Broadband Wireline Provider Service: Asymmetric xDSL; BBRI_DSLasym12

Data.gov (United States)

University of Rhode Island Geospatial Extension Program — This dataset represents the availability of wireline broadband Internet access in Rhode Island via Asymmetric xDSL technology. Broadband availability is summarized...

Broadband Wireline Provider Service: Symmetric xDSL; BBRI_DSLsym12

Data.gov (United States)

University of Rhode Island Geospatial Extension Program — This dataset represents the availability of wireline broadband Internet access in Rhode Island via Symmetric xDSL technology. Broadband availability is summarized at...

Optimal Power Allocation for Downstream xDSL With Per-Modem Total Power Constraints: Broadcast Channel Optimal Spectrum Balancing (BC-OSB)

Science.gov (United States)

Le Nir, Vincent; Moonen, Marc; Verlinden, Jan; Guenach, Mamoun

2009-02-01

Recently, the duality between Multiple Input Multiple Output (MIMO) Multiple Access Channels (MAC) and MIMO Broadcast Channels (BC) has been established under a total power constraint. The same set of rates for MAC can be achieved in BC exploiting the MAC-BC duality formulas while preserving the total power constraint. In this paper, we describe the BC optimal power allo- cation applying this duality in a downstream x-Digital Subscriber Lines (xDSL) context under a total power constraint for all modems over all tones. Then, a new algorithm called BC-Optimal Spectrum Balancing (BC-OSB) is devised for a more realistic power allocation under per-modem total power constraints. The capacity region of the primal BC problem under per-modem total power constraints is found by the dual optimization problem for the BC under per-modem total power constraints which can be rewritten as a dual optimization problem in the MAC by means of a precoder matrix based on the Lagrange multipliers. We show that the duality gap between the two problems is zero. The multi-user power allocation problem has been solved for interference channels and MAC using the OSB algorithm. In this paper we solve the problem of multi-user power allocation for the BC case using the OSB algorithm as well and we derive a computational efficient algorithm that will be referred to as BC-OSB. Simulation results are provided for two VDSL2 scenarios: the first one with Differential-Mode (DM) transmission only and the second one with both DM and Phantom- Mode (PM) transmissions.

SAGA: A DSL for Story Management

Directory of Open Access Journals (Sweden)

Lucas Beyak

2011-09-01

Full Text Available Video game development is currently a very labour-intensive endeavour. Furthermore it involves multi-disciplinary teams of artistic content creators and programmers, whose typical working patterns are not easily meshed. SAGA is our first effort at augmenting the productivity of such teams. Already convinced of the benefits of DSLs, we set out to analyze the domains present in games in order to find out which would be most amenable to the DSL approach. Based on previous work, we thus sought those sub-parts that already had a partially established vocabulary and at the same time could be well modeled using classical computer science structures. We settled on the 'story' aspect of video games as the best candidate domain, which can be modeled using state transition systems. As we are working with a specific company as the ultimate customer for this work, an additional requirement was that our DSL should produce code that can be used within a pre-existing framework. We developed a full system (SAGA comprised of a parser for a human-friendly language for 'story events', an internal representation of design patterns for implementing object-oriented state-transitions systems, an instantiator for these patterns for a specific 'story', and three renderers (for C++, C# and Java for the instantiated abstract code.

Segmenting the Cable Audience by Reason for Subscribing.

Science.gov (United States)

Umphrey, Don

1988-01-01

Compares the habits and attitudes of those who subscribed to cable television for better reception with those who subscribed for either greater programing selection or more movies. Finds attitudes vary more than television use between those who subscribe to get better reception and those who subscribe to get more programs. (RS)

Towards Error Handling in a DSL for Robot Assembly Tasks

DEFF Research Database (Denmark)

Laursen, Johan S.; Buch, Jacob P.; Sørensen, Lars C.

This work-in-progress paper presents our work with a domain specific language (DSL) for tackling the issue of programming robots for small-sized batch production. We observe that as the complexity of assembly increases so does the likelihood of errors, and these errors need to be addressed...

Towards Interactive, Incremental Programming of ROS Nodes

DEFF Research Database (Denmark)

Adam, Marian Sorin; Schultz, Ulrik Pagh

Writing software for controlling robots is a complex task, usually demanding command of many programming languages and requiring significant experimentation. We believe that a bottom-up development process that complements traditional component- and MDSD-based approaches can facilitate...... experimentation. We propose the use of an internal DSL providing both a tool to interactively create ROS nodes and a behaviour-replacement mechanism to interactively reshape existing ROS nodes by wrapping the external interfaces (the publish/subscribe topics), dynamically controlled using the Python command line...

Quality-constrained routing in publish/subscribe systems

NARCIS (Netherlands)

Zieba, Bogumil; van Sinderen, Marten J.; Wegdam, M.

2005-01-01

Routing in publish/subscribe (pub/sub) features a communication model where messages are not given explicit destination addresses, but destinations are determined by matching the subscription declared by subscribers. For a dynamic computing environment with applications that have quality demands,

Architectural Analysis of Systems Based on the Publisher-Subscriber Style

Science.gov (United States)

Ganesun, Dharmalingam; Lindvall, Mikael; Ruley, Lamont; Wiegand, Robert; Ly, Vuong; Tsui, Tina

2010-01-01

Architectural styles impose constraints on both the topology and the interaction behavior of involved parties. In this paper, we propose an approach for analyzing implemented systems based on the publisher-subscriber architectural style. From the style definition, we derive a set of reusable questions and show that some of them can be answered statically whereas others are best answered using dynamic analysis. The paper explains how the results of static analysis can be used to orchestrate dynamic analysis. The proposed method was successfully applied on the NASA's Goddard Mission Services Evolution Center (GMSEC) software product line. The results show that the GMSEC has a) a novel reusable vendor-independent middleware abstraction layer that allows the NASA's missions to configure the middleware of interest without changing the publishers' or subscribers' source code, and b) some high priority bugs due to behavioral discrepancies, which were eluded during testing and code reviews, among different implementations of the same APIs for different vendors.

Modern techniques and technologies for unbundled access in the local loop

Science.gov (United States)

Bacis Vasile, Irina Bristena; Schiopu, Paul; Marghescu, Cristina

2015-02-01

The efficient and unbundled use of the existing telecommunications infrastructure represents a major goal for the development of the services offered by telecommunications providers. A major telecommunications operator can provide services to a subscriber using a copper wire pair or part of the frequency spectrum of a copper wire pair, together with other operators, through a process of unbundling access in the local loop. Since access to the vocal band is an already solved problem, concerns turn to the broadband access with xDSL service delivery on ungrouped subscriber loops; besides the legal and economic aspects involved this has become an engineering problem also. The local loop unbundling methods have a substantial technical impact. This impact should be taken into account right from the design stage and then in the standardization stage of broadband systems intended to operate on copper wire pairs in the local loop. These systems are known under the generic term of xDSL and began to be analyzed in the late 90s. xDSL became the dominant solution for providing Internet at a reasonable price for both residential and business subscribers. In this massive development scenario, certain problems will arise from the early stages of deployment, and another type of problems will occur later on when a large number of systems will be installed in a single beam.

Publish Subscribe Systems Design and Principles

CERN Document Server

Tarkoma, Sasu

2012-01-01

This book offers an unified treatment of the problems solved by publish/subscribe, how to design and implement the solutions In this book, the author provides an insight into the publish/subscribe technology including the design, implementation, and evaluation of new systems based on the technology.  The book also addresses the basic design patterns and solutions, and discusses their application in practical application scenarios. Furthermore, the author examines current standards and industry best practices as well as recent research proposals in the area. Finally, necessary content ma

Penaeoid and sergestoid shrimps from the deep scattering layer (DSL) in the Arabian Sea

Digital Repository Service at National Institute of Oceanography (India)

Karuppasamy, P.K.; Menon, N.G.

Results of a preliminary study on the occurrence and distribution of seventeen species of Penaeoid and Sergestoid shrimps from the deep scattering layer (DSL) of the Indian EEZ of Arabian Sea are presented here based on the IKMT samples collected...

Secret Forwarding of Events over Distributed Publish/Subscribe Overlay Network.

Science.gov (United States)

Yoon, Young; Kim, Beom Heyn

2016-01-01

Publish/subscribe is a communication paradigm where loosely-coupled clients communicate in an asynchronous fashion. Publish/subscribe supports the flexible development of large-scale, event-driven and ubiquitous systems. Publish/subscribe is prevalent in a number of application domains such as social networking, distributed business processes and real-time mission-critical systems. Many publish/subscribe applications are sensitive to message loss and violation of privacy. To overcome such issues, we propose a novel method of using secret sharing and replication techniques. This is to reliably and confidentially deliver decryption keys along with encrypted publications even under the presence of several Byzantine brokers across publish/subscribe overlay networks. We also propose a framework for dynamically and strategically allocating broker replicas based on flexibly definable criteria for reliability and performance. Moreover, a thorough evaluation is done through a case study on social networks using the real trace of interactions among Facebook users.

Utilization and challenges of online subscribed databases by ...

African Journals Online (AJOL)

The paper investigated the Utilization and Challenges of Online Databases Subscribed to by university libraries in Katsina State. Objectives of the study were to find out the types of online subscribed databases used by academics in universities in Katsina; the extent to which the academics in the universities use the online ...

Secret Forwarding of Events over Distributed Publish/Subscribe Overlay Network.

Directory of Open Access Journals (Sweden)

Young Yoon

Full Text Available Publish/subscribe is a communication paradigm where loosely-coupled clients communicate in an asynchronous fashion. Publish/subscribe supports the flexible development of large-scale, event-driven and ubiquitous systems. Publish/subscribe is prevalent in a number of application domains such as social networking, distributed business processes and real-time mission-critical systems. Many publish/subscribe applications are sensitive to message loss and violation of privacy. To overcome such issues, we propose a novel method of using secret sharing and replication techniques. This is to reliably and confidentially deliver decryption keys along with encrypted publications even under the presence of several Byzantine brokers across publish/subscribe overlay networks. We also propose a framework for dynamically and strategically allocating broker replicas based on flexibly definable criteria for reliability and performance. Moreover, a thorough evaluation is done through a case study on social networks using the real trace of interactions among Facebook users.

Authenticated Location-Aware Publish/Subscribe Services in Untrusted Outsourced Environments

Directory of Open Access Journals (Sweden)

Han Yan

2017-01-01

Full Text Available Location-aware publish/subscribe is an important location-based service based on server-initiated model. Often times, the owner of massive spatio-textual messages and subscriptions outsources its location-aware publish/subscribe services to a third-party service provider, for example, cloud service provider, who is responsible for delivering messages to their relevant subscribers. The issue arising here is that the messages delivered by the service provider might be tailored for profit purposes, intentionally or not. Therefore, it is essential to develop mechanisms which allow subscribers to verify the correctness of the messages delivered by the service provider. In this paper, we study the problem of authenticating messages in outsourced location-aware publish/subscribe services. We propose an authenticated framework which not only can deliver the messages efficiently but also can make the subscribers’ authentication available with low cost. Extensive experiments on a real-world dataset demonstrate the effectiveness and efficiency of our proposed authenticated framework.

Integration of data validation and user interface concerns in a DSL for web applications

NARCIS (Netherlands)

Groenewegen, D.M.; Visser, E.

2009-01-01

This paper is a pre-print of: Danny M. Groenewegen, Eelco Visser. Integration of Data Validation and User Interface Concerns in a DSL for Web Applications. In Mark G. J. van den Brand, Jeff Gray, editors, Software Language Engineering, Second International Conference, SLE 2009, Denver, USA, October,

Motif Subscriber Menonton Channel YouTube Raditya Dika

OpenAIRE

Mellyaningsih, Adinda

2016-01-01

Penelitian ini dilakukan untuk mengetahui motif para subscriber dalam menonton channelYouTube Raditya Dika. Raditya Dika merupakan YouTuber Indonesia dengan jumlah subscriber terbanyak dan merupakan orang pertama di Indonesia yang mendapatkan penghargaan Certifies Award oleh YouTube. Peneliti menggunakan teori Uses and Gratification dengan empat indikator, yaitu hiburan dan relaksasi, hubungan antar pribadi, mencari informasi, dan persahabatan. Metode dalam penelitian ini adalah online survei...

List of subscribers as the source of data on book history and the history of reading: case study of book subscribers' lists printed in Dalmatia in the early 19th century

Directory of Open Access Journals (Sweden)

Jelena Lakuš

2013-02-01

Full Text Available Customer networks or lists of subscribers as a new publishing phenomenon first occurred in Dalmatia in the early 19th century. It was a model of collective funding of book, magazine and newspaper publishing, which gradually replaced the earlier system of individual patronage. It resulted in the publication of lists of subscribers that contained the names of all those who financially supported the printing of a book. The data on names of subscribers, their occupation, place of residence and number of copies ordered, which was the usual content of subscribers, lists, make them very valuable sources for research on the history of books and reading. This paper tries to show the research potential of such lists by presenting a case-study of five preserved and available subscribers' lists found in publications printed between 1835 and 1848 in the Zadar print shop of Battara brothers. The paper analyses the quantitative data on subscribers, their geographical distribution, professional profile and gender, which does not exhaust their research potential in full. The analysis has shown that despite the austere educational opportunities, high incidence of unemployment, and many other limitations, there were people who treasured the written word. The subscribers mostly came from coastal cities like Zadar, Split and Dubrovnik, which were the most important publishing and cultural centres. Even though the subscribers came from Austria, Military Border, Italy, Croatia proper and Slavonia, as well as Bosnia and Herzegovina, which was then part of the Ottoman Empire, they make up only one eight of the total number of subscribers in the corpus. The subscribers are both Roman-Catholic and Orthodox, who mostly subscribed to books printed in the Cyrillic script. The subscribers come from a wide range of professions, mostly from the church circles in Dalmatia, and the fewest of them were professors and teachers, members of the army and the police. As expected

The art of Spectral Management ; Upstream power back-off for VDSL2 - Whitepaper DSL05

NARCIS (Netherlands)

Brink, R.F.M. van den

2009-01-01

Spectral Management (SpM) involves managing an access network such that different systems can co-exist with each other. In relation to DSL systems, spectral management ensures that they can co-exist within the same cable. The use of spectral signal limits (specified via mandatory access rules) is

Reconfiguration Service for Publish/Subscribe Middleware

NARCIS (Netherlands)

Zieba, Bogumil; Glandrup, Maurice; van Sinderen, Marten J.; Wegdam, M.

2006-01-01

Mission-critical, distributed systems are often designed as a set of distributed, components that interact using publish/subscribe middleware. Currently, in these systems, software components are usually statically allocated to the nodes to fulfil predictability, reliability requirements. However, a

Subscriber Response System. Progress Report.

Science.gov (United States)

Callais, Richard T.

Results of preliminary tests made prior and subsequent to the installation of a two-way interactive communication system which involves a computer complex termed the Local Processing Center and subscriber terminals located in the home or business location are reported. This first phase of the overall test plan includes tests made at Theta-Com…

ScaMo: Realisation of an OO-functional DSL for cross platform mobile applications development

Science.gov (United States)

Macos, Dragan; Solymosi, Andreas

2013-10-01

The software market is dynamically changing: the Internet is going mobile, the software applications are shifting from the desktop hardware onto the mobile devices. The largest markets are the mobile applications for iOS, Android and Windows Phone and for the purpose the typical programming languages include Objective-C, Java and C ♯. The realization of the native applications implies the integration of the developed software into the environments of mentioned mobile operating systems to enable the access to different hardware components of the devices: GPS module, display, GSM module, etc. This paper deals with the definition and possible implementation of an environment for the automatic application generation for multiple mobile platforms. It is based on a DSL for mobile application development, which includes the programming language Scala and a DSL defined in Scala. As part of a multi-stage cross-compiling algorithm, this language is translated into the language of the affected mobile platform. The advantage of our method lies in the expressiveness of the defined language and the transparent source code translation between different languages, which implies, for example, the advantages of debugging and development of the generated code.

