total não estimulado em 10 dos 11 pacientes, sendo esse aumento mantido por dois meses após a interrupção do uso do medicamento.Introduction: Evaluation of quantitative non-stimulated salivary flow rate in 11 patients with oral and oropharyngeal squamous cell carcinoma after exclusive radiation therapy, treated with the association of lauryl-diethylene-glycol-ether-sodium sulfate and calcium hydroxide. Study design: Prospective clinical no randomized. Method: salivary flow was evaluated in three phases: 1 during seven

  19. Removal of Pb (II from Aqueous Solutions Using Mixtures of Bamboo Biochar and Calcium Sulphate, and Hydroxyapatite and Calcium Sulphate

    Directory of Open Access Journals (Sweden)

    Ahmed Hassan

    2016-01-01

    Full Text Available Sorption characteristics of Pb(II from aqueous solutions through a low-cost adsorbent mixture comprising of Bamboo biochar (BB and Calcium Sulphate (CS, and a more expensive mixture of Hydroxyapatite (HAP and Calcium Sulphate (CS, were investigated. The effects of equilibrium contact time, and adsorbate concentration conducted in batch experiments were studied. Adsorption equilibrium was established in 40 (min. The adsorption mechanism of Pb(II from these two adsorbent mixtures was carried out through a kinetic rate order. A pseudo second-order kinetic model was applied for the adsorption processes. The model yielded good correlation (R2 >0.999 of the experimental data. Adsorption of Pb(II using (BB&CS and (HAP&CS correlated well (R2 >0.99 with both the Langmuir and Freundlich isotherm equations under the concentration range studied. Hence, the effectiveness of an inexpensive natural material (BB&CS mixture in Pb(II removal is established, and is promising for use in other heavy metal adsorptions.

  20. Correlation analysis between sulphate content and leaching of sulphates in recycled aggregates from construction and demolition wastes.

    Science.gov (United States)

    Barbudo, Auxi; Galvín, Adela P; Agrela, Francisco; Ayuso, Jesús; Jiménez, Jose Ramón

    2012-06-01

    In some recycled aggregates applications, such as component of new concrete or roads, the total content of soluble sulphates should be measured and controlled. Restrictions are usually motivated by the resistance or stability of the new structure, and in most cases, structural concerns can be remedied by the use of techniques such as sulphur-resistant cements. However, environmental risk assessment from recycling and reuse construction products is often forgotten. The purpose of this study is to analyse the content of soluble sulphate on eleven recycled aggregates and six samples prepared in laboratory by the addition of different gypsum percentages. As points of reference, two natural aggregates were tested. An analysis of the content of the leachable amount of heavy metals regulated by European regulation was included. As a result, the correlation between solubility and leachability data allow suggest a limiting gypsum amount of 4.4% on recycled aggregates. This limit satisfies EU Landfill Directive criteria, which is currently used as reference by public Spanish Government for recycled aggregates in construction works. Copyright © 2012 Elsevier Ltd. All rights reserved.

  1. Sulphurous Mineral Waters: New Applications for Health

    Directory of Open Access Journals (Sweden)

    Jose Manuel Carbajo

    2017-01-01

    Full Text Available Sulphurous mineral waters have been traditionally used in medical hydrology as treatment for skin, respiratory, and musculoskeletal disorders. However, driven by recent intense research efforts, topical treatments are starting to show benefits for pulmonary hypertension, arterial hypertension, atherosclerosis, ischemia-reperfusion injury, heart failure, peptic ulcer, and acute and chronic inflammatory diseases. The beneficial effects of sulphurous mineral waters, sulphurous mud, or peloids made from sulphurous mineral water have been attributed to the presence of sulphur mainly in the form of hydrogen sulphide. This form is largely available in conditions of low pH when oxygen concentrations are also low. In the organism, small amounts of hydrogen sulphide are produced by some cells where they have numerous biological signalling functions. While high levels of hydrogen sulphide are extremely toxic, enzymes in the body are capable of detoxifying it by oxidation to harmless sulphate. Hence, low levels of hydrogen sulphide may be tolerated indefinitely. In this paper, we review the chemistry and actions of hydrogen sulphide in sulphurous mineral waters and its natural role in body physiology. This is followed by an update of available data on the impacts of exogenous hydrogen sulphide on the skin and internal cells and organs including new therapeutic possibilities of sulphurous mineral waters and their peloids.

  2. The influence of chloride and sulphate ions on the slaking rate of ...

    African Journals Online (AJOL)

    This paper describes an investigation into the influence of chloride and sulphate ions on the slaking of lime prepared from limestones of different geological origin in South Africa. It was endeavoured to assess the effects of the presence of chloride and sulphate ions on the hydration rate of lime, compared to its slaking in ...

  3. Comparison between sucrose, ethanol and methanol as carbon and energy sources for biological sulphate reduction

    CSIR Research Space (South Africa)

    Greben, HA

    2000-01-01

    Full Text Available containing high sulphate. Proc. Ind. Waste Conf., Purdue Univ., West Lafayette, 871?877. Omil, F., Lens, P., Visser, A., Hulshoff-Pol, L.W. and Lettinga, G. (1997). Long term competition between sulphate reducing bacteria and methanogenic bacteria in UASB...

  4. Modelling the competition between sulphate reducers and methanogens in a thermophilic methanol-fed bioreactor

    NARCIS (Netherlands)

    Spanjers, H.; Weijma, J.; Abusam, A.

    2002-01-01

    Sulphate can be removed from wastewater by means of biological anaerobic reduction to sulphide. The reduction requires the presence of a substrate that can serve as an electron donor. Methanol a suitable electron donor for sulphate reduction under thermophilic conditions. In an anaerobic system

  5. Studies on calcium, magnesium and sulphate in the Mandovi and Zuari river system (Goa)

    Digital Repository Service at National Institute of Oceanography (India)

    SenGupta, R.; Naik, S.

    -conservative parameters. Sulphate, however behaves in a purely conservative manner and remains in a steady state in the rivers. A'Simple mixture'relationship is applied to calculate the dilution and mixing processes in the rivers using calcium, magnesium and sulphate...

  6. Sulphate reduction and calcite precipitation in relation to internal eutrophication of groundwater fed alkaline fens

    NARCIS (Netherlands)

    Cirkel, D.G.; Beek, van C.G.E.M.; Witte, J.P.M.; Zee, van der S.E.A.T.M.

    2014-01-01

    Although in Europe atmospheric deposition of sulphur has decreased considerably over the last decades, groundwater pollution by sulphate may still continue due to pyrite oxidation in the soil as a result of excessive fertilisation. Inflowing groundwater rich in sulphate can change biogeochemical

  7. Complete sulphate removal from neutralised acidic mine drainage with barium carbonate

    CSIR Research Space (South Africa)

    Swanepoel, H

    2012-03-01

    Full Text Available sulphate removal is achieved. However, further treatment is required in order to reduce the sulphate concentration to below 500 mg/l, which is the required concentration for discharge into waterways. The CSIR developed and patented the ABC (alkali-barium-calcium...

  8. Treatment of acid and sulphate-rich effluents in an integrated biological/chemical process

    CSIR Research Space (South Africa)

    Maree, JP

    2004-04-01

    Full Text Available and sulphide could be removed simultaneously due to co-existence of sulphate-reducing bacteria and sulphur oxidising bacteria. The volumetric sulphate reduction rate in a complete-mixed reactor, with sucrose as an organic carbon and energy source, amounts to 12...

  9. Antiphospholipid syndrome (APS) nephropathy in catastrophic, primary, and systemic lupus erythematosus-related APS.

    Science.gov (United States)

    Tektonidou, Maria G; Sotsiou, Flora; Moutsopoulos, Haralampos M

    2008-10-01

    Renal involvement in antiphospholipid syndrome (APS) has been poorly recognized. A renal small-vessel vasculopathy, defined as APS nephropathy, has recently been observed in small series of patients with primary APS (PAPS) and systemic lupus erythematosus (SLE)-APS. We examined the renal histologic, clinical, and laboratory characteristics of different groups of patients with APS including catastrophic APS (CAPS). Our study included all CAPS (n=6), PAPS (n=8), and SLE-APS (n=23) patients with biopsy-proven renal involvement who were referred to our departments. The kidney biopsy specimens were retrospectively examined by the same renal pathologist. APS nephropathy was diagnosed as previously described. Demographic, clinical, and laboratory data were recorded. All patients with CAPS had acute and chronic renal vascular lesions compatible with diagnosis of APS nephropathy. Thrombotic microangiopathy (TMA), the acute lesion, was observed in all CAPS patients. Fibrous intimal hyperplasia of interlobular arteries (FIH) and focal cortical atrophy (FCA) were the most common chronic vascular lesions, occurring in 4 of 6 (66.7%) and 3 of 6 (50%) patients with CAPS, respectively. TMA was detected in 3 of 8 (37.5%) patients with PAPS and in 8 of 23 (35%) patients with SLE-APS, while FIH and FCA were found with similar frequencies in all 3 groups. Hypertension, proteinuria, hematuria, and renal insufficiency were the most common renal manifestations of all APS groups. Acute and chronic APS nephropathy lesions were detected in all 3 APS groups. Acute lesions were more prominent in CAPS, while chronic lesions were found with similar frequencies in all groups. Hypertension, proteinuria, hematuria, and renal insufficiency were the most common renal manifestations of all APS groups.

  10. AP1000 Containment Design and Safety Assessment

    International Nuclear Information System (INIS)

    Wright, Richard F.; Ofstun, Richard P.; Bachere, Sebastien

    2002-01-01

    The AP1000 is an up-rated version of the AP600 passive plant design that recently received final design certification from the US NRC. Like AP600, the AP1000 is a two-loop, pressurized water reactor featuring passive core cooling and passive containment safety systems. One key safety feature of the AP1000 is the passive containment cooling system which maintains containment integrity in the event of a design basis accident. This system utilizes a high strength, steel containment vessel inside a concrete shield building. In the event of a pipe break inside containment, a high pressure signal actuates valves which allow water to drain from a storage tank atop the shield building. Water is applied to the top of the containment shell, and evaporates, thereby removing heat. An air flow path is formed between the shield building and the containment to aid in the evaporation and is exhausted through a chimney at the top of the shield building. Extensive testing and analysis of this system was performed as part of the AP600 design certification process. The AP1000 containment has been designed to provide increased safety margin despite the increased reactor power. The containment volume was increased to accommodate the larger steam generators, and to provide increased margin for containment pressure response to design basis events. The containment design pressure was increased from AP600 by increasing the shell thickness and by utilizing high strength steel. The passive containment cooling system water capacity has been increased and the water application rate has been scaled to the higher decay heat level. The net result is higher margins to the containment design pressure limit than were calculated for AP600 for all design basis events. (authors)

  11. Hydrothermal Alteration in an Acid-Sulphate Geothermal Field: Sulphur Springs, Saint Lucia

    Science.gov (United States)

    Joseph, E. P.; Barrett, T. J.

    2017-12-01

    Sulphur Springs is a vigorous geothermal field associated with the Soufrière Volcanic Centre in southern Saint Lucia. Bubbling hydrothermal pools are rich in sodium-calcium sulphate, with pHs of 3-7 and temperatures of 41-97ºC. Fumaroles have temperatures up to, and at times above, 100°C. Gases from bubbling pools and fumaroles have high contents of CO2 (601-993 mmol/mol) and H2S (3-190 mmol/mol). To investigate the nature and extent of hydrothermal alteration, detailed chemical analysis was carried out on 25 altered rocks, 10 sediments from pools and creeks in the main discharge area, and 15 little-altered rocks up to 2 km away from geothermal field. Eight altered samples were also analysed for stable isotope compositions, with mineralogy determined by X-ray diffraction and mineral liberation analysis. Least-altered host rocks comprise calc-alkaline feldspar-quartz-porphyritic dacites of near-uniform composition that form massive domes and volcaniclastic units. These rocks were emplaced 10-30 Ka ago (Lindsay et al. 2013). Within the geothermal field, the dacites have been highly altered to kaolinite, quartz, cristobalite, alunite, natroalunite, smectite, native sulphur, jarosite, gypsum and amorphous compounds. Muds from grey to blackish hydrothermal pools additionally contain iron sulphides, mainly pyrite. Despite intense alteration of the original dacites, Zr and Ti have remained essentially immobile, allowing the calculation of mass changes. Major depletions of Fe, Mg, Ca, Na and commonly Si occur over an area of at least 200 x 400 m. The most altered rocks also show losses of Al, light REE and Y, implying leaching by highly acidic waters. A few altered rocks have, however, gained Al together with Si and P. Also present are m-scale zones of silica + native sulphur, wherein the silica appears to represent a residue from the leaching of dacite, rather than a hydrothermal addition. Delta-34S values of samples containing mixtures of sulphates, native sulphur and

  12. An overview of geoengineering of climate using stratospheric sulphate aerosols.

    Science.gov (United States)

    Rasch, Philip J; Tilmes, Simone; Turco, Richard P; Robock, Alan; Oman, Luke; Chen, Chih-Chieh; Stenchikov, Georgiy L; Garcia, Rolando R

    2008-11-13

    We provide an overview of geoengineering by stratospheric sulphate aerosols. The state of understanding about this topic as of early 2008 is reviewed, summarizing the past 30 years of work in the area, highlighting some very recent studies using climate models, and discussing methods used to deliver sulphur species to the stratosphere. The studies reviewed here suggest that sulphate aerosols can counteract the globally averaged temperature increase associated with increasing greenhouse gases, and reduce changes to some other components of the Earth system. There are likely to be remaining regional climate changes after geoengineering, with some regions experiencing significant changes in temperature or precipitation. The aerosols also serve as surfaces for heterogeneous chemistry resulting in increased ozone depletion. The delivery of sulphur species to the stratosphere in a way that will produce particles of the right size is shown to be a complex and potentially very difficult task. Two simple delivery scenarios are explored, but similar exercises will be needed for other suggested delivery mechanisms. While the introduction of the geoengineering source of sulphate aerosol will perturb the sulphur cycle of the stratosphere signicantly, it is a small perturbation to the total (stratosphere and troposphere) sulphur cycle. The geoengineering source would thus be a small contributor to the total global source of 'acid rain' that could be compensated for through improved pollution control of anthropogenic tropospheric sources. Some areas of research remain unexplored. Although ozone may be depleted, with a consequent increase to solar ultraviolet-B (UVB) energy reaching the surface and a potential impact on health and biological populations, the aerosols will also scatter and attenuate this part of the energy spectrum, and this may compensate the UVB enhancement associated with ozone depletion. The aerosol will also change the ratio of diffuse to direct energy

  13. Ammonium sulphate on maize crops under no tillage

    Directory of Open Access Journals (Sweden)

    Maria Anita Gonçalves da Silva

    2012-01-01

    Full Text Available The objectives of this work were to evaluate the management of N and S (as ammonium sulphate fertilization under no-tillage system on the components of maize productivity and on N and S accumulation in the crop, as well as to evaluate the minimum value of the Nitrogen Sufficiency Index (NSI 0.95 as an indicator for side dressing requirements. The experiment had a completely randomized block design with six treatments and four replications carried out in Red Latosol dystrophic soil (Hapludox, in Campo Mourão, Paraná State, where the following treatments in summer growth maize were applied: T1- 120 kg ha-1 N in seeding; T2- 120 kg ha-1 N in side dressing; T3- 40 kg ha-1 N in seeding and 80 kg ha-1 N in side dressing; T4- 30 kg ha-1 N in seeding and 90 kg ha-1 N in side dressing, monitored by a chlorophyll meter using the Nitrogen Sufficiency Index (NSI; T5- 120 kg ha-1 N anticipated in wheat seeding; T6- without nitrogen fertilization. NSI was determined by the relationship between the leaf chlorophyll index (ICF average of T4 plants and that one in the plot fertilized with 120 kg ha-1 N at the maize seed sowing (T1. During two years, ammonium sulphate was applied to the maize crop after wheat under no tillage system. In the first year, with adequate rainfall, the maize yield was similar to the one in which the complete ammonium sulphate dose application was done in maize seeding and side dressing. The anticipated fertilization to wheat seed sowing resulted in maize yield without difference from the parceled form. In the second year, with irregular rainfall, all treatments with N were similar and they increased maize yield compared to that without N fertilization. NSI of 0.95 was not efficient to evaluate maize N requirements in side dressing, and resulted in lower maize yield. N was accumulated mainly in the grains unlike S that accumulated in the plant shoots; both were highly correlated to maize productivity.

  14. AP English language & composition crash course

    CERN Document Server

    Hogue, Dawn

    2012-01-01

    AP English Language & Composition Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP English Language & Composition Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP English Language & Composition course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valua

  15. Operation of the APS rf gun

    International Nuclear Information System (INIS)

    Lewellen, J. W.

    1998-01-01

    The Advanced Photon Source (APS) has a thermionic-cathode rf gun system capable of providing beam to the APS linac. The gun system consists of a 1.6-cell thermionic-cathode rf gun, a fast kicker for beam current control, and an alpha magnet for bunch compression and injection into the APS linac line. This system is intended for use both as an injector for positron creation, and as a first beam source for the Low-Energy Undulator Test Line (LEUTL) project [1]. The first measured performance characteristics of the gun are presented.

  16. Tank 241-AP-107, grab samples, 7AP-99-1, 7AP-99-3 and 7AP-99-4 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    BELL, K.E.

    1999-08-12

    This document is the format IV, final report for the tank 241-AP-107 (AP-107) grab samples taken in May 1999 to address waste compatibility concerns. Chemical, radiochemical, and physical analyses on the tank AP-107 samples were performed as directed in Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999. Any deviations from the instructions provided in the tank sampling and analysis plan (TSAP) were discussed in this narrative. Interim data were provided earlier to River Protection Project (RPP) personnel, however, the data presented here represent the official results. No notification limits were exceeded.

  17. Triglyceride cracking for biofuel production using a directly synthesised sulphated zirconia catalyst.

    Science.gov (United States)

    Eterigho, Elizabeth J; Lee, Jon G M; Harvey, Adam P

    2011-05-01

    In this study, sulphated zirconia was directly synthesised and compared to the conventional wet method of preparation. The surface areas and pore sizes were 169 m(2)/g, 0.61 μm (directly synthesized) and 65 m(2)/g, 0.24 μm (conventional method), respectively. Directly synthesized sulphated zirconia was amorphous, whereas conventionally prepared sulphated zirconia is polycrystalline. Their IR spectra were broadly similar, although the area of the 1250 to 950 cm(-1) band was larger for directly synthesised sulphated zirconia. Not only were conversions greater for directly synthesised sulphated zirconia (63% vs. 42% after 4h), but it exhibited significantly greater yield for fatty acid methyl esters. The percentage yield (after 1h) of methyl esters was 43% for the directly synthesised catalyst and 15% for the conventionally synthesised. Copyright © 2011 Elsevier Ltd. All rights reserved.

  18. Ice and mineral licks used by caribou in winter

    Directory of Open Access Journals (Sweden)

    Douglas C. Heard

    1990-09-01

    Full Text Available In winter, barren-ground caribou obtain minerals from ice and soil licks. Between December and April we have seen caribou cratering on the surface of frozen lakes and licking the ice. Ice samples from eight licks on four lakes contained concentrations of calcium, magnesium, sodium, potassium, phosphorus, chloride and sulphate many times higher than in the surrounding unlicked ice or than would be expected in lake water. Soil licks being used in March and June had high concentrations of calcium, magnesium, sodium phosphorus and potassium. In winter caribou may be seeking supplements of all of the major mineral elements (calcium, magnesium, sodium and potassium at ice and soil licks because lichens, their staple winter diet, are low in minerals and may also reduce the absorption of some minerals.

  19. Adsorption of inorganic anionic contaminants on surfactant modified minerals

    Directory of Open Access Journals (Sweden)

    MAGDALENA TOMASEVIC-CANOVIC

    2003-11-01

    Full Text Available Organo-mineral complexes were obtained by treatment of aluminosilicate minerals (zeolite, bentonite and diatomaceous earth with a primary amine (oleylamine and an alkyl ammonium salt (stearyldimethylbenzyl ammonium chloride. The modification of the zeolite surface was carried out in two steps. The first step was treatment of the zeolite with 2 M HCl. This acid treatment of the zeolite increased its affinity for neutral molecules such as surface-active amines. The second step of the modification was the adsorption of oleylamine on the acid treated zeolite. Four types of organo-mineral complexes were prepared and their anion adsorption properties were compared to those of organo-zeolite. The adsorption of sulphate, bichromate and dihydrogenphosphate anions on the organo-mineral complexes was investigated. The anion adsorption measurements showed that the most efficient adsorbent for anion water pollutants was the primary amine modified H+-form zeolite.

  20. Hydrothermal minerals

    Digital Repository Service at National Institute of Oceanography (India)

    Nath, B.N.

    and in sedimented rifts adjacent to continental margins. The hydrothermal deposits mainly occur in the tectonically active regions, where plates shift and spread creating fissures in the seafloor. Mineralization at the spreading ridges is the result of sea-floor... processes. Submarine hydrothermal circulation in the oceanic crust and its activity on the ocean floor are fundamental processes controlling the transfer of energy and material from the lithosphere to the hydrosphere. Thermally induced circulation...

  1. Aggregation of Crystalline Copper Sulphate Salt in a Gelatin Medium

    Science.gov (United States)

    Bhattacharyya, Subarnarekha; Roy, Biswajit; Tarafdar, Sujata

    A drying droplet changes its morphological pattern depending upon complex pattern forming system. To control the distribution of solute particles in a droplet during drying is an important aspect in many scientific and industrial purposes. In this work, with the help of optical microscopy, we study characteristic patterns generated in dried drops of colloidal copper sulphate (CuSO4ṡ5H2O) solution on surface of glass. At lower concentration of salt solution the growth pattern follows a monofractal structure whereas at higher concentration, the self-assembled pattern gradually gets disappeared. Calculating the fractal dimension (FD) of the generated patterns by box counting method with help of imageJ, it is observed that the patterns resemble DLA structure through a specific range of concentration of the salt solution.

  2. Growth of calcium sulphate deposits on heated wall

    International Nuclear Information System (INIS)

    Muratore, Emile

    1970-01-01

    As distillation processes are used to desalinate sea water, salt deposit (or scaling) under the form of crystals on heat exchange surfaces is one of the main difficulties for these processes. Addressing the case of calcium sulphate solution instead of the more complex case of sea water, this research thesis first recalls theoretical, thermodynamic and kinetic data involved in precipitation, and aims at determining the kinetic law and growth mechanism. Precipitation of hemihydrate is experimentally studied in transient regime with a forced circulation without boiling along a heated wall, then with natural circulation with boiling occurring on the wall. A model is proposed to explain the experimentally determined kinetic law. A study in permanent regime is performed to analyze operating conditions of a heat exchanger. In-thickness growth rate of the hemihydrate is obtained from the evolution of the thermal resistance due to deposits. The inhibiting influence of iron is outlined

  3. Bronchography in dogs. Comparative study with two barium sulphate solutions

    International Nuclear Information System (INIS)

    Thibaut, J.; Gallardo, P.; Vargas, L.; Deppe, R.; Born, R.

    1998-01-01

    Two solutions of barium sulphate, 60 and 30% w/v, were compared with the ''overflow'' Bronchographic method. Two groups of eight healthy adult does of both sexes, weighing 7 to 18 kg were used for the study. The dogs were anaesthetised with thiopentone sodium 2% (20 mg/kg iv). After intubation, each dog received contrast medium by a catheter connected to a syringe, in a 9 mi dose. Two series of two x-rays plates were taken in left lateral recumbent, 3 and 6 min after administering the contrast medium and in ventrodorsal projection, 30 sec. later. The x-ray plates obtained were analysed and compared intra and inter group considering the advance speed of the contrast medium, the radiographic density and outlines. Adverse reactions were controlled

  4. Bioactivity and Applications of Sulphated Polysaccharides from Marine Microalgae

    Directory of Open Access Journals (Sweden)

    Rui Manuel Santos Costa de Morais

    2013-01-01

    Full Text Available Marine microalgae have been used for a long time as food for humans, such as Arthrospira (formerly, Spirulina, and for animals in aquaculture. The biomass of these microalgae and the compounds they produce have been shown to possess several biological applications with numerous health benefits. The present review puts up-to-date the research on the biological activities and applications of polysaccharides, active biocompounds synthesized by marine unicellular algae, which are, most of the times, released into the surrounding medium (exo- or extracellular polysaccharides, EPS. It goes through the most studied activities of sulphated polysaccharides (sPS or their derivatives, but also highlights lesser known applications as hypolipidaemic or hypoglycaemic, or as biolubricant agents and drag-reducers. Therefore, the great potentials of sPS from marine microalgae to be used as nutraceuticals, therapeutic agents, cosmetics, or in other areas, such as engineering, are approached in this review.

  5. Impact of sulphate geoengineering on rice yield in China

    Science.gov (United States)

    Zhan, Pei; Zhu, Wenquan; Zheng, Zhoutao; Zhang, Donghai; Li, Nan

    2017-04-01

    Sulphate geoengineering is one of the mostly discussed mitigation methods against global warming for its feasibility and inexpensiveness. With SO2 consistently injected into the stratosphere to balance the radiative force caused by anthropogenic emission, sulphate engineering will significantly influence the climate over the planet and moreover, affect agriculture productivity. In our study, BNU-ESM model was used to simulate the impact of sulphate engineering on climate and ORYZA(v3) model was used to simulate the impact of climate change on rice yield/production in China. Firstly, the ORYZA(v3) model was evaluated and calibrated using daily climate data, management data and county-level yield record during 1981-2010 in 19 provinces in China. Then climate anomalies of sulphate geoengineering simulated by BNU-ESM model was used to perturb the observed climate data over 318 stations evenly distribute in China during 1981-2010. In our study, a 30-year climate record of anomalies were extracted from BNU-ESM model to match the observed climate data, which consisted of a 15-year geoengineering record and a 15-year post-geoengineering record. Lastly, the perturbed climate data was used in calibrated-ORYZA(v3) model to simulate the rice yield over the 318 stations, which were later averaged into corresponding provincial yield. The results showed that (1) geoengineering would balance solar radiation for approximate 140 W ṡ m-2 per year (about 0.9 K per year in temperature), which would meet the pre-concerted goal of geoengineering but it would take only about 3 years for temperature to recover after the termination of geoengineering. In spite of this, there would be a declining of vapour pressure for about 0.12 KPa per year during geoengineering period, and it would take about 15 years to recover during post-geoengineering period. The simulation showed that geoengineering would have a little declining impact on average precipitation and would not have much impact on wind

  6. Recent Insights into Cell Surface Heparan Sulphate Proteoglycans and Cancer

    DEFF Research Database (Denmark)

    Couchman, John R; Multhaupt, Hinke; Sanderson, Ralph D

    2016-01-01

    A small group of cell surface receptors are proteoglycans, possessing a core protein with one or more covalently attached glycosaminoglycan chains. They are virtually ubiquitous and their chains are major sites at which protein ligands of many types interact. These proteoglycans can signal...... and regulate important cell processes, such as adhesion, migration, proliferation, and differentiation. Since many protein ligands, such as growth factors, morphogens, and cytokines, are also implicated in tumour progression, it is increasingly apparent that cell surface proteoglycans impact tumour cell...... behaviour. Here, we review some recent advances, emphasising that many tumour-related functions of proteoglycans are revealed only after their modification in processes subsequent to synthesis and export to the cell surface. These include enzymes that modify heparan sulphate structure, recycling of whole...

  7. Bioactivity and Applications of Sulphated Polysaccharides from Marine Microalgae

    Science.gov (United States)

    de Jesus Raposo, Maria Filomena; de Morais, Rui Manuel Santos Costa; de Morais, Alcina Maria Miranda Bernardo

    2013-01-01

    Marine microalgae have been used for a long time as food for humans, such as Arthrospira (formerly, Spirulina), and for animals in aquaculture. The biomass of these microalgae and the compounds they produce have been shown to possess several biological applications with numerous health benefits. The present review puts up-to-date the research on the biological activities and applications of polysaccharides, active biocompounds synthesized by marine unicellular algae, which are, most of the times, released into the surrounding medium (exo- or extracellular polysaccharides, EPS). It goes through the most studied activities of sulphated polysaccharides (sPS) or their derivatives, but also highlights lesser known applications as hypolipidaemic or hypoglycaemic, or as biolubricant agents and drag-reducers. Therefore, the great potentials of sPS from marine microalgae to be used as nutraceuticals, therapeutic agents, cosmetics, or in other areas, such as engineering, are approached in this review. PMID:23344113

  8. Meet the APS Editors Coffee Break

    Science.gov (United States)

    2014-03-01

    The APS Journal Editors invite you to join them for conversation and light refreshments. The Editors will be available to answer questions, discuss your ideas, and listen to your comments about the journals. All are welcome to attend.

  9. Pentoxifylline Treatment in Acute Pancreatitis (AP)

    Science.gov (United States)

    2018-02-21

    Acute Pancreatitis (AP); Gallstone Pancreatitis; Alcoholic Pancreatitis; Post-ERCP/Post-procedural Pancreatitis; Trauma Acute Pancreatitis; Hypertriglyceridemia Acute Pancreatitis; Idiopathic (Unknown) Acute Pancreatitis; Medication Induced Acute Pancreatitis; Cancer Acute Pancreatitis; Miscellaneous (i.e. Acute on Chronic Pancreatitis)

  10. AP1000 design and construction integration

    International Nuclear Information System (INIS)

    Winters, James W.; Clelland, Jill A.

    2004-01-01

    Construction costs of commercial nuclear generating plants must be reduced in order to expand the future use of nuclear energy. Two of the drivers of plant construction costs are the cost of financing during the construction duration and the substantial amount of skilled craft labor hours needed on site during construction. The application of information technology (IT) has been used to understand and reduce both of these drivers by establishing parallel construction paths using modules and integrating construction sequence review into the design process. In a program sponsored by EPRI, Westinghouse has modeled the construction of AP1000 in '4D' to show its viability, to improve its logic, to improve the plant design for constructibility and overall to reduce time and risk in the construction schedule. The design of most of AP1000 was constrained to be a duplicate of AP600 except where components required expansion for the higher power level. As a result, the construction schedule for AP1000 is as mature and as robust as that for AP600. Two areas important to the construction of AP1000 did require some design work because they could not remain the same as AP1000. First, the turbine building had to be redesigned to accommodate the larger turbine and its support systems. Again, as much of the AP600 design and philosophy as possible was retained. The building required enlargement and the basemat, foundations, steel structure and structural modules required modification. As concrete, steel, and equipment were defined by the designers, they were matched to the original AP600 turbine building schedule. This forced designers to assemble files to be consistent with building assembly activities and to think about constructibility as they defined the final design. Second, the reinforcement structure within the concrete under and supporting the containment vessel required detail design. Westinghouse was fortunate to have the constructor Obayashi of Japan recommend a detailed

  11. AP1000{sup TM} plant modularization

    Energy Technology Data Exchange (ETDEWEB)

    Cantarero L, C.; Demetri, K. J. [Westinghouse Electric Co., 1000 Westinghouse Drive, Cranberry Township, PA 16066 (United States); Quintero C, F. P., E-mail: cantarc@westinghouse.com [Westinghouse Electric Spain, Padilla 17, 28006 Madrid (Spain)

    2016-09-15

    The AP1000{sup TM} plant is an 1100 M We pressurized water reactor (PWR) with passive safety features and extensive plant simplifications that enhance construction, operation, maintenance and safety. Modules are used extensively in the design of the AP1000 plant nuclear island. The AP1000 plant uses modern, modular-construction techniques for plant construction. The design incorporates vendor-designed skids and equipment packages, as well as large, multi-ton structural modules and special equipment modules. Modularization allows traditionally sequential construction tasks to be completed simultaneously. Factory-built modules can be installed at the site in a planned construction schedule. The modularized AP1000 plant allows many more construction activities to proceed in parallel. This reduces plant construction calendar time, thus lowering the costs of plant financing. Furthermore, performing less work onsite significantly reduces the amount of skilled field-craft labor, which costs more than shop labor. In addition to labor cost savings, doing more welding and fabrication in a factory environment raises the quality of work, allowing more scheduling flexibility and reducing the amount of specialized tools required onsite. The site layout for the AP1000 plant has been established to support modular construction and efficient operations during construction. The plant layout is compact, using less space than previous conventional plant layouts. This paper provides and overview of the AP1000 plant modules with an emphasis on structural modules. Currently the Westinghouse AP1000 plant has four units under construction in China and four units under construction in the United States. All have shown successful fabrication and installation of various AP1000 plant modules. (Author)

  12. Identification and treatment of APS renal involvement.

    Science.gov (United States)

    Tektonidou, M G

    2014-10-01

    Renal involvement in antiphospholipid syndrome (APS), either primary or systemic lupus erythematosus (SLE)-related APS, includes renal artery stenosis or thrombosis, renal infarction, renal vein thrombosis and a small-vessel vaso-occlusive nephropathy defined as "antiphospholipid antibody (aPL)-associated nephropathy." aPL-associated nephropathy is characterized by acute lesions, thrombotic microangiopathy, and chronic lesions such as fibrous intimal hyperplasia, organizing thrombi with or without recanalization, fibrous occlusions of arteries or arterioles and focal cortical atrophy. Systemic hypertension, hematuria, proteinuria (ranging from mild to nephrotic level) and renal insufficiency represent the major clinical manifestations associated with aPL-associated nephropathy. Similar renal histologic and clinical characteristics have been described among all different groups of patients with positive aPL (primary APS, SLE-related APS, catastrophic APS and SLE/non-APS with positive aPL). In patients with aPL-associated nephropathy lesions in the absence of other causes associated with similar histological characteristics, aPL testing needs to be considered. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  13. Tank 241-AP-106, Grab samples, 6AP-98-1, 6AP-98-2 and 6AP-98-3 Analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    FULLER, R.K.

    1999-02-23

    This document is the final report for tank 241-AP-106 grab samples. Three grab samples 6AP-98-1, 6AP-98-2 and 6AP-98-3 were taken from riser 1 of tank 241-AP-106 on May 28, 1998 and received by the 222-S Laboratory on May 28, 1998. Analyses were performed in accordance with the ''Compatability Grab Sampling and Analysis Plan'' (TSAP) (Sasaki, 1998) and the ''Data Quality Objectives for Tank Farms Waste Compatability Program (DQO). The analytical results are presented in the data summary report. No notification limits were exceeded. The request for sample analysis received for AP-106 indicated that the samples were polychlorinated biphenyl (PCB) suspects. The results of this analysis indicated that no PCBs were present at the Toxic Substance Control Act (TSCA) regulated limit of 50 ppm. The results and raw data for the PCB analysis are included in this document.