Sinkronisasi Content E-learning Terdistribusi Berbasis Model Komunikasi Indirect Menggunakan Sistem Publish-Subscribe

Directory of Open Access Journals (Sweden)

Sufrendo Saputra

2017-01-01

Full Text Available Sinkronisasi content antar e-learning memungkinkan beberapa e-learning memiliki content yang sama secara konsisten. Perubahan content pada salah satu e-learning akan membuat sistem memastikan e-learning lain mengetahui perubahan tersebut. Model komunikasi yang memungkinkan adanya sinkronisasi ini merupakan komunikasi indirect berbasis publish-subscribe. Setiap e-learning memiliki content-nya masing-masing yang secara otomatis akan di-publish oleh sistem. E-learning lain yang tergabung dalam sistem sinkronisasi kemudian dapat memilih content mana yang ingin di-subscribe. Jika terdapat perubahan pada sebuah content, dan content tersebut memiliki subscriber, maka sistem akan memberitahu subscriber bahwa telah terjadi perubahan pada content. Teknologi utama yang digunakan dalam sistem ini adalah Moodle, PHP, dan Java. Moodle sebagai modul yang digunakan untuk mensimulasikan e-learning. PHP dan Java sebagai framework dari sistem sinkronisasi. Model komunikasi yang digunakan merupakan komunikasi indirect berbasis publish-subscribe. Model komunikasi ini menempatkan sebuah perantara bagi komunikasi antar e-learning.

How new subscribers use cancer-related online mailing lists.

Science.gov (United States)

Rimer, Barbara K; Lyons, Elizabeth J; Ribisl, Kurt M; Bowling, J Michael; Golin, Carol E; Forlenza, Michael J; Meier, Andrea

2005-07-01

Online cancer-related support is an under-studied resource that may serve an important function in the information seeking, care, and support of cancer patients and their families. With over 9.8 million cancer survivors (defined as anyone living with cancer) in the United States alone and the number growing worldwide, it is important to understand how they seek and use online resources to obtain the information they need, when they need it, and in a form and manner appropriate to them. These are stated cancer communication goals of the US National Cancer Institute. Our purposes are to (1) present background information about online mailing lists and electronic support groups, (2) describe the rationale and methodology for the Health eCommunities (HeC) study, and (3) present preliminary baseline data on new subscribers to cancer-related mailing lists. In particular, we describe subscribers' use of mailing lists, their reasons for using them, and their reactions to participating shortly after joining the lists. From April to August 2004, we invited all new subscribers to 10 Association of Cancer Online Resources mailing lists to complete Web-based surveys. We analyzed baseline data from the respondents to examine their perceptions about cancer-related mailing lists and to describe how cancer patients and survivors used these lists in the period shortly after joining them. Cumulative email invitations were sent to 1368 new mailing list subscribers; 293 Web surveys were completed within the allotted time frame (21.4% response rate). Most respondents were over age 50 (n = 203, 72%), white (n = 286, 98%), college graduates (n = 161, 55%), and had health insurance (n = 283, 97%). About 41% (n = 116) of new subscribers reported spending 1 to 3 hours per day reading and responding to list messages. They used the mailing lists for several reasons. Among the most frequently reported, 62% (n = 179) strongly agreed they used mailing lists to obtain information on how to deal

47 CFR 64.1170 - Reimbursement procedures where the subscriber has paid charges.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 3 2010-10-01 2010-10-01 false Reimbursement procedures where the subscriber... Preferred Telecommunications Service Providers § 64.1170 Reimbursement procedures where the subscriber has... reimburse the authorized carrier for reasonable expenses. (e) If the authorized carrier has not received...

GPON FTTH trial: lessons learned

Science.gov (United States)

Weis, Erik; Hölzl, Rainer; Breuer, Dirk; Lange, Christoph

2009-11-01

This paper reports on a FTTH field trial with GPON (Gigabit-capable passive optical network) technology in the network of Deutsche Telekom in the region of the cities of Berlin and Potsdam. Focus of this trial was to gain practical experience regarding GPON technology, fibre installation in existing ducts with micro duct technology, fibre cabling in customer buildings and impact on operational processes. Furthermore it is reported on an initial Deutsche Telekom FTTB deployment based on GPON technology in the city of Dresden with the main targets to obtain practical deployment and operation experiences with fibre-based access networks and to provide broadband access to a part of the city formerly not servable by DSL (digital subscriber line) technology.

Design of a Domain-Specific Language for Material Flow Analysis using Microsoft DSL tools: An Experience Paper

DEFF Research Database (Denmark)

Zarrin, Bahram; Baumeister, Hubert

2014-01-01

Material Flow Analysis (MFA) is the procedure of measuring and assessing the mass flows of matter (solid waste, water, food...) and substances (carbon, phosphorus ...) within a process or a system for the period of time. In this paper we propose a Domain-Specific Language (DSL) to model MFA in a ...

Joint-2D-SL0 Algorithm for Joint Sparse Matrix Reconstruction

Directory of Open Access Journals (Sweden)

Dong Zhang

2017-01-01

Full Text Available Sparse matrix reconstruction has a wide application such as DOA estimation and STAP. However, its performance is usually restricted by the grid mismatch problem. In this paper, we revise the sparse matrix reconstruction model and propose the joint sparse matrix reconstruction model based on one-order Taylor expansion. And it can overcome the grid mismatch problem. Then, we put forward the Joint-2D-SL0 algorithm which can solve the joint sparse matrix reconstruction problem efficiently. Compared with the Kronecker compressive sensing method, our proposed method has a higher computational efficiency and acceptable reconstruction accuracy. Finally, simulation results validate the superiority of the proposed method.

AGM: A DSL for mobile cloud computing based on directed graph

Science.gov (United States)

Tanković, Nikola; Grbac, Tihana Galinac

2016-06-01

This paper summarizes a novel approach for consuming a domain specific language (DSL) by transforming it to a directed graph representation persisted by a graph database. Using such specialized database enables advanced navigation trough the stored model exposing only relevant subsets of meta-data to different involved services and components. We applied this approach in a mobile cloud computing system and used it to model several mobile applications in retail, supply chain management and merchandising domain. These application are distributed in a Software-as-a-Service (SaaS) fashion and used by thousands of customers in Croatia. We report on lessons learned and propose further research on this topic.

A Scala DSL for RETE-Based Runtime Verification

Science.gov (United States)

Havelund, Klaus

2013-01-01

Runtime verification (RV) consists in part of checking execution traces against formalized specifications. Several systems have emerged, most of which support specification notations based on state machines, regular expressions, temporal logic, or grammars. The field of Artificial Intelligence (AI) has for an even longer period of time studied rule-based production systems, which at a closer look appear to be relevant for RV, although seemingly focused on slightly different application domains, such as for example business processes and expert systems. The core algorithm in many of these systems is the Rete algorithm. We have implemented a Rete-based runtime verification system, named LogFire (originally intended for offline log analysis but also applicable to online analysis), as an internal DSL in the Scala programming language, using Scala's support for defining DSLs. This combination appears attractive from a practical point of view. Our contribution is in part conceptual in arguing that such rule-based frameworks originating from AI may be suited for RV.

Subscribe to NIH MedlinePlus the Magazine

Science.gov (United States)

... turn Javascript on. Subscribe to NIH MedlinePlus the magazine NIH MedlinePlus the magazine is published quarterly, in print and on the ... up for a free subscription to NIH MedlinePlus Magazine. Librarians may order this magazine in bulk . Please ...

47 CFR 76.1619 - Information on subscriber bills.

Science.gov (United States)

2010-10-01

... subscriber within 30 days. (c) A cable franchise authority may enforce the customer service standards set forth in this section against cable operators. The franchise authority must provide affected cable...

Realizing IoT service's policy privacy over publish/subscribe-based middleware.

Science.gov (United States)

Duan, Li; Zhang, Yang; Chen, Shiping; Wang, Shiyao; Cheng, Bo; Chen, Junliang

2016-01-01

The publish/subscribe paradigm makes IoT service collaborations more scalable and flexible, due to the space, time and control decoupling of event producers and consumers. Thus, the paradigm can be used to establish large-scale IoT service communication infrastructures such as Supervisory Control and Data Acquisition systems. However, preserving IoT service's policy privacy is difficult in this paradigm, because a classical publisher has little control of its own event after being published; and a subscriber has to accept all the events from the subscribed event type with no choice. Few existing publish/subscribe middleware have built-in mechanisms to address the above issues. In this paper, we present a novel access control framework, which is capable of preserving IoT service's policy privacy. In particular, we adopt the publish/subscribe paradigm as the IoT service communication infrastructure to facilitate the protection of IoT services policy privacy. The key idea in our policy-privacy solution is using a two-layer cooperating method to match bi-directional privacy control requirements: (a) data layer for protecting IoT events; and (b) application layer for preserving the privacy of service policy. Furthermore, the anonymous-set-based principle is adopted to realize the functionalities of the framework, including policy embedding and policy encoding as well as policy matching. Our security analysis shows that the policy privacy framework is Chosen-Plaintext Attack secure. We extend the open source Apache ActiveMQ broker by building into a policy-based authorization mechanism to enforce the privacy policy. The performance evaluation results indicate that our approach is scalable with reasonable overheads.

An active 3-dimensional localization scheme for femtocell subscribers using E-UTRAN

KAUST Repository

Mohammed, Aquil Mirza; Muhammad, Zeeshan Shakir; Alouini, Mohamed-Slim

2012-01-01

Femtocells provide an efficient solution to overcome the indoor coverage problems and also to deal with the traffic within Macro cells. The possibility of localizing femtocell subscriber stations based on the timing ranging advance parameter (TRAP), obtained from E-UTRAN (Evolved UMTS Terrestrial Radio Access Network), within the network signal internals is challenging and is studied throughout in this paper. The principle approach to localization based on Euclidean distances from multiple base stations is outlined.We investigate the specifications of the timing parameters or TRAP used for air interface of 4G network as they relate to calculating the subscriber distances. Computer simulation is used to demonstrate the localization accuracy using multiple base station networks when estimating likely locations of femtocell subscribers stations on a twodimensional coordinate mapping system. However, we further extend our simulations to demonstrate expected location accuracy of subscriber stations, for multiple base station networks, on a three dimensional coordinate mapping scheme. The possibility of of error-fixes shows eight times greater accuracy than in previous results is expected to achieve by applying timing advance techniques to Global System for Mobile communications networks, by using a two-dimensional coordinate mapping scheme. We later compare our study with the effect of global positioning system (GPS) by using a three-dimensional coordinate mapping scheme, which is predicted to give an 72.4 cms accuracy of subscriber station location. © 2012 IEEE.

An active 3-dimensional localization scheme for femtocell subscribers using E-UTRAN

KAUST Repository

Mohammed, Aquil Mirza

2012-05-01

Femtocells provide an efficient solution to overcome the indoor coverage problems and also to deal with the traffic within Macro cells. The possibility of localizing femtocell subscriber stations based on the timing ranging advance parameter (TRAP), obtained from E-UTRAN (Evolved UMTS Terrestrial Radio Access Network), within the network signal internals is challenging and is studied throughout in this paper. The principle approach to localization based on Euclidean distances from multiple base stations is outlined.We investigate the specifications of the timing parameters or TRAP used for air interface of 4G network as they relate to calculating the subscriber distances. Computer simulation is used to demonstrate the localization accuracy using multiple base station networks when estimating likely locations of femtocell subscribers stations on a twodimensional coordinate mapping system. However, we further extend our simulations to demonstrate expected location accuracy of subscriber stations, for multiple base station networks, on a three dimensional coordinate mapping scheme. The possibility of of error-fixes shows eight times greater accuracy than in previous results is expected to achieve by applying timing advance techniques to Global System for Mobile communications networks, by using a two-dimensional coordinate mapping scheme. We later compare our study with the effect of global positioning system (GPS) by using a three-dimensional coordinate mapping scheme, which is predicted to give an 72.4 cms accuracy of subscriber station location. © 2012 IEEE.

A low complexity based spectrum management algorithm for ‘Near–Far’ problem in VDSL environment

Directory of Open Access Journals (Sweden)

Sunil Sharma

2015-10-01

Full Text Available In digital subscriber line (DSL system, crosstalk created by electromagnetic interference among twisted pairs degrades the system performance. Very high bit rate DSL (VDSL, utilizes higher bandwidth of copper cable for data transmission. During upstream transmission, a ‘Near–Far’ problem occurs in VDSL system. In this problem the far end crosstalk (FEXT is produced from near end user degrades the data rate achieved at the far end user. The effect of FEXT can be reduced by properly managing power spectral densities (PSD of transmitters of near and far users. This kind of power allocation is called dynamic spectrum management (DSM. In this paper, a new distributed DSM algorithm is proposed in which power from only those sub channels of near end user are reduced which create interference to far end user. This power back off strategy takes place with the help of power spectral density (PSD masks at interference creating sub channels of near end user. The simulation results of the proposed algorithm show an improvement in terms of data rate and approaches near to that of optimal spectrum balancing (OSB algorithm.

Scalable Security and Accounting Services for Content-Based Publish/Subscribe Systems

OpenAIRE

Himanshu Khurana; Radostina K. Koleva

2006-01-01

Content-based publish/subscribe systems offer an interaction scheme that is appropriate for a variety of large-scale dynamic applications. However, widespread use of these systems is hindered by a lack of suitable security services. In this paper, we present scalable solutions for confidentiality, integrity, and authentication for these systems. We also provide verifiable usage-based accounting services, which are required for e-commerce and e-business applications that use publish/subscribe ...

Subscribe to the Preserve America E-Newsletter

Science.gov (United States)

; the U.S. Departments of Defense, Interior, Agriculture, Commerce, Housing and Urban Development . Department of Commerce seal U.S. Department of Housing and Urban Development logo U.S. Department of the Interior seal Subscribe to the Preserve America E-Newsletter Sign up for the periodical Preserve America e

Service Differentiation in Residential Broadband Networks

DEFF Research Database (Denmark)

Sigurdsson, Halldór Matthias

2004-01-01

As broadband gains widespread adoption with residential users, revenue generating voice- and video-services have not yet taken off. This slow uptake is often attributed to lack of Quality of Service management in residential broadband networks. To resolve this and induce service variety, network...... access providers are implementing service differentiation in their networks where voice and video gets prioritised before data. This paper discusses the role of network access providers in multipurpose packet based networks and the available migration strategies for supporting multimedia services...... in digital subscriber line (DSL) based residential broadband networks. Four possible implementation scenarios and their technical characteristics and effects are described. To conclude, the paper discusses how network access providers can be induced to open their networks for third party service providers....

OPTIMASI PUBLISH-SUBSCRIBE ADAPTIF UNTUK MONITORING KEAMANAN SELASAR GEDUNG G4 TEKNIK ELEKTRO UNIVERSITAS NEGERI MALANG

Directory of Open Access Journals (Sweden)

I Made Wirawan

2017-10-01

Full Text Available Security and comfort become very important for every educational institution, especially college. Security and comfort should be properly integrated to create an ideal academic atmosphere. This research designs online security monitoring system of G4 TEUM's hallway area by utilizing social media using adaptive Publish Subscribe system. Publisher i.e. students upload the current condition of the G4 TEUM's hallway by utilizing social media: twitter, facebook or instagram, then brokers choose the uploaded data corresponding to G4 content to be sent in the form of notification to subscriber, which is TEUM security in the form of dynamic web application. The experimental results show that by using adaptive Publish-Subscribe method, the cpu usage is reduced by 31,76% and bandwith usage by 39,4%, compared with non-adaptive method, on data event obtained by both publisher and subscribe. Rasa aman dan nyaman merupakan salah satu hal  yang sangat berpengaruh pada dunia pendidikan dalam pembelajaran, khususnya di perguruan tinggi. Keamanan dan kenyamanan harus diintegrasikan dengan baik untuk menciptakan atmosfer akademik yang ideal. Penelitian ini merancang sistem pemantauan keamanan online di area selasar G4 TEUM dengan memanfaatkan media sosial yang menggunakan sistem Publish-Subscribe Adaptif. Publisher yaitu mahasiswa mengunggah kondisi terkini dari selasar G4 TEUM dengan memanfaatkan media sosial, seperti twitter, facebook, dan instagram, kemudian broker memilih data upload sesuai dengan konten G4 yang akan dikirimkan berupa notifikasi ke Subscriber, yaitu pihak keamanan TEUM dalam bentuk aplikasi web dinamis. Hasil percobaan menunjukkan bahwa dengan menggunakan metode Publish-Subscribe adaptif, penggunaan CPU berkurang sebesar 31,76% dan penggunaan bandwidth sebesar 39,4%, dibandingkan dengan metode non adaptif, pada data event yang diperoleh baik pada Publisher maupun Subscriber.