  14. Effect of chemical mixing state on the hygroscopicity and cloud nucleation properties of calcium mineral dust particles

    Directory of Open Access Journals (Sweden)

    R. C. Sullivan

    2009-05-01

    Full Text Available Atmospheric mineral dust particles can alter cloud properties and thus climate by acting as cloud condensation nuclei (CCN that form cloud droplets. The CCN activation properties of various calcium mineral dust particles were studied experimentally to investigate the consequences of field observations showing the segregation of sulphate from nitrate and chloride between individual aged Asian dust particles, and the enrichment of oxalic acid in Asian dust. Each mineral's observed apparent hygroscopicity was primarily controlled by its solubility, which determines the degree to which the mineral's intrinsic hygroscopicity can be expressed. The significant increase in hygroscopicity caused by mixing soluble hygroscopic material with insoluble mineral particles is also presented. Insoluble minerals including calcium carbonate, representing fresh unprocessed dust, and calcium sulphate, representing atmospherically processed dust, had similarly small apparent hygroscopicities. Their activation is accurately described by a deliquescence limit following the Kelvin effect and corresponded to an apparent single-hygroscopicity parameter, κ, of ~0.001. Soluble calcium chloride and calcium nitrate, representing atmospherically processed mineral dust particles, were much more hygroscopic, activating similar to ammonium sulphate with κ~0.5. Calcium oxalate monohydrate (κ=0.05 was significantly less CCN-active than oxalic acid (κ=0.3, but not as inactive as its low solubility would predict. These results indicate that the common assumption that all mineral dust particles become more hygroscopic and CCN-active after atmospheric processing should be revisited. Calcium sulphate and calcium oxalate are two realistic proxies for aged mineral dust that remain non-hygroscopic. The dust's apparent hygroscopicity will be controlled by its chemical mixing state, which is determined by its mineralogy and the chemical reaction pathways it experiences

  15. Vascular Manifestations in Antiphospholipid Syndrome (APS): Is APS a Thrombophilia or a Vasculopathy?

    Science.gov (United States)

    Siddique, Salma; Risse, Jessie; Canaud, Guillaume; Zuily, Stéphane

    2017-09-04

    Antiphospholipid antibody syndrome (APS) is characterized primarily by thrombosis and pregnancy morbidity. Chronic vascular lesions can also occur. While the underlying mechanisms of these vascular lesions are not entirely known, there have been multiple theories describing the potential process of vasculopathy in APS and the various clinical manifestations associated with it. Recently, it has been demonstrated that endothelial proliferation in kidneys can be explained by the activation of the mammalian target of rapamycin complex (mTORC) pathway by antiphospholipid antibodies (aPL). These data support the existence of an APS-related vasculopathy in different locations which can explain-in part-the different manifestations of APS. This review focuses on the various manifestations of APS as a result of APS-related vasculopathy, as well as pathophysiology, current screening, and treatment options for clinicians to be aware of.

  16. Kepler observations of rapidly oscillating Ap, δ Scuti and γ Doradus pulsations in Ap stars

    DEFF Research Database (Denmark)

    Balona, Luis A.; Cunha, Margarida S.; Kurtz, Donald W.

    2011-01-01

    Observations of the A5p star KIC 8677585 obtained during the Kepler 10-d commissioning run with 1-min time resolution show that it is a rapidly oscillating Ap (roAp) star with several frequencies with periods near 10 min. In addition, a low frequency at 3.142 d−1 is also clearly present....... Multiperiodic γ Doradus (γ Dor) and δ Scuti (δ Sct) pulsations, never before seen in any Ap star, are present in Kepler observations of at least three other Ap stars. Since γ Dor pulsations are seen in Ap stars, it is likely that the low frequency in KIC 8677585 is also a γ Dor pulsation. The simultaneous...... presence of both γ Dor and roAp pulsations and the unexpected detection of δ Sct and γ Dor pulsations in Ap stars present new opportunities and challenges for the interpretation of these stars. Since it is easy to confuse Am and Ap stars at classification dispersions, the nature of these Ap stars...

  17. Development of a glass matrix for vitrification of sulphate bearing high level radioactive liquid waste

    International Nuclear Information System (INIS)

    Kaushik, C.P.; Mishra, R.K.; Thorat, Vidya; Ramchandran, M.; Amar Kumar; Ozarde, P.D.; Raj, Kanwar; Das, D.

    2004-07-01

    High level radioactive liquid waste (HLW) is generated during reprocessing of spent nuclear fuel. In the earlier reprocessing flow sheet ferrous sulphamate has been used for valancy adjustment of Pu from IV to III for effective separation. This has resulted in generation of HLW containing significance amount of sulphate. Internationally borosilicate glass matrix has been adopted for vitrification of HLW. The first Indian vitrification facility at Waste Immobilislition Plant (WIP), Tarapur a five component borosilicate matrix (SiO 2 :B 2 O 3 :Na 2 O : MnO : TiO 2 ) has been used for vitrification of waste. However at Trombay HLW contain significant amount of sulphate which is not compatible with standard borosilicate formulation. Extensive R and D efforts were made to develop a glass formulation which can accommodate sulphate and other constituents of HLW e.g., U, Al, Ca, etc. This report deals with development work of a glass formulations for immobilization of sulphate bearing waste. Different glass formulations were studied to evaluate the compatibility with respect to sulphate and other constituents as mentioned above. This includes sodium, lead and barium borosilicate glass matrices. Problems encountered in different glass matrices for containment of sulphate have also been addressed. A glass formulation based on barium borosilicate was found to be effective and compatible for sulphate bearing high level waste. (author)

  18. Westinghouse AP600 advanced nuclear plant design

    International Nuclear Information System (INIS)

    Gangloff, W.

    1999-01-01

    As part of the cooperative US Department of Energy (DOE) Advanced Light Water Reactor (ALWR) Program and the Electric Power Research Institute (EPRI), the Westinghouse AP600 team has developed a simplified, safe, and economic 600-megawatt plant to enter into a new era of nuclear power generation. Designed to satisfy the standards set by DOE and defined in the ALWR Utility Requirements Document (URD), the Westinghouse AP600 is an elegant combination of innovative safety systems that rely on dependable natural forces and proven technologies. The Westinghouse AP600 design simplifies plant systems and significant operation, inspections, maintenance, and quality assurance requirements by greatly reducing the amount of valves, pumps, piping, HVAC ducting, and other complex components. The AP600 safety systems are predominantly passive, depending on the reliable natural forces of gravity, circulation, convection, evaporation, and condensation, instead of AC power supplies and motor-driven components. The AP600 provides a high degree of public safety and licensing certainty. It draws upon 40 years of experience in light water reactor components and technology, so no demonstration plant is required. During the AP600 design program, a comprehensive test program was carried out to verify plant components, passive safety systems components, and containment behavior. When the test program was completed at the end of 1994, the AP600 became the most thoroughly tested advanced reactor design ever reviewed by the US Nuclear Regulatory Commission (NRC). The test results confirmed the exceptional behavior of the passive systems and have been instrumental in facilitating code validations. Westinghouse received Final Design Approval from the NRC in September 1998. (author)

  19. Origin and paleoenvironmental interpretation of aluminum phosphate-sulfate minerals in a Neoproterozoic Baltic paleosol

    Science.gov (United States)

    Vircava, Ilze; Somelar, Peeter; Liivamägi, Sirle; Kirs, Juho; Kirsimäe, Kalle

    2015-04-01

    Aluminum phosphate-sulfate (APS) mineral solid-solutions occur as accessory phases in different sedimentary and hydrothermal deposits. Their composition is a sensitive environmental indicator recording changes in pH, temperature and chemical composition of the weathering, diagenetic or hydrothermal fluids. In this contribution we studied APS mineralization in a Neoproterozoic paleotropical paleosol developed on Paleo-Mesoproterozoic crystalline basement in the Baltic Basin. Small and disseminated APS minerals occur in high abundance (up to 4 wt.% of crystalline phases) in the weathering profile developed on gabbroic rocks rich in magmatic apatite. APS minerals belonging to a goyazite-florencite-svanbergite-woodhouseite solid-solution series occur in the uppermost part of the weathering profile and are replaced down-profile with secondary apatite. The change from APS minerals to secondary apatite precipitates reflects a paleo-pH gradient in the weathering profile from acidic (pH meters in the APS precipitation zone, to neutral or near neutral at 4-5 m-depth from the paleoweathered surface where secondary apatite occurs. Typically uniform < 5 μm-size APS crystallites suggest rapid precipitation in a highly supersaturated solution, but these crystals show a fine zonal structure whose nature and formation mechanism remain unclear.

  20. Preparation and Physiological activities of sulphated derivative extracted from corn bran

    Science.gov (United States)

    Mo, Qing; Dai, Linghao; Ma, Jianjun; Zhao, Xiaojing; Zhu, Linghui

    2017-05-01

    In the present study, the sulphated derivative (S-CBP) with the degree of substitution (0.46) was successfully prepared from the polysaccharide extracted from corn bran. Compared with native polysaccharide, the structures of the sulphated derivative were confirmed by FT-IR and SEC-LLS and the molecular weight were changed by chemical modification. Sulfation enhanced the antioxidant activities in a dose-dependent way, which seemed to be dependent on the character of the substituted group. The results suggest that the sulphated derivative, extracted from corn bran, are potential natural antioxidant and blood fat reduce agent.

  1. Grass-cellulose as energy source for biological sulphate removal from acid mine effluents

    CSIR Research Space (South Africa)

    Greben, HA

    2008-11-01

    Full Text Available sustained biological sulphate removal can be achieved, operating a continuously fed hybrid reactor at 25°C, treating sulphate-rich synthetic and pre-treated mine water, using the degradation products of grass-cellulose as the carbon and energy sources... and SO4 concentrations in the reactor can be observed from Figure 4: When the COD concentration was high, the sulphate concentration was low. Thus it is important to maintain a high reactor COD concentration, achieved by adding cut grass and by a...

  2. Barite mineralization in Kalana speleothems, Central Estonia: Sr, S and O isotope characterization

    Directory of Open Access Journals (Sweden)

    Mikk Gaškov

    2017-06-01

    Full Text Available Barite mineralization in association with calcitic speleothem precipitates in cave structures in Silurian Aeronian carbonate rocks in Kalana quarry, Central Estonia, was studied. Barite mineralization in Kalana occurs in two generations – euhedral bladed-tabular barite zonal crystals from a few to 10 cm in size, growing on the limestone-dolomite wall-rock (generation I, and sparsely placed thin tabular crystals a few millimetres thick and up to 1 cm in size, growing on calcitic crusts (generation II. The barite crystals of generation I are frequently found embedded by paragenetically later calcitic botryoidal crusts. The Sr and S isotopic composition of barite crystals shows a trend of increasing Sr isotope ratios (from 0.7114 to 0.7120 and δ34S values (from 13‰ to 33‰ from the central parts towards the edges of zonal crystals. This suggests barite precipitation by mixing of two endmember fluids at varying ratios during barite formation: warm (up to 70 °C reducing fluid bearing Ba, characterized by an elevated radiogenic Sr- and 34S-enriched isotopic signal, and a cooler ambient fluid bearing an isotopically lighter dissolved sulphate, characterized by lower Sr isotope ratios. The excess of radiogenic 87Sr in barite compared to Phanerozoic seawater values suggests Sr derived from a continental source, whereas sulphate was derived either from oxidized H2S or a modified seawater source. Gradual increase in δ34S values towards the outer zones could also indicate the 34S enrichment due to bacterial sulphate reduction, even though there is no paired 34S and 18O enrichment of sulphate, characteristic of bacterial reworking. This can be interpreted as indicating an open system with limited sulphate resupply where the δ18O composition of sulphate was equilibrated with warm ascending hydrothermal fluid.

  3. Determinação de elementos essenciais maiores e traço em queijos por espectrometria de emissão atômica com plasma de argônio induzido após digestão parcial Determination of minerals and trace elements in cheese by inductively-coupled plasma optical emission spectrometry after partial digestion

    Directory of Open Access Journals (Sweden)

    Carmen Silvia Kira

    2007-09-01

    Full Text Available Concentrações de Ca, Cr, Cu, Fe, K, Mg, Mn, Na, P e Zn foram determinadas em amostras de quatro tipos de queijo (mussarela, minas, prato e parmesão por espectrometria de emissão atômica com plasma de argônio acoplado indutivamente após dissolução parcial (hidrólise com HCl e total da matéria orgânica (digestão por via seca. As concentrações da maioria dos elementos essenciais maiores e traço, usando o método de dissolução parcial, foram consideradas estatisticamente iguais às obtidas com o método de dissolução total da matéria orgânica, demonstrando a potencialidade da digestão parcial em análises de rotina.Concentrations of Ca, Cr, Cu, Fe, K, Mg, Mn, Na, P and Zn in four different types of cheese (mozzarella, white cheese, prato and parmesan were analyzed by inductively-coupled plasma optical emission spectrometry (ICP-OES after partial digestion (HCl hydrolysis and total digestion of organic matter (dry ashing. The results obtained for most of the elements analyzed here by the partial digestion (HCl hydrolysis and dry ashing methods were found to be statistically congruent, demonstrating the promising potential of the partial digestion method in routine analyses.

  4. Tank 241-AP-107, grab samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Steen, F.H.

    1997-12-22

    This document is the final report for tank 241-AP-107 grab samples. Three grab samples were collected from riser 1 on September 11, 1997. Analyses were performed on samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Nuier, 1997). The analytical results are presented in the data summary report (Table 1). A notification was made to East Tank Farms Operations concerning low hydroxide in the tank and a hydroxide (caustic) demand analysis was requested. The request for sample analysis (RSA) (Attachment 2) received for AP-107 indicated that the samples were polychlorinated biphenyl (PCB) suspects. Therefore, prior to performing the requested analyses, aliquots were made to perform PCB analysis in accordance with the 222-S Laboratory administrative procedure, LAP-101-100. The results of this analysis indicated that no PCBs were present at 50 ppm and analysis proceeded as non-PCB samples. The results and raw data for the PCB analysis will be included in a revision to this document. The sample breakdown diagrams (Attachment 1) are provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed.

  5. Sulphate-reducing bacteria associated with biocorrosion: a review

    Directory of Open Access Journals (Sweden)

    Tania C. de Araujo-Jorge

    1992-09-01

    Full Text Available Biocorrosion means any process of corrosion in wich microorganisms are somehow involved. As far as the petroleum industry is concerned, the anaerobic type is the more important, with Sulphate-Reducing Bacteria (SRB accouting for half of the described processes. SRB are obligate anaerobs that use sulphur, sulphate or other oxidized sulphur compounds as oxidizing agents when decomposing organic material. A typical product of SRB metabolism, hydrogen sulphide -H2S-, is extremely toxic. In the present work we review the literature on mechanisms underlying biocorrosive process in wich SRB are involved and summarize some of the ultrastructural and eletrochemical work developed using SRB obtained from water injection flow in wells located on PETROBRAS offshore marine plataforms, sampled directly in the field over metallic probes, or cultured under laboratory conditions. Biofilms develop when SRB adhere to inert surfaces. A high diversity of morphological types is found inside these biofilms. Their extracellular matrix is highly hydrated and mainly anionic, as shown by its avid reaction with cationic compounds like ruthenium red. We have noted that variations in iron contet lead to interesting changes in the ultrastructure of the bacterial cell coat and also in the rate of corrosion induced in metallic test cupons. Since routine methods to prevent and treat SRB contamination and biodeterioration involve the use of biocides that are toxic and always have some environmental impact, an accurate diagnosis of biocorrosion is always required prior to a treatment decision. We developed a method that detects and semi-quantifies the presence of living or dead SRB by using free silver potentials as an indicator of corrosive action by SRB-associated sulphides. We found a correlation between sulphide levels (determined either by spectrophotometry, or using a silver electrode -E(Ag- that measured changes in free potentials induced by the presence of exogeneously

  6. The investigation of deactivation the tailings from sulphate uranium technology

    International Nuclear Information System (INIS)

    Nikonov, V.I.; Knjazev, O.I.; Ruzin, L.I.; Smolnya, T.A.

    2001-01-01

    The purpose of investigation is to decrease contamination of the environment from wastes, produced on treatment of uranium ores by traditional sulphate uranium technology. In the result of treatment the sulphate uranium leaching cakes by 1-3 M chloride or nitrate of alkali-earth metals solutions, the content of radium decrease till (2.4 - 3.0) x 10 -8 Ci/kg. Produced deactivating solutions in which the content of radium-226 and other natural radionuclides exceeds of ten times the limit of tolerance safe concentrations for water (5.4 x 10 -11 Ci/l Ra-226) further may be treated by sorption or extraction. Due to the reason we pay our attention to the class of non-traditional ion-exchangers, which is the micellar wastes from production of antibiotics (MPW). The problems of it's utilization is very acute. MPW from antibiotics generates everyday is amount of tens tones (on dried mass), contents till 80% of moisture and include in solid phase 50 - 95 % organics in the work we used MPW from erythromycin in form of dried powder with size of particles to 0.05 - 0.16 mm. The possibility of radionuclides extraction by mixture of D2EHPA with TBP or TOPO for nitric deactivated solutions are investigated. It was received the complete extraction Th-230 into organic phase and next concentration with high content of isotope Th-230. Ra-D and Po are not recovered by the extractant. Using the extractant preliminary saturated with barium permit to extract completely Ra from solution. The method purification of technological solutions from activity with using solid extractants - TVEKS was developed. The TVEKS samples on styren-divinylbenzen copolymer base with size 1.0 - 1.5 mm were synthesized. The solid carrier was impregnated by D2EHPA or PN-1200 extractant solution in kerosene and used for extraction of radioactive elements (mainly Ra) from chloride acid solutions with summary activity 8.7 x 10 -10 Ci/l. TVEKS was activated by barium to capacity 1-3 mg/l for increasing purification

  7. Detecting the global and regional effects of sulphate aerosol geoengineering

    Science.gov (United States)

    Lo, Eunice; Charlton-Perez, Andrew; Highwood, Ellie

    2017-04-01

    Climate warming is unequivocal. In addition to carbon dioxide emission mitigation, some geoengineering ideas have been proposed to reduce future surface temperature rise. One of these proposals involves injecting sulphate aerosols into the stratosphere to increase the planet's albedo. Monitoring the effectiveness of sulphate aerosol injection (SAI) would require us to be able to distinguish and detect its cooling effect from the climate system's internal variability and other externally forced temperature changes. This research uses optimal fingerprinting techniques together with simulations from the GeoMIP data base to estimate the number of years of observations that would be needed to detect SAI's cooling signal in near-surface air temperature, should 5 Tg of sulphur dioxide be injected into the stratosphere per year on top of RCP4.5 from 2020-2070. The first part of the research compares the application of two detection methods that have different null hypotheses to SAI detection in global mean near-surface temperature. The first method assumes climate noise to be dominated by unforced climate variability and attempts to detect the SAI cooling signal and greenhouse gas driven warming signal in the "observations" simultaneously against this noise. The second method considers greenhouse gas driven warming to be a non-stationary background climate and attempts to detect the net cooling effect of SAI against this background. Results from this part of the research show that the conventional multi-variate detection method that has been extensively used to attribute climate warming to anthropogenic sources could also be applied for geoengineering detection. The second part of the research investigates detection of geoengineering effects on the regional scale. The globe is divided into various sub-continental scale regions and the cooling effect of SAI is looked for in the temperature time series in each of these regions using total least squares multi

  8. Building an AP Social Studies Program with Non-Traditional AP Students

    Science.gov (United States)

    Ashmead, Amanda; Blanchette, Sue

    2013-01-01

    Equal access to education, that is to a high quality education, has increasingly come to mean access to an Advanced Placement program. In recent years, there has been steady attention paid to opening access to AP programs. The 9th annual College Board report (2013) stated "students who succeed on an AP Exam during high school typically…

  9. Center for Geometrisk Metrologi CGM ApS, Årsberetning 2001 til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2001. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000...

  10. A heterodimer of human 3'-phospho-adenosine-5'-phosphosulphate (PAPS) synthases is a new sulphate activating complex

    International Nuclear Information System (INIS)

    Grum, Daniel; Boom, Johannes van den; Neumann, Daniel; Matena, Anja; Link, Nina M.; Mueller, Jonathan W.

    2010-01-01

    3'-Phospho-adenosine-5'-phosphosulphate (PAPS) synthases are fundamental to mammalian sulphate metabolism. These enzymes have recently been linked to a rising number of human diseases. Despite many studies, it is not yet understood how the mammalian PAPS synthases 1 and 2 interact with each other. We provide first evidence for heterodimerisation of these two enzymes by pull-down assays and Foerster resonance energy transfer (FRET) measurements. Kinetics of dimer dissociation/association indicates that these heterodimers form as soon as PAPSS1 and -S2 encounter each other in solution. Affinity of the homo- and heterodimers were found to be in the low nanomolar range using anisotropy measurements employing proteins labelled with the fluorescent dye IAEDANS that - in spite of its low quantum yield - is well suited for anisotropy due to its large Stokes shift. Within its kinase domain, the PAPS synthase heterodimer displays similar substrate inhibition by adenosine-5'-phosphosulphate (APS) as the homodimers. Due to divergent catalytic efficacies of PAPSS1 and -S2, the heterodimer might be a way of regulating PAPS synthase function within mammalian cells.

  11. AP1000, a nuclear central of advanced design; AP1000, una central nuclear de diseno avanzado

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez M, N.; Viais J, J. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)]. e-mail: nhm@nuclear.inin.mx

    2005-07-01

    The AP1000 is a design of a nuclear reactor of pressurized water (PWR) of 1000 M We with characteristic of safety in a passive way; besides presenting simplifications in the systems of the plant, the construction, the maintenance and the safety, the AP1000 is a design that uses technology endorsed by those but of 30 years of operational experience of the PWR reactors. The program AP1000 of Westinghouse is focused to the implementation of the plant to provide improvements in the economy of the same one and it is a design that is derived directly of the AP600 designs. On September 13, 2004 the US-NRC (for their initials in United States- Nuclear Regulatory Commission) approved the final design of the AP1000, now Westinghouse and the US-NRC are working on the whole in a complete program for the certification. (Author)

  12. Magnesium stearate increases salbutamol sulphate dispersion: what is the mechanism?

    Science.gov (United States)

    Tay, Tracy; Das, Shyamal; Stewart, Peter

    2010-01-04

    The objective was to understand the mechanism of enhancement in salbutamol sulphate (SS) respiratory deposition through addition of magnesium stearate (MgSt). The mixing of MgSt with micronized SS occurred using a Turbula mixer (101 rpm), whilst varying mixing time and MgSt concentration and size. Deposition of SS was determined by a twin-stage impinger. Particle size distributions were obtained using the Malvern Mastersizer 2000. Morphology was examined by scanning electron microscopy and surface energy determined using inverse gas chromatography. Mixing of SS with increasing concentrations of MgSt improved dispersion (FPF of 3.3% using 1% w/w MgSt, 4.5% using 5% w/w MgSt and 7.8% using 10% w/w MgSt compared with 1.4% of pure SS for 20mg doses) when mixed for 0.5h; SS dispersion improved further after 3.5h of mixing. In addition to the action of the MgSt in coating SS particles, a greater understanding of the function of MgSt particles in acting as micro-carriers and in changing the mixture structure through incorporation into agglomerates has been achieved. The mechanistic understanding of improvement in drug deposition using MgSt will allow more directed strategies to be employed in designing powder formulations for inhalation.

  13. Dehydroepiandrosterone sulphate, body fat distribution and insulin in obese men.

    Science.gov (United States)

    Herranz, L; Megia, A; Grande, C; González-Gancedo, P; Pallardo, F

    1995-01-01

    Sex steroid hormones may be involved in determining body fat distribution in men. Recent evidence suggests that insulin may be an important regulator of sex hormones metabolism in men. Few data, however, are available on the relationship of dehydroepiandrosterone sulphate (DHEA-SO4), a major secretory product of the adrenal gland, to regional distribution of body fat or to insulin levels in men. We therefore examined the association of DHEA-SO4, total testosterone and free testosterone to waist-to-hip ratio (WHR) and to subscapular-to-triceps ratio (STR) in 34 obese, otherwise healthy men. In addition, we examined the relation between these sex steroid hormones and insulin response to an oral glucose tolerance test. DHEA-SO4 was significantly positively related to STR and significantly negatively related to insulin area. These associations remained significant after adjustment for age and obesity. Using multiple linear regression, DHEA-SO4 was independently related to both STR and insulin area. Without claiming any causality in the observed associations, we conclude that, in obese men, high DHEA-SO4 levels are related to centralized adiposity, while low DHEA-SO4 levels are related to hyperinsulinemia.

  14. Absorption of ammonium sulphate 15N by coffee plants

    International Nuclear Information System (INIS)

    Fenilli, Tatiele Anete Bergamo; Reichardt, Klaus; Bacchi, Osny Oliveira Santos; Trivelin, Paulo Cesar Ocheuze; Dourado Neto, Durval

    2005-01-01

    The objective of this study was to quantify the absorption of ammonium sulphate 15 N by coffee plants. Treatments consisted of five sub-plots of 9 plants, of which the three central ones received 280 kg ha -1 of 15 N, applied at four times: 1/4 on 01 Set 03; 1/4 on 03 Nov 03; 1/4 on 15 Dec 03 and 1/4 on 30 Jan 04. The isotopic enrichment was 2,072 ± 0,001 atom % 15 N. The dry matter of the shoot was evaluated every 60 days, using one plant per replicate, collected outside the sub-plot. They were as similar as possible to the labeled plants, which were used only for isotopic and Total N analysis, after being dried at 65 deg C until constant weight. At harvest, plants had absorbed 42,88% of the fertilizer N. Leaves accumulated the largest amount of fertilizer N, and were also the compartments that received most N from other parts of the plant. The following partition of the fertilizer N was found at harvest: 23.01% in young leaves, 6.23% in old leaves, 4,46% in stem, 3.46% in fruits, 3.10% in young branches and 2.63% in old branches. (author)

  15. Chondroitin sulphate-guided construction of polypyrrole nanoarchitectures

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Zhengnan [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510641 (China); Zhu, Wenjun [Department of Prosthodontics, Guanghua School of Stomatology, Sun Yat-sen University, Guangzhou 510055 (China); Liao, Jingwen [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510641 (China); Huang, Shishu [State Key Laboratory of Oral Diseases, West China College of Stomatology, Sichuan University (China); Department of Orthopaedics and Traumatology, The University of Hong Kong (China); Chen, Junqi; He, Tianrui [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510641 (China); Tan, Guoxin, E-mail: tanguoxin@126.com [Faculty of Light and Chemical, Guangdong University of Technology, Guangzhou 510006 (China); Ning, Chengyun, E-mail: imcyning@scut.edu.cn [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510641 (China)

    2015-03-01

    Nanospheres, nanocones, and nanowires are three typical polypyrrole (PPy) nanoarchitectures and electrochemically polymerized with the dope of chondroitin sulphate (CS) in this study. CS, a functional biomacromolecule, guides the formation of PPy nanoarchitectures as the dopant and morphology-directing agent. Combined with our previous reported other PPy nanoarchitectures (such as nanotube arrays and nanowires), this work further proposed the novel mechanism of the construction of PPy/CS nanoarchitectures with the synergistic effect of CS molecular chains structure and the steric hindrance. Compared to the undoped PPy, MC3T3-E1 cells with PPy/CS nanoarchitectures possessed stronger proliferation and osteogenic differentiation capability. This suggests that PPy/CS nanoarchitectures have appropriate biocompatibility. Altogether, the nanoarchitectured PPy/CS may find application in the regeneration of bone defect. - Highlights: • The formation mechanism of PPy nanoarchitectures was proposed. • CS acted as biofunctional dopant and morphology-directing agent in PPy forming. • PPy-CS nanoarchitectures were dependent on the Py/CS ratio.

  16. Chitosan microparticles for sustaining the topical delivery of minoxidil sulphate.

    Science.gov (United States)

    Gelfuso, Guilherme Martins; Gratieri, Taís; Simão, Patrícia Sper; de Freitas, Luís Alexandre Pedro; Lopez, Renata Fonseca Vianna

    2011-01-01

    Given the hypothesis that microparticles can penetrate the skin barrier along the transfollicular route, this work aimed to obtain and characterise chitosan microparticles loaded with minoxidil sulphate (MXS) and to study their ability to sustain the release of the drug, attempting a further application utilising them in a targeted delivery system for the topical treatment of alopecia. Chitosan microparticles, containing different proportions of MXS/polymer, were prepared by spray drying and were characterised by yield, encapsulation efficiency, size and morphology. Microparticles selected for further studies showed high encapsulation efficiency (∼82%), a mean diameter of 3.0 µm and a spherical morphology without porosities. When suspended in an ethanol/water solution, chitosan microparticles underwent instantaneous swelling, increasing their mean diameter by 90%. Release studies revealed that the chitosan microparticles were able to sustain about three times the release rate of MXS. This feature, combined with suitable size, confers to these microparticles the potential to target and improve topical therapy of alopecia with minoxidil.

  17. Shuttle APS propellant thermal conditioner study

    Science.gov (United States)

    Pearson, W. E.

    1971-01-01

    A study program was performed to allow selection of thermal conditioner assemblies for superheating O2 and H2 at supercritical pressures. The application was the auxiliary propulsion system (APS) for the space shuttle vehicle. The O2/H2 APS propellant feed system included propellant conditioners, of which the thermal conditioner assemblies were a part. Cryogens, pumped to pressures above critical, were directed to the thermal conditioner assembly included: (1) a gas generator assembly with ignition system and bipropellant valves, which burned superheated O2 and H2 at rich conditions; (2) a heat exchanger assembly for thermal conditioning of the cryogenic propellant; and (3) a dump nozzle for heat exchanger exhaust.

  18. An analysis of AP600 design features

    International Nuclear Information System (INIS)

    Park, Jong Kyoon; Jang, Moon Heui; Hwang, Yung Dong

    1994-01-01

    In the aspect of engineering, passive safety system concept has improved the safety degree of nuclear power plant. Therefore, the objective of this study is to check on the possibility of the capacity upgrade of nuclear power plant in the case of adopting the passive safety system concept of AP 600. The characteristics of AP 600 are the advanced functions in ECCS, heat removal of containment building and residual heat removal under the passive safety system concept. The result of this study will become the basic data of capacity upgrade of nuclear power plant and will be widely used in second year project. (Author)

  19. Measurement of dynamic wedge angles and beam profiles by means of MRI ferrous sulphate gel dosimetry

    Science.gov (United States)

    Bengtsson, Magnus; Furre, Torbjørn; Rødal, Jan; Skretting, Arne; Olsen, Dag R.

    1996-02-01

    The purpose of this study is to examine the possible value of measuring the dose distribution in dynamic wedge photon beams using ferrous sulphate gel phantoms analysed by MRI. The wedge angles and dose profiles were measured for a field size of and for dynamic wedge angles of , , and using a 15 MV photon beam generated from a Clinac 2100 CD (Varian). The dose profiles obtained from MRI ferrous sulphate gel were in good agreement with the dose measurements performed with a diode detector array. Also, the wedge angles determined from the MRI ferrous sulphate gel agreed well with the values obtained by using film dosimetry and with calculations by use of TMS (treatment planning system) (Helax, Uppsala, Sweden). The study demonstrated that MRI ferrous sulphate gel dosimetry is an adequate tool for measurements of some beam characteristics of dynamic radiation fields.

  20. In vitro toxicity of formocresol, ferric sulphate, and grey MTA on human periodontal ligament fibroblasts.

    Science.gov (United States)

    Al-Haj Ali, S N; Al-Jundi, S H; Ditto, D J

    2015-02-01

    This was to assess and compare the in vitro toxicity of formocresol, ferric sulphate and MTA on cultured human periodontal ligament (PDL) fibroblasts. PDL cells were obtained from sound first permanent molars and cultured in Dulbecco's modified Eagle's medium. PDL cells were subjected to different concentrations of formocresol, ferric sulphate, and grey MTA for 24, 48, and 72 h at 37 °C. Cells that were not exposed to the tested materials served as the negative control. In vitro toxicity was assessed using MTT assay. Statistical analysis of data was accomplished using ANOVA and Tukey statistical tests (pformocresol>ferric sulphate>grey MTA. Only grey MTA had comparable cell viability to the negative control, the other tested materials were significantly inferior at the three exposure periods (pformocresol. However, considering MTA's unavailability and high price in Jordan, ferric sulphate may be the best alternative to formocresol in pulpotomy of primary teeth.

  1. The bioavailability of four zinc oxide sources and zinc sulphate in broiler chickens

    OpenAIRE

    Veldkamp, T.; Diepen, van, J.T.M.; Bikker, P.

    2014-01-01

    Zinc is an essential trace element for all farm animal species. It is commonly included in animal diets as zinc oxide, zinc sulphate or organically bound zinc. Umicore Zinc Chemicals developed zinc oxide products with different mean particle sizes. Umicore Zinc Chemicals requested Wageningen UR Livestock Research to determine the bioavailability of four zinc oxide sources and zinc sulphate in broiler chickens. A precise estimate of the bioavailability of zinc sources is required both for fulf...

  2. VALIDATED SPECTROPHOTMETRIC METHOD FOR THE DETERMINATION OF SALBUTAMOL SULPHATE IN BULK AND PHARMACEUTICAL DOSAGE FORMS

    OpenAIRE

    Eswarudu.M.M; Sushma.M; Sushmitha.M; Yamini.K

    2012-01-01

    A new, simple, accurate and sensitive spectrophotometric method has been developed for the estimation of Salbutamol sulphate in bulk and in pharmaceutical formulations. Salbutamol sulphate shows ʎ max at 292 nm. The drug follows the beer’s lambert’s law in the concentration range of 20-100µ ml. the method was validated by following the analytical performance parameters as suggested by the international conference on harmonization which included accuracy, precision, linearity. All validation p...

  3. Changes of Soil Chemical Properties during Rice Straw Decomposition in Different Types of Acid Sulphate Soils

    OpenAIRE

    Anna Hairani; Ani Susilawati

    2013-01-01

    Organic residues often exhibit different physico-chemical properties and affect the soil ecosystem in different ways. Hence, the study of their impact on soil is essential to benefit from their potential as amendments and to avoid adverse environmental effects. It is required to study the role of rice straw in the changes of soil properties during decomposition processes in the rice field. The research was conducted on potential acid sulphate soil (PASS) and actual acid sulphate soil (AASS) i...

  4. Formation of sulphite, cysteic acid and taurine from sulphate by the egg embryo

    International Nuclear Information System (INIS)

    Chapeville, F.; Fromageot, P.

    1959-01-01

    It is shown that the formation of taurine from sulphate by the chicken embryo involves the reduction of sulphate to sulphite (I), the synthesis of cysteic acid (II) and its decarboxylation (Ill). The reaction (I) takes place in the vitellin sac. The reaction (II) results from the condensation of the sulphite with a-amino-acrylic acid and is carried out by the yolk. The enzymes responsible for the decarboxylation (III) are distributed both in the embryo and in its appendages. (author) [fr

  5. Sulphate fertilization ameliorates long-term aluminum toxicity symptoms in perennial ryegrass (Lolium perenne).

    Science.gov (United States)

    Wulff-Zottele, Cristian; Hesse, Holger; Fisahn, Joachim; Bromke, Mariusz; Vera-Villalobos, Hernán; Li, Yan; Frenzel, Falko; Giavalisco, Patrick; Ribera-Fonseca, Alejandra; Zunino, Ligia; Caruso, Immcolata; Stohmann, Evelyn; Mora, Maria de la Luz

    2014-10-01

    Effects of the oxanion sulphate on plant aluminum (Al(3+)) detoxification mechanisms are not well understood. Therefore, holistic physiological and biochemical modifications induced by progressively increased doses of sulphate fertilization in the presence of long-term Al(3+) stress were investigated in the aluminum sensitive perennial ryegrass (Lolium perenne L. cvJumbo). Plant growth inhibition induced by Al(3+) was decreased in response to increasing doses of sulphate supply. Aluminum concentrations measured in roots of perennial ryegrass by atomic absorption spectrometry declined significantly with increasing sulphate concentrations. In parallel, we determined a rise of sulphur in shoots and roots of perennial ryegrass. Inclusion of up to 360 μM of sulphate enhanced cysteine and glutathione biosynthesis in Al(3+) (1.07 μM) treated plants. This increase of thiol-containing compounds favored all modifications in the glutathione redox balance, declining lipid peroxidation, decreasing the activity of superoxide dismutase, and modifying the expression of proteins involved in the diminution of Al(3+) toxicity in roots. In particular, proteome analysis by 1D-SDS-PAGE and LC-MS/MS allowed to identify up (e.g. vacuolar proton ATPase, proteosome β subunit, etc) and down (Glyoxilase I, Ascorbate peroxidase, etc.) regulated proteins induced by Al(3+) toxicity symptoms in roots. Although, sulphate supply up to 480 μM caused a reduction in Al(3+) toxicity symptoms, it was not as efficient as compared to 360 μM sulphate fertilization. These results suggest that sulphate fertilization ameliorates Al(3+) toxicity responses in an intracellular specific manner within Lolium perenne. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  6. Production of ferric sulphate from pyrite by thiobacillus ferrooxidans. Application to uranium ore leaching

    International Nuclear Information System (INIS)

    Rouas, C.

    1988-12-01

    A process for uranium extraction by oxidizing solutions of ferric sulphate produced by T. ferrooxidans from pyrite is developed. A new counting method specific of T. ferrooxidans is designed. An uranium resistant wild strain, with oxidizing properties as high as the strain ATCC 19859, is isolated. Optimal conditions for ferric sulphate production from pyrite are defined (pH 1.8, density of the medium 1.2%, pyrite granulometry [fr

  7. Role of different additives and metallic micro minerals on the enhanced citric acid production by Aspergillus niger MNNG-115 using different carbohydrate materials.

    Science.gov (United States)

    Ali, Sikander; Haq, Ikram-ul

    2005-01-01

    The present investigation deals with the promotry effect of different additives and metallic micro minerals on citric acid production by Aspergillus niger MNNG-115 using different carbohydrate materials. For this, sugar cane bagasse was fortified with sucrose salt medium. Ethanol and coconut oil at 3.0% (v/w) level increased citric acid productivity. Fluoroacetate at a concentration of 1.0 mg/ml bagasse enhanced the yield of citric acid significantly. However, the addition of ethanol and fluoroacetate after 6 h of growth gave the maximum conversion of available sugar to citric acid. In another study, influence of some metallic micro-minerals viz. copper sulphate, molybdenum sulphate, zinc sulphate and cobalt sulphate on microbial synthesis of citric acid using molasses medium was also carried out. It was found that copper sulphate and molybdenum sulphate remarkably enhanced the production of citric acid while zinc sulphate was not so effective. However, cobalt sulphate was the least effective for microbial biosynthesis of citric acid under the same experimental conditions. In case of CuSO(4), the strain of Aspergillus niger MNNG-115 showed enhanced citric productivity with experimental (9.80%) over the control (7.54%). In addition, the specific productivity of the culture at 30 ppm CuSO(4) (Q(p) = 0.012a g/g cells/h) was several folds higher than other all other concentrations. All kinetic parameters including yield coefficients and volumetric rates revealed the hyper productivity of citric acid by CuSO(4) using blackstrap molasses as the basal carbon source. ((c) 2005 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim).

  8. Application of sugarcane bagasse for passive anaerobic biotreatment of sulphate rich wastewaters

    Science.gov (United States)

    Hussain, Ali; Qazi, Javed Iqbal

    2016-06-01

    Biological treatment of sulphate-rich wastewaters employing dissimilatory sulphate reducing bacteria as remedial agents is an attractive technique and has gained importance in the last few years. Industrial effluents enriched with sulphates are generally deficient in electron donors. And thus cannot be treated biologically without supplementation of carbon through an external source. For scalable operations, however, the carbon source must not be expensive. In this context, present study reports the efficiency of biological sulphate reduction using sugarcane bagasse as a cost-effective carbon source. An average 0.00391 ± 0.001 gL-1 day-1 (3.91 mgL-1 day-1) sulphate reduction was observed reaching maximally to 0.00466 ± 0.001 gL-1 day-1 (4.66 mgL-1 day-1) while employing Desulfovibrio fructosovorans-HAQ2 and Desulfovibrio piger-HAQ6 in a 60-day trial of anaerobic incubation using sugarcane bagasse as growth substrate. These findings will be helpful in developing economical bioremediation processes tending to operate for a longer period of time to reduce sulphate contents of contaminated waters.

  9. Differential inhibition of polymorphonuclear leukocyte recruitment in vivo by dextran sulphate and fucoidan

    Directory of Open Access Journals (Sweden)

    N. Van Osselaer

    1996-01-01

    Full Text Available The selectin-mediated rolling of leukocytes along the endothelial cells is a prerequisite step followed by firm adhesion and extravasation into the inflamed tissue. This initial contact can be suppressed by sulphated polysaccharides. We have studied the effect of sulphated polysaccharides on the ultimate polymorphonuclear leukocyte (PMN recruitment and plasma leakage in rabbit skin in response to intradermal injection of various inflammatory mediators. PMN infiltration evoked by various PMN chemoattractants (FMLP, C5a desArg, LTB4 and IL-8 was significantly inhibited after intravenous injection of dextran sulphate (25 mg/kg, heparin (2 × 90 mg/kg or fucoidan (1 mg/kg. PMN-dependent plasma leakage was equally well reduced by the different sulphated polymers. Vascular permeability induced by histamine or thrombin acting via a PMN-independent mechanism was not reduced. Fucoidan was the only polysaccharide able to suppress IL-1-induced PMN infiltration for 60–70%. Local administration of dextran sulphate had no effect on PMN-dependent plasma leakage. Differential inhibition of PMN recruitment was determined after injection of dextran sulphate or fucoidan depending on the type of insult. Therefore, these results suggest that different adhesion pathways are utilized during PMN recruitment in vivo in response to chemoattractants and IL-1.

  10. The reducibility of sulphuric acid and sulphate in aqueous solution (translated from German)

    International Nuclear Information System (INIS)

    Grauer, R.

    1990-07-01

    In connection with the Swedish project for the final storage of spent fuel elements it was necessary to assess whether dissolved sulphate can corrode the copper canister without the intervention of sulphate-reducing bacteria. A simple reaction between copper and sulphate is thermodynamically impossible. On the other hand, copper can react to give copper sulphide if an additional electron donor such as iron is available. Because little specific information is available about this subject the problem was extended to the much more general question of the reducibility of sulphur in dilute aqueous solution. It is a part of the general knowledge of chemistry, and there is also unanimity about it in the geochemical literature, that purely chemical reduction of sulphate does not take place in dilute solution at temperatures below 100 degrees C. This fact is, however, poorly documented and it was therefore necessary to substantiate it by drawing on numerous individual findings from different areas of pure and applied chemistry. The investigation confirms that sulphur in dilute solution is completely inert towards chemical reducing agents and also to cathodic reduction. Thus corrosion of copper by sulphate under final-storage conditions and in the absence of sulphate reducing bacteria can be ruled out with a probability verging on certainty. (85 refs.)

  11. The effect of sulphates on partitioning of pectinases in aqueous two-phase systems

    Directory of Open Access Journals (Sweden)

    Antov Mirjana G.

    2004-01-01

    Full Text Available The effect of various sulphate salts on the partitioning of endo-pectinase and exo-pectinase in aqueous two-phase systems, composed of polyethylene glycol and dextran, was studied. Presence of ammonium sulphate and sodium sulphate at concentration 15 mmol/l in the system polyethylene glycol 4000/crude dextran, at tie-line length 7.44%, increased partition coefficient of endo-pectinase 1.25 and 1.2 fold, respectively. Ammonium sulphate at 15 mmol/l and sodium sulphate at 5 mmol/l enhanced partition coefficient for exo-pectinase for about 60% in comparison to the system without salts. Addition of magnesium and sodium sulphate to a final concentration of 0.3 mmol/l in the system containing polyethylene glycol 6000/dextran 500 000, at tie-line length 6.26%, increased the partition coefficient of endo activity for 95% and 32%, respectively. Both salts at the same concentration increased partition coefficient of exo activity 1.5 and 3 times, respectively, in comparison to the system without salts.

  12. Comparison of physical and inhalation properties of spray-dried and micronized terbutaline sulphate.

    Science.gov (United States)

    Thi, Thanh Huong Hoang; Danède, Florence; Descamps, Marc; Flament, Marie-Pierre

    2008-09-01

    Terbutaline sulphate particles, for use in dry powder inhaler formulations, were prepared by spray-drying, using a Büchi 190 mini spray dryer. Spray-drying conditions were chosen to allow the production of spray-dried terbutaline sulphate with a size similar to micronized terbutaline sulphate, that is to say about 2.9 microm of volume mean diameter. The physical properties and in vitro inhalation behaviour of micronized and spray-dried terbutaline sulphate were compared. X-ray diffraction, DSC, SEM and laser size analysis were investigated. Spray-dying produced spherically shaped particles with amorphous structure. After blending with different lactoses, adhesion and aerodynamic properties were investigated. Evaluation of adhesion was carried out with a mechanical sieve and an Alpine air-jet sieve. The adhesion of terbutaline sulphate on the lactoses tested was lower in the case of the spray-dried drug. Aerodynamic evaluation of fine particle dose and emitted dose was conducted using a twin stage impactor. The emitted doses and the fine particle doses were higher with the spray-dried terbutaline sulphate. The Alpine air-jet sieve assays showed that there was a correlation between drug separation from a carrier by sieving and that obtained from longer in vitro deposition studies. There was a linear relationship between the adhesion characteristics and the fine particle dose.

  13. Characteristics and antioxidant of Ulva intestinalis sulphated polysaccharides extracted with different solvents.

    Science.gov (United States)

    Peasura, Napassorn; Laohakunjit, Natta; Kerdchoechuen, Orapin; Wanlapa, Sorada

    2015-11-01

    Ulva intestinalis, a tubular green seaweed, is a rich source of nutrient, especially sulphated polysaccharides. Sulphated polysaccharides from U. intestinalis were extracted with distilled water, 0.1N HCl, and 0.1N NaOH at 80°C for 1, 3, 6, 12, and 24h to study the effect of the extraction solvent and time on their chemical composition and antioxidant activity. Different types of solvents and extraction time had a significant influence on the chemical characteristics and antioxidant activity (p<0.05). Monosaccharide composition and FT-IR spectra analyses revealed that sulphated polysaccharides from all solvent extractions have a typical sugar backbone (glucose, rhamnose, and sulphate attached at C-2 or C-3 of rhamnose). Sulphated polysaccharides extracted with acid exhibited greater antioxidant activity than did those extracted with distilled water and alkali. The results indicated that solvent extraction could be an efficacious method for enhancing antioxidant activity by distinct molecular weight and chemical characteristic of sulphated polysaccharides. Copyright © 2015 Elsevier B.V. All rights reserved.

  14. Investigation of sulphate origins in the Jeffara aquifer, southeastern ...

    Indian Academy of Sciences (India)

    groundwater is recharged by the Continental Intercalaire (CI) geothermal water, water temperature decreases from the CI to the Jeffara aquifer. Solubility of the majority of minerals is modified by this change in temperature and thus a mixing process of thermal and non-thermal waters was examined. 1. Introduction.

  15. Tank 241-AP-107 tank characterization plan

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1994-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-AP-107

  16. Barron's AP English literature and composition

    CERN Document Server

    Ehrenhaft EdD, George

    2016-01-01

    Includes five full-length practice AP exams with all questions answered and explained. Also features additional reviews on poetry, fiction, and drama, definitions of 175 literary and rhetorical terms, and more. Can be purchased alone or with an optional CD-ROM with two additional practice tests.

  17. The Promise of AP World History

    Science.gov (United States)

    Saldaña, Cristóbal T.

    2013-01-01

    AP World History is the ideal history course. It introduces students to 10,000 years of world history, and demands critical reading, critical writing, and critical thinking skills on the part of both the teacher and the students. It requires students to build their expertise in reading their textbook, and places demands on the teacher to assign…

  18. Meet the Editors of APS Reception

    Science.gov (United States)

    The Editors of the APS journals invite you to join them for conversation on Tuesday, March 15, 4:30-6:00 pm. The Editors will be available to answer questions, hear your ideas, and discuss any comments about the journals. All are welcome. Light refreshments will be served.

  19. The Demographic Wave: Rethinking Hispanic AP Trends

    Science.gov (United States)

    Edwards, Kelcey; Sawtell, Ellen

    2013-01-01

    Presented at the Advanced Placement Annual Conference (APAC) in Las Vegas, NV in July 2013. This presentation reviews new research examining the AP® experience of Hispanic graduates over the past decade. Topics include an in-depth look at the AP Spanish Language and Culture gateway hypothesis and trends in family characteristics such as parent…

  20. Structuring the AP Art History Course

    Science.gov (United States)

    Herscher, Walter R.

    2013-01-01

    While AP (Advanced Placement) Art History may be taught within the art department in many schools, social studies teachers are equally capable of teaching the course well. They have the historical background to discuss the reasons for changes in art styles. A teacher's preparation is similar to teaching a course stressing political history,…

  1. Asteroseismic Theory of Rapidly Oscillating Ap Stars

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 26; Issue 2-3. Asteroseismic Theory of Rapidly Oscillating Ap Stars. Margarida S. Cunha. Volume 26 Issue 2-3 June-September 2005 pp 213-221. Fulltext. Click here to view fulltext PDF. Permanent link:

  2. The chemical composition of mineral trioxide aggregate

    Science.gov (United States)

    Camilleri, Josette

    2008-01-01

    Mineral trioxide aggregate (MTA) is composed of Portland cement, with 4:1 addition of bismuth oxide added so that the material can be detected on a radiograph. The cement is made up of calcium, silicon and aluminium. The main constituent phases are tricalcium and dicalcium silicate and tricalcium aluminate. There are two commercial forms of MTA, namely the grey and the white. The difference between the grey and the white materials is the presence of iron in the grey material, which makes up the phase tetracalcium alumino-ferrite. This phase is absent in white MTA. Hydration of MTA occurs in two stages. The initial reaction between tricalcium aluminate and water in the presence of calcium sulphate results in the production of ettringite. Tricalcium and dicalcium silicate react with water to produce calcium silicate hydrate and calcium hydroxide, which is leached out of the cement with time. PMID:20351970

  3. Heparan sulphate as a regulator of leukocyte recruitment in inflammation.

    Science.gov (United States)

    Kumar, Archana V; Katakam, Sampath K; Urbanowitz, Ann-Kathrin; Gotte, Martin

    2015-01-01

    A key event in inflammatory disease is the transendothelial recruitment of leukocytes from the circulation to the site of inflammation. Intense research in the past decades indicates that the polyanionic carbohydrate heparan sulphate (HS) modulates multiple steps in the leukocyte recruitment cascade. Leukocyte recruitment is initiated by endothelial cell activation and presentation of chemokines to rolling leukocytes, which, via integrin activation, results in adhesion and diapedesis through the vessel wall. Heparan sulfate proteoglycans (HSPGs) immobilize the chemokines on the luminal endothelial cells, rendering them more robust against mechanical or hydrodynamic perturbations. During inflammation, endothelial HSPGs serve as ligands to L-selectin on leukocytes, transport chemokines in a basolateral to apical direction across the endothelium, and present chemokines at the luminal surface of the endothelium to circulating cells. HSPGs also promote chemokine oligomerization, which influences chemokine receptor signaling. Furthermore, proteoglycans of the syndecan family are involved in modulating integrin-mediated tight adhesion of leukocytes to the endothelium. Creation of a chemokine gradient by a localized chemokine release influences the speed of leukocyte recruitment from the blood to the tissue by attracting crawling neutrophils to optimal sites for transmigration. The directionality of intraluminal crawling is thought to be influenced by both mechanotactic and haptotactic signals, which are modulated by HS-dependent signaling processes. Finally, diapedesis is influenced by HS regarding transendothelial chemokine gradient formation and integrin- CAM interactions, and further enhanced by heparanase-mediated degradation of the endothelial basement membrane. Overall, the multifunctional role of HS in inflammation marks it as a potential target of glycan-centered therapeutic approaches.

  4. [Neuroprotection for preterm infants with antenatal magnesium sulphate].

    Science.gov (United States)

    Marret, S; Ancel, P-Y

    2016-12-01

    To evaluate in preterm born children the neuroprotective benefits and the risks, at short- and long-term outcome, of the antenatal administration of magnesium sulphate (MgSO 4 ) in women at imminent risk of preterm delivery. Computer databases Medline, the Cochrane Library and the recommendations of various international scientific societies. Given the demonstrated benefit of antenatal MgSO 4 intravenous administration on the reduction of cerebral palsy rates and the improvement of motor development in children born preterm, it is recommended for all women whose imminent delivery is expected or programmed before 32 weeks of gestation (WG) (grade A). The analysis of the literature finds no argument for greater benefit of antenatal MgSO 4 administration in sub-groups of gestational age, or depending on the type of pregnancy (single or multiple pregnancy) or with the cause of preterm birth (NP2). Its administration is recommended before 32 WG, if single or multiple pregnancy, whatever the cause of prematurity (grade B). It is recommended 4g loading dose (professional consensus). With a loading dose of 4g intravenous (IV) in 20min, the serum magnesium is lower than with intramuscular suggesting a preference for the IV route (professional consensus). It is proposed to use a maintenance dose of 1g/h until delivery with a maximum recommended duration of 12hours without exceeding a cumulative dose of 50g (professional consensus). These doses are without severe adverse maternal side effects or adverse effects in newborns at short- and medium-term outcome (NP1). It is recommended to administer magnesium sulfate to the women at high risk of imminent preterm birth before 32 WG, whether expected or planned (grade A), with a 4g IV loading dose followed by a maintenance dose of 1g/h for 12hours (professional consensus), the pregnancy is single or multiple, whatever the cause of prematurity (professional consensus). Copyright © 2016. Published by Elsevier Masson SAS.

  5. Sulphated glycosaminoglycans support an assortment of planarian rhabdite structures.

    Science.gov (United States)

    Hayes, Matthew J

    2017-05-15

    Planaria are soft-bodied, bilateral flatworms of the phylum Platyhelminthes. They are covered in cilia and use ciliary-gliding to traverse the substratum while hunting. Their body surface is covered in a layer of viscous slime primarily derived from specialised secretory granules known as rhabdites. The slime must somehow stay associated with the surface of the animal in aqueous environments whilst also lubricating the interface of the animal and the surfaces over which the animal moves. The slime prevents damage to the animal's soft body and also contributes to adhesion to the substratum. In order to gain insight into how it might achieve these diverse functions, we performed electron microscopic examination of the slime's structure. Analysis of two freshwater flatworms from the UK Schmidtea polychroa (Schmidt, 1861) and Polycelis tenuis (Ijima, 1884) revealed a high level of organisation of the slime layer and a variety of ejected slime structures. We show that these structures are rich in sulphated glycosaminoglycans (sGAGs). Most of these (269 of 285 examined) appear to be topologically closed spheroids that we name ball-GAGs. Another class appears to burst to release flower- and star-like clusters which adhere to motile cilia. We also observe fibrous nets that are associated with entrapped bacteria. Examination of the structure of rhabdites ejected onto a porous surface suggests a mechanism by which their structure allows them to both bind to the porous surface and provide a smooth layer over which the animal could glide. Such sGAG-based structures might provide models for the design of artificial biomimetic replacements for tears, saliva, bio-compatible lubricants or drug-delivery vehicles. © 2017. Published by The Company of Biologists Ltd.

  6. Thermochemical sulphate reduction can improve carbonate petroleum reservoir quality

    Science.gov (United States)

    Jiang, Lei; Worden, Richard H.; Yang, Changbing

    2018-02-01

    Interest in the creation of secondary pore spaces in petroleum reservoirs has increased because of a need to understand deeper and more complex reservoirs. The creation of new secondary porosity that enhances overall reservoir quality in deeply buried carbonate reservoirs is controversial and some recent studies have concluded it is not an important phenomenon. Here we present petrography, geochemistry, fluid inclusion data, and fluid-rock interaction reaction modeling results from Triassic Feixianguan Formation, Sichuan Basin, China, core samples and explore the relative importance of secondary porosity due to thermochemical sulphate reduction (TSR) during deep burial diagenesis. We find that new secondary pores result from the dissolution of anhydrite and possibly from dissolution of the matrix dolomite. Assuming porosity before TSR was 16% and the percentage of anhydrite was 6%, modelling shows that, due to TSR, 1.6% additional porosity was created that led to permeability increasing from 110 mD (range 72-168 mD within a 95% confidence interval) to 264 mD (range 162-432 mD within a 95% confidence interval). Secondary porosity results from the density differences between reactant anhydrite and product calcite, the addition of new water during TSR, and the generation of acidity during the reaction of new H2S with the siderite component in pre-existing dolomite in the reservoir. Fluid pressure was high during TSR, and approached lithostatic pressure in some samples; this transient overpressure may have led to the maintenance of porosity due to the inhibition of compactional processes. An additional 1.6% porosity is significant for reserve calculations, especially considering that it occurs in conjunction with elevated permeability that results in faster flow rates to the production wells.

  7. Sulphated glycosaminoglycans support an assortment of planarian rhabdite structures

    Directory of Open Access Journals (Sweden)

    Matthew J. Hayes

    2017-05-01

    Full Text Available Planaria are soft-bodied, bilateral flatworms of the phylum Platyhelminthes. They are covered in cilia and use ciliary-gliding to traverse the substratum while hunting. Their body surface is covered in a layer of viscous slime primarily derived from specialised secretory granules known as rhabdites. The slime must somehow stay associated with the surface of the animal in aqueous environments whilst also lubricating the interface of the animal and the surfaces over which the animal moves. The slime prevents damage to the animal's soft body and also contributes to adhesion to the substratum. In order to gain insight into how it might achieve these diverse functions, we performed electron microscopic examination of the slime's structure. Analysis of two freshwater flatworms from the UK Schmidtea polychroa (Schmidt, 1861 and Polycelis tenuis (Ijima, 1884 revealed a high level of organisation of the slime layer and a variety of ejected slime structures. We show that these structures are rich in sulphated glycosaminoglycans (sGAGs. Most of these (269 of 285 examined appear to be topologically closed spheroids that we name ball-GAGs. Another class appears to burst to release flower- and star-like clusters which adhere to motile cilia. We also observe fibrous nets that are associated with entrapped bacteria. Examination of the structure of rhabdites ejected onto a porous surface suggests a mechanism by which their structure allows them to both bind to the porous surface and provide a smooth layer over which the animal could glide. Such sGAG-based structures might provide models for the design of artificial biomimetic replacements for tears, saliva, bio-compatible lubricants or drug-delivery vehicles.

  8. Minerals Yearbook, volume I, Metals and Minerals

    Science.gov (United States)

    ,

    2018-01-01

    The U.S. Geological Survey (USGS) Minerals Yearbook discusses the performance of the worldwide minerals and materials industries and provides background information to assist in interpreting that performance. Content of the individual Minerals Yearbook volumes follows:Volume I, Metals and Minerals, contains chapters about virtually all metallic and industrial mineral commodities important to the U.S. economy. Chapters on survey methods, summary statistics for domestic nonfuel minerals, and trends in mining and quarrying in the metals and industrial mineral industries in the United States are also included.Volume II, Area Reports: Domestic, contains a chapter on the mineral industry of each of the 50 States and Puerto Rico and the Administered Islands. This volume also has chapters on survey methods and summary statistics of domestic nonfuel minerals.Volume III, Area Reports: International, is published as four separate reports. These regional reports contain the latest available minerals data on more than 180 foreign countries and discuss the importance of minerals to the economies of these nations and the United States. Each report begins with an overview of the region’s mineral industries during the year. It continues with individual country chapters that examine the mining, refining, processing, and use of minerals in each country of the region and how each country’s mineral industry relates to U.S. industry. Most chapters include production tables and industry structure tables, information about Government policies and programs that affect the country’s mineral industry, and an outlook section.The USGS continually strives to improve the value of its publications to users. Constructive comments and suggestions by readers of the Minerals Yearbook are welcomed.

  9. Multivitamin/Mineral Supplements

    Science.gov (United States)

    ... en español Health Professional Other Resources Multivitamin/mineral Supplements Fact Sheet for Consumers Have a question? Ask ... MVMs? Disclaimer What are multivitamin/mineral (MVM) dietary supplements? Multivitamin/mineral (MVM) supplements contain a combination of ...

  10. Adult and paediatric patients with minimal change nephrotic syndrome show no major alterations in glomerular expression of sulphated heparan sulphate domains.

    NARCIS (Netherlands)

    Wijnhoven, T.J.M.; Geelen, J.M.; Bakker, M.; Lensen, J.F.M.; Rops, A.L.; Kramer, A.B.; Navis, G.J.; Hoven, M.J.W. van den; Vlag, J. van der; Berden, J.H.M.; Wetzels, J.F.M.; Heuvel, L.P.W.J. van den; Monnens, L.A.H.; Kuppevelt, A.H.M.S.M. van

    2007-01-01

    BACKGROUND: Minimal change nephrotic syndrome (MCNS) is the most frequent form of nephrotic syndrome in childhood. In the glomerular basement membrane (GBM) of adult patients with MCNS, a reduced expression of a specific heparan sulphate (HS) domain has been reported. In children with MCNS, urinary

  11. Adult and paediatric patients with minimal change nephrotic syndrome show no major alterations in glomerular expression of sulphated heparan sulphate domains

    NARCIS (Netherlands)

    Wijnhoven, Tessa J. M.; Geelen, Joyce M.; Bakker, Marinka; Lensen, Joost F. M.; Rops, Angelique L. W. M. M.; Kramer, Andrea B.; Navis, Gerjan; van den Hoven, Mabel J. W.; van der Vlag, Johan; Berden, Jo H. M.; Wetzels, Jack F. M.; van den Heuvel, Lambert P. W. J.; Monnens, Leo A. H.; van Kuppevelt, Toin H.

    2007-01-01

    Background. Minimal change nephrotic syndrome (MCNS) is the most frequent form of nephrotic syndrome in childhood. In the glomerular basement membrane (GBM) of adult patients with MCNS, a reduced expression of a specific heparan sulphate (HS) domain has been reported. In children with MCNS, urinary

  12. South Africa's mineral industry

    International Nuclear Information System (INIS)

    1985-06-01

    The main aim of the Minerals Bureau in presenting this annual review is to provide an up-to-date reference document on the current state of the mineral industry in South Africa. This includes a brief look at the production, trade, economy, resources and deposits of precious metals and minerals, energy minerals, metallic minerals, and non-metallic minerals. One article discusses the production, trade, export, deposits and economy of uranium

  13. Heavy mineral placers

    Digital Repository Service at National Institute of Oceanography (India)

    Gujar, A.R.

    ], which contains economic quantities of valuable minerals such as gold, tin and platinum etc. Placer deposit can also be defined as a “mineral deposit formed by the process of mechanical concentration of mineral particles from weathered debris... Content-Type text/plain; charset=UTF-8 32 Heavy mineral placers A. R. Gujar National Institute of Oceanography, Dona-Paula, Goa-403004 agujar@nio.org Heavy mineral placers Heavy mineral placer deposit is defined as “Alluvial...

  14. Magnesium sulphate can prolong pregnancy in patients with severe early-onset preeclampsia.

    Science.gov (United States)

    Ueda, Akihiko; Kondoh, Eiji; Kawasaki, Kaoru; Mogami, Haruta; Chigusa, Yoshitsugu; Konishi, Ikuo

    2016-10-01

    To assess whether long-term use of magnesium sulphate prolongs pregnancy in patients with severe early-onset preeclampsia. Retrospective cohort study included all singleton pregnancies with severe early-onset preeclampsia, expectantly managed in our institution between 2005 and 2013. Obstetric and perinatal outcomes were compared between patients managed using a current protocol that tolerates long-term (over 48 h) use of magnesium sulphate (long-term group, n = 26) and a historical control group (control group, n = 15) that underwent conventional treatment (up to 48 h use of magnesium sulphate). Long-term group showed significant prolongation of pregnancy compared with the control group (9.2 ± 7.9 versus 16.6 ± 9.3 d, log-rank test, p = 0.021), which was also observed in patients with severe preeclampsia occurring before 28 weeks' gestation (n = 11, 4.5 ± 5.2 versus 13.2 ± 6.8 d, log-rank test, p = 0.035). In contrast to a progressive decrease of platelet count in patients managed without magnesium sulphate, administration of magnesium sulphate for 7 d prevented the decrease of platelet count (p = 0.001). Thirty two percent of patients (13/41) experienced a major complication irrespective of duration of magnesium sulphate use. Long-term use of magnesium sulphate prolonged pregnancy in patients with severe early-onset preeclampsia and can help alleviate progression of preeclampsia.

  15. Comparative analysis between radiographic views for knee osteoarthrosis (bipedal AP versus monopedal AP

    Directory of Open Access Journals (Sweden)

    Rodrigo Pires e Albuquerque

    2013-08-01

    Full Text Available OBJECTIVE: A comparative analysis by applying the criteria of the original classification Ahlbäck in the anteroposterior (AP bipedal knee in extension and anteroposterior (AP monopodal knee in symptomatic knee arthrosis. With this analysis we intend to observe the agreement, any advantage or difference between the incidence and degree of joint involvement between the orthopedic surgeons and radiologists with the referring physician. METHODS: From January 2012 to March 2012, was a prospective study of 60 symptomatic arthrosis knees (60 patients, clinically selected group of outpatient knee and radiographic proposals submitted to the search. Of the 60 patients, 39 were female and 21 male, mean age 64 years (ranging from 50 to 84 years. Of the 60 knees studied, 37 corresponded to the right side and 23 on the left side. Statistical analysis was performed by Kappa statistics, which evaluates the interobserver agreement for qualitative data. RESULTS: According to the scale of Ahlbäck, there was a significant agreement (p < 0.0001 intra-observer in the classification of knee osteoarthritis among the five evaluators. There was a significant agreement (p < 0.0001 with inter-observer referring physician in the incidence of AP monopodal and AP bipedal for the four raters. CONCLUSION: The study found no difference between the incidence in the AP monopodal versus AP bipedal in osteoarthritis of the knee.

  16. CLEARING MAGNET DESIGN FOR APS-U

    Energy Technology Data Exchange (ETDEWEB)

    Abliz, M.; Grimmer, J.; Jaski, Y.; Westferro, F.; Ramanathan, M.

    2017-06-25

    The Advanced Photon Source is in the process of developing an upgrade (APS-U) of the storage ring. The upgrade will be converting the current double bend achromat (DBA) lattice to a multi-bend achromat (MBA) lattice. In addition, the storage ring will be operated at 6 GeV and 200 mA with regular swap-out injection to keep the stored beam current constant [1]. The swap-out injection will take place with beamline shutters open. For radiation safety to ensure that no electrons can exit the storage ring, a passive method of protecting the beamline and containing the electrons inside the storage ring is proposed. A clearing magnet will be located in all beamline front ends inside the storage ring tunnel. This article will discuss the features and design of the clearing magnet scheme for APS-U.

  17. DEVELOPMENT AND VALIDATION OF SPECTROPHOTOMETRIC METHOD FOR THE SIMULTANEOUS ESTIMATION OF SALBUTAMOL SULPHATE AND CETIRIZINE HYDROCHLORIDE IN COMBINED DOSAGE FORM

    OpenAIRE

    Sharma Deepak; Singh Gurmeet; Singh Mankaran; Kumar Dinesh; Rathore Mahendra Singh

    2012-01-01

    Salbutamol Sulphate (SAL) and Cetirizine HCl (CET) is used for the treatment of asthma and allergy. A simple, economical, accurate and precise method for simultaneous estimation of Salbutamol Sulphate (SAL) and Cetirizine HCl (CET) in combined dosage form has been developed. Simultaneous equation method based on measurement of absorbance at two wavelengths 276 nm and 230 nm, λmax of Salbutamol Sulphate (SAL) and Cetirizine HCl (CET) in 6.8 pH phosphate buffer. Both these drugs obeyed Beer La...

  18. Final report for tank 241-AP-108, grab samples 8AP-96-1, 8AP-96-2 and 8AP-96-FB

    International Nuclear Information System (INIS)

    Esch, R.A.

    1996-01-01

    This document is the final report deliverable for the tank 241-AP-108 grab samples. The samples were subsampled and analyzed in accordance with the TSAP. Included in this report are the results for the Waste Compatibility analyses, with the exception of DSC and thermogravimetric analysis (TGA) results which were presented in the 45 Day report (Part 2 of this document). The raw data for all analyses, with the exception of DSC and TGA, are also included in this report

  19. Cultural Diversity in AP Art History

    Science.gov (United States)

    Bolte, Frances R.

    2006-01-01

    Teaching AP Art History is like running on a treadmill that is moving faster than a teacher can run. Many teachers are out of breath before the end of the term and wonder how in the world they can cover every chapter. Because time is short and art from pre-history through to the present, including the non-European traditions, must be covered, this…

  20. Beryllium window for an APS diagnostics beamline

    International Nuclear Information System (INIS)

    Sheng, I.C.; Yang, B.X.; Sharma, Y.S.

    1997-01-01

    A beryllium (Be) window for an Advanced Photon Source (APS) diagnostics beamline has been designed and built. The window, which has a double concave axisymmetrical profile with a thickness of 0.5 mm at the center, receives 160 W/mm 2 (7 GeV/100 mA stored beam) from an undulator beam. The window design as well as thermal and thermomechanical analyses, including thermal buckling of the Be window, are presented

  1. Children born to SLE and APS mothers.

    Science.gov (United States)

    Nalli, C; Iodice, A; Andreoli, L; Lojacono, A; Motta, M; Fazzi, E; Tincani, A

    2014-10-01

    Systemic lupus erythematosus (SLE) and antiphospholipid antibody syndrome (APS) are autoimmune diseases that affect women of childbearing age. Pregnancies in these patients carry several complications such as prematurity. Maternal IgG antiphospholipid antibodies (aPL) can cross the placenta but they don't generally cause any neonatal thrombotic event. Because of the incompleteness of the fetal blood-brain barrier, aPL could theoretically reach the fetal brain. Whether this can have an effect on brain development is still under investigation. Some studies performed in children of patients with SLE and/or APS showed an increased number of learning disabilities without impairment in intelligence level. The objectives of this article are to evaluate the neurodevelopment outcome in 30 children (median age 9 years) born to mothers with SLE and/or APS with IgG anti-beta2-glycoprotein I during the third trimester of pregnancy and found positive for the same antibodies at birth. A neurological physical exam was performed in all children. We submitted some questionnaires to the mothers: the Child Behavior CheckList (CBCL) and a homemade set of questions obtained by a team composed of rheumatologists and pediatric neurologists. Intellectual functioning was determined by the Wechsler scale for corrected age. In all children neurological physical exam and intelligence levels were found to be normal but mild behavior disorders and history of neurological manifestations were shown in three children. Offspring of patients with SLE and/or APS are generally healthy. We and others observed the occurrence of minor neurological disorders that might be related to maternal disease or to prematurity. The limited number of the available data on this sensitive issue supports the need for further studies. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  2. Batch Cooling Crystallization of Potassium Sulphate from Water Solution

    Directory of Open Access Journals (Sweden)

    Kalšan, M.