Defining DSL design principles for enhancing the requirements elicitation process

Directory of Open Access Journals (Sweden)

Gustavo Arroyo

2012-03-01

Full Text Available La Elicitación de Requisitos propicia el entendimiento de las necesidades de los usuarios con respecto a un desarrollo de software. Los métodos que se emplean provienen de las ciencias sociales por lo que se carece de una retroalimentación ejecutable. Consecuentemente, la primera versión del software podría no cumplir con las expectativas. El uso de DSLs como herramientas para el descubrimiento de requisitos es una idea aceptada, desafortunadamente, muy pocos trabajos en la literatura se enfocan en la definición de principios de diseño de DSLs. En este trabajo planteamos principios de diseño de DSLs orientados a la elicitación de requisitos, enseguida, generamos casos de prueba en ANTLR, Ruby y Curry. También, enunciamos el perfil que debe tener el nuevo analista de software. Con ello, se incrementa la retroalimentación entre los involucrados en el desarrollo de software y se mejora el producto.Requirements elicitation is concerned with learning and understanding the needs of users w.r.t. a new software development. Frequently the methods employed for requirements elicitation are adapted from areas like social sciences that do not include executable (prototype based on feedback. As a consequence, it is relatively common to discover that the first release does not fit the requirements defined at the beginning of the project. Using domain-specific languages (DSLs as an auxiliary tool for requirements elicitation is a commonly well accepted idea. Unfortunately, there are few works in the literature devoted to the definition of design principles for DSLs to be experienced in the frameworks for DSL developing such as ANTLR, Ruby, and Curry. We propose design principles for the DSL development (regardless of paradigm which are sufficient to model the domain in a requirements phase. Further more we enunciate a new profile for the requirements analyst and a set of elicitation steps. The use of DSLs not only giveus an immediate feedback with

Predicting subscriber dissatisfaction and improving retention in the wireless telecommunications industry.

Science.gov (United States)

Mozer, M C; Wolniewicz, R; Grimes, D B; Johnson, E; Kaushansky, H

2000-01-01

Competition in the wireless telecommunications industry is fierce. To maintain profitability, wireless carriers must control churn, which is the loss of subscribers who switch from one carrier to another.We explore techniques from statistical machine learning to predict churn and, based on these predictions, to determine what incentives should be offered to subscribers to improve retention and maximize profitability to the carrier. The techniques include logit regression, decision trees, neural networks, and boosting. Our experiments are based on a database of nearly 47,000 U.S. domestic subscribers and includes information about their usage, billing, credit, application, and complaint history. Our experiments show that under a wide variety of assumptions concerning the cost of intervention and the retention rate resulting from intervention, using predictive techniques to identify potential churners and offering incentives can yield significant savings to a carrier. We also show the importance of a data representation crafted by domain experts. Finally, we report on a real-world test of the techniques that validate our simulation experiments.

Distributing Knight. Using Type-Based Publish/Subscribe for Building Distributed Collaboration Tools

DEFF Research Database (Denmark)

Damm, Christian Heide; Hansen, Klaus Marius

2002-01-01

more important. We present Distributed Knight, an extension to the Knight tool, for distributed, collaborative, and gesture-based object-oriented modelling. Distributed Knight was built using the type-based publish/subscribe paradigm. Based on this case, we argue that type-based publish......Distributed applications are hard to understand, build, and evolve. The need for decoupling, flexibility, and heterogeneity in distributed collaboration tools present particular problems; for such applications, having the right abstractions and primitives for distributed communication becomes even....../subscribe provides a natural and effective abstraction for developing distributed collaboration tools....

Linking the environment, DAF-7/TGFβ signaling and LAG-2/DSL ligand expression in the germline stem cell niche.

Science.gov (United States)

Pekar, Olga; Ow, Maria C; Hui, Kailyn Y; Noyes, Marcus B; Hall, Sarah E; Hubbard, E Jane Albert

2017-08-15

The developmental accumulation of proliferative germ cells in the C. elegans hermaphrodite is sensitive to the organismal environment. Previously, we found that the TGFβ signaling pathway links the environment and proliferative germ cell accumulation. Neuronal DAF-7/TGFβ causes a DAF-1/TGFβR signaling cascade in the gonadal distal tip cell (DTC), the germline stem cell niche, where it negatively regulates a DAF-3 SMAD and DAF-5 Sno-Ski. LAG-2, a founding DSL ligand family member, is produced in the DTC and activates the GLP-1/Notch receptor on adjacent germ cells to maintain germline stem cell fate. Here, we show that DAF-7/TGFβ signaling promotes expression of lag-2 in the DTC in a daf-3- dependent manner. Using ChIP and one-hybrid assays, we find evidence for direct interaction between DAF-3 and the lag-2 promoter. We further identify a 25 bp DAF-3 binding element required for the DTC lag-2 reporter response to the environment and to DAF-7/TGFβ signaling. Our results implicate DAF-3 repressor complex activity as a key molecular mechanism whereby the environment influences DSL ligand expression in the niche to modulate developmental expansion of the germline stem cell pool. © 2017. Published by The Company of Biologists Ltd.

Planning Multitechnology Access Networks with Performance Constraints

Science.gov (United States)

Chamberland, Steven

Considering the number of access network technologies and the investment needed for the “last mile” of a solution, in today’s highly competitive markets, planning tools are crucial for the service providers to optimize the network costs and accelerate the planning process. In this paper, we propose to tackle the problem of planning access networks composed of four technologies/architectures: the digital subscriber line (xDSL) technologies deployed directly from the central office (CO), the fiber-to-the-node (FTTN), the fiber-to-the-micro-node (FTTn) and the fiber-to-the-premises (FTTP). A mathematical programming model is proposed for this planning problem that is solved using a commercial implementation of the branch-and-bound algorithm. Next, a detailed access network planning example is presented followed by a systematic set of experiments designed to assess the performance of the proposed approach.

ADSL Transceivers Applying DSM and Their Nonstationary Noise Robustness

Directory of Open Access Journals (Sweden)

Bostoen Tom

2006-01-01

Full Text Available Dynamic spectrum management (DSM comprises a new set of techniques for multiuser power allocation and/or detection in digital subscriber line (DSL networks. At the Alcatel Research and Innovation Labs, we have recently developed a DSM test bed, which allows the performance of DSM algorithms to be evaluated in practice. With this test bed, we have evaluated the performance of a DSM level-1 algorithm known as iterative water-filling in an ADSL scenario. This paper describes the results of, on the one hand, the performance gains achieved with iterative water-filling, and, on the other hand, the nonstationary noise robustness of DSM-enabled ADSL modems. It will be shown that DSM trades off nonstationary noise robustness for performance improvements. A new bit swap procedure is then introduced to increase the noise robustness when applying DSM.

Characterization of a symbol rate timing recovery technique for a 2B1Q digital receiver

Science.gov (United States)

Aboulnasr, T.; Hage, M.; Sayar, B.; Aly, S.

1994-02-01

This paper presents a study of several implementations of the Mueller and Muller symbol rate timing recovery algorithm for ISDN transmission over digital subscriber loops (DSL). Implementations of this algorithm using various estimates of a specified timing function are investigated. It will be shown that despite the fact that all of the estimates considered are derived based on one set of conditions, their performance varies widely in a real system. The intrinsic properties of these estimates are first analyzed, then their performance on real subscriber loops is studied through extensive simulations of a practical digital receiver. The effect of various system parameters such as channel distortion and additive noise are included. Possible sources of convergence problems are also identified and corrective action proposed.

Understanding the Self-Directed Online Learning Preferences, Goals, Achievements, and Challenges of MIT OpenCourseWare Subscribers

Science.gov (United States)

Bonk, Curtis J.; Lee, Mimi Miyoung; Kou, Xiaojing; Xu, Shuya; Sheu, Feng-Ru

2015-01-01

This research targeted the learning preferences, goals and motivations, achievements, challenges, and possibilities for life change of self-directed online learners who subscribed to the monthly OpenCourseWare (OCW) e-newsletter from MIT. Data collection included a 25-item survey of 1,429 newsletter subscribers; 613 of whom also completed an…

The application and analyze of the publish-subscribe communication system for radiation and environmental monitoring system

International Nuclear Information System (INIS)

Ismet Isnaini; I Putu Susila; Istofa

2016-01-01

As part of the RAMONA (Radiation and Meteorological Monitoring Analysis System), a publish and subscribe communication system has been designed and implemented, to enable the Ultrasonic Device of Maretron WS0100 which is connected to the client computer to communicate with the server and/or other client. The Maretron is connected to other devices through an interface which use an NMEA2000 protocol, a communication protocol standard set by the National Maritime Electrical Association (NMEA), which usually used in the communication between sensors in the ships and its display. The Maretron device has several sensors embedded such as humidity, wind direction and speed, temperature as well as speed. The communication between Maretron is utilizing a MQTT (Message Queueing Telemetry Transport) system, a publish/subscribe protocol, in which a client publish its data to a data bus with a certain topic, while the server or other client who subscribe to that topic through a broker will then grab and process the data. The data format sent by the Maretron is in JSON (Java Scrip Object Notation) format, which will be parsed by the subscriber and later will be saved on a database or displayed in a website as per requirement. (author)

26 CFR 1.823-7 - Subscribers of reciprocal underwriters and interinsurers.

Science.gov (United States)

2010-04-01

... (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Mutual Insurance Companies (other Than Life and Certain Marine Insurance Companies and Other Than Fire Or Flood Insurance Companies Which Operate on Basis of... extent the insurance premium constituted a deductible expense when paid or accrued, the subscriber's...

Techno-Economics of Residential Broadband Deployment

DEFF Research Database (Denmark)

Sigurdsson, Halldor Matthias

2007-01-01

on account of their existing telecom network (”the raw copper”), and typically they will prefer an xDSL-based strategy (various types of Digital Subscriber Line-technology: ADSL, VDSL, etc.), where the rate of speed of data connections are increased gradually to 10-50 Mbit/s or even more, in order to gain...... broadband deployment strategy is depending on a complexed set of parameters, and there is a demand for precise techno-economic cost models estimating financial feasibility. The existing cost models do not consider the dynamic developments in the market caused by competition. The PhD thesis has a profound...... the general principles from the Danish LRAIC-model (Long Run Average Incremental Cost) and divides Denmark in 4 geografical profiles. Considering the existing copper-infrastructure the most advantageous strategies for the players of each of these profiles are identified. The importance of the time horizon...

The Normalized-Rate Iterative Algorithm: A Practical Dynamic Spectrum Management Method for DSL

Science.gov (United States)

Statovci, Driton; Nordström, Tomas; Nilsson, Rickard

2006-12-01

We present a practical solution for dynamic spectrum management (DSM) in digital subscriber line systems: the normalized-rate iterative algorithm (NRIA). Supported by a novel optimization problem formulation, the NRIA is the only DSM algorithm that jointly addresses spectrum balancing for frequency division duplexing systems and power allocation for the users sharing a common cable bundle. With a focus on being implementable rather than obtaining the highest possible theoretical performance, the NRIA is designed to efficiently solve the DSM optimization problem with the operators' business models in mind. This is achieved with the help of two types of parameters: the desired network asymmetry and the desired user priorities. The NRIA is a centralized DSM algorithm based on the iterative water-filling algorithm (IWFA) for finding efficient power allocations, but extends the IWFA by finding the achievable bitrates and by optimizing the bandplan. It is compared with three other DSM proposals: the IWFA, the optimal spectrum balancing algorithm (OSBA), and the bidirectional IWFA (bi-IWFA). We show that the NRIA achieves better bitrate performance than the IWFA and the bi-IWFA. It can even achieve performance almost as good as the OSBA, but with dramatically lower requirements on complexity. Additionally, the NRIA can achieve bitrate combinations that cannot be supported by any other DSM algorithm.

The Normalized-Rate Iterative Algorithm: A Practical Dynamic Spectrum Management Method for DSL

Directory of Open Access Journals (Sweden)

Statovci Driton

2006-01-01

Full Text Available We present a practical solution for dynamic spectrum management (DSM in digital subscriber line systems: the normalized-rate iterative algorithm (NRIA. Supported by a novel optimization problem formulation, the NRIA is the only DSM algorithm that jointly addresses spectrum balancing for frequency division duplexing systems and power allocation for the users sharing a common cable bundle. With a focus on being implementable rather than obtaining the highest possible theoretical performance, the NRIA is designed to efficiently solve the DSM optimization problem with the operators' business models in mind. This is achieved with the help of two types of parameters: the desired network asymmetry and the desired user priorities. The NRIA is a centralized DSM algorithm based on the iterative water-filling algorithm (IWFA for finding efficient power allocations, but extends the IWFA by finding the achievable bitrates and by optimizing the bandplan. It is compared with three other DSM proposals: the IWFA, the optimal spectrum balancing algorithm (OSBA, and the bidirectional IWFA (bi-IWFA. We show that the NRIA achieves better bitrate performance than the IWFA and the bi-IWFA. It can even achieve performance almost as good as the OSBA, but with dramatically lower requirements on complexity. Additionally, the NRIA can achieve bitrate combinations that cannot be supported by any other DSM algorithm.

7 CFR 1735.13 - Location of facilities and service for nonrural subscribers.

Science.gov (United States)

2010-01-01

...-TELECOMMUNICATIONS PROGRAM Loan Purposes and Basic Policies § 1735.13 Location of facilities and service for nonrural... times be necessary to provide loan funds to finance telephone facilities which (1) will also serve nonrural subscribers, or (2) are located in nonrural areas. Loans may be approved to finance such...

A community-based event delivery protocol in publish/subscribe systems for delay tolerant sensor networks.

Science.gov (United States)

Liu, Nianbo; Liu, Ming; Zhu, Jinqi; Gong, Haigang

2009-01-01

The basic operation of a Delay Tolerant Sensor Network (DTSN) is to finish pervasive data gathering in networks with intermittent connectivity, while the publish/subscribe (Pub/Sub for short) paradigm is used to deliver events from a source to interested clients in an asynchronous way. Recently, extension of Pub/Sub systems in DTSNs has become a promising research topic. However, due to the unique frequent partitioning characteristic of DTSNs, extension of a Pub/Sub system in a DTSN is a considerably difficult and challenging problem, and there are no good solutions to this problem in published works. To ad apt Pub/Sub systems to DTSNs, we propose CED, a community-based event delivery protocol. In our design, event delivery is based on several unchanged communities, which are formed by sensor nodes in the network according to their connectivity. CED consists of two components: event delivery and queue management. In event delivery, events in a community are delivered to mobile subscribers once a subscriber comes into the community, for improving the data delivery ratio. The queue management employs both the event successful delivery time and the event survival time to decide whether an event should be delivered or dropped for minimizing the transmission overhead. The effectiveness of CED is demonstrated through comprehensive simulation studies.

Structured P2P overlay of mobile brokers for realizing publish/subscribe communication in VANET.

Science.gov (United States)

Pandey, Tulika; Garg, Deepak; Gore, Manoj Madhava

2014-01-01

Publish/subscribe communication paradigm provides asynchrony and decoupling, making it an elegant alternative for designing applications in distributed and dynamic environment such as vehicular ad hoc networks (VANETs). In this paradigm, the broker is the most important component that decouples other two components, namely, publisher and subscriber. Previous research efforts have either utilized the deployment of distributed brokers on stationary road side info-stations or have assigned the role of broker to any moving vehicle on ad hoc basis. In one approach, lots of preinstalled infrastructures are needed whereas, in another, the quality of service is not guaranteed due to unpredictable moving and stopping patterns of vehicles. In this paper, we present the architecture of distributed mobile brokers which are dynamically reconfigurable in the form of structured P2P overlay and act as rendezvous points for matching publications and subscriptions. We have taken city buses in urban settings to act as mobile brokers whereas other vehicles are considered to be in role of publishers and subscribers. These mobile brokers also assist in locating a vehicle for successful and timely transfer of notifications. We have performed an extensive simulation study to compare our approach with previously proposed approaches. Simulation results establish the applicability of our approach.

Structured P2P Overlay of Mobile Brokers for Realizing Publish/Subscribe Communication in VANET

Directory of Open Access Journals (Sweden)

Tulika Pandey

2014-01-01

Full Text Available Publish/subscribe communication paradigm provides asynchrony and decoupling, making it an elegant alternative for designing applications in distributed and dynamic environment such as vehicular ad hoc networks (VANETs. In this paradigm, the broker is the most important component that decouples other two components, namely, publisher and subscriber. Previous research efforts have either utilized the deployment of distributed brokers on stationary road side info-stations or have assigned the role of broker to any moving vehicle on ad hoc basis. In one approach, lots of preinstalled infrastructures are needed whereas, in another, the quality of service is not guaranteed due to unpredictable moving and stopping patterns of vehicles. In this paper, we present the architecture of distributed mobile brokers which are dynamically reconfigurable in the form of structured P2P overlay and act as rendezvous points for matching publications and subscriptions. We have taken city buses in urban settings to act as mobile brokers whereas other vehicles are considered to be in role of publishers and subscribers. These mobile brokers also assist in locating a vehicle for successful and timely transfer of notifications. We have performed an extensive simulation study to compare our approach with previously proposed approaches. Simulation results establish the applicability of our approach.