    2009-12-01

    Full Text Available Batch cooling crystallization, at the rotation speed of 700 min–1, of an aqueous solution of a potassium sulphate has been investigated on a laboratory scale. The effect of hydrodynamics conditions on the crystallization process were investigated by using different type of impellers. Two types of impellers were investigated; the four-pitched blade impeller which generates axi-al flow and the six-blades Rusthon turbine which generates radial flow. The experiments were performed at four different linear cooling rates in the range from 8-20 °C h–1 for both types of impeller.The influence of the cooling rates on the metastable zone width, the crystallization kinetics and the granulometric properties of the obtained crystals were investigated. The experimental data show that higher cooling rate expands the metastable zone for all the types of impeller (Fig. 2 and influences the crystal size distribution (Fig. 7 and Fig. 8.At low cooling rates, supersaturation was kept at a constant value for a longer period. It resulted in improved conditions for mass transfer and the crystals grew. Bigger crystals were obtained at lower cooling rates (Fig. 7.It is stated that radial flow (Rusthon turbine is particularly inappropriate for the nucleation process, and for crystallization. Nucleation started at a lower temperature and higher supersaturation (Fig. 3. These conditions resulted in a high nucleation’s rate and large number of nucleation centres.Also, the obtained crystals settled on the wall of the reactor, baffles and stirrer. A great part of the obtained crystals was agglomerated. The nucleation order, n and coefficient of nucleation, kn were determined for different cooling rates (Fig. 5a. The nucleation order is higher at radial flow (nucleation started at higher supersaturation. The relation between the rate of concentration drop in a solution and supersaturation has beenapproximated with a power low equation (Fig. 5b. For the used impellers

  3. Overview of the advanced photon source (APS)

    International Nuclear Information System (INIS)

    White, M.M.

    1994-01-01

    The Advanced Photon Source (APS) is a state-of-the-art synchrotron light source facility dedicated to the production of extremely brilliant x-ray beams for research. Its super-intense x-ray beams will be used in many areas of research including industrial research, biological and medical research, defense-related research, and basic research. The APS x-ray beams will allow scientists to study smaller samples, more complex systems, faster reactions and processes, and gather data at a greater level of detail than has been possible to date. Creation of these beams begins with electron production by an electron gun with a thermionic cathode. The electrons are accelerated to 200 MeV by a linear accelerator (linac) and then impinge on a tungsten target, resulting in electron-positron pair production. The positrons are accelerated to 450 MeV in the remainder of the linac, then accumulated, damped, and transferred to a synchrotron that increases their energy to 7 GeV. The 7-GeV positrons are injected into a storage ring, where they pass through special magnets that cause them to emit x-rays of the desired quality. Construction at ANL is nearly complete at this time, and the APS will begin operating for users in 1996. The accelerator and experimental facilities are described in this paper, and a brief overview of some of the experimental programs is given

  4. APS - Diagnostics and challenges for the future.

    Science.gov (United States)

    Pengo, V; Bison, E; Zoppellaro, G; Padayattil Jose, S; Denas, G; Hoxha, A; Ruffatti, A; Banzato, A

    2016-11-01

    Diagnosis of antiphospholipid syndrome (APS) is essentially based on the detection of circulating antiphospholipid (aPL) antibodies. Progress have been made on the standardization of tests exploring the presence of aPL as guidelines on coagulation and immunological tests were recently published in the literature. Clinical relevance of aPL profile has come from prospective cohort studies in populations with a homogeneous antibody profile supporting the view that triple positivity is a high risk pattern in patients and carriers. In addition to the classic ones, several other tests have been proposed for the diagnosis of APS. The detection of antibodies directed to domain 1 and 4/5 of β2-Glycoprotein I (β2GP1) were found to be particularly sound. Several issues remain to be addressed. We do not yet know what is the physiological function of β2GP1 and the pathophysiology of thrombosis and pregnancy loss in these patients. Moreover, treatment is poorly defined especially in the case of feared catastrophic APS. Copyright © 2016 Elsevier B.V. All rights reserved.

  5. On the periodic variations of geomagnetic activity indices Ap and ap

    Directory of Open Access Journals (Sweden)

    H. Schreiber

    1998-05-01

    Full Text Available Yearly averages of geomagnetic activity indices Ap for the years 1967–1984 are compared to the respective averages of ν2·Bs, where v is the solar wind velocity and Bs is the southward interplanetary magnetic field (IMF component. The correlation of both quantities is known to be rather good. Comparing the averages of Ap with ν2 and Bs separately we find that, during the declining phase of the solar cycle, ν2 and during the ascending phase Bs have more influence on Ap. According to this observation (using Fourier spectral analysis the semiannual and 27 days, Ap variations for the years 1932–1993 were analysed separately for years before and after sunspot minima. Only those time-intervals before sunspot minima with a significant 27-day recurrent period of the IMF sector structure and those intervals after sunspot minima with a significant 28-28.5-day recurrent period of the sector structure were used. The averaged spectra of the two Ap data sets clearly show a period of 27 days before and a period of 28–29 days after sunspot minimum. Moreover, the phase of the average semiannual wave of Ap is significantly different for the two groups of data: the Ap variation maximizes near the equinoxes during the declining phase of the sunspot cycle and near the beginning of April and October during the ascending phase of the sunspot cycle, as predicted by the Russell-McPherron (R-M mechanism. Analysing the daily variation of ap in an analogue manner, the same equinoctial and R-M mechanisms are seen, suggesting that during phases of the solar cycle, when ap depends more on the IMF-Bs component, the R-M mechanism is predominant, whereas during phases when ap increases as v increases the equinoctial mechanism is more likely to be effective.Key words. Interplanetary physics · Magnetic fields · Solar wind plasma · Solar wind · magnetosphere interaction

  6. Selection of Suitable Carbon, Nitrogen and Sulphate Source for the Production of Alkaline Protease by Bacillus licheniformis NCIM-2042

    Directory of Open Access Journals (Sweden)

    Biswanath BHUNIA

    2010-06-01

    Full Text Available In this study, selection of suitable carbon, nitrogen and sulphate sources were carried out by one-variable-at-time approach for the production of alkaline protease enzyme by Bacillus licheniformis NCIM-2042. Maximum levels of alkaline protease were found in culture media supplemented with magnesium sulphate, starch and soybean meal as a good sulphate, carbon and nitrogen sources which influenced the maximum yield of this enzyme (137.69�4.57, 135.23�1.73 and 134.74�1.77, respectively in comparison with the other sulphate, carbon and nitrogen sources.

  7. Selection of Suitable Carbon, Nitrogen and Sulphate Source for the Production of Alkaline Protease by Bacillus licheniformis NCIM-2042

    Directory of Open Access Journals (Sweden)

    Biswanath BHUNIA

    2010-06-01

    Full Text Available In this study, selection of suitable carbon, nitrogen and sulphate sources were carried out by one-variable-at-time approach for the production of alkaline protease enzyme by Bacillus licheniformis NCIM-2042. Maximum levels of alkaline protease were found in culture media supplemented with magnesium sulphate, starch and soybean meal as a good sulphate, carbon and nitrogen sources which influenced the maximum yield of this enzyme (137.694.57, 135.231.73 and 134.741.77, respectively in comparison with the other sulphate, carbon and nitrogen sources.

  8. Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations (II): thrombocytopenia and skin manifestations.

    Science.gov (United States)

    Cervera, R; Tektonidou, M G; Espinosa, G; Cabral, A R; González, E B; Erkan, D; Vadya, S; Adrogué, H E; Solomon, M; Zandman-Goddard, G; Shoenfeld, Y

    2011-02-01

    The objectives of the 'Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations' were to assess the clinical utility of the international consensus statement on classification criteria and treatment guidelines for the catastrophic APS, to identify and grade the studies that analyze the relationship between the antiphospholipid antibodies and the non-criteria APS manifestations, and to present the current evidence regarding the accuracy of these non-criteria APS manifestations for the detection of patients with APS. This article summarizes the studies analyzed on thrombocytopenia and skin manifestations, and presents the recommendations elaborated by the Task Force after this analysis.

  9. The Protective Role of Zinc Sulphate on Ethanol -Induced Liver and Kidney Damages in Rats

    International Nuclear Information System (INIS)

    Al-Damegh, Mona Abdalla

    2007-01-01

    Around the world more and more people suffer from alcoholism. Addiction problems, alcoholism and excessive use of drugs both medical and nonmedical, are major causes of liver and kidney damage in adults. The purpose of this study was to investigate on the protective role of zinc sulphate on liver and kidney in rats with acute alcoholism. Wistar albino rats were divided into four groups. Group I; control group, group 2; given only Zinc Sulphate (100 mg/kg/day for 3days), group 3; rats given absolute ethanol (1 ml of absolute ethanol administrated by gavage technique to each rat), group 4 given Zinc sulphate prior to the administration of absolute ethanol. The results of this study revealed that acute ethanol exposure caused degenerative morphological changes in the liver and kidney. Significant difference were found in the levels of serum, liver, kidney super oxide dismutase(SOD), catalase (CAT), nitric oxide(NO), and malondialdehyde (MDA) in the ethanol group compared to the control group. Moreover ,serum urea, creatnine, uric acid, alkaline phoshpatase and transaminases activities (GOTand GPT) were increased in the ethanol group compared to the control group. On the other hand,administration of zinc sulphate in the ethanol group caused a significant decrease in the degenerative changes, lipid peroxidation, antioxidant enzymes, and nitric oxide in serum, liver, and kidney. It can be concluded that zinc Sulphate has a protective role on the ethanol induced liver and kidney injury. In addition ,nitric oxide is involved in the mechanism of acute alcohol intoxication. (author)

  10. Evaluating portland cement concrete degradation by sulphate exposure through artificial neural networks modeling

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Douglas Nunes de; Bourguignon, Lucas Gabriel Garcia; Tolentino, Evandro, E-mail: tolentino@timoteo.cefetmg.br [Centro Federal de Educacao Tecnologica de Minas Gerais (CEFET-MG), Timoteo, MG (Brazil); Costa, Rodrigo Moyses, E-mail: rodrigo@moyses.com.br [Universidade de Itauna, Itauna, MG (Brazil); Tello, Cledola Cassia Oliveira de, E-mail: tellocc@cdtn.br [Centro de Desenvolvimento da Tecnologia Nucelar (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2015-07-01

    A concrete is durable if it has accomplished the desired service life in the environment in which it is exposed. The durability of concrete materials can be limited as a result of adverse performance of its cement-paste matrix or aggregate constituents under either chemical or physical attack. Among other aggressive chemical exposures, the sulphate attack is an important concern. Water, soils and gases, which contain sulphate, represent a potential threat to the durability of concrete structures. Sulphate attack in concrete leads to the conversion of the hydration products of cement to ettringite, gypsum, and other phases, and also it leads to the destabilization of the primary strength generating calcium silicate hydrate (C-S-H) gel. The formation of ettringite and gypsum is common in cementitious systems exposed to most types of sulphate solutions. The present work presents the application of the neural networks for estimating deterioration of various concrete mixtures due to exposure to sulphate solutions. A neural networks model was constructed, trained and tested using the available database. In general, artificial neural networks could be successfully used in function approximation problems in order to approach the data generation function. Once data generation function is known, artificial neural network structure is tested using data not presented to the network during training. This paper is intent to provide the technical requirements related to the production of a durable concrete to be used in the structures of the Brazilian near-surface repository of radioactive wastes. (author)

  11. Influence on ammonium-sulphate fertilizer on P-uptake by upland rice

    International Nuclear Information System (INIS)

    Abdullah, N; Mitrosuhardjo, M.M.

    1988-01-01

    A greenhouse experiment to study the influence of ammonium -sulphate fertilizer on P-uptake by Atomita I/1 rice variety on latosol soil of Pasar Jumat has been conducted. Factorial experiment consisting of eight treatments was arrange in a fully randomized design. Each treatment was replicated three times. The rate of ammonium sulphate fertilizer was equivalent to 0, 30, 60, and 90 kg N/ha, and TSP at the rate of 90 and 180 kg P/ha. Ammonium sulphate fertilizer with 2% atom 15-N and TSP with specific activity of 0.2 mCi/g P2O5 were used in the experiment. The plant was harvested 70 days after planting, It was turned out that ammonium sulphate fertilizer gave a highly significant difference (p=<0.01) of dry weight of plant. The rate of TSP did not effect significantly on plant dry weight. Ammonium sulphate fertilizer gave highly significant difference on P-uptake. Fertilizer use efficiency was in the range of 3.88 - 6.60% for 90 kg P and 2.51 - 4.46% for 180 kg P. Fertilizer-N uptake was significantly increased (p=<0.05) with the increase of N rate. Rate of fertilizer-N use efficiency was in the range of 47-60% of the applied fertilizer. (authors). 4 refs, 9 tabs

  12. Resistance of class C fly ash belite cement to simulated sodium sulphate radioactive liquid waste attack

    International Nuclear Information System (INIS)

    Guerrero, A.; Goni, S.; Allegro, V.R.

    2009-01-01

    The resistance of class C fly ash belite cement (FABC-2-W) to concentrated sodium sulphate salts associated with low level wastes (LLW) and medium level wastes (MLW) is discussed. This study was carried out according to the Koch and Steinegger methodology by testing the flexural strength of mortars immersed in simulated radioactive liquid waste rich in sulphate (48 000 ppm) and demineralised water (used as a reference), at 20 deg. C and 40 deg. C over a period of 180 days. The reaction mechanisms of sulphate ion with the mortar was carried out through a microstructure study, which included the use of Scanning electron microscopy (SEM), porosity and pore-size distribution and X-ray diffraction (XRD). The results showed that the FABC mortar was stable against simulated sulphate radioactive liquid waste (SSRLW) attack at the two chosen temperatures. The enhancement of mechanical properties was a result of the formation of non-expansive ettringite inside the pores and an alkaline activation of the hydraulic activity of cement promoted by the ingress of sulphate. Accordingly, the microstructure was strongly refined

  13. Biotreatment of Cr(VI) contaminated waters by sulphate reducing bacteria fed with ethanol

    Energy Technology Data Exchange (ETDEWEB)

    Pagnanelli, F., E-mail: francesca.pagnanelli@uniroma1.it [Department of Chemistry, Sapienza University of Rome, P.le Aldo Moro 5, 00185 Rome (Italy); Cruz Viggi, C., E-mail: carolina.cruzviggi@uniroma1.it [Department of Chemistry, Sapienza University of Rome, P.le Aldo Moro 5, 00185 Rome (Italy); Cibati, A., E-mail: alessio.cibati@uniroma1.it [Department of Chemistry, Sapienza University of Rome, P.le Aldo Moro 5, 00185 Rome (Italy); Uccelletti, D., E-mail: daniela.uccelletti@uniroma1.it [Department of Biology and Biotechnology, Sapienza University of Rome, P.le A. Moro 5, 00185 Rome (Italy); Toro, L., E-mail: luigi.toro@uniroma1.it [Department of Chemistry, Sapienza University of Rome, P.le Aldo Moro 5, 00185 Rome (Italy); Palleschi, C., E-mail: claudio.palleschi@uniroma1.it [Department of Biology and Biotechnology, Sapienza University of Rome, P.le A. Moro 5, 00185 Rome (Italy)

    2012-01-15

    Highlights: Black-Right-Pointing-Pointer Use of ethanol as electron donor for sulphate-reducing bacteria for the treatment of Cr(VI). Black-Right-Pointing-Pointer Isolation of contribution in Cr removal (adsorption vs. bioprecipitation). Black-Right-Pointing-Pointer Bioassessment of the process effectiveness by ecotoxicological in vivo tests using C. elegans. - Abstract: Biological treatment of Cr(VI) contaminated waters was performed in fixed bed reactors inoculated with SRB (sulphate-reducing bacteria) growing on ethanol. Treatment efficiency was evaluated by checking chemical abatement of Cr(VI) and by ecotoxicological tests using the nematode Caenorhabditis elegans. A preliminary comparison between ethanol and lactate was performed, denoting that using ethanol, the same values of final sulphate abatement were obtained. In addition ethanol showed to be a substrate more competitive than lactate in kinetic terms. Fixed bed column reactors were continuously fed with a solution containing sulphates (3 g L{sup -1}), ethanol (1.5 g L{sup -1}) and Cr(VI) (50 mg L{sup -1}). At steady state the column inoculated with SRB removed 65 {+-} 5% of sulphate and 95 {+-} 5% of chromium. Bioactive removal mechanisms predominated over biosorption. Diminution of Cr(VI) toxicity was assessed by using the nematode C. elegans as a test organism showing that the survival of nematodes was 20% in the presence of the untreated influent and raised up to 53% when the nematodes were exposed to the treated effluent.

  14. Metal extraction from alum shale ashes under the effect of ammonium sulphate

    International Nuclear Information System (INIS)

    Maremaee, E.; Taal, H.

    1991-01-01

    The present study is a part of complex research about alum shale ashes carried out in the Institute of Chemistry of the Estonian Academy of Sciences during the period 1960-1975. In this paper the results of a research into decomposition of alum shale ashes under the effect of ammonium sulphate are presented. The following parameters of decomposition process were studied: temperature, time, quantity of ammonium sulphate needed for decomposition of ashes, In addition the effect of ammonium sulphate on the process of alum shale ashes thermal decomposition was studied using thermal methods. The optimum conditions determined for decomposition of ashes with ammonium sulphate were the following: temperature - 440 degrees by Celsius, duration -30 min., weight ratio of ammonium sulphate and ashes in reaction mixture -1.75 : 1. These data are confirmed by the results of thermal analysis. The above-mentioned process conditions guarantee the extraction of Ti, Mo, V, U and Fe about 70-85%, Al - up to 50%. 7 refs., 2 figs

  15. Methane production and simultaneous sulphate reduction in anoxic, salt marsh sediments

    Science.gov (United States)

    Oremland, R.S.; Marsh, L.M.; Polcin, S.

    1982-01-01

    It has been generally believed that sulphate reduction precludes methane generation during diagenesis of anoxic sediments1,2. Because most biogenic methane formed in nature is thought to derive either from acetate cleavage or by hydrogen reduction of carbon dioxide3-6, the removal of these compounds by the energetically more efficient sulphate-reducing bacteria can impose a substrate limitation on methanogenic bacteria 7-9. However, two known species of methanogens, Methanosarcina barkeri and Methanococcus mazei, can grow on and produce methane from methanol and methylated amines10-13. In addition, these compounds stimulate methane production by bacterial enrichments from the rumen11,14 and aquatic muds13,14. Methanol can enter anaerobic food webs through bacterial degradation of lignins15 or pectin16, and methylated amines can be produced either from decomposition of substances like choline, creatine and betaine13,14 or by bacterial reduction of trimethylamine oxide17, a common metabolite and excretory product of marine animals. However, the relative importance of methanol and methylated amines as precursors of methane in sediments has not been previously examined. We now report that methanol and trimethylamine are important substrates for methanogenic bacteria in salt marsh sediments and that these compounds may account for the bulk of methane produced therein. Furthermore, because these compounds do not stimulate sulphate reduction, methanogenesis and sulphate reduction can operate concurrently in sulphate-containing anoxic sediments. ?? 1982 Nature Publishing Group.

  16. Evaluating portland cement concrete degradation by sulphate exposure through artificial neural networks modeling

    International Nuclear Information System (INIS)

    Oliveira, Douglas Nunes de; Bourguignon, Lucas Gabriel Garcia; Tolentino, Evandro; Costa, Rodrigo Moyses; Tello, Cledola Cassia Oliveira de

    2015-01-01

    A concrete is durable if it has accomplished the desired service life in the environment in which it is exposed. The durability of concrete materials can be limited as a result of adverse performance of its cement-paste matrix or aggregate constituents under either chemical or physical attack. Among other aggressive chemical exposures, the sulphate attack is an important concern. Water, soils and gases, which contain sulphate, represent a potential threat to the durability of concrete structures. Sulphate attack in concrete leads to the conversion of the hydration products of cement to ettringite, gypsum, and other phases, and also it leads to the destabilization of the primary strength generating calcium silicate hydrate (C-S-H) gel. The formation of ettringite and gypsum is common in cementitious systems exposed to most types of sulphate solutions. The present work presents the application of the neural networks for estimating deterioration of various concrete mixtures due to exposure to sulphate solutions. A neural networks model was constructed, trained and tested using the available database. In general, artificial neural networks could be successfully used in function approximation problems in order to approach the data generation function. Once data generation function is known, artificial neural network structure is tested using data not presented to the network during training. This paper is intent to provide the technical requirements related to the production of a durable concrete to be used in the structures of the Brazilian near-surface repository of radioactive wastes. (author)

  17. Clinical and radiographic evaluation of pulpotomies in primary molars with formocresol, glutaraldehyde and ferric sulphate.

    Science.gov (United States)

    Havale, Raghavendra; Anegundi, Rajesh T; Indushekar, Kr; Sudha, P

    2013-03-01

    This in vivo study aimed to assess and compare the relative clinical and radiographic success of formocresol, glutaraldehyde and ferric sulphate as medicaments following pulpotomies in primary molars at three-monthly intervals over one year. The study was carried out on 90 primary molars in 54 children aged from 3 to 9 years. Selected teeth were equally distributed and randomly assigned to formocresol, glutaraldehyde and ferric sulphate pulpotomy medicament groups (30 in each group). The teeth were then evaluated clinically and radiographically at three-monthly intervals over one year. The resulting data were tabulated and statistically analysed using the chi-square test. After one year, the clinical success rate was 100% with glutaraldehyde, 96.7% with ferric sulphate, and 86.7% with formocresol. The radiological success rate gradually decreased over the year in all pulpotomy medicament groups. Radiological success rates in formocresol, glutaraldehyde, and ferric sulphate groups were 56.7%, 83.3%, and 63.3%, respectively. Two per cent glutaraldehyde may be recommended as a more effective alternative to formocresol and ferric sulphate as a pulpotomy medicament.

  18. Small Molecule Inhibitors Targeting Activator Protein 1 (AP-1)

    Science.gov (United States)

    2015-01-01

    Activator protein 1 (AP-1) is a pivotal transcription factor that regulates a wide range of cellular processes including proliferation, apoptosis, differentiation, survival, cell migration, and transformation. Accumulating evidence supports that AP-1 plays an important role in several severe disorders including cancer, fibrosis, and organ injury, as well as inflammatory disorders such as asthma, psoriasis, and rheumatoid arthritis. AP-1 has emerged as an actively pursued drug discovery target over the past decade. Excitingly, a selective AP-1 inhibitor T-5224 (51) has been investigated in phase II human clinical trials. Nevertheless, no effective AP-1 inhibitors have yet been approved for clinical use. Despite significant advances achieved in understanding AP-1 biology and function, as well as the identification of small molecules modulating AP-1 associated signaling pathways, medicinal chemistry efforts remain an urgent need to yield selective and efficacious AP-1 inhibitors as a viable therapeutic strategy for human diseases. PMID:24831826

  19. A novel homozygous AP4B1 mutation in two brothers with AP-4 deficiency syndrome and ocular anomalies.

    Science.gov (United States)

    Accogli, Andrea; Hamdan, Fadi F; Poulin, Chantal; Nassif, Christina; Rouleau, Guy A; Michaud, Jacques L; Srour, Myriam

    2018-04-01

    Adaptor protein complex-4 (AP-4) is a heterotetrameric protein complex which plays a key role in vesicle trafficking in neurons. Mutations in genes affecting different subunits of AP-4, including AP4B1, AP4E1, AP4S1, and AP4M1, have been recently associated with an autosomal recessive phenotype, consisting of spastic tetraplegia, and intellectual disability (ID). The overlapping clinical picture among individuals carrying mutations in any of these genes has prompted the terms "AP-4 deficiency syndrome" for this clinically recognizable phenotype. Using whole-exome sequencing, we identified a novel homozygous mutation (c.991C>T, p.Q331*, NM_006594.4) in AP4B1 in two siblings from a consanguineous Pakistani couple, who presented with severe ID, progressive spastic tetraplegia, epilepsy, and microcephaly. Sanger sequencing confirmed the mutation was homozygous in the siblings and heterozygous in the parents. Similar to previously reported individuals with AP4B1 mutations, brain MRI revealed ventriculomegaly and white matter loss. Interestingly, in addition to the typical facial gestalt reported in other AP-4 deficiency cases, the older brother presented with congenital left Horner syndrome, bilateral optic nerve atrophy and cataract, which have not been previously reported in this condition. In summary, we report a novel AP4B1 homozygous mutation in two siblings and review the phenotype of AP-4 deficiency, speculating on a possible role of AP-4 complex in eye development. © 2018 Wiley Periodicals, Inc.

  20. Barium sulphate preparations for use in double contrast examination of the upper gastrointestinal tract

    International Nuclear Information System (INIS)

    Anderson, W.; Harthill, J.E.; James, W.B.; Montgomery, D.

    1980-01-01

    Physical properties relevant to upper gastrointestinal radiology have been compared for five barium sulphate preparations and related to radiographic results. Evaluation of particles (size and stability) and whole suspension (dispersibility and fluidity) resulted in ranking of the preparations generally in accord with that based on radiological experience in double contrast examinations of the stomach. Experiments with extirpated pig stomach revealed a tendency for large particles in a low viscosity barium sulphate suspension to settle in mucosal grooves. This is believed to contribute to good radiographic definition of both the areae gastricae and small lesions. Particle size is therefore important and susceptibility to flocculation, a possible cause of random change in size during use, was assessed by measuring particle electrophoretic mobility under varying conditions; quantitative differences in suspension flow and dispersibility were also demonstrated. Fluidity and dispersibility together with rapid sedimentation of suitably sized particles resistant to flocculation underlie the successful use of low viscosity high density barium sulphate suspensions. (U.K.)

  1. CHRONIC Cd TOXICITY OF BEAN PLANTS CAN BE PARTIALLY REDUCED BY SUPPLY OF AMMONIUM SULPHATE

    Directory of Open Access Journals (Sweden)

    Andon VASSILEV

    2006-05-01

    Full Text Available The effect of ammonium sulphate supply on plant Cd uptake, growth and photosynthesis of bean plants (cv. Limburgse vroege grown in Cd-contaminated artifi cial soil was studied. The experiments were performed at controlled conditions in absence or presence of Cd (0 or 50 mg Cd kg-1 soil and with or without supply of ammonium sulphate [0 or 0.687 g (NH42SO4 kg-1]. Cadmium inhibited both growth and photosynthetic activity of bean plants. The supply of ammonium sulphate had no signifi cant effect on plant Cd uptake and growth inhibition, but to some extend, reduced Cd-induced stress and its negative impact on the photosynthetic performance.

  2. Precipitation of calcium sulphate on hot walls - influence of impurities, thermal and hydraulic effects

    International Nuclear Information System (INIS)

    Guillermin, Roger

    1973-01-01

    After some generalities on desalination by distillation processes and on problems due to scaling, this research thesis aims at a better understanding of the formation of deposits and their effects in the case of precipitation of calcium sulphate hemihydrate which precipitates above 100 C in pure solution and between 100 and 300 C in brine. Deposit growth, influence of impurities, and influence of the deposit on heat exchange and loss of load are the main issues of this research. The author addresses general principles of salt crystallization and the thermodynamic and kinetic aspects of calcium sulphate precipitation, studies the growth kinetics of the calcium sulphate hemihydrate in a transient concentration regime, reports the study of thermal and hydraulic effects of the formation of a hemihydrate deposit, notably by discussing the different phases involved in the covering of a metallic surface

  3. The influence of nickel sulphate on some physiological aspects of two cultivars of Raphanus sativus L.

    Directory of Open Access Journals (Sweden)

    Latif Helmy H.

    2010-01-01

    Full Text Available In this study two cultivars of radish Raphanus sativus cv. longipinnatus (white radish and Raphanus sativus cv. Cherry Belle (red radish were treated with different concentrations of nickel sulphate (0.0-50-100-150-200 ppm. The fresh and dry weight of shoots and roots, photosynthetic pigments, some antioxidant enzymes, total carbohydrates, total proteins and the SDS-PAGE protein profile of both cultivars were determined after 32 days. The results showed that increasing nickel sulphate concentrations decreased the fresh and dry weights of the shoots and roots, photosynthetic pigments, total carbohydrates and total protein in both cultivars. Higher concentrations of nickel sulphate increased the activity of catalase, peroxidase and polypenol oxidase. Electrophoresis banding profiles of proteins revealed qualitative and quantitative changes, and also the appearance or disappearance of some bands of the two cultivars. .

  4. Magnesium sulphate as a safe treatment for persistent pulmonary hypertension of newborn resistant to mechanical hyperventilation

    International Nuclear Information System (INIS)

    Dehdashtian, M.; Tebatebae, K.

    2007-01-01

    To see the effects of magnesium sulphate in newborn with persistent pulmonary hypertension of newborn (PPHN) who did not respond to mechanical hyperventilation and are candidate for Extra Corporeal Membrane Oxygenation (ECMO). Ten newborn who were admitted to Neonatal Intensive Care Unit (NICU) with profound hypoxia and respiratory failure due to PPHN were treated with conventional mechanical ventilation and then mechanical hyperventilation. The newborns who did not respond to mechanical Hyperventilation were treated with magnesium sulphate infusion. Nine out of ten babies survived and one of them died. The differences between the mean AaDo2, OI index, and PH after mechanical hyperventilation and magnesium sulphate administration was significant. Magnesium has a role in the treatment of PPHN patients who do not respond to hyperventilation or may be applied instead of hyperventilation. (author)

  5. AIRE variations in Addison's disease and autoimmune polyendocrine syndromes (APS)

    DEFF Research Database (Denmark)

    Bøe Wolff, A S; Oftedal, B; Johansson, S

    2008-01-01

    Autoimmune Addison's disease (AAD) is often associated with other components in autoimmune polyendocrine syndromes (APS). Whereas APS I is caused by mutations in the AIRE gene, the susceptibility genes for AAD and APS II are unclear. In the present study, we investigated whether polymorphisms...

  6. Teaching Materials and Strategies for the AP Music Theory Exam

    Science.gov (United States)

    Lively, Michael T.

    2017-01-01

    Each year, many students take the Advanced Placement (AP) Music Theory Exam, and the majority of these students enroll in specialized AP music theory classes as part of the preparation process. For the teachers of these AP music theory classes, a number of challenges are presented by the difficulty and complexity of the exam subject material as…

  7. Kinetic properties of growth of intestinal sulphate-reducing bacteria isolated from healthy mice and mice with ulcerative colitis

    Directory of Open Access Journals (Sweden)

    Ivan Kushkevych

    2017-01-01

    Full Text Available Inflammatory bowel disease including ulcerative colitis are complex multifactorial diseases of unknown aetiology. Sulphate-reducing bacteria are often associated with the occurrence of the disease. The physiological properties of intestinal sulphate-reducing bacteria including kinetic characteristic of their growth have never been reported. The aim of this research was to evaluate the presence of sulphate-reducing bacteria isolated from the intestines of mice, study their growth, calculate and compare the kinetic growth properties on the model of dextran sulphate sodium induced ulcerative colitis in the mice. The number of viable intestinal sulphate-reducing bacteria from the bowel lumen of mice with ulcerative colitis was higher (P > 0.05 by 22% at 12 h of cultivation compared with cultures of sulphate-reducing bacteria from the bowel lumen of healthy mice. The sulphate-reducing bacteria from mice with colitis also had a slightly higher generation time (14.29 h and exponential growth phase (22.24 h compared with cultures from healthy mice. The time of lag-phase was 2 × shorter (P > 0.01 in the cultures of sulphate-reducing bacteria from mice with ulcerative colitis. The described research is new and important for the prediction of the sulphate-reducing bacteria number in the gut and their rate of dissimilatory sulphate reduction. The kinetic characteristic of their growth is important for further clarification of the mechanisms of sulphate reduction and accumulation of hydrogen sulphide, which is toxic for epithelial cells of the intestine and can cause bowel diseases both in humans and animals, in particular ulcerative colitis.

  8. Micromechanical characterisation of failure in acrylic bone cement: the effect of barium sulphate agglomerates.

    Science.gov (United States)

    Shearwood-Porter, N; Browne, M; Sinclair, I

    2012-09-01

    Acrylic bone cement has been established as a method of fixation of load-bearing orthopaedic implants for nearly five decades, and has produced excellent long term clinical results. However, increasing patient BMI values and longer life expectancies are placing ever greater demands on joint replacements, so there is a need to further improve the performance of cemented fixation. Damage accumulation in the in vivo cement mantle due to initiation and coalescence of fatigue micro-cracks has been implicated in the aseptic loosening and failure of implants. While the effect of porosity on crack initiation processes has been widely reported, the relative influence of different radiopacifying agents is less well studied. In particular, barium sulphate radiopacifier particles have been reported to form large agglomerates within the cement that have been linked to initiation of fatigue cracks in vitro. However, there appears to be little understanding of the micromechanical aspects of cement failure due to barium sulphate agglomeration. The present study utilised micro-computed tomography (μCT) and field emission gun scanning electron microscopy (FEG-SEM), alongside mechanical testing, to provide a systematic, quantitative assessment of the effect of barium sulphate agglomeration on crack initiation processes in a conventional, vacuum-mixed acrylic cement. Three-dimensional characterisation of defect populations was performed, with agglomerates of barium sulphate particles found to be large (up to 0.37 mm equivalent spherical diameter), present at spatial densities up to 22 per mm³, and evenly distributed through each cement specimen. Fatigue cracks consistently initiated at the largest agglomerates; furthermore, fatigue life was found to scale consistently with largest defect size. As such, the tendency of barium sulphate particles to agglomerate is clearly evidenced to be detrimental to the fatigue performance of this cement in vitro. Optimisation of mixing techniques

  9. Dicty_cDB: FC-AP07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP07 (Link to dictyBase) - - - Contig-U15932-1 FC-AP07P (Li...nk to Original site) FC-AP07F 546 FC-AP07Z 446 FC-AP07P 992 - - Show FC-AP07 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP07Q.Seq.d/ Representative seq. ID FC-AP...07P (Link to Original site) Representative DNA sequence >FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP...ificant alignments: (bits) Value FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP07Q.Seq.d/ 1148 0.0 SSM404 (SSM404Q)

  10. Dicty_cDB: FC-AP08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP08 (Link to dictyBase) - - - Contig-U16116-1 FC-AP08P (Li...nk to Original site) FC-AP08F 125 FC-AP08Z 352 FC-AP08P 477 - - Show FC-AP08 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP08Q.Seq.d/ Representative seq. ID FC-AP...08P (Link to Original site) Representative DNA sequence >FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP... (VSA612Q) /CSM/VS/VSA6-A/VSA612Q.Seq.d/ 624 e-178 FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP

  11. Effects of Manganese (Ii Sulphate on Structural, Spectral, Optical, Thermal and Mechanical Properties of L-Alanine Sodium Sulphate Single Crystals

    Directory of Open Access Journals (Sweden)

    F. Praveena

    2017-04-01

    Full Text Available New Non-linear Optical materials have been attracting in the research world for their potential applications in emerging opto-electronic technology. The dipolar nature of amino acid leads to peculiar physical and chemical properties, thus making a good candidate for NLO applications. Single crystals of manganese(II sulphate doped L-Alanine sodium sulphate(LASS has been synthesized by slow evaporation technique. Structural property of the grown crystals are characterized by X-ray powder diffraction,FT-IR spectral analysis conforms all the functional groups. Thermogravity (TG and differential themogravimetric (DTA analysis have been performed to study the thermal stability of the crystals. The second harmonic generation efficiency was measured by Kurtz-Perry powder technique. The transmission and absorption of electromagnetic radiation is analysed through UV-VIS spectrum. Microhardness was measured at different applied load to understand the mechanical stability of the crystal.