Maximizing the number of satisfied subscribers in Pub/Sub systems under capacity constraints

NARCIS (Netherlands)

Setty, V.J.; Kreitz, G; Urdaneta, G; Vitenberg, R; van Steen, M.R.

2014-01-01

Publish/subscribe (pub/sub) is a popular communication paradigm in the design of large-scale distributed systems. A provider of a pub/sub service (whether centralized, peer-assisted, or based on a federated organization of cooperatively managed servers) commonly faces a fundamental challenge: given

Time coordination of heterogeneous distance protections using a domain specific language

Directory of Open Access Journals (Sweden)

Marcin Kowalski

2012-01-01

Full Text Available BACKGROUND: Distance protections are widely used in protection of energy transmission lines, but their time coordination is still an important and difficult problem. Inappropriate configuration leads to a hazard event: remote circuit breaker tripping provided the local circuit breaker can be opened, which severely impairs power system operation.OBJECTIVE: To describe a method and provide software tools to alleviate the hazard in power systems.METHODS: A domain specific language (DSL for representation of a transmission line with its distance protection schema, and a translation algorithm from the DSL to probabilistic fault trees with time dependencies (PFTTDs are employed.RESULTS: The paper presents software tools that can support power protection experts in time coordination of distance protections. The tools are based upon abstract and concrete syntax of the DSL designed specifically for the purpose of the distance protection time coordination problem. In order to render creation of power line and its protection schema models easier, a DSL-dedicated editor supporting syntax and semantic aspects of the DSL has been developed. Additionally, a translator from the DSL into PFTTD language has been implemented.CONCLUSIONS: Power system experts are enabled to perform hazard probability assessment and sensitivity analysis.LIMITATIONS: Translation supports two types of distance protections, which are: single-system relays with starting elements as well as multi-system relays without starting elements. For the single-system relay, there is one timer per relay. For multi-system relays, there is one timer for each of possibly many protection zones. Other types of protections, e.g. overcurrent are not considered.

E-lifestyle, Customer Satisfaction and Loyalty among Mobile Subscribers in Thailand

OpenAIRE

Hassan, Siti Hasnah; Thurasamy, T. Ramayah; Loi, Wai Yee

2017-01-01

This paper aims at assessing the relationship between e-lifestyle, customer satisfaction, and loyalty among mobile service subscribers in Thailand. The results reveal that e-lifestyle has a substantial effect on customer satisfaction. Subsequently, customer satisfaction affects strongly on consumer loyalty towards telecommunication service providers. Moreover, customer satisfaction mediates the relationship between e-lifestyle and consumer loyalty. The study concludes that e-lifestyle has to ...

A Community-Based Event Delivery Protocol in Publish/Subscribe Systems for Delay Tolerant Sensor Networks

Directory of Open Access Journals (Sweden)

Haigang Gong

2009-09-01

Full Text Available The basic operation of a Delay Tolerant Sensor Network (DTSN is to finish pervasive data gathering in networks with intermittent connectivity, while the publish/subscribe (Pub/Sub for short paradigm is used to deliver events from a source to interested clients in an asynchronous way. Recently, extension of Pub/Sub systems in DTSNs has become a promising research topic. However, due to the unique frequent partitioning characteristic of DTSNs, extension of a Pub/Sub system in a DTSN is a considerably difficult and challenging problem, and there are no good solutions to this problem in published works. To ad apt Pub/Sub systems to DTSNs, we propose CED, a community-based event delivery protocol. In our design, event delivery is based on several unchanged communities, which are formed by sensor nodes in the network according to their connectivity. CED consists of two components: event delivery and queue management. In event delivery, events in a community are delivered to mobile subscribers once a subscriber comes into the community, for improving the data delivery ratio. The queue management employs both the event successful delivery time and the event survival time to decide whether an event should be delivered or dropped for minimizing the transmission overhead. The effectiveness of CED is demonstrated through comprehensive simulation studies.

Publish/Subscribe on Top of DHT Using RETE Algorithm

Science.gov (United States)

Shvartzshnaider, Yan; Ott, Maximilian; Levy, David

This paper discusses the construction of a Global Semantic Graph (GSG) [1] to support future information- and collaboration-centric applications and services. The GSG is a publish/subscribe (pub/sub) based architecture that supports publication of tuples and subscriptions with standing graph queries. We believe that an implementation of an efficient pattern matching algorithm such as Rete [2] on top of a distributed environment might serve as a possible substrate for GSG's pub/sub facility. Rete operates on loosely coupled alpha, beta and join nodes and therefore has been chosen by us for implementation in a distributed setting.

Pull vs. Push: How OmniEarth Delivers Better Earth Observation Information to Subscribers

Science.gov (United States)

Fish, C.; Slagowski, S.; Dyrud, L.; Fentzke, J.; Hargis, B.; Steerman, M.

2015-04-01

Until very recently, the commercialization of Earth observation systems has largely occurred in two ways: either through the detuning of government satellites or the repurposing of NASA (or other science) data for commercial use. However, the convergence of cloud computing and low-cost satellites is enabling Earth observation companies to tailor observation data to specific markets. Now, underserved constituencies, such as agriculture and energy, can tap into Earth observation data that is provided at a cadence, resolution and cost that can have a real impact to their bottom line. To connect with these markets, OmniEarth fuses data from a variety of sources, synthesizes it into useful and valuable business information, and delivers it to customers via web or mobile interfaces. The "secret sauce" is no longer about having the highest resolution imagery, but rather it is about using that imagery - in conjunction with a number of other sources - to solve complex problems that require timely and contextual information about our dynamic and changing planet. OmniEarth improves subscribers' ability to visualize the world around them by enhancing their ability to see, analyze, and react to change in real time through a solutions-as-a-service platform.

Approximate spatio-temporal top-k publish/subscribe

KAUST Repository

Chen, Lisi

2018-04-26

Location-based publish/subscribe plays a significant role in mobile information disseminations. In this light, we propose and study a novel problem of processing location-based top-k subscriptions over spatio-temporal data streams. We define a new type of approximate location-based top-k subscription, Approximate Temporal Spatial-Keyword Top-k (ATSK) Subscription, that continuously feeds users with relevant spatio-temporal messages by considering textual similarity, spatial proximity, and information freshness. Different from existing location-based top-k subscriptions, Approximate Temporal Spatial-Keyword Top-k (ATSK) Subscription can automatically adjust the triggering condition by taking the triggering score of other subscriptions into account. The group filtering efficacy can be substantially improved by sacrificing the publishing result quality with a bounded guarantee. We conduct extensive experiments on two real datasets to demonstrate the performance of the developed solutions.

Approximate spatio-temporal top-k publish/subscribe

KAUST Repository

Chen, Lisi; Shang, Shuo

2018-01-01

Location-based publish/subscribe plays a significant role in mobile information disseminations. In this light, we propose and study a novel problem of processing location-based top-k subscriptions over spatio-temporal data streams. We define a new type of approximate location-based top-k subscription, Approximate Temporal Spatial-Keyword Top-k (ATSK) Subscription, that continuously feeds users with relevant spatio-temporal messages by considering textual similarity, spatial proximity, and information freshness. Different from existing location-based top-k subscriptions, Approximate Temporal Spatial-Keyword Top-k (ATSK) Subscription can automatically adjust the triggering condition by taking the triggering score of other subscriptions into account. The group filtering efficacy can be substantially improved by sacrificing the publishing result quality with a bounded guarantee. We conduct extensive experiments on two real datasets to demonstrate the performance of the developed solutions.

Status and Subscribing: A Response to Schwitzgebel

Science.gov (United States)

Hewson, Peter W.; Lemberger, John

Schwitzgebel (1999) has proposed an account of theories that can be used in deciding whether children's cognitive development is like theory change in science. In this article we outline an account of conceptual learning in terms of the conceptions that people hold, the status they award to their conceptions, and the conceptual ecology containing the criteria they use in determining status. A comparison of our account with Schwitzgebel's shows an equivalence between Schwitzgebel's subscribing and one component of status (fruitfulness), but no counterpart to another (plausibility). In addition, Schwitzgebel's account predicts that people possess an explanation-seeking curiosity that is associated with patterns of arousal and affect when anomalous phenomena are encountered. We present the results of empirical work that demonstrates that students do exhibit strong affective reactions to awareness of experimental anomalies and their resolution.

Checking Flight Rules with TraceContract: Application of a Scala DSL for Trace Analysis

Science.gov (United States)

Barringer, Howard; Havelund, Klaus; Morris, Robert A.

2011-01-01

Typically during the design and development of a NASA space mission, rules and constraints are identified to help reduce reasons for failure during operations. These flight rules are usually captured in a set of indexed tables, containing rule descriptions, rationales for the rules, and other information. Flight rules can be part of manual operations procedures carried out by humans. However, they can also be automated, and either implemented as on-board monitors, or as ground based monitors that are part of a ground data system. In the case of automated flight rules, one considerable expense to be addressed for any mission is the extensive process by which system engineers express flight rules in prose, software developers translate these requirements into code, and then both experts verify that the resulting application is correct. This paper explores the potential benefits of using an internal Scala DSL for general trace analysis, named TRACECONTRACT, to write executable specifications of flight rules. TRACECONTRACT can generally be applied to analysis of for example log files or for monitoring executing systems online.

A Comparison Between Publish-and-Subscribe and Client-Server Models in Distributed Control System Networks

Science.gov (United States)

Boulanger, Richard P., Jr.; Kwauk, Xian-Min; Stagnaro, Mike; Kliss, Mark (Technical Monitor)

1998-01-01

The BIO-Plex control system requires real-time, flexible, and reliable data delivery. There is no simple "off-the-shelf 'solution. However, several commercial packages will be evaluated using a testbed at ARC for publish- and-subscribe and client-server communication architectures. Point-to-point communication architecture is not suitable for real-time BIO-Plex control system. Client-server architecture provides more flexible data delivery. However, it does not provide direct communication among nodes on the network. Publish-and-subscribe implementation allows direct information exchange among nodes on the net, providing the best time-critical communication. In this work Network Data Delivery Service (NDDS) from Real-Time Innovations, Inc. ARTIE will be used to implement publish-and subscribe architecture. It offers update guarantees and deadlines for real-time data delivery. Bridgestone, a data acquisition and control software package from National Instruments, will be tested for client-server arrangement. A microwave incinerator located at ARC will be instrumented with a fieldbus network of control devices. BridgeVIEW will be used to implement an enterprise server. An enterprise network consisting of several nodes at ARC and a WAN connecting ARC and RISC will then be setup to evaluate proposed control system architectures. Several network configurations will be evaluated for fault tolerance, quality of service, reliability and efficiency. Data acquired from these network evaluation tests will then be used to determine preliminary design criteria for the BIO-Plex distributed control system.

Fiber To The Subscriber: Look At Narrowband Services First

Science.gov (United States)

Mangum, Karen L.

1990-01-01

Today, it's not easy to find a telecommunications publication that doesn't have a feature article on fiber to the home. Not only do these articles appear in telecommunications publications but in newspapers like in the Wall Street Journal and USA Today. What concerns me about these articles is the immediate emphasis on CATV and video on demand services. Fiber is indeed a broadband transmission medium. However, from BellSouths point of view, the video services are not necessary to the economic equation for placing fiber to the subscriber. Our objective is to place fiber in the network for POTS like services first and upgrade the electronics based on customer demand.

CMSG - A PUBLISH/SUBSCRIBE INTERPROCESS COMMUNICATION PACKAGE

International Nuclear Information System (INIS)

Wolin, Elliott; Timmer, Carl; Gyurjyan, Vardan; Heyes, William; Jastrzembski, Edward; Lawrence, David; Abbott, David

2008-01-01

Publish/subscribe message passing is an extremely simple, flexible, and powerful interprocess communication (IPC) paradigm. It is widely used in industry, but not nearly so in High Energy and Nuclear Physics (HENP), perhaps due to the cost of commercial implementations. cMsg, developed at Jefferson Lab in the US, contains a full-featured pub/sub interprocess communication package that is simple to install and use. It is very efficient, and implements both point-to-point and pub/sub communications, server redundancy, hot server failover, and a server discovery service. In addition, for developers cMsg provides a framework within which one can deploy multiple underlying communication packages that do not necessarily need to implement the full pub/sub paradigm. This allows for unification of all communication in a control system under a single API, shortens development time, and allows for simple upgrade or replacement of underlying communication packages and protocols.

Forensic Tools for Mobile Phone Subscriber Identity Modules

Directory of Open Access Journals (Sweden)

Wayne Jansen

2006-06-01

Full Text Available Mobile phones and other handheld devices incorporating cellular capabilities, such as Personal Digital Assistants, are ubiquitous.  Besides placing calls, these devices allow users to perform other useful tasks, including text messaging and phonebook entry management.  When cell phones and cellular devices are involved in a crime or other incident, forensic specialists require tools that allow the proper retrieval and speedy examination of data present on the device.  For devices conforming to the Global System for Mobile Communications (GSM standards, certain data such as dialed numbers, text messages, and phonebook entries are maintained on a Subscriber Identity Module (SIM.  This paper gives a snapshot of the state of the art of forensic software tools for SIMs and an explanation of the types of digital evidence they can recover.

Self-Adapting Routing Overlay Network for Frequently Changing Application Traffic in Content-Based Publish/Subscribe System

Directory of Open Access Journals (Sweden)

Meng Chi

2014-01-01

Full Text Available In the large-scale distributed simulation area, the topology of the overlay network cannot always rapidly adapt to frequently changing application traffic to reduce the overall traffic cost. In this paper, we propose a self-adapting routing strategy for frequently changing application traffic in content-based publish/subscribe system. The strategy firstly trains the traffic information and then uses this training information to predict the application traffic in the future. Finally, the strategy reconfigures the topology of the overlay network based on this predicting information to reduce the overall traffic cost. A predicting path is also introduced in this paper to reduce the reconfiguration numbers in the process of the reconfigurations. Compared to other strategies, the experimental results show that the strategy proposed in this paper could reduce the overall traffic cost of the publish/subscribe system in less reconfigurations.

An Analytic Hierarchy Process Analysis: Application to Subscriber Retention Decisions in the Nigerian Mobile Telecommunications

Directory of Open Access Journals (Sweden)

Adebiyi Sulaimon Olanrewaju

2015-12-01

Full Text Available The introduction of mobile number portability (MNP in the Nigerian telecommunications industry has brought a new challenge for mobile operators. This study investigates the use of Analytic Hierarchy Process (AHP in customer retention decisions in the Nigerian telecommunication industry using a cross-sectional survey design. Primary data were obtained through questionnaires administered to 480 mobile telecommunications subscribers in six tertiary institutions located in Lagos State, Nigeria. These educational institutions were chosen using a multistage sampling technique. Of 438 questionnaires received from subscribers, 408 were valid. Based on this sample data an AHP model was built to assess the determinants of customer retention decisions. Next, eigen values, an eigen vector and maximum lambda (λMax were obtained using the AHP analysis for the matrices. This analysis shows that customers considered call quality as the important in the retention decision. We conclude that AHP is a meaningful tool for determining what motivates retention decisions, that can help network operators formulate effective customer retention strategies.

Enabling Large-Scale IoT-Based Services through Elastic Publish/Subscribe.

Science.gov (United States)

Vavassori, Sergio; Soriano, Javier; Fernández, Rafael

2017-09-19

In this paper, we report an algorithm that is designed to leverage the cloud as infrastructure to support Internet of Things (IoT) by elastically scaling in/out so that IoT-based service users never stop receiving sensors' data. This algorithm is able to provide an uninterrupted service to end users even during the scaling operation since its internal state repartitioning is transparent for publishers or subscribers; its scaling operation is time-bounded and depends only on the dimension of the state partitions to be transmitted to the different nodes. We describe its implementation in E-SilboPS, an elastic content-based publish/subscribe (CBPS) system specifically designed to support context-aware sensing and communication in IoT-based services. E-SilboPS is a key internal asset of the FIWARE IoT services enablement platform, which offers an architecture of components specifically designed to capture data from, or act upon, IoT devices as easily as reading/changing the value of attributes linked to context entities. In addition, we discuss the quantitative measurements used to evaluate the scale-out process, as well as the results of this evaluation. This new feature rounds out the context-aware content-based features of E-SilboPS by providing, for example, the necessary middleware for constructing dashboards and monitoring panels that are capable of dynamically changing queries and continuously handling data in IoT-based services.

ANTIVIRAL ACTIVITY OF DIANTHUS SUPERBUSN L. AGAINST HEPATITIS B VIRUS IN VITRO AND IN VIVO.

Science.gov (United States)

Li, Wei-Guo; Wang, He-Qun

2016-01-01

Hepatitis is a viral infection of hepatitis B virus (HBV). Limitations of drug used in the management of it opens the interest related to alternative medicine. The given study deals with the antiviral activity of Dianthus superbusn L. (DSL) against HBV in vitro & in vivo . In vitro study liver cell line HepG2.2.15 was used by transinfected it with HBV. Cytotoxicity stduy was performed by using different concentrations of DSL such as 50, 100, 200, 500 & 1000 μg/ml. Anti HBV activity of DSL was estimated by assesing the concentration of HBsAg and HbeAg in cell culture medium by using ELISA. Whereas in vivo study was performed on ducklings and antiviral activity of DSL (100, 200, 400 mg/kg) was confirmed by estimating the serum concentration of HBV DNA and histopathology study of hepatocytes in HBV infected ducklings. Result of the study suggested that >500 μg/ml concentration of hydroalcoholic extract of DSL was found tobe cytotoxic. It was also observed that DSL significantly ( p <0.05) reduces the concentration of antigenes in cell culture media as per the concentration and days of treatment dependent. Moreover in vivo study confirms the anti viral activity of DSL (200 & 400 mg/kg) as it significantly ( p <0.05) decreases the serum concenetration of HBV DNA in HBV infected dukling compared to control group. Histopathology study was also reveals the hepatprotective effect of DSL in HBV infected ducklings. The given study concludes the antiviral activity DSL against HBV by in vitro and in vivo models.

Perceptions of the Concerned Reader: An Analysis of the Subscribers of E/The Environmental Magazine.

Science.gov (United States)

Labbe, Colleen P.; Fortner, Rosanne W.

2001-01-01

Describes a study aimed at determining if 'E/The Environmental Magazine' has met two goals: (1) its subscribers' need for environmental information and (2) its publishers' goal of inspiring environmentally responsible behavior. Results indicate that the level of the magazine's influence varied according to the reader's behavior category.…

Efficient high speed communications over electrical powerlines for a large number of users

Energy Technology Data Exchange (ETDEWEB)

Lee, J.; Tripathi, K.; Latchman, H.A. [Florida Univ., Gainesville, FL (United States). Dept. of Electrical and Computer Engineering

2007-07-01

Affordable broadband Internet communication is currently available for residential use via cable modem and other forms of digital subscriber lines (DSL). Powerline communication (PLC) systems were never considered seriously for communications due to their low speed and high development cost. However, due to technological advances PLCs are now spreading to local area networks and broadband over power line systems. This paper presented a newly proposed modification to the standard HomePlug 1.0 MAC protocol to make it a constant contention window-based scheme. The HomePlug 1.0 was developed based on orthogonal frequency division multiplexing (OFDM) and carrier sense multiple access with collision avoidance (CSMA/CA). It is currently the most commonly used technology of power line communications, supporting a transmission rate of up to 14 Mbps on the power line. However, the throughput performance of this original scheme becomes critical when the number of users increases. For that reason, a constant contention window based medium access control protocol algorithm of HomePlug 1.0 was proposed under the assumption that the number of active stations is known. An analytical framework based on Markov Chains was developed in order to model this modified protocol under saturation conditions. Modeling results accurately matched the actual performance of the system. This paper revealed that the performance can be improved significantly if the variables were parameterized in terms of the number of active stations. 15 refs., 1 tab., 6 figs.

Subscribers and newspaper subscriptions in Spain at the beginning of the XX century. Notes from an asturian perspective

Directory of Open Access Journals (Sweden)

Víctor Rodríguez Infiesta

2008-12-01

Full Text Available In the first decades of the XX century the possibility of a particular newspaper having a high number of subscribers was, from the point of view of the newspaper publishers, the best guarantee of its stability. However it was not all advantages in a system which gave rise to numerous complaints and created a peculiar relationship with the subscriber. By various means —delivery men, the post and public establishments, principally— the subscription service continually generated situations illustrative of the level of development of the Spanish press in years in which progress accelerates and deficiencies and limitations also become apparent. Limitations which, particularly in an outlying region with mostly inadequate means of communication such as Asturias, could become one of the main factors delaying the establishment of a large press with mass-readership.

Study of the B$_{s}^{0}\\overline{B}_{s}^{0}$ oscillation frequency using D$_{s}^{-}$l$^{+}$ combinations in Z decays

CERN Document Server

Buskulic, Damir; Décamp, D; Ghez, P; Goy, C; Lees, J P; Lucotte, A; Minard, M N; Odier, P; Pietrzyk, B; Casado, M P; Chmeissani, M; Crespo, J M; Delfino, M C; Efthymiopoulos, I; Fernández, E; Fernández-Bosman, M; Garrido, L; Juste, A; Martínez, M; Orteu, S; Pacheco, A; Padilla, C; Pascual, A; Perlas, J A; Riu, I; Sánchez, F; Teubert, F; Colaleo, A; Creanza, D; De Palma, M; Gelao, G; Girone, M; Iaselli, Giuseppe; Maggi, G; Maggi, M; Marinelli, N; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Alemany, R; Bazarko, A O; Bonvicini, G; Cattaneo, M; Comas, P; Coyle, P; Drevermann, H; Forty, Roger W; Frank, M; Hagelberg, R; Harvey, J; Janot, P; Jost, B; Kneringer, E; Knobloch, J; Lehraus, Ivan; Lutters, G; Martin, E B; Mato, P; Minten, Adolf G; Miquel, R; Moneta, L; Oest, T; Pater, J R; Pusztaszeri, J F; Ranjard, F; Rensing, P E; Rolandi, Luigi; Schlatter, W D; Schmelling, M; Schneider, O; Tejessy, W; Tomalin, I R; Venturi, A; Wachsmuth, H W; Wagner, A; Wildish, T; Ajaltouni, Ziad J; Barrès, A; Boyer, C; Falvard, A; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Proriol, J; Rossignol, J M; Fearnley, Tom; Hansen, J B; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Wäänänen, A; Kyriakis, A; Markou, C; Simopoulou, Errietta; Siotis, I; Vayaki, Anna; Zachariadou, K; Blondel, A; Bonneaud, G R; Brient, J C; Bourdon, P; Rougé, A; Rumpf, M; Valassi, Andrea; Verderi, M; Videau, H L; Candlin, D J; Parsons, M I; Focardi, E; Parrini, G; Corden, M; Georgiopoulos, C H; Jaffe, D E; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Casper, David William; Chiarella, V; Felici, G; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Curtis, L; Dorris, S J; Halley, A W; Knowles, I G; Lynch, J G; O'Shea, V; Raine, C; Reeves, P; Scarr, J M; Smith, K; Thompson, A S; Thomson, F; Thorn, S; Turnbull, R M; Becker, U; Geweniger, C; Graefe, G; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Putzer, A; Rensch, B; Schmidt, M; Sommer, J; Stenzel, H; Tittel, K; Werner, S; Wunsch, M; Abbaneo, D; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Moutoussi, A; Nash, J; Sedgbeer, J K; Stacey, A M; Williams, M D; Dissertori, G; Girtler, P; Kuhn, D; Rudolph, G; Betteridge, A P; Bowdery, C K; Colrain, P; Crawford, G; Finch, A J; Foster, F; Hughes, G; Sloan, Terence; Williams, M I; Galla, A; Greene, A M; Kleinknecht, K; Quast, G; Renk, B; Rohne, E; Sander, H G; Van Gemmeren, P; Zeitnitz, C; Aubert, Jean-Jacques; Bencheikh, A M; Benchouk, C; Bonissent, A; Bujosa, G; Calvet, D; Carr, J; Diaconu, C A; Etienne, F; Konstantinidis, N P; Payre, P; Rousseau, D; Talby, M; Sadouki, A; Thulasidas, M; Trabelsi, K; Aleppo, M; Ragusa, F; Abt, I; Assmann, R W; Bauer, C; Blum, Walter; Dietl, H; Dydak, Friedrich; Ganis, G; Gotzhein, C; Jakobs, K; Kroha, H; Lütjens, G; Lutz, Gerhard; Männer, W; Moser, H G; Richter, R H; Rosado-Schlosser, A; Schael, S; Settles, Ronald; Seywerd, H C J; Saint-Denis, R; Wiedenmann, W; Wolf, G; Boucrot, J; Callot, O; Cordier, A; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Jacquet, M; Kim, D W; Le Diberder, F R; Lefrançois, J; Lutz, A M; Nikolic, I A; Park, H J; Park, I C; Schune, M H; Simion, S; Veillet, J J; Videau, I; Azzurri, P; Bagliesi, G; Batignani, G; Bettarini, S; Bozzi, C; Calderini, G; Carpinelli, M; Ciocci, M A; Ciulli, V; Dell'Orso, R; Fantechi, R; Ferrante, I; Foà, L; Forti, F; Giassi, A; Giorgi, M A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Rizzo, G; Sanguinetti, G; Sciabà, A; Spagnolo, P; Steinberger, Jack; Tenchini, Roberto; Tonelli, G; Vannini, C; Verdini, P G; Walsh, J; Blair, G A; Bryant, L M; Cerutti, F; Chambers, J T; Gao, Y; Green, M G; Medcalf, T; Perrodo, P; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Haywood, S; Maley, P; Norton, P R; Thompson, J C; Wright, A E; Bloch-Devaux, B; Colas, P; Emery, S; Kozanecki, Witold; Lançon, E; Lemaire, M C; Locci, E; Marx, B; Pérez, P; Rander, J; Renardy, J F; Roussarie, A; Schuller, J P; Schwindling, J; Trabelsi, A; Vallage, B; Black, S N; Dann, J H; Johnson, R P; Kim, H Y; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Boswell, R; Brew, C A J; Cartwright, S L; Combley, F; Köksal, A; Lehto, M H; Newton, W M; Reeve, J; Thompson, L F; Böhrer, A; Brandt, S; Büscher, V; Cowan, G D; Grupen, Claus; Minguet-Rodríguez, J A; Rivera, F; Saraiva, P; Smolik, L; Stephan, F; Apollonio, M; Bosisio, L; Della Marina, R; Giannini, G; Gobbo, B; Musolino, G; Rothberg, J E; Wasserbaech, S R; Armstrong, S R; Bellantoni, L; Elmer, P; Feng, Z; Ferguson, D P S; Gao, Y S; González, S; Grahl, J; Greening, T C; Harton, J L; Hayes, O J; Hu, H; McNamara, P A; Nachtman, J M; Orejudos, W; Pan, Y B; Saadi, Y; Schmitt, M; Scott, I J; Sharma, V; Walsh, A M; Wu Sau Lan; Wu, X; Yamartino, J M; Zheng, M; Zobernig, G

1996-01-01

A lower limit on the oscillation frequency of the BsBsbar system is obtained from approximately four million hadronic Z decays accumulated using the ALEPH detector at LEP from 1991 to 1995. Leptons are combined with opposite sign Ds- candidates reconstructed in seven different decay modes as evidence of semileptonic Bs decays. Criteria designed to ensure precise proper time reconstruction select 277 Ds-,l+ combinations. The initial state of these Bs candidates is determined using an algorithm optimized to efficiently utilise the tagging information available for each event. The limit at 95\\% confidence level on the BsBsbar oscillation frequency is delta_m_s > 6.6 ps^-1. The same data is used to update the measurement of the Bs lifetime, tau_s = 1.54 +0.14 (stat) +0.04 (syst) ps. -0.13 -0.04

Determinants of Customer Loyalty among Mobile Telecom Subscribers in the Brong Ahafo Region of Ghana

Directory of Open Access Journals (Sweden)

Kwabena Adjei

2014-01-01

Full Text Available The purpose of this study is to investigate the determinants of brand equity among mobile telecom users in Brong Ahafo Region of Ghana. Mobile telecommunication providers have a great role in strengthening the economy and encouraging the efficiency among a large number of subscribers across the country. The success of any business depends on the strength of their brands, which attracts new and existing customers for continuous growth.  In Ghana, there are six mobile telecom providers operating in the market (Vodafone, Airtel, MTN, Tigo, Glo, & Expresso. Primary data was obtained through a questionnaire and residents of Sunyani Municipality were targeted for the study. 200 questionnaires were self-administered by the researchers to the subscribers of all the mobile telecom providers and 194 questionnaires were returned. The questionnaires were analysed using SPSS 16 and pearson correlation was used to establish the relationship between the dependent and independent variables. The results identified call rate/quality, network coverage and sales promotion as having significant positive relationship to customer loyalty. In addition, brand image and prompt customer service were seen to have a less effect on customer loyalty.

Near-Capacity Coding for Discrete Multitone Systems with Impulse Noise

Directory of Open Access Journals (Sweden)

Kschischang Frank R

2006-01-01

Full Text Available We consider the design of near-capacity-achieving error-correcting codes for a discrete multitone (DMT system in the presence of both additive white Gaussian noise and impulse noise. Impulse noise is one of the main channel impairments for digital subscriber lines (DSL. One way to combat impulse noise is to detect the presence of the impulses and to declare an erasure when an impulse occurs. In this paper, we propose a coding system based on low-density parity-check (LDPC codes and bit-interleaved coded modulation that is capable of taking advantage of the knowledge of erasures. We show that by carefully choosing the degree distribution of an irregular LDPC code, both the additive noise and the erasures can be handled by a single code, thus eliminating the need for an outer code. Such a system can perform close to the capacity of the channel and for the same redundancy is significantly more immune to the impulse noise than existing methods based on an outer Reed-Solomon (RS code. The proposed method has a lower implementation complexity than the concatenated coding approach.

Planning of Efficient Wireless Access with IEEE 802.16 for Connecting Home Network to the Internet

Directory of Open Access Journals (Sweden)

Pichet Ritthisoonthorn

2010-01-01

Full Text Available The emergence of IEEE802.16 wireless standard technology (WiMAX has significantly increased the choice to operators for the provisioning of wireless broadband access network. WiMAX is being deployed to compliment with xDSL in underserved or lack of the broadband network area, in both developed and developing countries. Many incumbent operators in developing countries are considering the deployment of WiMAX as part of their broadband access strategy. This paper presents an efficient and simple method for planning of broadband fixed wireless access (BFWA with IEEE802.16 standard to support home connection to Internet. The study formulates the framework for planning both coverage and capacity designs. The relationship between coverage area and access rate from subscriber in each environment area is presented. The study also presents the throughput and channel capacity of IEEE802.16 in different access rates. An extensive analysis is performed and the results are applied to the real case study to demonstrate the practicality of using IEEE 802.16 for connecting home to Internet. Using empirical data and original subscriber traffic from measurement, it is shown that the BFWA with IEEE802.16 standard is a capacity limited system. The capacity of IEEE802.16 is related to different factors including frequency bandwidth, spectrum allocation, estimation of traffic per subscriber, and choice of adaptive modulation from subscriber terminal. The wireless access methods and procedures evolved in this research work and set out in this paper are shown to be well suited for planning BFWA system based on IEEE802.16 which supports broadband home to Internet connections.

Building flexible, distributed collaboration tools using type-based publish/subscribe - The Distributed Knight case

DEFF Research Database (Denmark)

Hansen, Klaus Marius; Damm, Christian Heide

2004-01-01

Distributed collaboration is becoming increasingly impor tant also in software development. Combined with an in creasing interest in experimental and agile approaches to software development, this poses challenges to tool sup port for software development. Specifically, tool support is needed...... for flexible, distributed collaboration. We intro duce the Distributed Knight tool that provides flexible and lightweight support for distributed collaboration in object oriented modelling. The Distributed Knight implementa tion builds crucially on the type-based publish/subscribe distributed communication...... paradigm, which provides an effective and natural abstraction for developing distributed collaboration tools....

The electromagnetic compatibility of the PLC technology; La compatibilite electromagnetique de la technologie CPL. Des donnees sur les lignes electriques

Energy Technology Data Exchange (ETDEWEB)

Bermudez, J.-L.; Marthe, E.; Rachidi, F.; Rubinstein, M.; Vukicevic, A.