  12. The bioactivation procedure for increasing the sulphate-reducing bacteria in a UASB reactor

    Directory of Open Access Journals (Sweden)

    M. M. M. Gonçalves

    2005-12-01

    Full Text Available Bioactivation, a procedure to obtain anaerobic sulphidogenic sludge, was developed in order to increase sulphate reduction and, consequently, sulphide production to remove metals from effluents. This procedure, in which the source of carbon/energy (lactate is gradually replaced, consisted of three operational conditions. It was observed that bioactivation took six months so there was a 100-fold increase in the population of sulphate-reducing bacteria estimated by the most-probable-number (MPN when molasses was employed as a new source.

  13. Comparative study of oral and intramuscular atropine sulphate as a premedicant in paediatric age group.

    Directory of Open Access Journals (Sweden)

    Chaudhari L

    1989-01-01

    Full Text Available The use of atropine sulphate in the paediatric age group as a premedicant orally in a dosage of 0.02 mg/kg body weight 70 minutes prior to surgery was found to be as effective as atropine sulphate given intramuscularly 35 minutes prior to surgery in a dosage of 0.01 mg/kg body weight. This avoids the unpleasant memory of needle prick; The duration of effect as studied in the normal healthy children not subjected to surgery was found to be 2 1/2-3 hours.

  14. Yield of castor bean fertilized with sewage sludge and potassium and magnesium sulphate

    OpenAIRE

    Cavalcanti,Thâmara F. M.; Zuba,Geraldo R.; Sampaio,Regynaldo A.; Carneiro,João P.; Oliveira,Ely S. A. de; Rodrigues,Márcio N.

    2015-01-01

    ABSTRACTThe aim of this study was to evaluate the yield and nutrition of castor bean in response to fertilization with sewage sludge and potassium (K) and magnesium (Mg) sulphate. The experiment was carried out from January to July 2011. The treatments, in a randomized block design with three replicates, in a Nitosol, corresponded to a factorial scheme (2 x 4 +1): two doses of K and Mg sulphate combined with four doses of sewage sludge (0, 2.60, 5.20 and 10.40 t ha-1, dry basis), applied base...

  15. Laboratory effluent Treatment by Using Coagulant Alum sulphate and Poly Aluminium Chloride (PAC

    Directory of Open Access Journals (Sweden)

    Raimon Raimon

    2017-06-01

    Full Text Available It has been investigated of the laboratory effluent treatment using coagulant Alum sulphate (AS and Poly Aluminum Chloride (PAC. This research purposes to get the best doses of coagulant in waste water treatment. Parameter focuses are Total Dissolved Solid (TDS, Fe, Mn, Cr, and Ammoniac (NH3. The result shows the Alum sulphate was more effective. The effectiveness of pollutant decrease is 58,80% of TDS, 99,14% of Fe, 98% of Cr, 77,24% of Mn, and 23,18% of Ammoniac, respectively.

  16. Comparing traditional AP classes to portfolio AP classes in effectiveness of measuring knowledge.

    Directory of Open Access Journals (Sweden)

    Olona, L.

    2017-07-01

    Full Text Available High school students across the United States and internationally take Advanced Placement exams in May each year. These students also spend their school year enrolled in an Advanced Placement (AP class in preparation for the exam. There is a lack of research on any correlation between a student’s performance in class and performance on the exam. This study aims to compare the difference in correlation between traditional AP classes and portfolio AP classes. Second-semester grades and exam scores were collected from 2015 and 2016 from Norman High School students. Traditional classes had weak, if any, correlation, and portfolio classes presented no correlation. This lack of a relationship between class grade and exam score implies that students are unable to gauge their future exam performance based on class performance. Future researchers should compare data for a greater sample of students as well as regional samples.

  17. AP600 containment purge radiological analysis

    Energy Technology Data Exchange (ETDEWEB)

    O`Connor, M.; Schulz, J.; Tan, C. [Bechtel Power Corporation (United States)] [and others

    1995-02-01

    The AP600 Project is a passive pressurized water reactor power plant which is part of the Design Certification and First-of-a-Kind Engineering effort under the Advanced Light Water Reactor program. Included in this process is the design of the containment air filtration system which will be the subject of this paper. We will compare the practice used by previous plants with the AP600 approach to meet the goals of industry standards in sizing the containment air filtration system. The radiological aspects of design are of primary significance and will be the focus of this paper. The AP600 Project optimized the design to combine the functions of the high volumetric flow rate, low volumetric flow rate, and containment cleanup and other filtration systems into one multi-functional system. This achieves a more simplified, standardized, and lower cost design. Studies were performed to determine the possible concentrations of radioactive material in the containment atmosphere and the effectiveness of the purge system to keep concentrations within 10CFR20 limits and within offsite dose objectives. The concentrations were determined for various reactor coolant system leakage rates and containment purge modes of operation. The resultant concentrations were used to determine the containment accessibility during various stages of normal plant operation including refueling. The results of the parametric studies indicate that a dual train purge system with a capacity of 4,000 cfm per train is more than adequate to control the airborne radioactivity levels inside containment during normal plant operation and refueling, and satisfies the goals of ANSI/ANS-56.6-1986 and limits the amount of radioactive material released to the environment per ANSI/ANS 59.2-1985 to provide a safe environment for plant personnel and offsite residents.

  18. The APS thin pulsed septum magnets

    International Nuclear Information System (INIS)

    Lopez, F.; Mills, F.; Milton, S.; Reeves, S.; Sheynin, S.; Thompson, K.; Turner, L.

    1994-01-01

    A thin (2-mm) eddy-current pulsed septum magnet was developed for use in the Advanced Photon Source (APS) machines. A number of different configurations of the magnet were assembled and tested in an effort to minimize the undesired leakage field in the stored-beam region. However, because of measured excessive leakage fields, an alternative direct-drive septum magnet was also constructed and tested. We present here the design specifications and acceptable performance criteria along with results of magnetic field measurements

  19. Tumores de apéndice cecal

    Directory of Open Access Journals (Sweden)

    Rubén Bembilbre Taboada

    1998-08-01

    Full Text Available Se realizó un estudio descriptivo-retrospectivo de 8 pacientes con tumores de apéndice cecal, en el período comprendido entre el 1 de enero de 1990 y el 1 de enero de 1997, los cuales fueron intervenidos quirúrgicamente en el Hospital Provincial Clinicoquirúrgico Docente "Dr. Gustavo Aldereguía". Se revisaron todos los libros de biopsias del Departamento de Anatomía Patológica correspondientes al período analizado, para obtener aquellos casos con diagnóstico de afección tumoral de apéndice. Se estudiaron las historias clínicas y se recogieron datos de interés como sexo, manifestaciones clínicas, diagnóstico presuntivo, diagnóstico anatomopatológico y tipo de intervención. La afección tumoral de apéndice cecal es infrecuente y constituyó el 0,38% del total de 20057 apéndices examinadas. No se hallaron diferencias respecto al sexo. Hubo un ligero predominio en pacientes con edades de más de 60 años. Los hallazgos clínicos más frecuentes fueron dolor agudo en fosa inguinal derecha y fiebre, con predominio del adenocarcinoma. Los principales resultados se exponen en tablasA retrospective-descriptive study of 8 patients with appendix ceci tumors attending the hospital from January 1st, 1990 to January 1st 1997 was made. These patients were operated at "Dr. Gustavo Aldereguía" clinical surgical teaching hospital in Cienfuegos. All the biopsy records of the analyzed period were checked in the Pathological Anatomy Department so as to collect those cases diagnosed with appendix ceci tumors. Medical records were examined and interesting data were collected as follows: sex, clinical symptoms, presumptive diagnosis, anatomopathological diagnosis and type of surgery. Tumors in appendix ceci are unusual and represented 0.38 % of 20 057 analyzed appendixes. Sex was not a determining factor. The disease was slightly predominant in patients over 60. The most frequent clinical findings were: nagging pain in the right inguinal fosa and

  20. Studies of microparticles in patients with the antiphospholipid syndrome (APS).

    Science.gov (United States)

    Vikerfors, A; Mobarrez, F; Bremme, K; Holmström, M; Ågren, A; Eelde, A; Bruzelius, M; Antovic, A; Wallén, H; Svenungsson, E

    2012-06-01

    To study circulating platelet, monocyte and endothelial microparticles (PMPs, MMPs and EMPs) in patients with antiphospholipid syndrome (APS) in comparison with healthy controls. Fifty-two patients with APS and 52 healthy controls were investigated. MPs were measured on a flow cytometer (Beckman Gallios) and defined as particles sized APS patients versus controls (p APS patients. We observed a high number of EMPs expressing TF in APS patients. The numbers of MMPs and total EMPs were also higher as compared with healthy controls but in contrast to previous reports, the number of PMPs did not differ between groups.

  1. Solid state reaction studies of ammonium sulphate with tetrafluorides of uranium and thorium (Preprint No. AL.06)

    International Nuclear Information System (INIS)

    Singh Mudher, K.D.; Khandekar, R.R.; Krishnan, K.; Jayadevan, N.C.

    1989-01-01

    Solid state reactions of uranium and thorium tetrafluorides with ammonium sulphate convert them to easily soluble sulphates. New phases of anhydrous U(SO 4 ) 2 and Th(SO 4 ) 2 formed during the course of reaction are characterised by chemical and x-ray methods. X-ray data of these phases have been indexed on hexagonal crystal system. (author)

  2. In vitro and in vivo evaluation of gelatin-chondroitin sulphate hydrogels for controlled release of antibacterial proteins

    NARCIS (Netherlands)

    Kuijpers, AJ; van Wachem, PB; van Luyn, MJA; Brouwer, LA; Engbers, GHM; Krijgsveld, J; Zaat, SAJ; Feijin, J

    Chemically cross-linked gelatin-chondroitin sulphate (ChS) hydrogels, impregnated in Dacron, were evaluated as drug delivery systems for antibacterial proteins. The gelatin-chondroitin sulphate gels, plain or impregnated in Dacron, were cross-linked with a water-soluble carbodiimide (EDC) and

  3. In vitro and in vivo evaluation of gelatin-chondroitin sulphate hydrogels for controlled release of antibacterial proteins

    NARCIS (Netherlands)

    Kuijpers, A.J.; van Wachem, P.B.; van Luyn, M.J.A.; Brouwer, L.A.; Engbers, G.H.M.; Krijgsveld, J.; Zaat, S.A.J.; Dankert, J.; Feijen, Jan

    2000-01-01

    Chemically cross-linked gelatin–chondroitin sulphate (ChS) hydrogels, impregnated in Dacron, were evaluated as drug delivery systems for antibacterial proteins. The gelatin–chondroitin sulphate gels, plain or impregnated in Dacron, were cross-linked with a water-soluble carbodiimide (EDC) and

  4. Dicty_cDB: FC-AP10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP10 (Link to dictyBase) - - - Contig-U15819-1 FC-AP10Z (Li...nk to Original site) - - FC-AP10Z 497 - - - - Show FC-AP10 Library FC (Link to library) Clone ID FC-AP10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP10Q.Seq.d/ Representative seq. ID FC-AP...10Z (Link to Original site) Representative DNA sequence >FC-AP10 (FC-AP10Q) /CSM/FC/FC-AP/FC-AP10Q.Seq....SGDWWDAELKGRRGKVPSNYLQLIKNAAPPRAGGPPVPTGNRA PTTTTTSGGSTRGGFNNGPSTAPSGRGAAPPSSRGGMAPRGGSVAPPSSRGGIAPRGGIA PRGGMAPRGGMAP

  5. Dicty_cDB: FC-AP01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP01 (Link to dictyBase) - - - Contig-U15092-1 FC-AP01Z (Li...nk to Original site) - - FC-AP01Z 591 - - - - Show FC-AP01 Library FC (Link to library) Clone ID FC-AP01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP01Q.Seq.d/ Representative seq. ID FC-AP...01Z (Link to Original site) Representative DNA sequence >FC-AP01 (FC-AP01Q) /CSM/FC/FC-AP/FC-AP01Q.Seq....EELNISGPLSRNKLKWADFLNLTMNTNHARG HRHGRSPSKIFWRAVRGMLPHKTPRGQAALDNMKVFEGVPAPYDKVKRVVVPSALRVVKL NTTRKYTVLSRLSQE

  6. A study to evaluate therapeutic properties of minerals of manghopir hot spring, karachi

    International Nuclear Information System (INIS)

    Javed, A.; Iqbal, J.; Khan, F.A.; Siddiqui, I.

    2009-01-01

    European balneologists have extensively studied the therapeutic value of mineral water. Mineral springs with different mineral contents are recommended for various therapeutic uses. People have been using geothermal water for bathing and good health for many thousands of years A mineral hot spring has greater than 1000 mg/L (ppm) of naturally dissolved solids. Hot mineral spring water contains elements like calcium, magnesium, sodium, potassium as sulphates, bi- carbonates and chlorides, which are used externally to cure many diseases. Manghopir spring contain 38-84 mg/L calcium, 29-56 mg/L magnesium, 388-555 mg/L sodium, 411-599 mg/L chloride, 186-442 mg/L sulphate, 10-25 mg/L potassium, and 1509-2188 mg/L total dissolved solids while the pH was in the range of 7.2-7.8. The temperature of Manghopir Euthermal hot spring remains constant ranging between 40 to 47 degree C. (author)

  7. RELAP5/MOD3 AP600 problems

    International Nuclear Information System (INIS)

    Riemke, R.A.

    1993-01-01

    RELAP5/MOD3 is a reactor systems analysis code that has been developed jointly by the US Nuclear Regulatory Commission (USNRC) and a consortium consisting of several of the countries and domestic organizations that were members of the International Code Assessment and Applications Program (ICAP). The code is currently being used to simulate transients for the next generation of advanced light water reactors (ALWR's). One particular reactor design is the Westinghouse AP600 pressurized water reactor (PWR), which consists of two hot legs and four cold legs as well as passive emergency core cooling (ECC) systems. Initial calculations with RELAP5/MOD3 indicated that the code was not as robust as RELAP5/MOD2.5 with regard to AP600 calculations. Recent modifications in the areas of condensation wall heat transfer, interfacial heat transfer in the presence of noncondensibles, bubbly flow interfacial heat transfer, and time smoothing of both interfacial drag and interfacial heat transfer have improved the robustness, although more reliability is needed

  8. Structural modules in AP1000 plant design

    International Nuclear Information System (INIS)

    Prasad, N.; Tunon-Sanjur, L.

    2007-01-01

    Structural modules are extensively used in AP1000 plant design. The shop manufacturing of modules components improves the quality and reliability of plant structures. The application of modules has a positive impact on construction schedules, and results in substantial savings in the construction cost. This paper describes various types of structural modules used for AP1000 plant structures. CA structural wall modules are steel plate modules with concrete placed, on or within the module, after module installation. The layout and design of the largest CA wall modules, CA01 and CA20, is described in detail. General discussion of structural floor modules, such as the composite and finned floors, is also included. Steel form CB modules (liners) consist of plate reinforced with angle stiffeners and tee sections. The angles and the tee sections are on the concrete side of the plate. Design of CB20 has been included as an example of CB type modules. Design codes and structural concepts related to module designs are discussed. (authors)

  9. On the Mechanisms for Defeating AP Projectiles

    Science.gov (United States)

    Rosenberg, Z.; Dekel, E.; Ashuach, Y.; Yeshurun, Y.

    The important mechanisms for defeating armor piercing (AP) projectiles are reviewed in this paper. These mechanisms are based on the compressive strength of the target material (its inherent resistance to penetration) and on the asymmetrical forces which it exerts on the threat, through proper geometrical arrangements. We discuss the basic features of the resistance to penetration, starting with the classical analysis of the cavity expansion process in elasto-plastic solids. This property of the target is responsible for the deceleration of hard cored projectiles and for the erosion of long rods, under normal impact conditions. We then discuss the asymmetrical interaction of AP projectiles with inclined plates (metals and polymers) and with ceramic spheres. These asymmetric forces are responsible for their deflection and breakup. Our work combines experimental observations with numerical simulations and engineering models, which enhance the understanding of the various phenomena encountered in these complex situations. This understanding is necessary for optimizing the performance of any armor design against a given threat.

  10. AP1000 shield building: a constructability challenge

    International Nuclear Information System (INIS)

    Di Giuseppe, Giovanni; Bonanno, Domenico

    2010-01-01

    The AP1000 Shield Building, an enhanced structure which surrounds the containment vessel, consists of standard Reinforced Concrete (RC) and composite Steel and Concrete (SC) construction. In the SC module the surface steel plates, (with attached shear studs and angles) filled with concrete, act as the steel reinforcement in concrete. This is a relatively new design technology that required the appropriate use of structural codes, supplemented with information from applicable tests on similar composite steel and concrete construction. Being a newer design concept, existing codes do not provide explicit guidance on SC construction so a review of literature and test data on composite structures similar to AP1000 shield building was done in order to confirm the technical basis for the design. The SC walls, air inlet structure and roof of the Shield Building will be constructed using modular construction practices and then transported to site and lifted into place. These modules, working also as permanent form-work, will be filled with high strength Self- Consolidating Concrete. (SCC) This paper provides a focused and integrated presentation of the enhanced shield building design methodology, testing, constructability and inspection. (authors)

  11. Westinghouse AP1000 advanced passive plant: design features and benefits

    International Nuclear Information System (INIS)

    Walls, S.J.; Cummins, W.E.

    2003-01-01

    The Westinghouse AP1000 Program is aimed at implementing the AP1000 plant to provide a further major improvement in plant economics while maintaining the passive safety advantages established by the AP600. An objective is to retain to the maximum extent possible the plant design of the AP600 so as to retain the licensing basis, cost estimate, construction schedule, modularization scheme, and the detailed design from the AP600 program. Westinghouse and the US Nuclear Regulatory Commission staff have embarked on a program to complete Design Certification for the AP1000 by 2004. A pre-certification review phase was completed in March 2002 and was successful in establishing the applicability of the AP600 test program and AP600 safety analysis codes to the AP1000 Design Certification. On March 28, 2002, Westinghouse submitted to US NRC the AP1000 Design Control Document and Probabilistic Risk Assessment, thereby initiating the formal design certification review process. The results presented in these documents verify the safety performance of the API 000 and conformance with US NRC licensing requirements. Plans are being developed for implementation of a series of AP1000 plants in the US. Key factors in this planning are the economics of AP1000, and the associated business model for licensing, constructing and operating these new plants. Similarly plans are being developed to get the AP1000 design reviewed for use in the UK. Part of this planning has been to examine the AP1000 design relative to anticipated UK safety and licensing issues. (author)

  12. Preparation and characterisation of ammonium plutonium (III) sulphate tetrahydrate NH4Pu(SO4)2.4H2O (Preprint No. AL.05)

    International Nuclear Information System (INIS)

    Iyer, P.N.; Natarajan, P.R.

    1989-01-01

    Ammonium plutonium (III) sulphate tetrahydrate has been prepared and characterised by chemical and thermal analysis. X-ray powder diffraction studies showed the compound to be isostructural to ammonium samarium sulphate tetrahydrate. (author)

  13. Construction Minerals Operations

    Data.gov (United States)

    Department of Homeland Security — This map layer includes construction minerals operations in the United States. The data represent commodities covered by the Minerals Information Team (MIT) of the...

  14. Roles of gibberellic acid and zinc sulphate in increasing size and ...

    African Journals Online (AJOL)

    PRECIOUS

    2009-12-15

    GA3) at 0, 15, 30 and 45 ppm and zinc sulphate at 0, 0.25, 0.5 and 0.75% when fruit were at 70% of their final size in experiments carried out in 2007 season. The effect of GA3 and ZnSO4 treatments on yield and some variables ...

  15. Highly sulphated galactan from Halymenia durvillei (Halymeniales, Rhodophyta), a red seaweed of Madagascar marine coasts.

    Science.gov (United States)

    Fenoradosoa, T A; Delattre, C; Laroche, C; Wadouachi, A; Dulong, V; Picton, L; Andriamadio, P; Michaud, P

    2009-08-01

    Halymenia durvillei is a red seaweed with a great potential as sulphated galactan producer collected in the coastal waters of small island of Madagascar (Nosy-be in Indian Ocean). To elucidate the structure of its polysaccharide, NMR (1H and 13C), FTIR, HPAEC and different colorimetric methods were carried out. It has been shown that this polysaccharide, consisted mainly of galactose, was branched by xylose and galactose in minor amounts. Arabinose and fucose were also detected. This galactan was found highly sulphated (42%, w/w) and pyruvylated (1.8%, w/w). Analysis of glycosidic linkages by CPG-MS and 13C NMR indicated that the polysaccharide has the defining linear backbone of alternating 3-beta-D-galactopyranosyl units and 4-linked alpha-L/D-galactopyranosyl residues. 3,6-Anhydrogalactose units have been also detected in minor quantity. This lambda-carrageenan like polysaccharide has shown original sulphatation patterns with 2-O (26%) or 2/6-O (58%) sulphated 3-linked beta-D-galactopyranosyl units and 6-O (19%) or 2/6-O (47%) 4-linked alpha-L/D-galactopyranosyl residues.

  16. The bioavailability of four zinc oxide sources and zinc sulphate in broiler chickens

    NARCIS (Netherlands)

    Veldkamp, T.; Diepen, van J.T.M.; Bikker, P.

    2014-01-01

    Zinc is an essential trace element for all farm animal species. It is commonly included in animal diets as zinc oxide, zinc sulphate or organically bound zinc. Umicore Zinc Chemicals developed zinc oxide products with different mean particle sizes. Umicore Zinc Chemicals requested Wageningen UR

  17. Urinary sulphate excretion and progression of diabetic nephropathy in Type1 diabetes

    NARCIS (Netherlands)

    Andresdottir, G.; Bakker, S. J. L.; Hansen, H. P.; Parving, H-H; Rossing, P.

    Aims Hydrogen sulphide levels are reduced in many disease states, including diabetes and end-stage renal disease. We aimed to determine whether urinary sulphate excretion, as a proxy for hydrogen sulphide, was associated with progression of diabetic nephropathy. Methods We conducted a post-hoc study

  18. The use of magnesium sulphate for the treatment of severe pre ...

    African Journals Online (AJOL)

    Background : Pre-eclampsia and eclampsia are important causes of maternal and perinatal morbidity and mortality in the developing countries. There is need to provide the most effective management to pre-eclamptic and eclamptic patients. There is now evidence that magnesium sulphate is the most effective ...

  19. Underground Corrosion by Microorganisms Part II : Role of Anaerobic Sulphate Reducing Bacteria-Desulfotomaculum SP

    OpenAIRE

    H. M. Dayal; K. C. Tiwari; Kamlesh Mehta; Mr. Chandrashekhar

    1988-01-01

    During the course of studies on the corrosion causing soil microflora from different geoclimatic regions of India, several strains of anaerobic sulphate reducing bacteria belonging to genus Desulfotomaculum were isolated and characterised. Their corrosive action on mild steel, galvanised iron and structural aluminium, the three main metals of construction of underground structures, have been studied under laboratory conditions.

  20. Roles of gibberellic acid and zinc sulphate in increasing size and ...

    African Journals Online (AJOL)

    GA3) at 0, 15, 30 and 45 ppm and zinc sulphate at 0, 0.25, 0.5 and 0.75% when fruit were at 70% of their final size in experiments carried out in 2007 season. The effect of GA3 and ZnSO4 treatments on yield and some variables related to fruit ...

  1. Increased permeability for polyethylene glycols through skin compromised by sodium lauryl sulphate

    NARCIS (Netherlands)

    Jakasa, Ivone; Verberk, Maarten M.; Bunge, Annette L.; Kruse, Jacob; Kezic, Sanja

    2006-01-01

    In this in vivo human study we assessed the influence of skin damage by sodium lauryl sulphate (SLS) on percutaneous penetration of polyethylene glycols (PEGs) of different molecular weights (MW). Percutaneous penetration of PEGs was determined using tape stripping of the stratum corneum (SC). The

  2. In vivo efficacy study of quinine sulphate in the treatment of ...

    African Journals Online (AJOL)

    Objective: To evaluate clinical, parasitological and haematological responses to quinine sulphate therapy in patients with uncomplicated malaria using the 14-day WHO protocol. Design: Longitudinal study. Setting: The Buea Provincial hospital annex located in South Western Cameroon. Subjects: The study participants ...

  3. Effect of water hyacinth on distribution of sulphate-reducing bacteria ...

    African Journals Online (AJOL)

    The effect of the water hyacinth, Eichhornia crassipes (Mart.) Solms-Laub, on the distribution of populations of sulphate-reducing bacteria (SRB) in sediments from various stations on the shores of Lake Victoria around Mwanza Municipality, Tanzania, was studied. Lactate-utilising SRB were observed to be the dominant ...

  4. Forest land cover continues to exacerbate freshwater acidification despite decline in sulphate emissions

    International Nuclear Information System (INIS)

    Dunford, Robert W.; Donoghue, Daniel N.M.; Burt, Tim P.

    2012-01-01

    Evidence from a multi-date regional-scale analysis of both high-flow and annual-average water quality data from Galloway, south-west Scotland, demonstrates that forest land cover continues to exacerbate freshwater acidification. This is in spite of significant reductions in airborne pollutants. The relationship between freshwater sulphate and forest cover has decreased from 1996 to 2006 indicating a decrease in pollutant scavenging. The relationship between forest cover and freshwater acidity (pH) is, however, still present over the same period, and does not show conclusive signs of having declined. Furthermore, evidence for forest cover contributing to a chlorine bias in marine ion capture suggests that forest scavenging of sea-salts may mean that the forest acidification effect may continue in the absence of anthropogenic pollutant inputs, particularly in coastal areas. - Highlights: ► Forest cover and water chemistry remain linked despite decreased sulphate emissions. ► Forest cover has significant relationships SO 4 2− , Cl − , Na + , pH, ANC and Na:Cl ratio. ► Forest cover: pH relationships shows some evidence of decline 1996–2006. ► Forest cover: freshwater sulphate relationships show evidence of decline 1996–2006. ► Natural forest-mechanisms may exacerbate acidification, particularly sea-salt scavenging. - Relationships between forest land cover and freshwater pH continue to be evident despite declines in anthropogenic pollutant sulphate deposition; sea-salt scavenging may play a role.

  5. Toxicity of copper sulphate on some haematological parameters of a freshwater teleost Cyprinus carpio var. communis

    OpenAIRE

    Ramesh, M.

    2001-01-01

    Haematological changes in a freshwater teleost, Cyprinus carpio var. communis, exposed to acute and sublethal toxicity of copper sulphate were studied. During the acute treatment, erythrocyte and leucocyte count, and haemoglobin content increased, whereas during the sublethal treatment, erythrocyte count and haemoglobin content decreased and leucocyte count increased.

  6. Chlorhexidine mouthwash and sodium lauryl sulphate dentifrice: do they mix effectively or interfere?

    NARCIS (Netherlands)

    Elkerbout, T. A.; Slot, D. E.; Bakker, E. W. P.; van der Weijden, G. A.

    2016-01-01

    What is the effectiveness of a chlorhexidine (CHX) mouthwash used in combination with a sodium lauryl sulphate (SLS) dentifrice on the parameters of plaque and gingivitis? MEDLINE-PubMed, Cochrane-CENTRAL, EMBASE and other electronic databases were searched up to July 2014. The inclusion criteria

  7. Behaviour of Type 316 steel in acidic sulphate solutions at 300-3500C

    International Nuclear Information System (INIS)

    Newman, J.F.

    1987-11-01

    Most cation resin beds in service in CEGB power stations, and particularly those in AGR stations, are regenerated with sulphuric acid. Slippage results in trace levels of sulphate passing into the boilers. Previous work has shown that in once-through boilers, feedwater containing 2 μg kg -1 of sulphate could concentrate at localized dry-out sites to form solutions having from 0.1 to 7 wt% of solute. It has been shown also that if the sulphate was present in an acidic solution and it were to be in contact with Type 316 austentitic superheater steel, then intergranular corrosion and intergranular cracking could occur. Previous data, including some unreported results, are tabulated and discussed. The current work had two main objectives. The first was to extend the previous investigations to examine a wider range of acidic sulphate concentrations (as indicated by calculations on the concentration of solute in feedwater), the influence of environment pH, and the effect of sensitization of specimens. The second objective was primarily concerned with elucidating the causes of scatter in the results. This involved examining the influence of electrode potential, the ageing characteristics of the environment, and the method of applying stress to the specimens. (author)

  8. Greener iodination of arenes using sulphated ceria-zirconia catalysts in polyethylene glycol

    Science.gov (United States)

    An environmentally benign method for the selective monoiodination of diverse aromatic compounds has been developed using reusable sulphated ceria-zirconia under mild conditions. The protocol provides moderate to good yields of aryl iodides in PEG-200 as a greener solvent. The cat...

  9. Study of the extraction of cobalt(II) from sulphate medium by using ...

    African Journals Online (AJOL)

    In this work we have first investigated the extraction of cobalt(II) from sulphate medium using capric acid dissolved in chloroform and then the effect of other diluents on the extraction process at 25°C. This study aims to understand the behaviour followed by this metal or, in other words, find its stoichiometry at the end of the ...

  10. Sulphur-oxidising and Sulphate-reducing Communities in Brazilian Mangrove Sediments

    NARCIS (Netherlands)

    Varon-Lopez, Maryeimy; Dias, A.C.F; Fasanella, C.C.; Durrer, A.; Melo, I.S.; Kuramae, E.E.; Andreote, F.D.

    2014-01-01

    Mangrove soils are anaerobic environments rich in sulphate and organic matter. Although the sulphur cycle is one of the major actors in this ecosystem, little is known regarding the sulphur bacteria communities in mangrove soils. We investigated the abundance, composition and diversity of

  11. Does sulphate enrichment promote the expansion of Typha domingensis (cattail) in the Florida Everglades?

    Science.gov (United States)

    Li, S.; Mendelssohn, I.A.; Hao, Chen; Orem, W.H.

    2009-01-01

    1. The expansion of Typha domingensis into areas once dominated by Cladium jamaicense in the Florida Everglades has been attributed to altered hydrology and phosphorus enrichment, although increased concentrations of sulphate and phosphorus often coincide. The potential importance of hydrogen sulphide produced from sulphate in the expansion of Typha has received little attention. The present study aimed to quantify the comparative growth and photosynthetic responses of Cladium and Typha to sulphate/sulphide. 2. Laboratory experiments showed that Cladium is less tolerant of sulphide than Typha. Cladium was adversely affected at sulphide concentrations of approximately 0.22 mm, while Typha continued to grow well and appeared healthy up to 0.69 mm sulphide. 3. Experiments in field mesocosms provided strong support for species-specific differences in physiology and growth. Regardless of interstitial sulphide concentrations attained, Typha grew faster and had a higher photosynthetic capacity than Cladium. However, sulphide concentrations in the mesocosms reached only 0.18 mm which, based on the hydroponic study, was insufficient to affect the growth or photosynthetic responses of either species. Nevertheless, the upper range of sulphide (0.25-0.375 mm) in Everglades' soil is high enough, based on our results, to impact Cladium but not Typha. 4. This research supports the hypothesis that sulphide accumulation could affect plant species differentially and modify species composition. Consequently, the role of sulphate loading should be considered, in conjunction with hydroperiod, phosphorus availability and disturbances, in developing future management plans for the Everglades. ?? 2009 Blackwell Publishing Ltd.

  12. Reduction of sulphate content from coated alumina SO 2+ 4 Al 2 O 3 ...

    African Journals Online (AJOL)

    The aim of this study was to reduce the anion (sulphate) content from such· oxide layer wing spillover phenomena. Three catalysts were used for this purpose as a spillover hydrogen generator. From the three used catalysts PdlAIPJ is the only catalyst that can reduce anion from this oxide layer:. The result showed the ...

  13. The feasibility of a permeable reactive barrier to treat acidic sulphate ...

    African Journals Online (AJOL)

    2006-04-02

    Apr 2, 2006 ... The water quality is acidic and is contaminated with respect to nitrate, sulphate, aluminium, fluoride and ... that the long-term performance would be inhibited by clogging and armouring by aluminium and manganese precipitates. ..... excess of concentration in brackets represent health risks. (DWAF, 1996).

  14. Synthesis and localization of two sulphated glycoproteins associated with basement membranes and the extracellular matrix

    DEFF Research Database (Denmark)

    Hogan, B L; Taylor, A; Kurkinen, M

    1982-01-01

    interactions and are not precursors or products of each other. They contain asparagine-linked oligosaccharides, but these are not the exclusive sites of sulphate labeling. Antiserum raised against the Mr 150,000 sgp C of Reichert's membranes has been used in an immunohistochemical analysis of rat skin...

  15. Chlorhexidine mouthwash and sodium lauryl sulphate dentifrice: do they mix effectively or interfere?

    NARCIS (Netherlands)

    Elkerbout, T.A.; Slot, D.E.; Bakker, E.W.P.; Van der Weijden, G.A.

    2016-01-01

    Focused question: What is the effectiveness of a chlorhexidine (CHX) mouthwash used in combination with a sodium lauryl sulphate (SLS) dentifrice on the parameters of plaque and gingivitis? Material and methods: MEDLINE-PubMed, Cochrane-CENTRAL, EMBASE and other electronic databases were searched up

  16. Sulphation of CaO-Based Sorbent Modified in CO2 Looping Cycles

    Science.gov (United States)

    Manovic, Vasilije; Anthony, Edward J.; Loncarevic, Davor

    CaO-based looping cycles for CO2 capture at high temperatures are based on cyclical carbonation of CaO and regeneration of CaCO3. The main limitation of natural sorbents is the loss of carrying capacity with increasing numbers of reaction cycles, resulting in spent sorbent ballast. Use of spent sorbent from CO2 looping cycles for SO2 capture is a possible solution investigated in this study. Three limestones were investigated: Kelly Rock (Canada), La Blanca (Spain) and Katowice (Poland). Carbonation/calcination cycles were performed in a tube furnace with original limestones and samples thermally pretreated for different times (i.e., sintered). The spent sorbent samples were sulphated in a thermogravimetric analyzer. Changes in the resulting pore structure were then investigated using mercury porosimetry. Final conversions of both spent and pretreated sorbents after longer sulphation times were comparable or higher than those observed for the original sorbents. Maximum sulphation levels strongly depend on sorbent porosity and pore surface area. The shrinkage of sorbent particles during calcination/cycling resulted in a loss of sorbent porosity (≤48%), which corresponds to maximum sulphation levels ˜55% for spent Kelly Rock and Katowice. However, this is ˜10% higher than for the original samples. By contrast, La Blanca limestone had more pronounced particle shrinkage during pretreatment and cycling, leading to lower porosity, Katowice samples final conversions are determined by the total pore volume available for the bulky CaSO4 product.

  17. Composition and structure of an iron-bearing, layered double hydroxide (LDH) - Green rust sodium sulphate

    DEFF Research Database (Denmark)

    Christiansen, B. C.; Balic-Zunic, T.; Petit, P. O.

    2009-01-01

    Mixed-valent Fe(II),Fe(III)-layered hydroxide, known as green rust, was synthesized from slightly basic, sodium sulphate solutions in an oxygen-free glove box. Solution conditions were monitored with pH and Eh electrodes and optimized to ensure a pure sulphate green-rust phase. The solid...... was characterised using Mossbauer spectroscopy, X-ray diffraction, scanning electron microscopy and atomic force microscopy. The composition of the solution from which the green rust precipitated was established by mass and absorption spectroscopy. The sulphate form of green rust is composed of brucite-like layers......(III)(3)(SO4)(2)(OH)(18)center dot 12H(2)O, space group P-3, a = 9.528(6) angstrom, c = 10.968(8) angstrom and Z = 1. Green rust sodium sulphate, GR(Na,SO4) crystallizes in thin, hexagonal plates. Particles range from less than 50 nm to 2 mu m in diameter and are 40 nm thick or less. The material is redox...

  18. The use of magnesium sulphate (MgSO 4 ) for seizure prophylaxis ...

    African Journals Online (AJOL)

    Background: Magnesium sulphate use in the prevention of seizures resulting from preeclampsia and eclampsia is widely accepted. However, several protocols exist worldwide. Aim: To determine serum magnesium levels and associated clinical outcomes in severe pre-eclamptic and eclamptic women treated with ...

  19. Should Magnesium Sulphate Prophylaxis be Used in all Cases of Severe Preeclampsia?

    Directory of Open Access Journals (Sweden)

    Sohini Bhattacharya,

    2011-01-01

    Full Text Available A case control study, undertaken in the department of Obstetrics and Gynecology in a tertiary referral centre, was designed to administer standard dose of magnesium sulphate to 50 randomly selected severely preeclamptic women in labor (Group 1. 48 women who formed the control group did not receive the drug (Group 2. The admission – delivery interval, rate of Cesarean section showed no statistically significant difference. Four patients developed convulsions in Group 1 in contrast to twelve patients in Group 2. Efficacy of magnesium sulphate at preventing eclampsia was calculated as 68%. Mild respiratory depression occurred in two cases and oliguria in eight cases in Group 1. Both the conditions improved on suspending further doses of magnesium sulphate. No patient had post partum haemorrhage in Group 1 although 4% patients had it in Group 2. Neonatal outcome was comparable in both the groups. Hence magnesium sulphate may be regarded as a fairly safe and effective prophylactic agent for eclampsia when used in severe preeclampsia in labor.

  20. Aluminum-contaminant transport by surface runoff and bypass flow from an acid sulphate soil

    NARCIS (Netherlands)

    Minh, L.Q.; Tuong, T.P.; Mensvoort, van M.E.F.; Bouma, J.

    2002-01-01

    Quantifying the process and the amount of acid-contaminant released to the surroundings is important in assessing the environmental hazards associated with reclaiming acid sulphate soils (ASS). The roles of surface runoff and bypass flow (i.e. the rapid downward flow of free water along macropores

  1. Mineral commodity summaries 2015

    Science.gov (United States)

    ,

    2015-01-01

    Each chapter of the 2015 edition of the U.S. Geological Survey (USGS) Mineral Commodity Summaries (MCS) includes information on events, trends, and issues for each mineral commodity as well as discussions and tabular presentations on domestic industry structure, Government programs, tariffs, 5-year salient statistics, and world production and resources. The MCS is the earliest comprehensive source of 2014 mineral production data for the world. More than 90 individual minerals and materials are covered by two-page synopses.

  2. Sulphatising roasting of a Greenlandic uranium ore, reactivity of minerals and recovery

    International Nuclear Information System (INIS)

    Gamborg Hansen, J.K.

    1977-03-01

    Uranium in the lujavrite ore from Kvanefjeld, South Greenland, can be solubilised by sulphatising roasting at 700degC. The reactivity of various lujavrite minerals in the roasting process and the mechanism of the reaction were investigated by X-ray diffraction, optical microscopy, electron microprobe, thermal analysis, Moessbauer and infrared spectroscopy. Soluble sulphates are formed on the surface of the grains; an outer zone of the grains is transformed; usually a core remains unchanged. Variations in uranium recovery can be explained by variations in the contents of the uranium-bearing minerals, steenstrupine and uranium-containing pigmentary material (altered Zr containing silicate minerals), and in the degree of alteration os steenstrupine. Characterization of these minerals required many qualitative and a few quantitative electron microprobe analyses. (author)

  3. Dicty_cDB: FC-AP22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP22 (Link to dictyBase) - G24045 DDB0232387 Contig-U15141-1 FC-AP...22F (Link to Original site) FC-AP22F 317 - - - - - - Show FC-AP22 Library FC (Link to library) Clone ID FC-AP...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP22Q.Se...q.d/ Representative seq. ID FC-AP22F (Link to Original site) Representative DNA sequence >FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP...KKKKKKK Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP

  4. Dicty_cDB: FC-AP21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP21 (Link to dictyBase) - - - Contig-U15099-1 FC-AP21Z (Li...nk to Original site) - - FC-AP21Z 511 - - - - Show FC-AP21 Library FC (Link to library) Clone ID FC-AP21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP21Q.Seq.d/ Representative seq. ID FC-AP...21Z (Link to Original site) Representative DNA sequence >FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP21Q.Seq....14Q.Seq.d/ 1013 0.0 SLE553 (SLE553Q) /CSM/SL/SLE5-C/SLE553Q.Seq.d/ 1013 0.0 FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP

  5. Dicty_cDB: FC-AP24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP24 (Link to dictyBase) - - - Contig-U16528-1 FC-AP24F (Li...nk to Original site) FC-AP24F 525 - - - - - - Show FC-AP24 Library FC (Link to library) Clone ID FC-AP24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP24Q.Seq.d/ Representative seq. ID FC-AP...24F (Link to Original site) Representative DNA sequence >FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq....C-BE24Q.Seq.d/ 1041 0.0 FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq.d/ 1041 0.0

  6. Control units for APS power supplies

    International Nuclear Information System (INIS)

    Despe, O.D.; Saunders, C.; McGhee, D.G.

    1993-01-01

    The Advanced Photon Source (APS) accelerator facility is made up of five major subsystems in addition to the linac: the positron accumulator ring (PAR), low energy transport (LET), booster synchrotron (SYNCH), high energy transport (HET), the storage ring (SR). Each subsystem has multiple magnet power supply combinations, some requiring multiple of operation. These magnet and power supply combinations computer controlled and monitored. The power supply control unit (PSCU) is the first layer of hardware and software above the power supply itself and is described in this paper. The description includes the basic philosophy for each of operation and how it influences the topology and of implementing control. The design of the analog reference blocks (ARBs) influenced the design of other custom functions well as the feedback controls for vibration and other dynamic corrections. The command set supported by the PSCU is discussed

  7. Investigation of APS PAR Vertical Beam Instability

    CERN Document Server

    Yao, Chihyuan; Sereno, Nicholas S; Yang Bing Xin

    2005-01-01

    The Advanced Photon Source (APS) particle accumulator ring (PAR) is a 325-MeV storage ring that collects and compresses linac pulse trains into a single bunch for booster injection. A vertical beam instability has been observed when only a single linac bunch is injected and the total beam charge is from 0.15 to 0.7 nC. The instability starts about 80 ms after the injection, lasts about 160 ms, and is highly reproducible. We performed spectral measurement and time-resolved imaging with both a gated-intensified camera and a streak camera in order to characterize this instability. Initial analysis of the data indicates that the instability is due to ion trapping. A stable lattice was established as result of the investigation. This report summarizes the experimental results and gives some preliminary analysis.

  8. Quantitation and identification of methanogens and sulphate reducers in Olkiluoto groundwater

    International Nuclear Information System (INIS)

    Bomberg, M.; Nyyssoenen, M.; Itaevaara, M.

    2010-08-01

    The GEOFUNC Project focuses on the microbiology connected to safety and risk assessment of the final disposal of high radioactive nuclear waste. Methanogenic archaea and sulphate reducing bacteria are significant groups of microorganisms in anaerobic environments, and are of crucial concern for the safe long term storage of nuclear waste in deep bedrock. The sulphate reducing bacteria are able to produce sulphide which may cause corrosion of the copper in the radioactive waste storage capsules. Methanogens, on the other hand, may produce quantities of methane from various organic carbon compounds, CO 2 and H 2 . Methane may both serve as carbon source for methanotrophic microbial groups, and may also cause mobilization of radionuclides, as a result of gas discharge through fractures in the bedrock. The transition zones between the sulphate rich and methane rich waters are locations for microbial processes where the methane may serve as carbon source for sulphate reducing bacteria, which in turn would produce corrosive sulphides. It has been estimated that only 1-10 % of all the microorganisms present in the environment can be isolated and cultivated. Uncultured microorganisms can be identified and their numbers in the environment quantified by identification of specific marker genes that are essential for their functions by use of molecular methods. Methanogens, for example, can be identified by their genes for methyl coenzyme M reductase (mcrA), which is an essential enzyme involved in the production of methane. The mcrA is specifically present only in methanogenic archaea. Sulphate reducers are identified by their dissimilatory sulphite reductase genes (dsrB), which are present in and essential for all microorganisms performing dissimilatory sulphate reducing. In the GEOFUNC project, a quantitative PCR method (qPCR) was developed for the detection of methanogens and sulphate reducers. This method is based on specific quantitative detection of marker genes

  9. Low Earth orbit assessment of proton anisotropy using AP8 and AP9 trapped proton models.

    Science.gov (United States)

    Badavi, Francis F; Walker, Steven A; Santos Koos, Lindsey M

    2015-04-01

    The completion of the International Space Station (ISS) in 2011 has provided the space research community with an ideal evaluation and testing facility for future long duration human activities in space. Ionized and secondary neutral particles radiation measurements inside ISS form the ideal tool for validation of radiation environmental models, nuclear reaction cross sections and transport codes. Studies using thermo-luminescent detectors (TLD), tissue equivalent proportional counter (TPEC), and computer aided design (CAD) models of early ISS configurations confirmed that, as input, computational dosimetry at low Earth orbit (LEO) requires an environmental model with directional (anisotropic) capability to properly describe the exposure of trapped protons within ISS. At LEO, ISS encounters exposure from trapped electrons, protons and geomagnetically attenuated galactic cosmic rays (GCR). For short duration studies at LEO, one can ignore trapped electrons and ever present GCR exposure contributions during quiet times. However, within the trapped proton field, a challenge arises from properly estimating the amount of proton exposure acquired. There exist a number of models to define the intensity of trapped particles. Among the established trapped models are the historic AE8/AP8, dating back to the 1980s and the recently released AE9/AP9/SPM. Since at LEO electrons have minimal exposure contribution to ISS, this work ignores the AE8 and AE9 components of the models and couples a measurement derived anisotropic trapped proton formalism to omnidirectional output from the AP8 and AP9 models, allowing the assessment of the differences between the two proton models. The assessment is done at a target point within the ISS-11A configuration (circa 2003) crew quarter (CQ) of Russian Zvezda service module (SM), during its ascending and descending nodes passes through the south Atlantic anomaly (SAA). The anisotropic formalism incorporates the contributions of proton narrow

  10. MR imaging during arterial-portography (MR-AP) in the detection of hepatic tumor. Comparison with CT-AP

    International Nuclear Information System (INIS)

    Kajiya, Yoshiki; Nakajo, Masayuki; Miyazono, Nobuaki; Kajiya, Yoriko; Fujiyoshi, Fumito; Ichinari, Naohide

    1997-01-01

    This study was undertaken to compare the detection rate of hepatic space occupying lesion (SOLs) between computed tomography during arterial portography (CT-AP) and magnetic resonance imaging during arterial portography (MR-AP) and the differences in time intensity curve on MR-AP between HCC, metastatic tumor, FNH, and hemangioma. We performed CT-AP and MR-AP in 17 patients including 14 cases of HCC and one each of metastasis, FNH, and hemangioma. MR-AP was performed by Turbo-FLASH sequence. There was no statistically significant difference between CT-AP and MR-AP in detecting satellite lesions in terms of smallest diameter and number of flow defects (p>0.05). Hemangioma showed rapid enhancement after the first pass and, consequently, the same enhancement as the hepatic parenchyma. MR-AP was comparable to CT-AP in the detection of hepatic SOLs. Hemangioma showed an enhancement pattern different from those of HCC, metastatic tumor, and FNH, which showed patterns similar to each other. (author)

  11. Clinical manifestations of antiphospholipid syndrome (APS) with and without antiphospholipid antibodies (the so-called 'seronegative APS').

    Science.gov (United States)

    Rodriguez-Garcia, Jose Luis; Bertolaccini, Maria Laura; Cuadrado, Maria Jose; Sanna, Giovanni; Ateka-Barrutia, Oier; Khamashta, Munther A

    2012-02-01

    Although the medical literature currently provides a growing number of isolated case reports of patients with clinically well-defined antiphospholipid syndrome (APS) and persistently negative antiphospholipid antibodies (aPL), there are no studies including a series of patients addressing the clinical features of this condition. The authors assessed clinical manifestations of APS in 154 patients: 87 patients with seropositive APS and 67 patients with thrombosis and/or pregnancy morbidity persistently negative for aPL and presenting with at least two additional non-criteria manifestations of APS (the so-called 'seronegative APS', SN-APS). Patients were interviewed at the time of recruitment, and a retrospective file review was carried out. There were no significant differences in the frequency of thrombotic events or obstetric morbidity in patients with SN-APS versus patients with seropositive APS: deep vein thrombosis (31.4% vs 31.0%), pulmonary embolism (23.8% vs 28.7%), stroke (14.9% vs 17.2%), transient ischaemic attack (11.9% vs 10.3%), early spontaneous abortions (67.1% vs 52.1%), stillbirths (62.5% vs 59.4%), prematurity (28.1% vs 21.7%) or pre-eclampsia (28.1% vs 23.1%). Classic and SN-APS patients show similar clinical profiles. The results suggest that clinical management in patients with APS should not be based only on the presence of conventional aPL.

  12. Radiation characteristics of scintillator coupled CMOS APS for radiography conditions

    International Nuclear Information System (INIS)

    Kim, Kwang Hyun; Kim, Soongpyung; Kang, Dong-Won; Kim, Dong-Kie

    2006-01-01

    Under industrial radiography conditions, we analyzed short-term radiation characteristics of scintillator coupled CMOS APS (hereinafter SC CMOS APS). By means of experimentation, the contribution of the transmitted X-ray through the scintillator to the properties of the CMOS APS and the afterimage, generated in the acquired image even at low dose condition, were investigated. To see the transmitted X-ray effects on the CMOS APS, Fein focus TM X-ray machine, two scintillators of Lanex TM Fine and Regular, and two CMOS APS array of RadEye TM were used under the conditions of 50 kV p /1 mAs and 100 kV p /1 mAs. By measuring the transmitted X-ray on signal and Noise Power Spectrum, we analytically examined the generation mechanism of the afterimage, based on dark signal or dark current increase in the sensor, and explained the afterimage in the SC CMOS APS

  13. Dose-response testing with nickel sulphate using the TRUE test in nickel-sensitive individuals. Multiple nickel sulphate patch-test reactions do not cause an 'angry back'

    DEFF Research Database (Denmark)

    Andersen, Klaus Ejner; Lidén, C; Hansen, J

    1993-01-01

    The aim of this study was to employ the TRUE test assay to confirm the presence or absence of the 'angry back' phenomenon, i.e. that a strong positive patch-test reaction heightens adjacent patch-test response. In addition, we wished to establish the dose-response relationship for nickel sulphate...... back' phenomenon was not apparent in this study, as the spill-over effect was not statistically significant. Strong reactions to high concentrations of nickel sulphate did not enhance the response to adjacent lower concentrations of nickel sulphate....

  14. Comparison of the effects of the K(+)-channel openers cromakalim and minoxidil sulphate on vascular smooth muscle.

    Science.gov (United States)

    Wickenden, A. D.; Grimwood, S.; Grant, T. L.; Todd, M. H.

    1991-01-01

    1 The actions of the potassium channel openers, cromakalim and minoxidil sulphate, were compared in a range of isolated blood vessel preparations. 2 Cromakalim and minoxidil sulphate inhibited spontaneous mechanical activity of the guinea-pig portal vein and relaxed the noradrenaline precontracted rat aorta with similar potency. In contrast, minoxidil sulphate was less potent than cromakalim in inhibiting spontaneous activity in the rat portal vein and was essentially inactive in the noradrenaline precontracted rat mesenteric artery and rabbit aorta. 3 Minoxidil sulphate did not antagonize the effects of cromakalim in the rabbit aorta indicating it was not acting as a partial 'agonist'. 4 Charybdotoxin, noxiustoxin and rubidium failed to discriminate between cromakalim and minoxidil sulphate indicating that the apparently selective effects of minoxidil sulphate were not mediated by either Ca(2+)-activated potassium channels, delayed rectifiers or rubidium impermeable potassium channels. 5 Glibenclamide antagonized the effects of cromakalim in an apparently competitive manner whereas the effects of minoxidil sulphate were antagonized in a non-competitive manner. The involvement of subtypes of ATP-sensitive potassium channels is discussed. PMID:1878752

  15. Auricular Chondritis in a Postpartum Flare of SLE and APS

    Directory of Open Access Journals (Sweden)

    Elodie Ponce

    2014-10-01

    Full Text Available Introduction: Auricular chondritis has been occasionally described in patients with systemic lupus erythematosus (SLE and antiphospholipid syndrome (APS. Materials and methods: We report the case of a woman with a previous history of APS who presented with auricular chondritis with onset of SLE symptoms during the postpartum period. Conclusion: SLE and APS should be taken into consideration in the differential diagnosis of auricular chondritis.

  16. Essence and characteristics of the Westinghouse technology AP1000

    International Nuclear Information System (INIS)

    Llovet, Ricardo

    2014-01-01

    The AP1000 nuclear power plant can place the reactor in a Safe Shutdown Condition within the first 72 hours of a Station Blackout, without the use of AC power or operator action •With some operator action after 3 days, the AP1000 nuclear power plant continues to maintain reactor core cooling and Spent Fuel Pool cooling indefinitely •The AP1000 nuclear power plant has superior coping capabilities as well as significantly reduced risk for core damage

  17. FRANX. Application for analysis and quantification of the APS fire

    International Nuclear Information System (INIS)

    Snchez, A.; Osorio, F.; Ontoso, N.

    2014-01-01

    The FRANX application has been developed by EPRI within the Risk and Reliability User Group in order to facilitate the process of quantification and updating APS Fire (also covers floods and earthquakes). By applying fire scenarios are quantified in the central integrating the tasks performed during the APS fire. This paper describes the main features of the program to allow quantification of an APS Fire. (Author)

  18. Chelated minerals for poultry

    Directory of Open Access Journals (Sweden)

    SL Vieira

    2008-06-01

    Full Text Available Organic minerals have been subject of an increasing number of investigations recently. These compounds can be considered the most significant event regarding commercial forms of minerals targeting animal supplementation in the last decades. Minerals, especially metals, are usually supplemented in poultry feeds using cheap saline sources and have never required a lot of attention in terms of quality. On the other hand, definitions of organic minerals are very broad and frequently lead to confusion when decision-making becomes necessary. Organic minerals include any mineral bound to organic compounds, regardless of the type of existing bond between mineral and organic molecules. Proteins and carbohydrates are the most frequent candidates in organic mineral combinations. Organic fraction size and bond type are not limitations in organic mineral definition; however, essential metals (Cu, Fe, Zn, and Mn can form coordinated bonds, which are stable in intestinal lumen. Metals bound to organic ligands by coordinated bonds can dissociate within animal metabolism whereas real covalent bonds cannot. Chelated minerals are molecules that have a metal bound to an organic ligand through coordinated bonds; but many organic minerals are not chelates or are not even bound through coordinated bonds. Utilization of organic minerals is largely dependent on the ligand; therefore, amino acids and other small molecules with facilitated access to the enterocyte are supposed to be better utilized by animals. Organic minerals with ligands presenting long chains may require digestion prior to absorption. After absorption, organic minerals may present physiological effects, which improve specific metabolic responses, such as the immune response. Many studies have demonstrated the benefits of metal-amino acid chelates on animal metabolism, but the detection positive effects on live performance is less consistent.

  19. AP-2ε Expression in Developing Retina: Contributing to the Molecular Diversity of Amacrine Cells.

    Science.gov (United States)

    Jain, Saket; Glubrecht, Darryl D; Germain, Devon R; Moser, Markus; Godbout, Roseline

    2018-02-21

    AP-2 transcription factors play important roles in the regulation of gene expression during development. Four of the five members of the AP-2 family (AP-2α, AP-2β, AP-2γ and AP-2δ) have previously been shown to be expressed in developing retina. Mouse knockouts have revealed roles for AP-2α, AP-2β and AP-2δ in retinal cell specification and function. Here, we show that the fifth member of the AP-2 family, AP-2ε, is also expressed in amacrine cells in developing mammalian and chicken retina. Our data indicate that there are considerably fewer AP-2ε-positive cells in the developing mouse retina compared to AP-2α, AP-2β and AP-2γ-positive cells, suggesting a specialized role for AP-2ε in a subset of amacrine cells. AP-2ε, which is restricted to the GABAergic amacrine lineage, is most commonly co-expressed with AP-2α and AP-2β, especially at early stages of retinal development. Co-expression of AP-2ε and AP-2γ increases with differentiation. Analysis of previously published Drop-seq data from single retinal cells supports co-expression of multiple AP-2s in the same cell. Since AP-2s bind to their target sequences as either homodimers or heterodimers, our work suggests spatially- and temporally-coordinated roles for combinations of AP-2 transcription factors in amacrine cells during retinal development.

  20. Determinants of magnesium sulphate use in women hospitalized at <29 weeks with severe or non-severe pre-eclampsia.

    Directory of Open Access Journals (Sweden)

    Dane A De Silva

    Full Text Available Magnesium sulphate is recommended by international guidelines to prevent eclampsia among women with pre-eclampsia, especially when it is severe, but fewer than 70% of such women receive magnesium sulphate. We aimed to identify variables that prompt Canadian physicians to administer magnesium sulphate to women with pre-eclampsia.Data were used from the Canadian Perinatal Network (2005-11 of women hospitalized at <29 weeks' who were thought to be at high risk of delivery due to pre-eclampsia (using broad Canadian definition. Unadjusted analyses of relative risks were estimated directly and population attributable risk percent (PAR% calculated to identify variables associated with magnesium sulphate use. A multivariable model was created and a generalized estimating equation was used to estimate the adjusted RR that explained magnesium sulphate use in pre-eclampsia. The adjusted PAR% was estimated by bootstrapping.Of 631 women with pre-eclampsia, 174 (30.1% had severe pre-eclampsia, of whom 131 (75.3% received magnesium sulphate. 457 (69.9% women had non-severe pre-eclamspia, of whom 291 (63.7% received magnesium sulphate. Use of magnesium sulphate among women with pre-eclampsia could be attributed to the following clinical factors (PAR%: delivery for 'adverse conditions' (48.7%, severe hypertension (21.9%, receipt of antenatal corticosteroids (20.0%, maternal transport prior to delivery (9.9%, heavy proteinuria (7.8%, and interventionist care (3.4%.Clinicians are more likely to administer magnesium sulphate for eclampsia prophylaxis in the presence of more severe maternal clinical features, in addition to concomitant antenatal corticosteroid administration, and shorter admission to delivery periods related to transport from another institution or plans for interventionist care.

  1. Alternative method of portable irradiation of manganese sulphate solution by an plutonium-beryllium source for manganese sulphate bath efficiency measurements

    International Nuclear Information System (INIS)

    Silva, Fellipe Souza da; Martins, Marcelo Marques; Pereira, Walsan Wagner

    2016-01-01

    This study intends to create an alternative irradiation system from a Plutonium-Beryllium source for manganese sulphate solution using the Monte Carlo code. Thus seeking to eliminate the issue of institutes that do not have reactors or particle accelerators in its infrastructure, in order to optimize and provide independence for them to carry out efficiency measurements of MnSO 4 solution in their own locality. The Monte Carlo simulations defined the technical features of this new system so that the solution reaches the maximum neutron capture by manganese in solution. (author)

  2. ONLINE MINIMIZATION OF VERTICAL BEAM SIZES AT APS

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Yipeng

    2017-06-25

    In this paper, online minimization of vertical beam sizes along the APS (Advanced Photon Source) storage ring is presented. A genetic algorithm (GA) was developed and employed for the online optimization in the APS storage ring. A total of 59 families of skew quadrupole magnets were employed as knobs to adjust the coupling and the vertical dispersion in the APS storage ring. Starting from initially zero current skew quadrupoles, small vertical beam sizes along the APS storage ring were achieved in a short optimization time of one hour. The optimization results from this method are briefly compared with the one from LOCO (Linear Optics from Closed Orbits) response matrix correction.

  3. The Ped-APS Registry: the antiphospholipid syndrome in childhood.

    Science.gov (United States)

    Avcin, T; Cimaz, R; Rozman, B

    2009-09-01

    In recent years, antiphospholipid syndrome (APS) has been increasingly recognised in various paediatric autoimmune and nonautoimmune diseases, but the relatively low prevalence and heterogeneity of APS in childhood made it very difficult to study in a systematic way. The project of an international registry of paediatric patients with APS (the Ped-APS Registry) was initiated in 2004 to foster and conduct multicentre, controlled studies with large number of paediatric APS patients. The Ped-APS Registry is organised as a collaborative project of the European Forum on Antiphospholipid Antibodies and Juvenile Systemic Lupus Erythematosus Working Group of the Paediatric Rheumatology European Society. Currently, it documents a standardised clinical, laboratory and therapeutic data of 133 children with antiphospholipid antibodies (aPL)-related thrombosis from 14 countries. The priority projects for future research of the Ped-APS Registry include prospective enrollment of new patients with aPL-related thrombosis, assessment of differences between the paediatric and adult APS, evaluation of proinflammatory genotype as a risk factor for APS manifestations in childhood and evaluation of patients with isolated nonthrombotic aPL-related manifestations.

  4. Project W-211, initial tank retrieval systems, description of operations for 241-AP-102 and 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-02-25

    The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability.

  5. Dicty_cDB: FC-AP13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP13 (Link to dictyBase) - - - Contig-U15374-1 FC-AP13P (Li...nk to Original site) FC-AP13F 550 FC-AP13Z 184 FC-AP13P 734 - - Show FC-AP13 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP13Q.Seq.d/ Representative seq. ID FC-AP...13P (Link to Original site) Representative DNA sequence >FC-AP13 (FC-AP13Q) /CSM/FC/FC-AP/FC-AP...KKRKLNILIIII*fnnhqvmekkikkkiknkkn f*k Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP

  6. Magnetic susceptibilities of minerals

    Science.gov (United States)

    Rosenblum, Sam; Brownfield, I.K.

    2000-01-01

    Magnetic separation of minerals is a topic that is seldom reported in the literature for two reasons. First, separation data generally are byproducts of other projects; and second, this study requires a large amount of patience and is unusually tedious. Indeed, we suspect that most minerals probably are never investigated for this property. These data are timesaving for mineralogists who concentrate mono-mineralic fractions for chemical analysis, age dating, and for other purposes. The data can certainly be used in the ore-beneficiation industries. In some instances, magnetic-susceptibility data may help in mineral identification, where other information is insufficient. In past studies of magnetic separation of minerals, (Gaudin and Spedden, 1943; Tille and Kirkpatrick, 1956; Rosenblum, 1958; Rubinstein and others, 1958; Flinter, 1959; Hess, 1959; Baker, 1962; Meric and Peyre, 1963; Rojas and others, 1965; and Duchesne, 1966), the emphasis has been on the ferromagnetic and paramagnetic ranges of extraction. For readers interested in the history of magnetic separation of minerals, Krumbein and Pettijohn (1938, p. 344-346) indicated nine references back to 1848. The primary purpose of this paper is to report the magnetic-susceptibility data on as many minerals as possible, similar to tables of hardness, specific gravity, refractive indices, and other basic physical properties of minerals. A secondary purpose is to demonstrate that the total and best extraction ranges are influenced by the chemistry of the minerals. The following notes are offered to help avoid problems in separating a desired mineral concentrate from mixtures of mineral grains.

  7. AIRE variations in Addison's disease and autoimmune polyendocrine syndromes (APS): partial gene deletions contribute to APS I.

    Science.gov (United States)

    Bøe Wolff, A S; Oftedal, B; Johansson, S; Bruland, O; Løvås, K; Meager, A; Pedersen, C; Husebye, E S; Knappskog, P M

    2008-03-01

    Autoimmune Addison's disease (AAD) is often associated with other components in autoimmune polyendocrine syndromes (APS). Whereas APS I is caused by mutations in the AIRE gene, the susceptibility genes for AAD and APS II are unclear. In the present study, we investigated whether polymorphisms or copy number variations in the AIRE gene were associated with AAD and APS II. First, nine SNPs in the AIRE gene were analyzed in 311 patients with AAD and APS II and 521 healthy controls, identifying no associated risk. Second, in a subgroup of 25 of these patients, AIRE sequencing revealed three novel polymorphisms. Finally, the AIRE copy number was determined by duplex quantitative PCR in 14 patients with APS I, 161 patients with AAD and APS II and in 39 healthy subjects. In two Scandinavian APS I patients previously reported to be homozygous for common AIRE mutations, we identified large deletions of the AIRE gene covering at least exon 2 to exon 8. We conclude that polymorphisms in the AIRE gene are not associated with AAD and APS II. We further suggest that DNA analysis of the parents of patients found to be homozygous for mutations in AIRE, always should be performed.

  8. High Pressure Reverse Flow APS Engine

    Science.gov (United States)

    Senneff, J. M.

    1972-01-01

    A design and test demonstration effort was undertaken to evaluate the concept of the reverse flow engine for the APS engine application. The 1500 lb (6672 N) thrust engine was designed to operate on gaseous hydrogen and gaseous oxygen propellants at a mixture ratio of 4 and to achieve the objective performance of 435 sec (4266 Nsec/kg) specific impulse. Superimposed durability requirements called for a million-cycle capability with 50 hours duration. The program was undertaken as a series of tasks including the initial preliminary design, design of critical test components and finally, the design and demonstration of an altitude engine which could be used interchangeably to examine operating parameters as well as to demonstrate the capability of the concept. The program results are reported with data to indicate that all of the program objectives were met or exceeded within the course of testing on the program. The analysis effort undertaken is also reported in detail and supplemented with test data in some cases where prior definitions could not be made. The results are contained of these analyses as well as the test results conducted throughout the course of the program. Finally, the test data and analytical results were combined to allow recommendations for a flight weight design. This preliminary design effort is also detailed.

  9. Effect of temperature on sulphate reduction, growth rate and growth yield in five psychrophilic sulphate-reducing bacteria from Arctic sediments

    DEFF Research Database (Denmark)

    Knoblauch, C.; Jørgensen, BB

    1999-01-01

    and T(opt). For strains LSv21 and LSv514, however, growth yields were highest at the lowest temperatures, around 0 degrees C. The results indicate that psychrophilic sulphate-reducing bacteria are specially adapted to permanently low temperatures by high relative growth rates and high growth yields......Five psychrophilic sulphate-reducing bacteria (strains ASv26, LSv21, PSv29, LSv54 and LSv514) isolated from Arctic sediments were examined for their adaptation to permanently low temperatures, All strains grew at -1.8 degrees C, the freezing point of sea water, but their optimum temperature...... for growth (T(opt)) were 7 degrees C (PSv29), 10 degrees C (ASv26, LSv54) and 18 degrees C (LSv21, LSv514), Although T(opt) was considerably above the in situ temperatures of their habitats (-1.7 degrees C and 2.6 degrees C), relative growth rates were still high at 0 degrees C, accounting for 25...

  10. 43 CFR 19.8 - Prospecting, mineral locations, mineral patents, and mineral leasing within National Forest...

    Science.gov (United States)

    2010-10-01

    ... patents, and mineral leasing within National Forest Wilderness. 19.8 Section 19.8 Public Lands: Interior... § 19.8 Prospecting, mineral locations, mineral patents, and mineral leasing within National Forest... locations, mineral patents, and mineral leasing within National Forest Wilderness are contained in parts...

  11. Influence of the temperature in heptahydrate iron sulfate and calcium sulphate, under gamma irradiation

    International Nuclear Information System (INIS)

    Negron M, A.; Ramos B, S.; Frias, D.; Sanchez M, G.

    2007-01-01

    Full text: Experimental results have shown that kinetics of the reaction mechanism initiated by radiolysis is strongly affected by changes in the state of the dosimeter and temperature of irradiation: Response of the dosimeter as a function of the irradiation temperature plays an important role that has not been considered. This effect also has consequences for practical applications in dosimetry. It is obvious that significant errors may occur if dependence on irradiation temperature takes place and it was not taken into account.This issue is relevant to irradiation that takes place at low temperatures. If products are presented and irradiated below room temperature, the evaluation of energy deposited by gamma radiation on samples irradiated below room temperature is a truly difficult task. In irradiating heptahydrate iron sulphate and calcium sulphate with gamma rays at different decreasing temperatures keeping constant the rest of irradiation conditions, we have used low and high doses.(Author)

  12. Extraction of nickel from Ramu laterite by sulphation roasting-water leaching

    Science.gov (United States)

    Wang, Weiwei; Du, Shangchao; Liu, Guo; Tang, Jianwen; Lu, Yeda; Lv, Dong

    2017-08-01

    Recovery of nickel from a PNG nickel laterite with high content of iron by a sulphation roasting-water leaching has been studied. The influences of sulfuric acid/ore ratio, temperature of roasting and water on recovery efficiency were investigated. The effective separation of nickel over the co-existed elements including iron was achieved by the process with mixing, curing, roasting and leaching stages. Near 100% of nickel was leached from the roasted laterite by water at 80°C in an atmospheric air, while co-leaching of about 2% of iron, under the optimal pre-treatment conditions with the ratio of acid: ore around 0.45:1 and the roasting temperature about 650°C. The advantages and disadvantages of sulphation atmospheric leaching are compared with pressure acid leaching with engineering consideration.

  13. Paddle-wheel versus percolation mechanism for cation transport in some sulphate phases

    DEFF Research Database (Denmark)

    Andersen, N.H.; Bandaranyake, P.W.S.K.; Careem, M.A.

    1992-01-01

    Lithium sulphate and a few other compounds have high temperature phases which are both solid electrolytes and plastic crystals (rotor phases). Three types of experiments are here considered in order to test the validity of a "paddle-wheel mechanism" that has been proposed for cation conductivity...... curved pathway of continuous lithium occupation corresponding to a distance of about 3.7 angstrom. Thus, lithium transport occurs in one of the six directions [110], [110BAR], [101] etc. The electrical conductivity has been studied for solid solutions of lithium tungstate in cubic lithium sulphate....... The conductivity is reduced in the one-phase region, while it is increased in a two phase (solid-melt) region. There are pronounced differences between the rotor phases and other phases concerning how partial cation substitution affects the electrical conductivity of solid solutions. Regarding self...