2006-07-01

PLC (Power Line Communications) in Europe or BPL (Broadband over Power Lines) in the US are techniques that allows the utilization of low and middle voltage power lines for the transmission of high frequencies by coupling electrical signals to them. In this way, unshielded power lines may be used for the transmission of numerical information similar to the well known xDSL-techniques using telephone lines. Typically, the frequency range used by PLC is between 9 kHz and 30 MHz. The authors describe the general principles and investigate possible electromagnetic interference with existing radio frequency equipment like xDSL, CATV (Cable Television) and Wireless (GSM, Bluetooth, WiFi). Finally, they present theoretical and experimental results of techniques allowing the reduction of such interference by reducing the emission of electromagnetic signals from PLC systems. The preferred method is based on an active control by injecting an auxiliary signal into the third conductor (ground)

A Uniform Publish-Subscribe Infrastructure for Communication in Wireless Mobile Environments

DEFF Research Database (Denmark)

Brønsted, Jeppe; Hansen, Klaus Marius; Thorup, Rolf

2006-01-01

In near future the transportation sector will be communication enabled. Devices in vehicles will be able to communicate and thus make a new range of services possible. However, heterogeneous communication capabilities and vehicle mobility complicates the art of designing and implementing these ne...... communication is handled uniformly. By showing how the infrastructure is used in a concrete instance we argue that it meets the requirements for middleware stated above and provides a good programming model for distributed systems in mobile environments......In near future the transportation sector will be communication enabled. Devices in vehicles will be able to communicate and thus make a new range of services possible. However, heterogeneous communication capabilities and vehicle mobility complicates the art of designing and implementing these new...... systems and therefore it is important to have communication middleware that hides the complexity of low level network programming and presents a clean and understandable abstraction over communication to the application programmer. It has previously been shown that the publish-subscribe messaging paradigm...

Explicit Context Matching in Content-Based Publish/Subscribe Systems

Directory of Open Access Journals (Sweden)

Miguel Jiménez

2013-03-01

Full Text Available Although context could be exploited to improve performance, elasticity and adaptation in most distributed systems that adopt the publish/subscribe (P/S communication model, only a few researchers have focused on the area of context-aware matching in P/S systems and have explored its implications in domains with highly dynamic context like wireless sensor networks (WSNs and IoT-enabled applications. Most adopted P/S models are context agnostic or do not differentiate context from the other application data. In this article, we present a novel context-aware P/S model. SilboPS manages context explicitly, focusing on the minimization of network overhead in domains with recurrent context changes related, for example, to mobile ad hoc networks (MANETs. Our approach represents a solution that helps to effciently share and use sensor data coming from ubiquitous WSNs across a plethora of applications intent on using these data to build context awareness. Specifically, we empirically demonstrate that decoupling a subscription from the changing context in which it is produced and leveraging contextual scoping in the filtering process notably reduces (unsubscription cost per node, while improving the global performance/throughput of the network of brokers without altering the cost of SIENA-like topology changes.

Introducing voluntary private health insurance in a mixed medical economy: are Hong Kong citizens willing to subscribe?

Science.gov (United States)

He, Alex Jingwei

2017-08-25

Struggling to correct the public-private imbalance in its health care system, the Hong Kong SAR Government seeks to introduce a government-regulated voluntary health insurance scheme, or VHIS, a distinctive financing instrument that combines the characteristics of private insurance with strong government regulation. This study examines citizens' responses to the new scheme and their willingness to subscribe. First-hand data were collected from a telephone survey that randomly sampled 1793 Hong Kong adults from September 2014 to February 2015. Univariate and multivariate methods were employed in data analysis. More than one third of the respondents explicitly stated intention of subscribing to the VHIS, a fairly high figure considering the scheme's voluntary nature. Multivariate analysis revealed moderate evidence of adverse selection, defined as individuals' opportunistic behaviors when making insurance purchasing decision based on their own assessment of risks or likelihood of making a claim. The excellent performance of Hong Kong's public medical system has had two parallel impacts. On the one hand, high-risk residents, particularly the uninsured, do not face a pressing need to switch out of the overloaded public system despite its inadequacies; this, in turn, may reduce the impact of adverse selection that may lead to detrimental effects to the insurance market. On the other hand, high satisfaction reinforces the interests of those who have both the need for better services and the ability to pay for supplementary insurance. Furthermore, the high-risk population demonstrates a moderate interest in the insurance despite the availability of government subsidies. This may offset the intended effect of the reform to some extent.

Broadband availability in metropolitan and non-metropolitan Pennsylvania

Directory of Open Access Journals (Sweden)

Lawrence E. Wood

2016-09-01

Full Text Available Over the past few years having a broadband connection has become essential for many Internet activities. As broadband increases in importance, it becomes imperative to assess how its use and availability may vary, especially in relation to issues such as geographic location. For rural areas in particular, the availability of broadband service is especially important. This research assesses broadband service availability in rural areas of Pennsylvania, USA. In particular, it examines the extent to which Digital Subscriber Line (DSL and broadband cable modem services are being deployed throughout rural Pennsylvania. It compares this deployment with the availability of such services in the state’s urban and metropolitan areas. The results of this research suggest that there is a “digital divide” in terms of broadband availability between rural and urban areas of Pennsylvania. However, this “divide” is perhaps not as wide as might be expected. Thus, as broadband is becoming increasingly available in rural areas of the U.S. and throughout much of the rest of the world, this research concludes that while research must remain vigilant in terms of assessing advanced telecommunications availability in rural areas, future research should also be sure to focus on how such technologies can be used to promote economic and social concerns, including in relation to building online networks and diminishing social and professional isolation in rural areas.

Broadband Access

Indian Academy of Sciences (India)

First page Back Continue Last page Overview Graphics. Broadband Access. Worldwide market for broadband access $30 Billion! Over 200 million broadband subscribers worldwide! Various Competing Broadband access. Digital Subscriber line; Wireless; Optical Fiber.

cMsg - A general purpose, publish-subscribe, interprocess communication implementation and framework

International Nuclear Information System (INIS)

Timmer, C; Abbott, D; Gyurjyan, V; Heyes, G; Jastrzembski, E; Wolin, E

2008-01-01

cMsg is software used to send and receive messages in the Jefferson Lab online and runcontrol systems. It was created to replace the several IPC software packages in use with a single API. cMsg is asynchronous in nature, running a callback for each message received. However, it also includes synchronous routines for convenience. On the framework level, cMsg is a thin API layer in Java, C, or C++ that can be used to wrap most message-based interprocess communication protocols. The top layer of cMsg uses this same API and multiplexes user calls to one of many such wrapped protocols (or domains) based on a URL-like string which we call a Uniform Domain Locator or UDL. One such domain is a complete implementation of a publish-subscribe messaging system using network communications and written in Java (user APIs in C and C++ too). This domain is built in a way which allows it to be used as a proxy server to other domains (protocols). Performance is excellent allowing the system not only to be used for messaging but also as a data distribution system

Determination of D-saccharic acid-1,4-lactone from brewed kombucha broth by high-performance capillary electrophoresis.

Science.gov (United States)

Wang, Kan; Gan, Xuhua; Tang, Xinyun; Wang, Shuo; Tan, Huarong

2010-02-01

Kombucha is a health tonic. D-saccharic acid-1,4-lactone (DSL), a component of kombucha, inhibits the activity of glucuronidase, an enzyme indirectly related with cancers. To date, there is no efficient method to determine the content of DSL in kombucha samples. In this paper, we report a rapid and simple method for the separation and determination of DSL in kombucha samples, using the high-performance capillary electrophoresis (HPCE) method with diode array detection (DAD). With optimized conditions, DSL can be separated in a 50 cm length capillary at a separation voltage of 20 kV in 40 mmol/L borax buffer (pH 6.5) containing 30 mmol/L SDS and 15% methanol (v/v). Quantitative evaluation of DSL was determined by ultraviolet absorption at lambda=190 nm. The relationship between the peak areas and the DSL concentrations, in a specified working range with linear response, was determined by first-order polynomial regression over the range 50-1500 microg/mL with a detection limit of 17.5 microg/mL. Our method demonstrated excellent reproducibility and accuracy with relative standard deviations (RSD) of less than 5% DSL content (n=5). This is the first report to determine DSL by HPCE. We have successfully applied this method to determine DSL in kombucha samples in various fermented conditions. 2009 Elsevier B.V. All rights reserved.

D-saccharic acid-1,4-lactone ameliorates alloxan-induced diabetes mellitus and oxidative stress in rats through inhibiting pancreatic beta-cells from apoptosis via mitochondrial dependent pathway

Energy Technology Data Exchange (ETDEWEB)

Bhattacharya, Semantee [Department of Life Sciences and Biotechnology, Jadavpur University, 188, Raja S C Mullick Road, Kolkata 700 032 (India); Manna, Prasenjit [Division of Molecular Medicine, Bose Institute, P-1/12, CIT Scheme VII M, Kolkata-700054 (India); Gachhui, Ratan [Department of Life Sciences and Biotechnology, Jadavpur University, 188, Raja S C Mullick Road, Kolkata 700 032 (India); Sil, Parames C., E-mail: parames@bosemain.boseinst.ac.in [Division of Molecular Medicine, Bose Institute, P-1/12, CIT Scheme VII M, Kolkata-700054 (India)

2011-12-15

Oxidative stress plays a vital role in diabetic complications. To suppress the oxidative stress mediated damage in diabetic pathophysiology, a special focus has been given on naturally occurring antioxidants present in normal diet. D-saccharic acid 1,4-lactone (DSL), a derivative of D-glucaric acid, is present in many dietary plants and is known for its detoxifying and antioxidant properties. The aim of the present study was to evaluate the beneficial role of DSL against alloxan (ALX) induced diabetes in the pancreas tissue of Swiss albino rats. A dose-dependent study for DSL (20-120 mg/kg body weight) was carried out to find the effective dose of the compound in ALX-induced diabetic rats. ALX exposure elevated the blood glucose, glycosylated Hb, decreased the plasma insulin and disturbed the intra-cellular antioxidant machineries whereas oral administration of DSL at a dose of 80 mg/kg body weight restored these alterations close to normal. Investigating the mechanism of the protective activity of DSL we observed that it prevented the pancreatic {beta}-cell apoptosis via mitochondria-dependent pathway. Results showed decreased mitochondrial membrane potential, enhanced cytochrome c release in the cytosol and reciprocal regulation of Bcl-2 family proteins in the diabetic rats. These events were also found to be associated with increased level of Apaf-1, caspase 9, and caspase 3 that ultimately led to pancreatic {beta}-cell apoptosis. DSL treatment, however, counteracted these changes. In conclusion, DSL possesses the capability of ameliorating the oxidative stress in ALX-induced diabetes and thus could be a promising approach in lessening diabetic complications. Highlights: Black-Right-Pointing-Pointer Oxidative stress is suggested as a key event in the pathogenesis of diabetes. Black-Right-Pointing-Pointer D-saccharic acid 1,4-lactone (DSL) reduces the alloxan-induced diabetes mellitus. Black-Right-Pointing-Pointer DSL normalizes cellular antioxidant machineries

D-saccharic acid-1,4-lactone ameliorates alloxan-induced diabetes mellitus and oxidative stress in rats through inhibiting pancreatic beta-cells from apoptosis via mitochondrial dependent pathway

International Nuclear Information System (INIS)

Bhattacharya, Semantee; Manna, Prasenjit; Gachhui, Ratan; Sil, Parames C.

2011-01-01

Oxidative stress plays a vital role in diabetic complications. To suppress the oxidative stress mediated damage in diabetic pathophysiology, a special focus has been given on naturally occurring antioxidants present in normal diet. D-saccharic acid 1,4-lactone (DSL), a derivative of D-glucaric acid, is present in many dietary plants and is known for its detoxifying and antioxidant properties. The aim of the present study was to evaluate the beneficial role of DSL against alloxan (ALX) induced diabetes in the pancreas tissue of Swiss albino rats. A dose-dependent study for DSL (20–120 mg/kg body weight) was carried out to find the effective dose of the compound in ALX-induced diabetic rats. ALX exposure elevated the blood glucose, glycosylated Hb, decreased the plasma insulin and disturbed the intra-cellular antioxidant machineries whereas oral administration of DSL at a dose of 80 mg/kg body weight restored these alterations close to normal. Investigating the mechanism of the protective activity of DSL we observed that it prevented the pancreatic β-cell apoptosis via mitochondria-dependent pathway. Results showed decreased mitochondrial membrane potential, enhanced cytochrome c release in the cytosol and reciprocal regulation of Bcl-2 family proteins in the diabetic rats. These events were also found to be associated with increased level of Apaf-1, caspase 9, and caspase 3 that ultimately led to pancreatic β-cell apoptosis. DSL treatment, however, counteracted these changes. In conclusion, DSL possesses the capability of ameliorating the oxidative stress in ALX-induced diabetes and thus could be a promising approach in lessening diabetic complications. Highlights: ► Oxidative stress is suggested as a key event in the pathogenesis of diabetes. ► D-saccharic acid 1,4-lactone (DSL) reduces the alloxan-induced diabetes mellitus. ► DSL normalizes cellular antioxidant machineries disturbed due to alloxan toxicity. ► DSL inhibits pancreatic β-cells apoptosis

Antiviral activity of Dianthus superbusn L. against hepatitis B virus in ...

African Journals Online (AJOL)

Background: Hepatitis is a viral infection of hepatitis B virus (HBV). Limitations of drug used in the management of it opens the interest related to alternative medicine. The given study deals with the antiviral activity of Dianthus superbusn L. (DSL) against HBV in vitro & in vivo. Material and Methods: In vitro study liver cell line ...

Bandwidth allocation and pricing problem for a duopoly market

Directory of Open Access Journals (Sweden)

You Peng-Sheng

2011-01-01

Full Text Available This research discusses the Internet service provider (ISP bandwidth allocation and pricing problems for a duopoly bandwidth market with two competitive ISPs. According to the contracts between Internet subscribers and ISPs, Internet subscribers can enjoy their services up to their contracted bandwidth limits. However, in reality, many subscribers may experience the facts that their on-line requests are denied or their connection speeds are far below their contracted speed limits. One of the reasons is that ISPs accept too many subscribers as their subscribers. To avoid this problem, ISPs can set limits for their subscribers to enhance their service qualities. This paper develops constrained nonlinear programming to deal with this problem for two competitive ISPs. The condition for reaching the equilibrium between the two competitive firms is derived. The market equilibrium price and bandwidth resource allocations are derived as closed form solutions.

Multifractality and autoregressive processes of dry spell lengths in Europe: an approach to their complexity and predictability

Science.gov (United States)

Lana, X.; Burgueño, A.; Serra, C.; Martínez, M. D.

2017-01-01

Dry spell lengths, DSL, defined as the number of consecutive days with daily rain amounts below a given threshold, may provide relevant information about drought regimes. Taking advantage of a daily pluviometric database covering a great extension of Europe, a detailed analysis of the multifractality of the dry spell regimes is achieved. At the same time, an autoregressive process is applied with the aim of predicting DSL. A set of parameters, namely Hurst exponent, H, estimated from multifractal spectrum, f( α), critical Hölder exponent, α 0, for which f( α) reaches its maximum value, spectral width, W, and spectral asymmetry, B, permits a first clustering of European rain gauges in terms of the complexity of their DSL series. This set of parameters also allows distinguishing between time series describing fine- or smooth-structure of the DSL regime by using the complexity index, CI. Results of previous monofractal analyses also permits establishing comparisons between smooth-structures, relatively low correlation dimensions, notable predictive instability and anti-persistence of DSL for European areas, sometimes submitted to long droughts. Relationships are also found between the CI and the mean absolute deviation, MAD, and the optimum autoregressive order, OAO, of an ARIMA( p, d,0) autoregressive process applied to the DSL series. The detailed analysis of the discrepancies between empiric and predicted DSL underlines the uncertainty over predictability of long DSL, particularly for the Mediterranean region.

Diet and trophic ecology of the lanternfish Electrona risso (Cocco 1829) in the Strait of Messina (central Mediterranean Sea) and potential resource utilization from the Deep Scattering Layer (DSL)

Science.gov (United States)

Battaglia, Pietro; Andaloro, Franco; Esposito, Valentina; Granata, Antonia; Guglielmo, Letterio; Guglielmo, Rosanna; Musolino, Simona; Romeo, Teresa; Zagami, Giacomo

2016-07-01

The feeding habits of the mesopelagic lanternfish Electrona risso from the Strait of Messina (central Mediterranean Sea) were analyzed for the first time. A total of 326 individuals were collected stranded along the Sicilian coast of the Strait of Messina from October 2012 to May 2013. Specimens ranged from 12.0 to 53.8 mm LS (mean LS = 38.6 ± 8.4 mm). Their stomach content was examined and prey composition and feeding strategy were investigated. The results indicate that E. risso is a specialist predator, which feeds mainly on the small mesopelagic fish Cyclothone braueri (%IRI = 74.06) and in minor proportion on zooplankton, with a prevalence of copepods. The specialized feeding strategy of E. risso is confirmed by the low value of Levins standardized index (Bj = 0.141), which indicated a restricted niche breadth. The value of the index of trophic level (TROPH) for E. risso resulted 4.20. The prey composition suggests that E. risso can be considered a weakly vertical migrating species, that feeds on the DSL crustacean and fish communities below 300 m of depth.

Diagnostic staging laparoscopy in gastric cancer treatment: A cost-effectiveness analysis.

Science.gov (United States)

Li, Kevin; Cannon, John G D; Jiang, Sam Y; Sambare, Tanmaya D; Owens, Douglas K; Bendavid, Eran; Poultsides, George A

2018-05-01

Accurate preoperative staging helps avert morbidity, mortality, and cost associated with non-therapeutic laparotomy in gastric cancer (GC) patients. Diagnostic staging laparoscopy (DSL) can detect metastases with high sensitivity, but its cost-effectiveness has not been previously studied. We developed a decision analysis model to assess the cost-effectiveness of preoperative DSL in GC workup. Analysis was based on a hypothetical cohort of GC patients in the U.S. for whom initial imaging shows no metastases. The cost-effectiveness of DSL was measured as cost per quality-adjusted life-year (QALY) gained. Drivers of cost-effectiveness were assessed in sensitivity analysis. Preoperative DSL required an investment of $107 012 per QALY. In sensitivity analysis, DSL became cost-effective at a threshold of $100 000/QALY when the probability of occult metastases exceeded 31.5% or when test sensitivity for metastases exceeded 86.3%. The likelihood of cost-effectiveness increased from 46% to 93% when both parameters were set at maximum reported values. The cost-effectiveness of DSL for GC patients is highly dependent on patient and test characteristics, and is more likely when DSL is used selectively where procedure yield is high, such as for locally advanced disease or in detecting peritoneal and superficial versus deep liver lesions. © 2017 Wiley Periodicals, Inc.

A communication model to integrate the Request-Response and the Publish-Subscribe paradigms into ubiquitous systems.

Science.gov (United States)

Rodríguez-Domínguez, Carlos; Benghazi, Kawtar; Noguera, Manuel; Garrido, José Luis; Rodríguez, María Luisa; Ruiz-López, Tomás

2012-01-01

The Request-Response (RR) paradigm is widely used in ubiquitous systems to exchange information in a secure, reliable and timely manner. Nonetheless, there is also an emerging need for adopting the Publish-Subscribe (PubSub) paradigm in this kind of systems, due to the advantages that this paradigm offers in supporting mobility by means of asynchronous, non-blocking and one-to-many message distribution semantics for event notification. This paper analyzes the strengths and weaknesses of both the RR and PubSub paradigms to support communications in ubiquitous systems and proposes an abstract communication model in order to enable their seamless integration. Thus, developers will be focused on communication semantics and the required quality properties, rather than be concerned about specific communication mechanisms. The aim is to provide developers with abstractions intended to decrease the complexity of integrating different communication paradigms commonly needed in ubiquitous systems. The proposal has been applied to implement a middleware and a real home automation system to show its applicability and benefits.

An Integrated Framework to Specify Domain-Specific Modeling Languages

DEFF Research Database (Denmark)

Zarrin, Bahram; Baumeister, Hubert

2018-01-01

, a logic-based specification language. The drawback of MS DSL Tools is it does not provide a formal and rigorous approach for semantics specifications. In this framework, we use Microsoft DSL Tools to define the metamodel and graphical notations of DSLs, and an extended version of ForSpec as a formal......In this paper, we propose an integrated framework that can be used by DSL designers to implement their desired graphical domain-specific languages. This framework relies on Microsoft DSL Tools, a meta-modeling framework to build graphical domain-specific languages, and an extension of ForSpec...... language to define their semantics. Integrating these technologies under the umbrella of Microsoft Visual Studio IDE allows DSL designers to utilize a single development environment for developing their desired domain-specific languages....

A Communication Model to Integrate the Request-Response and the Publish-Subscribe Paradigms into Ubiquitous Systems

Directory of Open Access Journals (Sweden)

Tomás Ruiz-López

2012-06-01

Full Text Available The Request-Response (RR paradigm is widely used in ubiquitous systems to exchange information in a secure, reliable and timely manner. Nonetheless, there is also an emerging need for adopting the Publish-Subscribe (PubSub paradigm in this kind of systems, due to the advantages that this paradigm offers in supporting mobility by means of asynchronous, non-blocking and one-to-many message distribution semantics for event notification. This paper analyzes the strengths and weaknesses of both the RR and PubSub paradigms to support communications in ubiquitous systems and proposes an abstract communication model in order to enable their seamless integration. Thus, developers will be focused on communication semantics and the required quality properties, rather than be concerned about specific communication mechanisms. The aim is to provide developers with abstractions intended to decrease the complexity of integrating different communication paradigms commonly needed in ubiquitous systems. The proposal has been applied to implement a middleware and a real home automation system to show its applicability and benefits.

A Communication Model to Integrate the Request-Response and the Publish-Subscribe Paradigms into Ubiquitous Systems

Science.gov (United States)

Rodríguez-Domínguez, Carlos; Benghazi, Kawtar; Noguera, Manuel; Garrido, José Luis; Rodríguez, María Luisa; Ruiz-López, Tomás

2012-01-01

The Request-Response (RR) paradigm is widely used in ubiquitous systems to exchange information in a secure, reliable and timely manner. Nonetheless, there is also an emerging need for adopting the Publish-Subscribe (PubSub) paradigm in this kind of systems, due to the advantages that this paradigm offers in supporting mobility by means of asynchronous, non-blocking and one-to-many message distribution semantics for event notification. This paper analyzes the strengths and weaknesses of both the RR and PubSub paradigms to support communications in ubiquitous systems and proposes an abstract communication model in order to enable their seamless integration. Thus, developers will be focused on communication semantics and the required quality properties, rather than be concerned about specific communication mechanisms. The aim is to provide developers with abstractions intended to decrease the complexity of integrating different communication paradigms commonly needed in ubiquitous systems. The proposal has been applied to implement a middleware and a real home automation system to show its applicability and benefits. PMID:22969366

D-Saccharic acid 1,4-lactone protects diabetic rat kidney by ameliorating hyperglycemia-mediated oxidative stress and renal inflammatory cytokines via NF-κB and PKC signaling

Energy Technology Data Exchange (ETDEWEB)

Bhattacharya, Semantee [Department of Life Sciences and Biotechnology, Jadavpur University, 188, Raja S C Mullick Road, Kolkata 700 032 (India); Manna, Prasenjit [Division of Molecular Medicine, Bose Institute, P-1/12, CIT Scheme VII M, Kolkata-700054 (India); Gachhui, Ratan [Department of Life Sciences and Biotechnology, Jadavpur University, 188, Raja S C Mullick Road, Kolkata 700 032 (India); Sil, Parames C., E-mail: parames@bosemain.boseinst.ac.in [Division of Molecular Medicine, Bose Institute, P-1/12, CIT Scheme VII M, Kolkata-700054 (India)

2013-02-15

Increasing evidence suggests that oxidative stress is involved in the pathogenesis of diabetic nephropathy (DN) and this can be attenuated by antioxidants. D-Saccharic acid 1,4-lactone (DSL) is known for its detoxifying and antioxidant properties. Our early investigation showed that DSL can ameliorate alloxan (ALX) induced diabetes mellitus and oxidative stress in rats by inhibiting pancreatic β-cell apoptosis. In the present study we, therefore, investigated the protective role of DSL against renal injury in ALX induced diabetic rats. ALX exposure (at a dose of 120 mg/kg body weight, i. p., once) elevated the blood glucose level, serum markers related to renal injury, the production of reactive oxygen species (ROS), and disturbed the intra-cellular antioxidant machineries. Oral administration of DSL (80 mg/kg body weight) restored all these alterations close to normal. In addition, DSL could also normalize the aldose reductase activity which was found to increase in the diabetic rats. Investigating the mechanism of its protective activity, we observed the activation of different isoforms of PKC along with the accumulation of matrix proteins like collagen and fibronectin. The diabetic rats also showed nuclear translocation of NF-κB and increase in the concentration of inflammatory cytokines in the renal tissue. The activation of mitochondria dependent apoptotic pathway was observed in the diabetic rat kidneys. However, treatment of diabetic rats with DSL counteracted all these changes. These findings, for the first time, demonstrated that DSL could ameliorate renal dysfunction in diabetic rats by suppressing the oxidative stress related signalling pathways. - Highlights: ► Sustained hyperglycemia and oxidative stress lead to diabetic renal injury. ► D-saccharic acid 1,4-lactone prevents renal damage in alloxan-induced diabetes. ► It restores intra-cellular antioxidant machineries and kidney apoptosis. ► DSL reduces hyperglycemia-mediated oxidative stress

Debye screening length effects of nanostructured materials

CERN Document Server

Ghatak, Kamakhya Prasad

2014-01-01

This monograph solely investigates the Debye Screening Length (DSL) in semiconductors and their nano-structures. The materials considered are quantized structures of non-linear optical, III-V, II-VI, Ge, Te, Platinum Antimonide, stressed materials, Bismuth, GaP, Gallium Antimonide, II-V and Bismuth Telluride respectively. The DSL in opto-electronic materials and their quantum confined counterparts is studied in the presence of strong light waves and intense electric fields on the basis of newly formulated electron dispersion laws that control the studies of such quantum effect devices. The suggestions for the experimental determination of 2D and 3D DSL and the importance of measurement of band gap in optoelectronic materials under intense built-in electric field in nano devices and strong external photo excitation (for measuring photon induced physical properties) have also been discussed in this context. The influence of crossed electric and quantizing magnetic fields on the DSL and the DSL in heavily doped ...

Reconfigurable multiport EPON repeater

Science.gov (United States)

Oishi, Masayuki; Inohara, Ryo; Agata, Akira; Horiuchi, Yukio

2009-11-01

An extended reach EPON repeater is one of the solutions to effectively expand FTTH service areas. In this paper, we propose a reconfigurable multi-port EPON repeater for effective accommodation of multiple ODNs with a single OLT line card. The proposed repeater, which has multi-ports in both OLT and ODN sides, consists of TRs, BTRs with the CDR function and a reconfigurable electrical matrix switch, can accommodate multiple ODNs to a single OLT line card by controlling the connection of the matrix switch. Although conventional EPON repeaters require full OLT line cards to accommodate subscribers from the initial installation stage, the proposed repeater can dramatically reduce the number of required line cards especially when the number of subscribers is less than a half of the maximum registerable users per OLT. Numerical calculation results show that the extended reach EPON system with the proposed EPON repeater can save 17.5% of the initial installation cost compared with a conventional repeater, and can be less expensive than conventional systems up to the maximum subscribers especially when the percentage of ODNs in lightly-populated areas is higher.

Do top predators cue on sound production by mesopelagic prey?

Science.gov (United States)

Baumann-Pickering, S.; Checkley, D. M., Jr.; Demer, D. A.

2016-02-01

Deep-scattering layer (DSL) organisms, comprising a variety of mesopelagic fishes, and squids, siphonophores, crustaceans, and other invertebrates, are preferred prey for numerous large marine predators, e.g. cetaceans, seabirds, and fishes. Some of the DSL species migrate from depth during daylight to feed near the surface at night, transitioning during dusk and dawn. We investigated if any DSL organisms create sound, particularly during the crepuscular periods. Over several nights in summer 2015, underwater sound was recorded in the San Diego Trough using a high-frequency acoustic recording package (HARP, 10 Hz to 100 kHz), suspended from a drifting surface float. Acoustic backscatter from the DSL was monitored nearby using a calibrated multiple-frequency (38, 70, 120, and 200 kHz) split-beam echosounder (Simrad EK60) on a small boat. DSL organisms produced sound, between 300 and 1000 Hz, and the received levels were highest when the animals migrated past the recorder during ascent and descent. The DSL are globally present, so the observed acoustic phenomenon, if also ubiquitous, has wide-reaching implications. Sound travels farther than light or chemicals and thus can be sensed at greater distances by predators, prey, and mates. If sound is a characteristic feature of pelagic ecosystems, it likely plays a role in predator-prey relationships and overall ecosystem dynamics. Our new finding inspires numerous questions such as: Which, how, and why have DSL organisms evolved to create sound, for what do they use it and under what circumstances? Is sound production by DSL organisms truly ubiquitous, or does it depend on the local environment and species composition? How may sound production and perception be adapted to a changing environment? Do predators react to changes in sound? Can sound be used to quantify the composition of mixed-species assemblages, component densities and abundances, and hence be used in stock assessment or predictive modeling?

Buying a house with solar cells. Survey among subscribers and buyers of newly built houses in Amsterdam, Netherlands

International Nuclear Information System (INIS)

Van Mierlo, B.; Sprengers, M.

1995-12-01

In a new housing estate in Amsterdam in 1995 the regional energy utility (EBA) has integrated a photovoltaic (PV) system (250 kWp) into 63 houses out of 245 houses. The parts of these owner-occupied houses with PV panels are not owned by the occupants. In order to determine which are the motives to buy solar houses and in order to analyze changes in their attitudes questionnaires were sent to potential occupants twice. First to the people who registered for the new housing project (subscribers), and second to the people who bought one of the 245 houses either with or without PV (buyers). The overall conclusion is that PV does not play an important role in the decision making process when buying a new house. It is recommended to study differences in PV preferences and opinions a few years after the buyers have moved to their new houses. 10 figs., 17 tabs., 9 refs., 3 appendices

Hepatoprotective effects of kombucha tea: identification of functional strains and quantification of functional components.

Science.gov (United States)

Wang, Yong; Ji, Baoping; Wu, Wei; Wang, Ruojun; Yang, Zhiwei; Zhang, Di; Tian, Wenli

2014-01-30

Kombucha tea (KT), a traditional health beverage containing potential hepatoprotective agents, is fermented from sugared tea by a symbiotic culture of yeast and bacteria for 8 days. However, the functional strains that produce components for the hepatoprotective property of KT remain unclear. Multiple strains are involved in traditional KT production. Therefore, KT has not been standardized or produced commercially. This study aimed to identify the functional strains and quantify the functional components with hepatoprotective effects in kombucha tea. Gluconacetobacter sp. A4 was one of the microorganisms in KT in which the D-saccharic acid-1,4-lactone (DSL) produced by G. sp. A4 was significantly higher than that produced by original tea fungus at 8 days of fermentation. Traditional KT (TKT, tea broth fermented by mixed tea fungus), modified KT (MKT, fermented by single G. sp. A4), and DSL significantly inhibited the acetaminophen-induced increase of alanine aminotransferase, alkaline phosphatase, triglyceride and malondialdehyde, as well as facilitating the reduction of total antioxidant capacity in mice. Furthermore, MKT and TKT are both similar to DSL in terms of protection against acetaminophen-induced liver injury in mice. These results suggested a positive relationship between DSL content and the hepatoprotective effect of TKT, MKT and DSL groups. G. sp. A4 was concluded to be a potential functional strain and DSL might be the key functional component for the hepatoprotective property in KT. The stronger capability of G. sp. A4 in producing DSL makes it a better choice for the commercial production of KT. © 2013 Society of Chemical Industry.

Time coordination of heterogeneous distance protections using a domain specific language

OpenAIRE

Marcin Kowalski; Jan Magott

2012-01-01

BACKGROUND: Distance protections are widely used in protection of energy transmission lines, but their time coordination is still an important and difficult problem. Inappropriate configuration leads to a hazard event: remote circuit breaker tripping provided the local circuit breaker can be opened, which severely impairs power system operation.OBJECTIVE: To describe a method and provide software tools to alleviate the hazard in power systems.METHODS: A domain specific language (DSL) for repr...

Who Has the Knowledge if not the Primary Knower ? - Using exchange structure analysis to cast light on particular pedagogic practices in teaching Danish as a Second Language and History

DEFF Research Database (Denmark)

Meidell Sigsgaard, Anna-Vera

2012-01-01

This paper reports on findings from a project researching Danish as a Second Language (DSL). While official pedagogic discourse (Bernstein, 2000) is available in curriculum guidelines, the historically grounded relative autonomy of schools means that the actual pedagogic discourse of DSL varies...... in terms of teachers’ competencies. A deeply rooted progressivist approach to schooling combined with a more recent focus on national testing correlate with a Ministerial recommendation that DSL be taught embedded in the school’s other subjects (Undervisningsministeriet, 2005). This paper focuses...