  14. Sulphated glycosaminoglycans prevent the neurotoxicity of a human prion protein fragment.

    Science.gov (United States)

    Pérez, M; Wandosell, F; Colaço, C; Avila, J

    1998-10-15

    Although a number of features distinguish the disease isoform of the prion protein (PrPSc) from its normal cellular counterpart (PrPC) in the transmissible spongiform encephalopathies (TSEs), the neuropathogenesis of these diseases remains an enigma. The amyloid fibrils formed by fragments of human PrP have, however, been shown to be directly neurotoxic in vitro. We show here that sulphated polysaccharides (heparin, keratan and chondroitin) inhibit the neurotoxicity of these amyloid fibrils and this appears to be mediated via inhibition of the polymerization of the PrP peptide into fibrils. This provides a rationale for the therapeutic effects of sulphated polysaccharides and suggests a rapid in vitro functional screen for TSE therapeutics.

  15. AP-102/104 Retrieval control system qualification test procedure

    International Nuclear Information System (INIS)

    RIECK, C.A.

    1999-01-01

    This Qualification Test Procedure documents the results of the qualification testing that was performed on the Project W-211, ''Initial Tank Retrieval Systems,'' retrieval control system (RCS) for tanks 241-AP-102 and 241-AP-104. The results confirm that the RCS has been programmed correctly and that the two related hardware enclosures have been assembled in accordance with the design documents

  16. Hyperoxia increases AP-1 DNA binding in rat brain.

    Science.gov (United States)

    Tong, LiQi; Toliver-Kinsky, Tracy; Rassin, David; Werrbach-Perez, Karin; Perez-Polo, J Regino

    2003-01-01

    Oxidative stress appears to contribute to neurodegenerative outcomes after ischemia, hypoxia, and hyperoxia. The AP-1 transcription factor is made up of a family of regulatory proteins that can be activated by oxidative stress. In the present study, we examined AP-1 DNA binding activity in terms of specific participating AP-1 proteins in rat brain after hyperoxia. Male Sprague-Dawley rats were exposed to 100% oxygen under isobaric conditions over time. The AP-1 DNA binding activity present in the rat hippocampus and basal forebrain was characterized by electrophoretic mobility shift analysis (EMSA) and the participating AP-1 proteins identified by immunodepletion/supershift and Western blotting analyses. The Fos and Jun proteins were localized by immunohistochemistry to hippocampus. There were significant increases in AP-1 DNA binding in both hippocampus and basal forebrain after hyperoxia. There was also a significant increase in c-Jun protein levels and the proportion of c-Jun present in AP-1 DNA binding complexes in hippocampal nuclei after hyperoxia. These results suggest that AP-1 activation via c-Jun binding to DNA is an important component of brain responses to oxidative stress.

  17. Training and development of the Assistant Practitioners (APs) in radiography

    International Nuclear Information System (INIS)

    Stewart-Lord, Adéle

    2014-01-01

    A mixed methods study conducted over three phases (Phase I – scoping exercise, Phase II – questionnaire and Phase III – semi-structured interviews) aimed to explore the role and integration of the assistant practitioner (AP) practitioner in radiography from the AP perspective. Findings of the overall study are presented across a range of articles where this publication only presents the findings in relation to the training and education of APs from all three phases. Results showed the educational routes undertaken by APs in radiography during training. Training whilst working in the clinical department has highlighted a number of key issues relating to educational pathways and delivery methods. Findings showed that APs felt that more could be done to prepare the individual for clinical practice thereby increasing their confidence and facilitating role development. Results also identified a number of challenges in the training and education of APs in radiography. Clear routes of progression and career pathways are not available to APs in radiography. In conclusion the findings suggest the need for a review of existing educational programmes and future standardisation. The need exists to clarify the justifiable methods of training and differentiate between recognised educational qualifications to enable informed career development decisions by APs and their employers

  18. Discussion of QA grading for AP1000 NP plant

    International Nuclear Information System (INIS)

    Luo Shuiyun; Zhang Qingchuan

    2012-01-01

    The grading method of quality assurance for the following AP1000 project is presented based on the Westinghouse classification principle, referring to the classification method of the AP1000 self-reliance supporting project and considering the factors of classification, which can meet the requirements of domestic nuclear safety regulation and standard of the QA classification. (authors)

  19. Status of the Advanced Photon Source (APS) linear accelerator

    International Nuclear Information System (INIS)

    White, M.; Berg, W.; Fuja, R.; Grelick, A.; Mavrogenes, G.; Nassiri, A.; Russell, T.; Wesolowski, W.

    1993-01-01

    A 2856-MHz S-band, 450-MeV electron/positron linear accelerator is the first part of the injector for the Advanced Photon Source (APS) 7-GeV storage ring. Construction of the APS linac is currently nearing completion, and commissioning will begin in July 1993. The linac and its current status are discussed in this paper

  20. Data-Based Decision Making: The Road to AP Equity

    Science.gov (United States)

    Edwards, Kelcey; Duggan, Odette

    2012-01-01

    Presented at the Advanced Placement Annual Conference (APAC) in Lake Buena Vista, FL in July 2012. This presentation reviews concepts central to achieving equitable AP access and success for all willing and academically prepared students. We analyze trends in participation and performance by race/ethnicity from the AP Report to the Nation and…

  1. APS extends open access to all its journals

    CERN Multimedia

    Thomas, Kim

    2006-01-01

    "Physics research promoter and publisher the American Physical Society (APS) is to extend open access to all its journals. Th APS previously made its five print journals available through subscriptions, and its two e-journals (Physical Review Special Topics and Physics Educatoin Research) on an open access basis." (1/2 page)

  2. [Diverse histological lesions in a patient with antiphospholipid syndrome (APS)].

    Science.gov (United States)

    Salvatore, Ermanno; Luciani, Remo; Di Palma, Annamaria; Aversano, Arturo; Stellato, Davide; Liuzzi, Marco; Iele, Emilio; Martignetti, Vinicio; Spagnuolo, Enrico; Morrone, Luigi

    2011-01-01

    Antiphospholipid syndrome (APS) is a rare autoimmune disorder. It can be secondary to systemic lupus erythematosus (SLE) or occur in the absence of autoimmune disease. The hallmark of this so-called primary APS is the presence of circulating antiphospholipid antibodies. Renal involvement in primary APS is caused by thrombosis within the renal vasculature. Recently, nonthrombotic glomerulonephritic renal lesions have been described in primary APS as a new histological entity. We here report a patient with primary APS in whom both lesion types were present. A 58-year-old Caucasian man with no significant past medical history presented to our nephrology unit with diffuse edema. Urinalysis showed proteinuria exceeding 400 mg/dL. The autoantibody panel (p-ANCA, c- ANCA, anti-nucleus, anti-DS-DNA) was negative except for anticardiolipin antibodies, which tested positive in two different samples. The diagnostic workup included a kidney biopsy that revealed thrombotic lesions compatible with primary APS and a typical pattern of focal segmental glomerulosclerosis. The kidney is a major target in APS but the exact mechanism underlying the pathogenesis of APS nephropathy has been poorly recognized. The use of kidney biopsy is a fundamental diagnostic tool in this setting, with possible implications also from a prognostic and therapeutic viewpoint.

  3. Building an SDN enterprise WLAN based on virtual APs

    NARCIS (Netherlands)

    Sequeira, L.; Cruz, J.L. de la; Ruiz-Mas, J.; Saldana, J.; Fernandez-Navajas, J.; Almodovar, J.

    2017-01-01

    In this letter, the development and testing of an open enterprise Wi-Fi solution based on virtual access points (APs), managed by a central WLAN controller is presented. It allows seamless handovers between APs in different channels, maintaining the QoS of real-time services. The potential

  4. OpenAPS Data Commons on Open Humans

    OpenAIRE

    Lewis, Dana M.; Ball, Madeleine

    2017-01-01

    Poster describing OpenAPS, Open Humans, and joint work creating a data commons for OpenAPS data in the Open Humans platform. Presented at the 2017 Sage Assembly Bionetworks Assembly and recipient of a Young Innovator/Investigator award.

  5. AP: A Critical Examination of the Advanced Placement Program

    Science.gov (United States)

    Sadler, Philip M.; Sonnert, Gerhard; Tai, Robert; Klopfenstein, Kirstin

    2016-01-01

    The Advanced Placement (AP) program was created to enhance the experience of gifted students as they transition from high school to college. "AP: A Critical Examination of the Advanced Placement Program," edited by Philip M. Sadler, Gerhard Sonnert, Robert Tai, and Kirstin Klopfenstein (2010, Harvard Education Press), questions the…

  6. A Closer Examination of the Academic Benefits of AP

    Science.gov (United States)

    McKillip, Mary E. M.; Rawls, Anita

    2013-01-01

    The authors sought to better understand the relationship between students participating in the Advanced Placement (AP) program and subsequent performance on the Scholastic Aptitude Test (SAT). Focusing on students graduating from U.S. public high schools in 2010, the authors used propensity scores to match junior year AP examinees in 3 subjects to…

  7. Development of a superconducting undulator for the APS

    International Nuclear Information System (INIS)

    Ivanyushenkov, Y; Abliz, M; Doose, C; Fuerst, J; Hasse, Q; Kasa, M; Trakhtenberg, E; Vasserman, I; Gluskin, E; Lev, V; Mezentsev, N; Syrovatin, V; Tsukanov, V

    2013-01-01

    As the western hemisphere's premier x-ray synchrotron radiation source, the Advanced Photon Source (APS) continues to advance the state of the art in insertion device technology in order to maintain record high brightness, especially in the hard x-ray wavelength region. Due to the unique bunch pattern used for normal APS operations and its ultimate capabilities, the APS has chosen superconducting technology for its future hard x-ray undulator sources. In the last several years, the APS in collaboration with the Budker Institute of Nuclear Physics has being developing the technology for planar, small-period superconducting undulators (SCUs). These developments include the design and construction of several prototypes and the construction of the necessary mechanical, vacuum, and cryogenic infrastructure at the APS site. Several prototypes of the SCU magnetic structure have been built and tested. The first SCU is assembled and will be installed in the APS storage ring at the end of 2012. Expected SCU performance in terms of x-ray brightness should noticeably exceed that of existing APS undulators. Immediately after commissioning, the SCU will be used at APS Sector 6 as the radiation source for high-energy x-ray studies.

  8. AP@home: The Artificial Pancreas Is Now at Home

    NARCIS (Netherlands)

    Heinemann, Lutz; Benesch, Carsten; DeVries, J. Hans

    2016-01-01

    In the past years the development of an artificial pancreas (AP) has made great progress and many activities are ongoing in this area of research. The major step forward made in the last years was moving the evaluation of AP systems from highly controlled experimental conditions to daily life

  9. Accidental intravenous infusion of a large dose of magnesium sulphate during labor: A case report

    Directory of Open Access Journals (Sweden)

    Kamal Kumar

    2013-01-01

    Full Text Available During labor and child delivery, a wide range of drugs are administered. Most of these medications are high-alert medications, which can cause significant harm to the patient due to its inadvertent use. Errors could be caused due to unfamiliarity with safe dosage ranges, confusion between similar looking drugs, mislabeling of drugs, equipment misuse, or malfunction and communication errors. We report a case of inadvertent infusion of a large dose of magnesium sulphate in a pregnant woman.

  10. Accelerating the transit time of barium sulphate suspensions in small bowel examinations

    International Nuclear Information System (INIS)

    Summers, David S.; Roger, Mark D.; Allan, Paul L.; Murchison, John T.

    2007-01-01

    Purpose: To determine whether hyperosmolar and effervescent agents proven individually to accelerate transit time in the barium small bowel examination have an additive effect when combined, surpassing that of either agent alone. Materials and methods: One hundred and forty-nine patients were randomised to four groups. Three hundred milliliters of barium sulphate alone was given to the first group. Fifteen milliliters of iodinated hyperosmolar contrast agent (Gastrografin, meglumine/sodium diatrizoate, Schering) was given in addition to barium sulphate to the second group while six packets of effervescent granules (Carbex, Ferring) were added for the third group. The final group was given a combination of both additives and barium sulphate. The time taken following ingestion for the contrast column to reach the caecum, as assessed by frequent interval fluoroscopy, was recorded. A subgroup of 32 patients were selected randomly from the four groups, 8 from each and assessed for quality of examination. Statistical assessments were made using Kruskal-Wallis and Mann-Whitney tests. Results: One hundred and nineteen patients were analysed after exclusions. The addition of accelerant to barium sulphate, both individually and in combination significantly reduced the small bowel transit time (p < 0.001). No significant difference existed between the additives when used with barium alone. The combined group had significantly faster transit times compared to the hyperosmolar group (p = 0.02). Differences between combined and effervescent groups tended towards significance (p = 0.09). No significant difference existed between groups when examination quality was assessed. Conclusion: These results suggest that the addition of combined effervescent and hyperosmolar agents to the barium suspension may significantly shorten the small bowel transit time without adversely affecting examination quality. This has implications for patient acceptability of the examination as well as

  11. A new hydroxytyrosol metabolite identified in human plasma: hydroxytyrosol acetate sulphate.

    Science.gov (United States)

    Rubió, Laura; Macià, Alba; Valls, Rosa M; Pedret, Anna; Romero, Maria-Paz; Solà, Rosa; Motilva, Maria-José

    2012-09-15

    We report progress in the study of olive oil phenolic metabolites in humans and identify a new hydroxytyrosol metabolite called hydroxytyrosol acetate sulphate, which was determined using tandem MS, after ingestion of 30 ml of olive oil with a high phenolic content (500 mg/kg oil), reaching a maximum concentration of 1.63 μM. In order to understand and explain the generation of this metabolite, two different pathways are proposed. Copyright © 2012 Elsevier Ltd. All rights reserved.

  12. Conductometric and volumetric study of copper sulphate in aqueous ethanol solutions at different temperatures

    Directory of Open Access Journals (Sweden)

    Esam A. Gomaa

    2017-09-01

    Full Text Available An Anton Par Model 55 densimeter was used to measure the densities of copper sulphate solutions in H2O and EtOH–H2O at 298.15 K, 303.15 K, 308.15 K, and 313.15 K. The acquired information was used to ascertain the apparent molar volumes, limiting partial molar volumes, and transfer partial molar volumes of copper sulphate. These computed parameters were utilized to decipher the solute–solute and solute–solvent interactions of copper sulphate in an aqueous ethanol solution. The ion solvation behavior of copper sulphate in water and aqueous ethanol over the range of 298.15–313.15 K was studied using the electrical conductivity principle. The Kraus–Bray and Shedlovsky models of conductivity were used to analyze the obtained conductance data. From the obtained data, the limiting molar conductance λ°m, association constant KA, energy of activation of the rating process (Ea, and related thermodynamic parameters were determined. The Walden product (λ°mη0 was determined. The standard thermodynamic parameters of association (ΔG°A, ΔH°A were calculated and discussed. Increased ion–solvent and solvent–solvent interactions are indicated by limiting molar conductance values with an increasing amount of ethanol. The negative ΔG°A values indicate that the association processes in all of the studied systems are spontaneous processes. The negative estimation of (ΔH°A demonstrates that the association processes is exothermic in nature.

  13. Oral zinc sulphate in treatment of patients with thallium poisoning: A clinical therapeutic trial

    Directory of Open Access Journals (Sweden)

    Ahmed A. Al-Mohammadi

    2011-06-01

    Full Text Available Thallium poisoning is usually associated with typical dermatological features simulating that of zinc deficiency. The aim of this study was to evaluate the role of oral zinc sulphate in the treatment of patients with thallium poisoning.Materials and methods: This clinical therapeutic trial study was conducted in Departments of Dermatology of Baghdad and Basrah Teaching Hospitals from February 2008 - February 2010, where a total of 37 patients with thallium poisoning were enrolled.A detailed history was taken from all patients and complete clinical examination was performed. All patients received zinc sulphate in a dose of 5 mg/kg three times a day few days before confirming the diagnosis of thallium poisoning. Thallium in urine had been measured using the colorimetric method and was positive in all patients. After confirming the diagnosis of thallium poisoning, thallium antidotes Prussian blue was given to 32 patients.Results: Age range of 37 patients was 5-33 (24±5.3 years. The dermatological findings were mainly: anagen hair loss affected the scalp and limbs. Also, dusky ecchymotic red dermatitis like rash was observed on the face and dorsum of hands and legs, while neurological manifestations were mainly of peripheral neuropathy, were reported in 21 (55% patients. All patients but two responded promptly to a trial of zinc sulphate within few days.Conclusion: Oral Zinc sulphate appears to be an effective and safe treatment for thallium poisoning particularly for skin and hair features and in reducing its lethal progression and complications. J Clin Exp Invest 2011;2(2:133-7

  14. Aluminum sulphate production and zeolite from residual muds of the company Extralum S.A

    International Nuclear Information System (INIS)

    Carranza, C.; Montero, M.

    2002-01-01

    As part of our research on alternative raw materials for the chemical industry we studied sludge from an anodizing process at Extralum S.A. The sludge contains mainly bayerite, Al(OH) 3 and bohemite A1O (OH). Starting from these we developed a hydrothermal synthesis of Aluminium sulphate and Zeolite A. The Zeolite A was identified by Powder X-ray crystallography. The scanning electron microscope image of the Zeolite A shows a very high degree of crystallinity. (Author) [es

  15. Oral zinc sulphate in treatment of patients with thallium poisoning: A clinical therapeutic trial

    OpenAIRE

    Ahmed A. Al-Mohammadi; Adil A. Noaimi; Khalifa E. Sharquie; Khalil I. Al-Hamdi

    2011-01-01

    Thallium poisoning is usually associated with typical dermatological features simulating that of zinc deficiency. The aim of this study was to evaluate the role of oral zinc sulphate in the treatment of patients with thallium poisoning.Materials and methods: This clinical therapeutic trial study was conducted in Departments of Dermatology of Baghdad and Basrah Teaching Hospitals from February 2008 - February 2010, where a total of 37 patients with thallium poisoning were enrolled.A detailed h...

  16. Sulphated glycosaminoglycans prevent the neurotoxicity of a human prion protein fragment.

    OpenAIRE

    Pérez, M; Wandosell, F; Colaço, C; Avila, J

    1998-01-01

    Although a number of features distinguish the disease isoform of the prion protein (PrPSc) from its normal cellular counterpart (PrPC) in the transmissible spongiform encephalopathies (TSEs), the neuropathogenesis of these diseases remains an enigma. The amyloid fibrils formed by fragments of human PrP have, however, been shown to be directly neurotoxic in vitro. We show here that sulphated polysaccharides (heparin, keratan and chondroitin) inhibit the neurotoxicity of these amyloid fibrils a...

  17. Kinetics of barium sulphate reaction crystallization in crystallizers with internal circulation

    Directory of Open Access Journals (Sweden)

    J. Koralewska

    2008-06-01

    Full Text Available Kinetic calculation results describing the observed nucleation and growth rates of barium sulphate crystals precipitated in an integrated reaction-crystallization process in a barium sulphate-ammonium chloride-water system are presented and analyzed. The scope of experiments included two continuous model DTM-type crystallizers (Draft Tube Magma with internal circulation of the suspension forced by a liquid jet-pump device responsible for stable and intensive enough ascending/descending flow of BaSO4 crystal magma in a mixing chamber. For comparison purposes the experimental data corresponding to a continuous DT (Draft Tube crystallizer with propeller agitator are presented and discussed. The various types of laboratory crystallizers used were fed with concentrated water solution of barium chloride (of 10 or 24 mass % and - in a stoichiometric proportion - crystalline ammonium sulphate, assuming isothermal (348 K and hydrodynamic (average residence time of suspension in a crystallizer: 900 s process conditions. The observed nucleation and growth rates of barium sulphate crystals were estimated on the basis of crystal size distributions (CSDs using convenient calculation scheme derived for an MSMPR (Mixed Suspension Mixed Product Removal model approach. Considering the experimental population density distribution courses, a size-dependent growth (SDG phenomenon was taken into account in the kinetic calculations. Five SDG kinetic models recommended in the accessible literature were used for kinetic parameter values estimation. It was proved statistically, that Rojkowski’s two SDG models (hyperbolic and exponential best suit for our own experimental data description. The experimental data presented can be practically applied for improving the constructions of liquid jet-pump DTM crystallizers recommended for reaction crystallization of sparingly soluble inorganic salts (especially for high concentrations of reaction substrates in the modern

  18. Magnesium status and parenteral magnesium sulphate therapy in acute aluminum phosphide intoxication.

    Science.gov (United States)

    Chugh, S N; Kamar, P; Sharma, A; Chugh, K; Mittal, A; Arora, B

    1994-12-01

    The results of an open randomized study on magnesium status and parenteral magnesium sulphate therapy in acute aluminium phosphide intoxication are presented. The study was conducted on 105 patients divided into two group (I & II). Patients of Group I did not receive parenteral magnesium and acted as blank. Magnesium levels were monitored every 6 h for 24 h. Patients of group II received magnesium sulphate therapy. It was administered as 1.0 g (8.1 mEq or 4.05 mmol) magnesium sulphate dissolved in 100 ml of 5 per cent dextrose intravenously as a bolus dose followed by 1.0 g every hour for three successive hours, then 1.0 g every 6 h as a maintenance dose for the next 24 h as intravenous infusion in 5 per cent dextrose. The total dose of magnesium sulphate infused was 30.0 mmol over a period of 24 h (initial dose), then 16.0 mmol (4.0 g) daily till final outcome or a maximum of five days. All the vital parameters were monitored. All the patients were followed till final outcome. The resuscitation methods used were the same in both groups. At the end of the study, mortality rates were calculated in both groups. Hypomagnesaemia was observed as the constant finding in patients of Group I. It was transient and reversed itself without MgSO4. The mortality rate was 52 per cent. On the other hand, magnesium levels rose immediately after parenteral MgSO4 administration in patients of group II and they remained persistently above normal during the observed period.(ABSTRACT TRUNCATED AT 250 WORDS)

  19. Copper toxicity in sheep: the effects of repeated intravenous injections of copper sulphate

    Energy Technology Data Exchange (ETDEWEB)

    Howell, J.M.; Gopinath, C.

    1977-01-01

    Four Clun Forest, Suffolk cross sheep were given daily intravenous injections of copper sulphate. Three similar sheep acted as controls. The copper dosed sheep developed haemolysis and showed liver, kidney and brain damage similar to that seen in chronic copper poisoning. All animals survived for 30 days and two would have lived longer. Reticulocytes were produced after four days and continued to be produced, sometimes in high numbers throughout the course of the experiment. 21 references, 6 figures, 2 tables.

  20. Effects of preoperative magnesium sulphate on post-cesarean pain, a placebo controlled double blind study.

    Directory of Open Access Journals (Sweden)

    Seyed Mohamad Mireskandari

    2015-03-01

    Full Text Available To study the role of preoperative intravenous magnesium sulphate in decreasing post-cesarean pain and opioid requirement during first 24hrs.In a double blind randomized clinical trial, prior to induction of general anesthesia, fifty elective cesarean candidates were randomly assigned to one of the two groups of placebo or magnesium sulfate. After surgery visual analogue scale (VAS and infused morphine by PCA during 24 hrs were recorded. The data were analyzed by mann-Whitney -test, analysis of variance, and student t- test.VAS was significantly lower among patients in the magnesium sulphate group at intervals of 1(st, 6(th & 12(th hours after cesarean section (C/S with the mean scales of (48.9 ± 19.6 VS 74.7 ± 18.4, (42.1 ± 0.9 VS 58.3 ± 16.5 and (25.2 ± 6.1VS 30 ± 8.1 respectively and p-value of <0.001, 0.002 and 0.05 respectively. However at 24 hrs there was no significant difference in VAS with mean VAS scales of 22.6 ± 4.5 VS 23.6 ± 4.9 and p-value of 0.49. The dose of infused Morphine during 24 hrs was significantly less in the magnesium sulphate group than the placebo group with the means of 4.36 ± 1.4 VS 7.02 ± 1.9 mg respectively (p < 0.001.Administration of bolus 50 mg/kg magnesium sulphate prior to induction of general anesthesia may significantly decreased the morphine requirement during immediate post operative period and can be recommended as one of the modalities of post-operative pain control in the pregnant patients.

  1. Ammonium sulphate fertiliser increases larval populations of Anopheles arabiensis and culicine mosquitoes in rice fields

    DEFF Research Database (Denmark)

    Mutero, C M; Ng'ang'a, P N; Wekoyela, P

    2004-01-01

    Field experiments were conducted in central Kenya, to study the effect of ammonium sulphate fertiliser ((NH(4))(2)SO(4)) on mosquito larval populations in rice fields. The experiments used a complete randomised block design having four blocks with two experimental ponds per block, and the fertili...... in rice fields, thereby making them visually more attractive for egg-laying by An. arabiensis and culicine mosquitoes....

  2. Biological sulphate removal from acid mine effluent using ethanol as carbon and energy source

    CSIR Research Space (South Africa)

    Greben, HA

    2000-01-01

    Full Text Available 3000 mg/l down to less than 200 mg/l and the formed sulphides to less than 200 mg/l. The VSS value in the reactor varied between 3 and 4 g/l, resulting in a specific sulphate removal rate from 0.47 to 2.47 g SO4/(g VSS.d), while the volumetric rate...

  3. Evaluation of formocresol versus ferric sulphate primary molar pulpotomy: a systematic review and meta-analysis.

    Science.gov (United States)

    Peng, L; Ye, L; Guo, X; Tan, H; Zhou, X; Wang, C; Li, R

    2007-10-01

    To present a systematic review of the effects of formocresol and ferric sulphate when used as medicaments in pulpotomized primary molar teeth. The study list was obtained by using MEDLINE, the Cochrane Library, EMBASE and SCI search. Only those papers which met the inclusion criteria were accepted. The quality of studies used for meta-analysis was assessed by a series of validity criteria according to Jadad's scale. A systematic review and meta-analysis were performed. Eleven clinical studies comprising four randomized-clinical trials (RCTs), four controlled clinical trials (CCTs) and three retrospective studies were included. The results of the meta-analysis of six prospective clinical trials suggested that the two popular pulpotomy medicaments were not significantly different in terms of clinical outcomes, radiographic findings, prevalence of apical and furcal destruction, internal root resorption or pulp canal obliteration. The relative risk (RR) value and 95% CI for those parameters were 0.72 (0.43-1.23), 0.87 (0.59-1.30), 0.67 (0.27-1.66), 1.77 (0.56-5.58) and 1.41 (0.63-3.15), respectively. The overall clinical and radiographic success rates based on the data of treatments with ferric sulphate from the 11 studies included ranged from 78% to 100% (mean 91.6 +/- 8.15%) and from 42% to 97% (mean 73.5 +/- 18.40%), respectively. In primary molar teeth with exposure of vital pulps by caries or trauma, pulpotomies performed with either formocresol or ferric sulphate have similar clinical and radiographic success. Ferric sulphate may be recommended as a suitable replacement for formocresol.

  4. Ferric sulphate and formocresol in pulpotomy of primary molars: long term follow-up study.

    Science.gov (United States)

    Ibricevic, H; Al-Jame, Q

    2003-03-01

    The objective of this study was to compare the effects of ferric sulphate (FS) to that of the full strength of formocresol (Buckley's formula) (FC) as pulpotomy agents in primary human molar teeth 42-48 months after treatment. This was to assess the succeeding premolar teeth for decalcification, abnormal morphology or any other defect. Seventy children, ranging in age from 3 to 6 years, mean 4.3 years, were treated for pulpotomy of primary molars. Ferric sulphate 15.5% solution (applied for 15 seconds for 84 teeth) and formocresol solution (5 minutes procedure for next the 80 teeth) were used as pulpotomy agents. In both groups, pulp stumps were covered with zinc oxide eugenol paste. Permanent restorations were, in most cases, stainless steel crowns and in some of them amalgams. Follow-up clinical assessments were every 3 months and the radiographic follow-up time was 6, 20 and 42-48 months after treatment. The differences were statistically analyzed using the Chi square test. These revealed 96.4% clinical success rate in the FS and 97.5% in the FC groups. Radiographic success rate in the FS group was 92.0%, while 94.6% in the FC group. No statistical significant differences were found between the radiographic assessment of the two pulpotomy agents. Ferric sulphate showed similar clinical and radiographic success rate as a pulpotomy agent for primary molar teeth after long term evaluation period, compared with formocresol. Ferric sulphate, because of its lower toxicity, may become a replacement for formocresol in primary molar teeth.

  5. Salbutamol sulphate-ethylcellulose microparticles: formulation and in-vitro evaluation with emphasis on mathematical approaches

    Directory of Open Access Journals (Sweden)

    G Murtaza

    2009-10-01

    Full Text Available "n "nBackground and the purpose of the study: This study reports the laboratory optimization for the preparation of salbutamol sulphate-ethylcellulose microparticles by a non-solvent addition coacervation technique through adjustment of the ratio of salbutamol sulphate to ethylcellulose. The variation of drug release between the microparticles and tabletted microparticles was also investigated. "nMethods: In vitro release profiles of developed microparticles and tabletted microparticles were studied using USP XXIV dissolution apparatus I and II, respectively, in 450 ml double distilled water at 50 rpm maintained at 37°C. "nResults: White microparticles with no definite shape having good entrapment efficiency (96.68 to 97.83% and production yield (97.48 ± 1.21 to 98.35 ± 1.08% were obtained. In this investigation, initial burst effect was observed in the drug release behavior. The rate of drug release from microparticles decreased as the concentration of polyisobutylene was increased from 6% to 12% during microencapsulation. The release pattern of tabletted microparticles was affected significantly (p < 0.05 by the addition of hydroxy propyl methyl cellulose (HPMC as excepient and insignificantly (p > 0.05 by the type of dissolution media and stirring speed. Tabletted microparticles showed good stability and reproducibility. Ethylcellulose was found to be compatible with salbutamol sulphate. The drug release from all formulations was best fit to Higuchi's equation and the mechanism of drug release was anomalous diffusion from all formulations. "nConclusion: The results of this study suggest that by using ethylcellulose it is possible to design a single-unit, sustained-release oral dosage form of salbutamol sulphate for indication of twice a day.

  6. EFFECTS INDUCED BY DIETHYL SULPHATE ON SOME CYTOGENETICAL PARAMETERS AND LENGTH GROWTH OF HEMP PLANTLETS

    Directory of Open Access Journals (Sweden)

    Elena Truta

    2007-08-01

    Full Text Available The hemp seeds were treated with diethyl sulphate, in four concentrations (0.1%, 0.25%, 0.5%, and 1% and in two variants of alkylant exposure (3 and 6 hours. The length growth of plantlets, mitotic index and frequency of chromosomal aberrations were the analyzed parameters. Significant modifications were obtained at the level of parameters in variants treated with DES, comparatively with control.

  7. The role of cysteine residues in the sulphate transporter, SHST1: construction of a functional cysteine-less transporter.

    Science.gov (United States)

    Howitt, Susan M

    2005-05-20

    We investigated the role of cysteine residues in the sulphate transporter, SHST1, with the aim of generating a functional cysteine-less variant. SHST1 contains five cysteine residues and none was essential for function. However, replacement of C421 resulted in a reduction in transport activity. Sulphate transport by C205 mutants was dependent on the size of the residue at this position. Alanine at position 205 resulted in a complete loss of function whereas leucine resulted in a 3-fold increase in sulphate transport relative to wild type SHST1. C205 is located in a putative intracellular loop and our results suggest that this loop may be important for sulphate transport. By replacing C205 with leucine and the other four cysteine residues with alanine, we constructed a cysteine-less variant of SHST1 that has transport characteristics indistinguishable from wild type. This construct will be useful for further structure and function studies of SHST1.

  8. Vanadia on sulphated-ZrO2, a promising catalyst for NO abatement with ammonia in alkali containing flue gases

    DEFF Research Database (Denmark)

    Kustov, Arkadii; Kustova, Marina; Fehrmann, Rasmus

    2005-01-01

    Vanadia supported on TiO2, ZrO2, and sulphated-ZrO2 have been prepared. These catalysts were characterized by elemental analysis, N-2-BET, XRD, FTIR, and NH3-TPD methods. The stability of surface sulphated groups, studied by FTIR- spectroscopy, was found to depend dramatically on the temperature...... of the calcination of the samples. No considerable decomposition of surface sulphates was observed below 350 ° C. The influence of potassium oxide additives on the acidity and activity in NO SCR with ammonia was studied. It was found that the introduction of small amounts of potassium (K/V molar ratio ... to almost complete depression of the samples acidity and considerable weakening of the remaining acid sites for TiO2 and ZrO2 based systems. For the sulphated system, surface sulphur groups, due to their strong acidity, represent attractive sites for the localization of potassium oxide and the decrease...

  9. Relationships between sulphate reduction and COD/VFA utilisation using grass cellulose as carbon and energy sources

    CSIR Research Space (South Africa)

    Mulopo, J

    2010-07-01

    Full Text Available wastewater. PhD Thesis, Wageningen Agricultural University, Wageningen, The Netherlands. 11. Oude Elferink, S. J. W. H. (1998). Sulphate-reducing Bacteria in Anaerobic Bioreactors. PhD Thesis, Wageningen Agricultural University, Wageningen, The Netherlands...

  10. The development of beam current monitors in the APS

    International Nuclear Information System (INIS)

    Wang, X.; Lenkszus, F.; Rotela, E.

    1995-01-01

    The Advanced Photon Source (APS) is a third-generation 7-GeV synchrotron radiation source. The precision measurement of beam current is a challenging task in high energy accelerators, such as the APS, with a wide range of beam parameters and complicated noise, radiation, and thermal environments. The beam pulses in the APS injector and storage ring have charge ranging from 50pC to 25nC with pulse durations varying from 30ps to 30ns. A total of nine non- intercepting beam current monitors have been installed in the APS facility (excluding those in the linac) for general current measurement. In addition, several independent current monitors with specially designed redundant interlock electronics are installed for personnel safety and machine protection. This paper documents the design and development of current monitors in the APS,. discusses the commissioning experience in the past year, and presents the results of recent operations

  11. AP1000, a nuclear central of advanced design

    International Nuclear Information System (INIS)

    Hernandez M, N.; Viais J, J.

    2005-01-01

    The AP1000 is a design of a nuclear reactor of pressurized water (PWR) of 1000 M We with characteristic of safety in a passive way; besides presenting simplifications in the systems of the plant, the construction, the maintenance and the safety, the AP1000 is a design that uses technology endorsed by those but of 30 years of operational experience of the PWR reactors. The program AP1000 of Westinghouse is focused to the implementation of the plant to provide improvements in the economy of the same one and it is a design that is derived directly of the AP600 designs. On September 13, 2004 the US-NRC (for their initials in United States- Nuclear Regulatory Commission) approved the final design of the AP1000, now Westinghouse and the US-NRC are working on the whole in a complete program for the certification. (Author)

  12. Maintenance of the APS of an electron beam accelerator

    International Nuclear Information System (INIS)

    Lee, Byung Cheol; Choi, Hwa Lim; Yang, Ki Ho; Kim, Sung Chan

    2008-12-01

    APS is a part of power supply system which provides the high voltage, high current to the anode of electron beam in the irradiation facility in KAERI. This APS had been used in turn-key base for 10 years, and frequently the Russian scientists had visited to repair this machine. In Summer the humid air had been supplied to dissipate the heat of APS. There is a big and high frequency noise around the transformer in the mutation room. So we stopped the irradiation works and analyzed and repaired the APS. The main course of the problem is the deterioration of IGBT and thyristors which are components of phase controller. We replaced this by new one and APS is now operating well

  13. Coated particle assemblies for the concomitant pulmonary administration of budesonide and salbutamol sulphate.

    Science.gov (United States)

    Raula, Janne; Rahikkala, Antti; Halkola, Tuomas; Pessi, Jenni; Peltonen, Leena; Hirvonen, Jouni; Järvinen, Kristiina; Laaksonen, Timo; Kauppinen, Esko I

    2013-01-30

    The aims were to prepare stable and well-dispersible pulmonary fine powders composed of combination drugs with different water solubility, to facilitate concomitant release of corticosteroid budesonide and short acting β-agonist salbutamol sulphate and to improve the dissolution of the budesonide. The budesonide nanosuspensions were prepared by a wet milling which were mixed then with salbutamol sulphate, mannitol (bulking material) and leucine (coating material) for the preparation of micron-sized particles by an aerosol flow reactor wherein leucine formed a rough coating layer on particle surface. The stable and intact particle assemblies showed excellent aerosolization performance. The emitted doses from the inhaler, Easyhaler(®), were ~3 mg/dose with a coefficient variation of 0.1, and the fine particle fractions were ~50%. Complete dissolution of budesonide nanocrystals from the particles took place within 20 min with the same rate as salbutamol sulphate. Combining the two formulation technologies enabled the encapsulation of drugs with different solubility into a single, intact particle. The leucine coating provided excellent aerosolization properties which allowed fine powder delivery from the inhaler without carrier particles. This study showed the feasibility of preparing powders for combination therapy that are utilized, for instance, in inhalation therapy. Copyright © 2012 Elsevier B.V. All rights reserved.

  14. New Sulphated Flavonoids from Tamarix africana and Biological Activities of Its Polar Extract.

    Science.gov (United States)

    Karker, Manel; De Tommasi, Nunziatina; Smaoui, Abderrazak; Abdelly, Chedly; Ksouri, Riadh; Braca, Alessandra

    2016-10-01

    The phytochemical investigation of Tamarix africana Poir. (Tamaricaceae) shoot polar extract afforded three new sulphated flavonoids, (2 S ,4 R )-5,7,4'-trihydroxyflavan-4-ol 5,7-disulphate ( 1 ), (2 S )-5,7,4'-trihydroxyflavan 7- O -sulphate ( 2 ), and (2 S )-naringenin 4'- O -sulphate ( 3 ), together with ten known compounds. Their structures were determined by spectroscopic methods including 1D and 2D NMR analysis and HRMS. Biological activities of the polar extract of T. africana shoots related to its phenolic content were also investigated. A high total phenolic content (151.1 mg GAE/g) was found in the methanol shoot extract, which exhibits strong antioxidant activities using the oxygen radical absorbance capacity method and a skin cell-based assay. Moreover, the shoot extract showed significant anti-inflammatory activity, reducing nitric oxide release by 53.5 % at 160 µg/mL in lipopolysaccharide-stimulated RAW 264.7 macrophages. Finally, T. africana shoot extract inhibited the growth of A-549 lung carcinoma cells, with an IC 50 value of 34 µg/mL. Georg Thieme Verlag KG Stuttgart · New York.

  15. Structural features and antiviral activity of sulphated fucans from the brown seaweed Cystoseira indica.

    Science.gov (United States)

    Mandal, Pinaki; Mateu, Cecilia Gabriela; Chattopadhyay, Kausik; Pujol, Carlos Alberto; Damonte, Elsa Beatriz; Ray, Bimalendu

    2007-01-01

    Natural compounds offer interesting pharmacological perspectives for antiviral drug development. In this study, we have analysed sulphated-fucan-containing fractions isolated from the brown seaweed Cystoseira indica. The crude water extract (CiWE) and the main fraction (CiF3) obtained by anion exchange chromatography had potent antiviral activity against herpes simplex virus types 1 (HSV-1) and 2 (HSV-2) without cytotoxicity for Vero cell cultures. Furthermore, they had no direct inactivating effect on virions in a virucidal assay, and lacked anticoagulant activity. The mode of action of these compounds could be mainly ascribed to an inhibitory effect on virus adsorption. Chemical, chromatographic and spectroscopic methods showed that the major polysaccharide had an apparent molecular mass of 35 kDa and contained a backbone of alpha-(1 --> 3)-linked fucopyranosyl residues substituted at C-2 with fucopyranosyl and xylopyranosyl residues. This sulphated fucan, considered the active principle of the C. indica water extract, also contained variously linked xylose and galactose units and glucuronic acid residues. Sulphate groups, if present, are located mostly at C-4 of (1 --> 3)-linked fucopyranosyl units, and appeared to be very important for the anti-herpetic activity of this polymer.

  16. COMPARATIVE STUDY OF EFFICACY OF FERROUS SULPHATE AND CARBONYL IRON IN ANEMIA OF ANTENATAL WOMEN

    Directory of Open Access Journals (Sweden)

    Radhika

    2015-03-01

    Full Text Available Iron deficiency anemia is the most common and important public health problem all over the world in the risk group of antenatal women. Research is going on to improve the iron status of the pregnant women with different forms of iron available. In this regard, Carbonyl Iron is showing promising results in improving the red cell mass with better compliance. 120 antenatal women were recruited in this study. The study comprised of 6weeks for each patient. They were given Carbonyl Iron 100 mg/day and FeS04 100gm/day . Before and after treatment all the baseline and specific investigations were one. Results were tabulated, comparison and significance were tested by unpaired student ’s’ test and their 'p' value was calculated. Results were shown graphically also. Carbonyl Iron showed improvement in hemoglobin, PCV and better than ferrous Sulphate (P <0.001. Incidence of side effects were less with Carbonyl Iron than Ferrous Sulphate, better compliance was seen with Carbonyl Iron. In conclusion, the present study s howed that Carbonyl Iron had better efficacy and safety in the management of Iron deficiency anemia in antenatal women than ferrous Sulphate

  17. Inhibition of acetaminophen oxidation by cimetidine and the effects on glutathione and activated sulphate synthesis rates

    DEFF Research Database (Denmark)

    Dalhoff, K; Poulsen, H E

    1993-01-01

    The aim of the present study was to examine the effects of the hepatotoxic drug, acetaminophen, on the synthesis rates of glutathione, activated sulphate (PAPS, adenosine 3'-phosphate 5'-phosphosulphate) and the acetaminophen metabolites, acetaminophen-glutathione and acetaminophen-sulphate after...... with 60 micrograms/ml cimetidine for 30 min. did not affect PAPS (1.71 versus 1.78 nmol/10(6) cells) nor glutathione concentration (16.0 versus 16.4 nmol/10(6) cells). The subsequent incubation with 5 mM acetaminophen resulted in decreased PAPS synthesis in the cimetidine treated cells [0.79 x 10......(3) versus 0.92 x 10(3) nmol/(10(6) cells.hr)] (P acetaminophen-sulphate synthesis [1.73 versus 1.79 nmol/10(6) cells and 13.0 versus 12.9 nmol/(10(6) cells.hr), respectively]. Decreased PAPS synthesis may be related to decreased ATP supply or may...

  18. Yield of castor bean fertilized with sewage sludge and potassium and magnesium sulphate

    Directory of Open Access Journals (Sweden)

    Thâmara F. M. Cavalcanti

    2015-08-01

    Full Text Available ABSTRACTThe aim of this study was to evaluate the yield and nutrition of castor bean in response to fertilization with sewage sludge and potassium (K and magnesium (Mg sulphate. The experiment was carried out from January to July 2011. The treatments, in a randomized block design with three replicates, in a Nitosol, corresponded to a factorial scheme (2 x 4 +1: two doses of K and Mg sulphate combined with four doses of sewage sludge (0, 2.60, 5.20 and 10.40 t ha-1, dry basis, applied based on its nitrogen (N content and the N requirement for the crop and an additional treatment with NPK. The castor bean grain yield fertilized with sewage sludge did not differ from conventional fertilization, with the maximum value achieved at a dose of 7.5 t ha-1 of sewage sludge. The fertilization with sewage sludge increased zinc and copper levels in the soil to values close to or higher than those in conventional fertilization, without any influence on the concentrations in the leaf. Fertilization with K and Mg sulphate increased the levels of these cations in the soil without affecting the concentrations in the leaves. The fertilization with sewage sludge increased the contents of organic matter, sulfur, zinc, iron, copper and boron in the soil, and manganese and boron in castor bean leaves.

  19. Topical therapy of acne vulgaris using 2% tea lotion in comparison with5% Zinc sulphate lotion

    International Nuclear Information System (INIS)

    Sharquie, Khalifa E.; Noaimi, Adil A.; Al-Salih, Mazin M.

    2008-01-01

    Objective was to evaluate effectiveness of 2% tea lotion in comparisonwith 5% zinc sulphate solution in the treatment of acne vulgaris. This is asingle-blind randomly comparative therapeutic clinical trial carried out inthe Department of Dermatology, Baghdad Teaching Hospital, Iraq from June 2006to December 2007. Full history and clinical examination were studied for eachpatient regarding all relevant points of the disease, to evaluate theseverity of acne. Forty-seven patients with acne vulgaris were dividedrandomly into 2 groups and were instructed to use the following solutionstwice daily for 2 months; group A used 2% tea lotion, group B used 5% zincsulphate lotion. Patients with papulopustular lesions were included in thestudy, while patients with severe acne were excluded. The clinicalimprovement was scored by counting the number of inflammatory lesions beforeand after treatment. Forty patients completed the study, their ages rangedfrom 13-27 years with a mean+-standard deviation of 19.5+-3.5 years with 20patients in each group. Two percent tea lotion was statistically significantin decreasing the number of the inflammatory lesions in acne vulgaris, while5% zinc sulphate solution was beneficial, but did not reach statisticallysignificant level as tea lotion. Two percent of tea lotion was a goodalternative remedy to be used in the treatment of acne vulgaris and was muchsuperior than topical 5% zinc sulphate solution. (author)

  20. Production of granules of urea, urea-ammonium sulphate and urea-potassium chloride enriched with 15N

    International Nuclear Information System (INIS)

    Bendassolli, J.A.

    1991-01-01

    Using a pearling tower it was possible to produce granulated urea, and granulated mixtures of ammonium sulphate and urea, potassium chloride and urea, Labelled in 15 N. Granulated urea with 1, 2, 3 and 4 mm of diameter was obtained using a system with a heating controller. A low concentration of biuret was observed in the granules produced ( 15 N-Labelled ( 15 NH 4' 15 NH 2 ) with variable proportion of ammonium sulphate and urea. (author)

  1. Influence of sulphate on the composition and antibacterial and antiviral properties of the exopolysaccharide from Porphyridium cruentum.

    Science.gov (United States)

    Raposo, Maria Filomena de Jesus; de Morais, Alcina Maria Miranda Bernardo; de Morais, Rui Manuel Santos Costa

    2014-04-17

    The influence of two culture media and three different concentrations of sulphate in the medium on the growth of two strains of Porphyridium cruentum and on the production, composition and viscoelastic characteristics, and antimicrobial properties of the sulphated exopolysaccharide (EPS) were studied. A Bohlin C50 rheometer was used to evaluate the viscosity and elasticity of the EPS solutions. HSV virus, types 1 and 2, Vaccinia virus and Vesicular stomatitis virus were used along with two Gram-negative (Escherichia coli and Salmonella enteritidis) and one Gram-positive (Staphylococcus aureus) bacteria, for testing the antimicrobial activity of EPS. The growth of microalgae was higher in NTIP medium and the production of EPS was enhanced by sulphate 21mM. The protein content of the EPS was enhanced by the addition of sulphate 52mM and 104mM; this concentration also induced an increase in sulphate content of the EPS. However, neither the contents of EPS in carbohydrates and uronic acids were affected by the culture medium supplementation in sulphate. In general, the EPS from the Spanish strain presented a higher antiviral activity than the EPS from the Israeli strain. All EPS extracts revealed a strong activity against V. stomatitis virus, higher than the activity of all chemical compounds tested. The EPS from the Israeli strain also presented antibacterial activity against S. enteritidis. Enrichment of the culture medium with sulphate improved protein and sulphate content of EPS. EPS extracts presented a relevant activity against V. stomatitis virus and S. enteritidis bacterium. Copyright © 2014 Elsevier Inc. All rights reserved.

  2. Toxicology studies of primycin-sulphate using a three-dimensional (3D) in vitro human liver aggregate model.

    Science.gov (United States)

    Pénzes, Ágota; Mahmud Abdelwahab, Elhusseiny Mohamed; Rapp, Judit; Péteri, Zsanett A; Bovári-Biri, Judit; Fekete, Csaba; Miskei, György; Kvell, Krisztián; Pongrácz, Judit E

    2017-11-05

    Primycin-sulphate is a highly effective compound against Gram (G) positive bacteria. It has a potentially synergistic effect with vancomycin and statins which makes primycin-sulphate a potentially very effective preparation. Primycin-sulphate is currently used exclusively in topical preparations. In vitro animal hepatocyte and neuromuscular junction studies (in mice, rats, snakes, frogs) as well as in in vitro human red blood cell experiments were used to test toxicity. During these studies, the use of primycin-sulphate resulted in reduced cellular membrane integrity and modified ion channel activity. Additionally, parenteral administration of primycin-sulphate to mice, dogs, cats, rabbits and guinea pigs indicated high level of acute toxicity. The objective of this study was to reveal the cytotoxic and gene expression modifying effects of primycin-sulphate in a human system using an in vitro, three dimensional (3D) human hepatic model system. Within the 3D model, primycin-sulphate presented no acute cytotoxicity at concentrations 1μg/ml and below. However, even at low concentrations, primycin-sulphate affected gene expressions by up-regulating inflammatory cytokines (e.g., IL6), chemokines (e.g., CXCL5) and by down-regulating molecules of the lipid metabolism (e.g., peroxisome proliferator receptor (PPAR) alpha, gamma, etc). Down-regulation of PPAR alpha cannot just disrupt lipid production but can also affect cytochrome P450 metabolic enzyme (CYP) 3A4 expression, highlighting the need for extensive drug-drug interaction (DDI) studies before human oral or parenteral preparations can be developed. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Opposite effects of cell differentiation and apoptosis on Ap3A/Ap4A ratio in human cell cultures.

    Science.gov (United States)

    Vartanian, A; Prudovsky, I; Suzuki, H; Dal Pra, I; Kisselev, L

    1997-09-29

    The biological role of diadenosine oligophosphates (DAOP) remains obscure in spite of numerous attempts to solve this enigma. It is known that Ap3A contrary to Ap4A accumulates in human cultured cells treated with interferons (IFNs) alpha or gamma. Since IFNs are considered as antiproliferative regulators, we assumed that different cell status may be associated with varying intracellular levels of DAOP. Promyelocytic human cell line HL60 induced by phorbol ester (TPA) to differentiate to macrophage-like cells in culture exhibits a profound loss of proliferative potential. Here we have shown a 4-5-fold increase in Ap3A concentration in HL60 cells induced by TPA, similar to the effect of IFN, while the Ap4A concentration remained unchanged. On the contrary, in cells undergoing apoptosis induced by VP16, a topoisomerase II inhibitor, the Ap3A concentration considerably decreased, while the Ap4A concentration increased. These findings combined with earlier results suggest an involvement of the Ap3A/Ap4A ratio in signal transduction pathways controlling the cell status.

  4. [Ce(AP)Λ6 IΛ3-]Dy(AP)Λ6 IΛ3-DMF system at 0 deg C

    International Nuclear Information System (INIS)

    Rukk, N.S.; Kuznetsova, G.P.; Stepin, B.D.

    1985-01-01

    Using isothermal method at 0 deg C, phase equilibria in the system [Ce(AP) 6 ]I 3 -[Dy(AP) 6 ]I 3 -DMF have been studied. It is established, that in the system solid solutions with continuity break are formed, and distribution diagram is referred to type 5 of the Roozeboom classification

  5. Vanadia on sulphated-ZrO2, a promising catalyst for NO abatement with ammonia in alkali containing flue gases

    DEFF Research Database (Denmark)

    Kustov, Arkadii; Kustova, Marina; Fehrmann, Rasmus

    2005-01-01

    Vanadia supported on TiO2, ZrO2, and sulphated-ZrO2 have been prepared. These catalysts were characterized by elemental analysis, N-2-BET, XRD, FTIR, and NH3-TPD methods. The stability of surface sulphated groups, studied by FTIR- spectroscopy, was found to depend dramatically on the temperature...... to almost complete depression of the samples acidity and considerable weakening of the remaining acid sites for TiO2 and ZrO2 based systems. For the sulphated system, surface sulphur groups, due to their strong acidity, represent attractive sites for the localization of potassium oxide and the decrease...... and activity of the V2O5/sulphated-ZrO2 probably due to regeneration of surface sulphated groups at the reaction conditions. The potassium-doped V2O5/sulphated-ZrO2 catalyst reveal high activity and stability at 300 ° C, comparable with unpoisoned catalysts. At 400 ° C the presence of potassium compounds seems...

  6. A kinetic approach of sulphur behaviour in borosilicate glasses and melts: implications for sulphate incorporation in nuclear waste glasses

    Energy Technology Data Exchange (ETDEWEB)

    Lenoir, Marion [Service de Confinement des Dechets et Vitrification - Laboratoire d' Etudes de Base sur les Verres, CEA Valrho, Centre de Marcoule, 30207 Bagnols sur Ceze (France); Physique des Mineraux et des Magmas, UMR 7047 - CNRS, Institut de Physique du Globe de Paris, 7 place Jussieu, 75252 Paris Cedex 05 (France); Grandjean, Agnes [Service de Confinement des Dechets et Vitrification - Laboratoire d' Etudes de Base sur les Verres, CEA Valrho, Centre de Marcoule, 30207 Bagnols sur Ceze (France); Neuville, Daniel R. [Physique des Mineraux et des Magmas, UMR 7047 - CNRS, Institut de Physique du Globe de Paris, 7 place Jussieu, 75252 Paris Cedex 05 (France)

    2008-07-01

    The kinetics of sulphate decomposition in a borosilicate melt were studied using in situ Raman spectroscopy. This technique permits the quantification of the amount of sulphate dissolved in a borosilicate glass as a function of heating time by comparison with measurements obtained by microprobe WDS (Wavelength Dispersive Spectrometry). In order to quantify the content of sulphate obtained by Raman spectroscopy, the integrated intensity of the sulphate band at 985 cm{sup -1} was scaled to the sum of the integrated bands between 800 and 1200 cm{sup -1}, bands that are assigned to Q{sup n} silica units on the basis of previous literature. Viscosities of some borosilicate glasses are also presented here in order to study the kinetics of sulphate decomposition as a function of the viscosity of the melt. This underlines the importance of variations in viscosity depending on the composition of the melt and thus shows that viscosity is an important parameter governing the kinetics of decomposition of sulphate in borosilicate glasses. (authors)

  7. Hexagonal ZnO porous plates prepared from microwave synthesized layered zinc hydroxide sulphate via thermal decomposition

    Energy Technology Data Exchange (ETDEWEB)

    Machovsky, Michal, E-mail: machovsky@ft.utb.cz [Centre of Polymer Systems, University Institute, Tomas Bata University in Zlin, Nad Ovcirnou 3685, 760 01 Zlin (Czech Republic); Polymer Centre, Faculty of Technology, Tomas Bata University in Zlin, Nam. T.G. Masaryka 275, 762 72 Zlin (Czech Republic); Kuritka, Ivo, E-mail: ivo@kuritka.net [Centre of Polymer Systems, University Institute, Tomas Bata University in Zlin, Nad Ovcirnou 3685, 760 01 Zlin (Czech Republic); Polymer Centre, Faculty of Technology, Tomas Bata University in Zlin, Nam. T.G. Masaryka 275, 762 72 Zlin (Czech Republic); Sedlak, Jakub, E-mail: j1sedlak@ft.utb.cz [Centre of Polymer Systems, University Institute, Tomas Bata University in Zlin, Nad Ovcirnou 3685, 760 01 Zlin (Czech Republic); Polymer Centre, Faculty of Technology, Tomas Bata University in Zlin, Nam. T.G. Masaryka 275, 762 72 Zlin (Czech Republic); Pastorek, Miroslav, E-mail: pastorek@ft.utb.cz [Centre of Polymer Systems, University Institute, Tomas Bata University in Zlin, Nad Ovcirnou 3685, 760 01 Zlin (Czech Republic); Department of Polymer Engineering, Faculty of Technology, Tomas Bata University in Zlin, Nam. T.G. Masaryka 275, 762 72 Zlin (Czech Republic)

    2013-10-15

    Graphical abstract: - Highlights: • Zinc hydroxy sulphate was synthesized in 3 min via microwave hydrothermal route. • Zinc hydroxy sulphate was converted into mesh like porous ZnO by calcining at 900°. • The process of transformation is topotactic. - Abstract: Layered zinc hydroxide sulphate (ZHS) was prepared by microwave-assisted hydrothermal precipitation of zinc sulphate monohydrate with hexamethylenetetramine. Under ambient conditions, the structure of ZHS determined by X-ray diffraction (XRD) was found to be a mixture of zinc hydroxide sulphate pentahydrate Zn{sub 4}SO{sub 4}(OH){sub 6}·5H{sub 2}O and tetrahydrate Zn{sub 4}SO{sub 4}(OH){sub 6}·4H{sub 2}O. Fourier transform infrared (FTIR) spectroscopy was used for characterization of the prepared materials. Based on the interpretation of ZHS's thermal decomposition profile obtained by thermogravimetric analysis, ZnO of high purity was prepared by calcination at 900 °C for 2 h. The structure of the resulting ZnO was confirmed by the XRD. The morphology examination by scanning electron microscopy revealed a porous mesh-like ZnO structure developed from the ZHS precursor at the expense of mass removal due to the release of water and sulphate during the calcination.

  8. Characterization of the Bacterial and Sulphate Reducing Community in the Alkaline and Constantly Cold Water of the Closed Kotalahti Mine

    Directory of Open Access Journals (Sweden)

    Malin Bomberg

    2015-07-01

    Full Text Available Drainage from metal-sulphide rich rocks may cause considerable environmental stress in the form of elevated sulphate and heavy metal contamination of the environment. Mine draining effects from closed mines may be abated using indigenous and introduced microbial communities for sulphate reduction and metal precipitation at the mining site. Here we characterized the general and sulphate reducing bacterial (SRB community of Kotalahti Mine (Finland. The mine was flooded after closure and sulphate reduction and metal precipitation was induced by addition of pig manure sludge into the Vehkankuilu shaft. Water was sampled from Vehkankuilu and Ollinkuilu shafts from depths −10, −30, −70 and −100 m 15 years after the treatment. The water in the shafts differed from each other biologically and geochemically. The shafts are not directly connected except by some fracture zones, and the Ollinkuilu shaft is used as a reference for environmental monitoring. The detected bacterial communities from both shafts contained methylotrophic γ-Proteobacteria, hydrogenotrophic and methylotrophic β-Proteobacteria and fermenting bacterial clades. The concentration of SRB was low, at most 4.0 × 103 dsrB genes·mL−1, and the SRB affiliated with Desulfobulbus and Thermoanaerobacteriales clades. Despite the obvious success of the mine as an in situ bioreactor for increasing water pH and removing sulphate and heavy metals by induced sulphate reduction under suboptimal temperature, only a small portion, less than 0.5%, of the bacterial population in the mine water was SRB.

  9. Study on the influence of Sempervivum tectorum and Melatonin on Glutathion protective effects in rats blood exposed to Aluminum sulphate

    Directory of Open Access Journals (Sweden)

    Corina Gravila

    2014-05-01

    Full Text Available The present study was carried out to investigate the influence of Sempervivum tectorum aqueous extract and melatonin on reduced glutathione (GSH protective effect in Wistar albino rat blood exposed to aluminium sulphate- Al2(SO43. The rats were divided in one control group (C and 7 experimental groups (E. The control group received tap water. The experimental rats were feed the following way: E1 group – aluminum sulphate, daily, for 3 months; : E2 group – Sempervivum tectorum, daily, for 3 months; : E3 group – melatonin, daily, for 3 months; : E4 group – aluminum sulphate with Sempervivum tectorum, daily, for 3 months; : E5 group – aluminum sulphate with melatonin, daily, for 3 months; E6 group – aluminum sulphate, daily, for 3 months, and thereafter with Sempervivum tectorum for 1 month; E7 group – aluminum sulphate, daily, for 3 month, and thereafter with melatonin for 1 month. This study showed that Aluminum toxicity induced lower GSH. The oxidative stress caused by aluminum, given individual, is more pronounced than in the case in which aluminum is administered simultaneously with Sempervivum tectorum or melatonin. Decreasing GSH value is very small if Sempervivum tectorum or melatonin is given for one month, three months after the administration of aluminum. Effect induced by melatonin is more favorable than that of Sempervivum tectorum.

  10. Mineral commodity summaries 2016

    Science.gov (United States)

    Ober, Joyce A.

    2016-01-01

    This report is the earliest Government publication to furnish estimates covering 2015 nonfuel mineral industry data. Data sheets contain information on the domestic industry structure, Government programs, tariffs, and 5-year salient statistics for more than 90 individual minerals and materials

  11. Vitamins, Minerals, and Mood

    Science.gov (United States)

    Kaplan, Bonnie J.; Crawford, Susan G.; Field, Catherine J.; Simpson, J. Steven A.

    2007-01-01

    In this article, the authors explore the breadth and depth of published research linking dietary vitamins and minerals (micronutrients) to mood. Since the 1920s, there have been many studies on individual vitamins (especially B vitamins and Vitamins C, D, and E), minerals (calcium, chromium, iron, magnesium, zinc, and selenium), and vitamin-like…

  12. Mineral Commodity Summaries 2011

    Science.gov (United States)

    ,

    2011-01-01

    Each chapter of the 2011 edition of the U.S. Geological Survey (USGS) Mineral Commodity Summaries (MCS) includes information on events, trends, and issues for each mineral commodity as well as discussions and tabular presentations on domestic industry structure, Government programs, tariffs, 5-year salient statistics, and world production and resources. The MCS is the earliest comprehensive source of 2010 mineral production data for the world. More than 90 individual minerals and materials are covered by two-page synopses. For mineral commodities for which there is a Government stockpile, detailed information concerning the stockpile status is included in the two-page synopsis. Mineral Commodity Summaries 2011 contains new chapters on iron oxide pigments, wollastonite, and zeolites. The chapters on mica (natural), scrap and flake and mica (natural), sheet have been combined into a single chapter - mica (natural). Abbreviations and units of measure, and definitions of selected terms used in the report, are in Appendix A and Appendix B, respectively. "Appendix C - Reserves and Resources" has been divided into "Part A - Resource/Reserve Classification for Minerals" and "Part B - Sources of Reserves Data," including some information that was previously in this introduction. A directory of USGS minerals information country specialists and their responsibilities is Appendix D. The USGS continually strives to improve the value of its publications to users. Constructive comments and suggestions by readers of the MCS 2011 are welcomed.

  13. Mineral commodity summaries 2018

    Science.gov (United States)

    Ober, Joyce A.

    2018-01-31

    This report is the earliest Government publication to furnish estimates covering 2017 nonfuel mineral industry data. Data sheets contain information on the domestic industry structure, Government programs, tariffs, and 5-year salient statistics for more than 90 individual minerals and materials.

  14. AP1000R licensing and deployment in the United States

    International Nuclear Information System (INIS)

    Jordan, R. P.; Russ, P. A.; Filiak, P. P.; Castiglione, L. L.

    2012-01-01

    In recent years, both domestic and foreign utilities have turned to the standardized Westinghouse AP1000 plant design in satisfying their near - and long-term - sustainable energy needs. As direct support to these actions, licensing the AP1000 design has played a significant role by providing one of the fundamental bases in clearing regulatory hurdles leading to the start of new plant construction. Within the U.S. alone, Westinghouse AP1000 licensing activities have reached unprecedented milestones with the approvals of both AP1000 Design Certification and Southern Company's combined construction permit and operating license (COL) application directly supporting the construction of two new nuclear plants in Georgia. Further COL application approvals are immediately pending for an additional two AP1000 plants in South Carolina. And, across the U.S. nuclear industry spectrum, there are 10 other COL applications under regulatory review representing some 16 new plants at 10 sites. In total, these actions represent the first wave of new plant licensing under the regulatory approval process since 1978. Fundamental to the Nuclear Regulatory Commission's AP1000 Design Certification is the formal recognition of the AP1000 passive safety design through regulatory acceptance rulemaking. Through recognition and deployment of the AP1000 Design Certification, the utility licensee / operator of this reactor design are now offered an opportunity to use a simplified 'one-step' combined license process, thereby managing substantial back-end construction schedule risk from regulatory and intervention delays. Application of this regulatory philosophy represents both acceptance and encouragement of standardized reactor designs like the AP1000. With the recent AP1000 Design Certification and utility COL acceptances, the fundamental licensing processes of this philosophy have successfully proven the attainment of significant milestones with the next stage licensing actions directed

  15. MATHEMATICAL MODELING FOR BENZYLPENICILIN POTASSIUM AND STREPTOMYCIN SULPHATE POTENCY DETERMINATION OF ASCOMICIN

    Directory of Open Access Journals (Sweden)

    Viviana Ciuca

    2016-12-01

    Full Text Available Ascomicin is an antibacterial unguent for treatment of local infections of skin, eyes, outer ear, in cattle, sheep, pig, dog and cat. The product contains two active substances: benzylpenicillin potassium (Penicillin G potassium and streptomycin sulphate. The main characteristic of commercial product is benzylpenicillin potassium and streptomycin sulphate potency. The potency is estimated by comparing the inhibition of growth of sensitive micro-organisms produced by known concentrations of the antibiotic to be examined and a reference substance. The validation study aims to demonstrate the determination of the potency of benzylpenicillin potassium and streptomycin sulphate, it is an appropriate analytical method, reproducible and meets the quality requirements of Ascomicin product. The paper establishes the performance characteristics of the method considered and identify the factors that influence these characteristics. The diameters of inhibition zones, directly proportional to the logarithm of the concentration of the antibiotic used for the assay, measured and calculated using statistical methods (Combistats Soft. The assay is designed in such a way that the mathematical model on which the potency equation is based can be proved to be valid. A parallel-line model is chosen. The two log dose response lines of the preparation under examination and the standard preparation are parallel; they are rectilinear over the range of doses used in the calculation. These conditions are verified by validity tests for a given probability (P = 0.05. The test is not valid unless the confidence limits (P = 0.95 are not less than 50 per cent and not more than 200 per cent of the estimated potency. The estimated potency is not less than 95 per cent and not more than 105 per cent of the stated potency. The stated potency is not less than 19400 international units/g benzylpenicillin potassium and 13960 international units/g streptomycin sulphate. The validation

  16. Mineral industry in Australia

    International Nuclear Information System (INIS)

    Parbo, S.A.

    1982-01-01

    The paper reviews the history and growth of the mineral industry in Australia and its significance to the nation's economic growth and overseas trade, particularly over the last twenty years during which time production of coal, iron ore, manganese and mineral sands has increased greatly and new discoveries of petroleum, bauxite and nickel have given rise to major new industries. Australia ranks fourteenths in the value of world trade and is among the world's largest exporters of alumina, iron ore, mineral sands, coal, lead, zinc and nickel. Some details of production, processing and exports of the major minerals are given. Comment is made on the policies and roles of the six State Governments and the Federal Government in respect of ownership and control of the mining, processing and exporting of both energy and non-energy minerals. (orig.) [de

  17. Membranes and pathophysiological mineralization.

    Science.gov (United States)

    Roszkowska, Monika; Strzelecka-Kiliszek, Agnieszka; Magne, David; Pikula, Slawomir; Bessueille, Laurence

    Vascular calcification accompanies the pathological process of atherosclerotic plaque formation. Artery calcification results from trans-differentiation of vascular smooth muscle cells (VSMCs) into cells resembling mineralization-competent cells such as osteoblasts and chondrocytes. The activity of tissue-nonspecific alkaline phosphatase (TNAP), a GPI-anchored enzyme necessary for physiological mineralization, is induced in VSMCs in response to inflammation. TNAP achieves its mineralizing function being anchored to plasma membrane of mineralizing cells and to the surface of their derived matrix vesicles (MVs), and numerous important reports indicate that membranes play a crucial role in initiating the crystal formation. In this review, we would like to highlight various functions of lipids and proteins associated to membranes at different stages of both physiological mineralization and vascular calcification, with an emphasis on the pathological process of atherosclerotic plaque formation.

  18. Taxation of unmined minerals

    International Nuclear Information System (INIS)

    Bremberg, B.P.

    1989-01-01

    This paper reports on the Kentucky Revenue Cabinet which began implementing its controversial unmined minerals tax program. The Revenue Cabinet should complete its first annual assessment under this program in December, 1989. The Revenue Cabinet's initial efforts to collect basic data concerning the Commonwealth's coal bearing lands has yielded data coverage for 5 million of Kentucky's 10 million acres of coal lands. Approximately 1000 detailed information returns have been filed. The returns will be used to help create an undeveloped mineral reserves inventory, determine mineral ownership, and value mineral reserves. This new program is run by the Revenue Cabinet's Mineral Valuation Section, under the Division of Technical Support, Department of Property Taxation. It has been in business since September of 1988

  19. Marine Mineral Exploration

    DEFF Research Database (Denmark)

    The past 20 years have seen extensive marine exploration work by the major industrialized countries. Studies have, in part, been concentrated on Pacific manganese nodule occurrences and on massive sulfides on mid-oceanic ridges. An international jurisdictional framework of the sea-bed mineral...... resources was negotiated by the United Nations Conference on the Law of the Sea (UNCLOS III). A most important outcome of this conference was the establishment of an Exclusive Economic Zone (EEZ) of at least 200 nautical miles for all coastal states and the recognition of a deep-sea regime. Mineral deposits...... in EEZ areas are fairly unknown; many areas need detailed mapping and mineral exploration, and the majority of coastal or island states with large EEZ areas have little experience in exploration for marine hard minerals. This book describes the systematic steps in marine mineral exploration...

  20. Raising the acceptance of the AP2-line

    International Nuclear Information System (INIS)

    Trbojevic, D.

    1989-01-01

    The 120 GeV Main Ring proton beam collides with the target at the end of the AP-1 line and creates antiprotons and other secondary particles. The AP-2 line transfers the negative particles from the target to the Debuncher. To provide a bigger antiproton stack size in the Accumulator, both the Debuncher as well as the AP-2 line acceptance have to be raised. This is a proposal for the improvement of the AP-2 line acceptance. The first part of the memo presents an acceptance examination of the existing AP-2 line by computer simulation, while the second presents a short proposal for aperture corrections. The computer program TURTLE was used to trace antiprotons through the AP-2 line without taking into account other negative charged particles. Betatron functions were obtained from the output of the SYNCH computer program. The SYNCH program was also used to check the dispersion match between the AP-2 line and the Debuncher. 3 refs., 6 figs., 5 tabs