Who Has the Knowledge if not the Primary Knower?

DEFF Research Database (Denmark)

Meidell Sigsgaard, Anna-Vera

This paper reports on findings from a project researching Danish as a Second Language (DSL). While official pedagogic discourse (Bernstein, 2000) is available in curriculum guidelines, the historically grounded relative autonomy of schools means that the actual pedagogic discourse of DSL varies...... in terms of teachers’ competencies. A deeply rooted progressivist approach to schooling combined with a more recent focus on national testing correlate with a Ministerial recommendation that DSL be taught embedded in the school’s other subjects (Undervisningsministeriet, 2005). This paper focuses...

Implementing Explicit and Finding Implicit Sharing in Embedded DSLs

Directory of Open Access Journals (Sweden)

Oleg Kiselyov

2011-09-01

Full Text Available Aliasing, or sharing, is prominent in many domains, denoting that two differently-named objects are in fact identical: a change in one object (memory cell, circuit terminal, disk block is instantly reflected in the other. Languages for modelling such domains should let the programmer explicitly define the sharing among objects or expressions. A DSL compiler may find other identical expressions and share them, implicitly. Such common subexpression elimination is crucial to the efficient implementation of DSLs. Sharing is tricky in embedded DSL, since host aliasing may correspond to copying of the underlying objects rather than their sharing. This tutorial summarizes discussions of implementing sharing in Haskell DSLs for automotive embedded systems and hardware description languages. The technique has since been used in a Haskell SAT solver and the DSL for music synthesis. We demonstrate the embedding in pure Haskell of a simple DSL with a language form for explicit sharing. The DSL also has implicit sharing, implemented via hash-consing. Explicit sharing greatly speeds up hash-consing. The seemingly imperative nature of hash-consing is hidden beneath a simple combinator language. The overall implementation remains pure functional and easy to reason about.

Bossa Nova: Introducing modularity into the Bossa Nova domain-specific language

DEFF Research Database (Denmark)

Lawall, Julia Laetitia; Duschene, Hervé; Muller, Gilles

2005-01-01

subfamilies in using this language to implement an encyclopedic, multi-OS library of scheduling policies. In this paper, we propose that introducing certain kinds of modularity into the language can furnish abstractions appropriate for implementing scheduling policy subfamilies. We present the design of our...... of how to capture these subfamilies in DSL abstractions. A solution should retain features of the original DSL to leverage existing expertise and support tools.   The Bossa DSL is a language targeted towards the development of kernel process scheduling policies. We have encountered the issue of program...

UNA HERRAMIENTA DE DIAGNÓSTICO PARA ENLACES DE SUSCRIPCIÓN DIGITAL ASIMÉTRICA (ADSL A DIAGNOSTIC TOOL FOR ASYMMETRIC DIGITAL SUBSCRIBER LINE LINKS

Directory of Open Access Journals (Sweden)

Mario Medina Carrasco

2009-04-01

Full Text Available Se presenta el software CuLineAnalyzer, una herramienta de diagnóstico para enlaces ADSL que aprovecha las mediciones de las razones señal-ruido (SNR de los subcanales de la técnica de transmisión DMT realizadas por las propias unidades de terminación ADSL (ATU. Estos datos son adquiridos remotamente y se almacenan en una estación central, desde donde pueden ser desplegados a solicitud del operador, el cual los utiliza para realizar los diagnósticos pertinentes. Una fortaleza importante de esta herramienta es la capacidad de almacenar mediciones realizadas a diferentes horas del día durante largos períodos para detectar así condiciones esporádicas, errores espurios y tendencias en la condición de la línea. Esta herramienta ha sido usada con éxito para monitorear un banco de módems ADSL Alcatel SpeedTouch. El diseño modular y operación paramétrica de la herramienta permite adaptarla fácilmente a nuevos modelos de módems ADSL y DSLAMs.We present the CuLineAnalyzer software, a diagnostic tool for ADSL links that leverages the DMT subchannel signal-to-noise ratio (SNR measurements made by the ATUs themselves. These measurements are read via remote access and are logged into a central server, from which they can be displayed under operator control, so the pertinent diagnosis can be performed. An important strength of this tool is that it can store measurements performed at different times for long periods, so as to detect sporadic conditions, spurious errors and line condition trends. This tool has been used successfully to monitor a bank of Alcatel SpeedTouch ADSL modems. The tool's modular design and parametric operation makes it easy to adapt it to new ADSL modem and DSLAM models.

Distribution and abundance of pelagic shrimps from the deep scattering layer of the eastern Arabian Sea

Digital Repository Service at National Institute of Oceanography (India)

Karuppasamy, P.K.; Menon, N.G.; Nair, K.K.C.; Achuthankutty, C.T.

&ons like co~e~ods to depended on the concentration of DSL thickness as evidenced macroorganisms like shrimps, squids and fishes that prey from from echograms. The catches were preserved in 10% buffered within and outside the DSL Ongmanson & William 1973...

Click Spam Prevention Model for On-Line Advertisement

OpenAIRE

Zingirian, Nicola; Benini, Michele

2018-01-01

This paper shows a vulnerability of the pay-per-click accounting of Google Ads and proposes a statistical tradeoff-based approach to manage this vulnerability. The result of this paper is a model to calculate the overhead cost per click necessary to protect the subscribers and a simple algorithm to implement this protection. Simulations validate the correctness of the model and the economical applicability.

Research of application mode for FTTX technology

Science.gov (United States)

Wang, Zhong; Yun, Xiang; Huang, Wei

2009-08-01

With rapid development of Internet and broadband access network, the technologies of xDSL, FTTx+LAN, WLAN have more applications, new network service emerges in endless stream, especially the increase of network game, meeting TV, video on demand, etc. FTTH supports all present and future service with enormous bandwidth, including traditional telecommunication service, traditional data service and traditional TV service, and the future digital TV and VOD. With huge bandwidth of FTTH, it wins the final solution of broadband network, becomes the final goal of development of optical access network. In this paper, technique theory of EPON is introduced at first. At the same time, MAC frame structure, automatic detection and ranging of MPCP, DBA,and multi-LLID of EPON is analyzed. Then, service development ability, cost advantage and maintenance superiority based on EPON technology are carried out. At last,with Cost comparison between FTTH / FTTB building model and the traditional model, FTTB + LAN mode which is suitable for the newadding residential users in general areas and FTTN + DSL mode which is suitable for the old city and rural access network transformation are built up in detail. And FTTN + DSL project of rural information in rural areas and FTTH broadband HOUSE project on service solutions program are analyzed. comparing to the traditional access technologies, EPON technology has the obvious advantages, such as distance transmission, high or wide band, saving line resources, service abilities, etc. These are the qualities which not only be served for home users, but solve more access problems for us effectively.

Implementing domain-specific languages with Xtext and Xtend

CERN Document Server

Bettini, Lorenzo

2013-01-01

A step-by-step guide that enables you to quickly implement a DSL with Xtext and Xtend in a test-driven way with the aid of simplified examples.This book is for programmers who want to learn about Xtext and how to use it to implement a DSL (or a programming language) together with Eclipse IDE tooling. It assumes that the user is familiar with Eclipse and its functionality. Existing basic knowledge of a compiler implementation would be useful, though not strictly required, since the book will explain all the stages of the development of a DSL.

Children's speech recognition and loudness perception with the Desired Sensation Level v5 Quiet and Noise prescriptions.

Science.gov (United States)

Crukley, Jeffery; Scollie, Susan D

2012-12-01

To determine whether Desired Sensation Level (DSL) v5 Noise is a viable hearing instrument prescriptive algorithm for children, in comparison with DSL v5 Quiet. In particular, the authors compared children's performance on measures of consonant recognition in quiet, sentence recognition in noise, and loudness perception when fitted with DSL v5 Quiet and Noise. Eleven children (ages 8 to 17 years) with stable, congenital sensorineural hearing losses participated in the study. Participants were fitted bilaterally to DSL v5 prescriptions with behind-the-ear hearing instruments. The order of prescription was counterbalanced across participants. Repeated measures analysis of variance was used to compare performance between prescriptions. Use of the Noise prescription resulted in a significant decrease in consonant perception in Quiet with low-level input, but no difference with average-level input. There was no significant difference in sentence-in-noise recognition between the two prescriptions. Loudness ratings for input levels above 72 dB SPL were significantly lower with the noise prescription. Average-level consonant recognition in quiet was preserved and aversive loudness was alleviated by the Noise prescription relative to the quiet prescription, which suggests that the DSL v5 Noise prescription may be an effective approach to managing the nonquiet listening needs of children with hearing loss.

Projected sea level rise, gyre circulation and water mass formation in the western North Pacific: CMIP5 inter-model analysis

Science.gov (United States)

Terada, Mio; Minobe, Shoshiro

2018-06-01

Future changes in the dynamic sea level (DSL), which is defined as sea-level deviation from the global mean sea level, is investigated over the North Pacific, by analyzing data from the Coupled Model Intercomparison Project Phase 5. The analysis provides more comprehensive descriptions of DSL responses to the global warming in this region than available from previous studies, by using surface and subsurface data until the year 2300 under middle and high greenhouse-gas emission scenarios. The DSL changes in the North Pacific are characterized by a DSL rise in the western North Pacific around the Kuroshio Extension (KE), as also reported by previous studies. Subsurface density analysis indicates that DSL rise around the KE is associated with decrease in density of subtropical mode water (STMW) and with northward KE migration, the former (latter) of which is relatively strong between 2000 and 2100 for both RCP4.5 and RCP8.5 (between 2100 and 2300 for RCP8.5). The STMW density decrease is related to large heat uptake to the south and southeast of Japan, while the northward KE migration is associated with the poleward shift of the wind stress field. These features are commonly found in multi-model ensemble means and the relations among representative quantities produced by different climate models.

A microprocessor based exchange data collection and analysis terminal application to A.E.A. PABX

International Nuclear Information System (INIS)

Mohammed, F.A.; Ezzat, A.K.; Ayad, N.M.A.

1978-01-01

The traffic data acquisition and analysis comprises micro-processer based data collection, terminals (MBDCT) and a centralized computer. The MBDCT's can communicate with the computer through a data set system. Each (MBDCT) remote terminal is connected to about two hundreds subscriber lines. It scans the trunk lines to detect the on/off hook states and to calculate the call time and the called number. If the called subscriber is not from the 200 local lines, its status should be detected though the computer communication with the two terminals. The data collected by the terminal can be slightly analysed using the microprocessor programming capability. More-over short quality performance reports can be printed on a printer interfaced to the microprocessor. Also, data can be transmitted to the central computer for further data traffic investigation. The analysis outcome can be utilized for telephone line maintenance and reorganization. This report is concerned with the terminal details as applied to the A-E-A. PABX. It consists mainly of five external lines and about 300 internal lines

A Domain Specific Language for Performance Evaluation of Medical Imaging Systems

NARCIS (Netherlands)

van den Berg, Freek; Remke, Anne Katharina Ingrid; Haverkort, Boudewijn R.H.M.; Turau, Volker; Kwiatkowska, Marta; Mangharam, Rahul; Weyer, Christoph

2014-01-01

We propose iDSL, a domain specific language and toolbox for performance evaluation of Medical Imaging Systems. iDSL provides transformations to MoDeST models, which are in turn converted into UPPAAL and discrete-event MODES models. This enables automated performance evaluation by means of model

Photoelectric Properties of Si Doping Superlattice Structure on 6H-SiC(0001).

Science.gov (United States)

Li, Lianbi; Zang, Yuan; Hu, Jichao; Lin, Shenghuang; Chen, Zhiming

2017-05-25

The energy-band structure and visible photoelectric properties of a p/n-Si doping superlattice structure (DSL) on 6H-SiC were simulated by Silvaco-TCAD. The,n the Si-DSL structures with 40 nm-p-Si/50 nm-n-Si multilayers were successfully prepared on 6H-SiC(0001) Si-face by chemical vapor deposition. TEM characterizations of the p/n-Si DSL confirmed the epitaxial growth of the Si films with preferred orientation and the misfit dislocations with a Burgers vector of 1/3 at the p-Si/n-Si interface. The device had an obvious rectifying behavior, and the turn-on voltage was about 1.2 V. Under the visible illumination of 0.6 W/cm², the device demonstrated a significant photoelectric response with a photocurrent density of 2.1 mA/cm². Visible light operation of the Si-DSL/6H-SiC heterostructure was realized for the first time.

Photoelectric Properties of Si Doping Superlattice Structure on 6H-SiC(0001

Directory of Open Access Journals (Sweden)

Lianbi Li

2017-05-01

Full Text Available The energy-band structure and visible photoelectric properties of a p/n-Si doping superlattice structure (DSL on 6H-SiC were simulated by Silvaco-TCAD. The,n the Si-DSL structures with 40 nm-p-Si/50 nm-n-Si multilayers were successfully prepared on 6H-SiC(0001 Si-face by chemical vapor deposition. TEM characterizations of the p/n-Si DSL confirmed the epitaxial growth of the Si films with preferred orientation and the misfit dislocations with a Burgers vector of 1/3 <21-1> at the p-Si/n-Si interface. The device had an obvious rectifying behavior, and the turn-on voltage was about 1.2 V. Under the visible illumination of 0.6 W/cm2, the device demonstrated a significant photoelectric response with a photocurrent density of 2.1 mA/cm2. Visible light operation of the Si-DSL/6H-SiC heterostructure was realized for the first time.

47 CFR 68.213 - Installation of other than “fully protected” non-system simple customer premises wiring.

Science.gov (United States)

2010-10-01

... only to “unprotected” premises wiring used with simple installations of wiring for up to four line residential and business telephone service. More complex installations of wiring for multiple line services... requirements, for installation and maintenance of wiring on the subscriber's side of the demarcation point...

Conceptual model of the globalization for domain-specific languages

NARCIS (Netherlands)

Clark, T.; van den Brand, M.; Combemale, B.; Rumpe, B.; Combemale, B.

2015-01-01

Domain Specific Languages (DSL) have received some prominence recently. Designing a DSL and all their tools is still cumbersome and lots of work. Engineering of DSLs is still at infancy, not even the terms have been coined and agreed on. In particular globalization and all its consequences need to

Domain Specific Language Support for Exascale

Energy Technology Data Exchange (ETDEWEB)

Sadayappan, Ponnuswamy [The Ohio State Univ., Columbus, OH (United States)

2017-02-24

Domain-Specific Languages (DSLs) offer an attractive path to Exascale software since they provide expressive power through appropriate abstractions and enable domain-specific optimizations. But the advantages of a DSL compete with the difficulties of implementing a DSL, even for a narrowly defined domain. The DTEC project addresses how a variety of DSLs can be easily implemented to leverage existing compiler analysis and transformation capabilities within the ROSE open source compiler as part of a research program focusing on Exascale challenges. The OSU contributions to the DTEC project are in the area of code generation from high-level DSL descriptions, as well as verification of the automatically-generated code.

Light penetration structures the deep acoustic scattering layers in the global ocean.

KAUST Repository

Aksnes, Dag L.; Rø stad, Anders; Kaartvedt, Stein; Martinez, Udane; Duarte, Carlos M.; Irigoien, Xabier

2017-01-01

The deep scattering layer (DSL) is a ubiquitous acoustic signature found across all oceans and arguably the dominant feature structuring the pelagic open ocean ecosystem. It is formed by mesopelagic fishes and pelagic invertebrates. The DSL animals are an important food source for marine megafauna and contribute to the biological carbon pump through the active flux of organic carbon transported in their daily vertical migrations. They occupy depths from 200 to 1000 m at daytime and migrate to a varying degree into surface waters at nighttime. Their daytime depth, which determines the migration amplitude, varies across the global ocean in concert with water mass properties, in particular the oxygen regime, but the causal underpinning of these correlations has been unclear. We present evidence that the broad variability in the oceanic DSL daytime depth observed during the Malaspina 2010 Circumnavigation Expedition is governed by variation in light penetration. We find that the DSL depth distribution conforms to a common optical depth layer across the global ocean and that a correlation between dissolved oxygen and light penetration provides a parsimonious explanation for the association of shallow DSL distributions with hypoxic waters. In enhancing understanding of this phenomenon, our results should improve the ability to predict and model the dynamics of one of the largest animal biomass components on earth, with key roles in the oceanic biological carbon pump and food web.

Light penetration structures the deep acoustic scattering layers in the global ocean.

KAUST Repository

Aksnes, Dag L.

2017-05-01

The deep scattering layer (DSL) is a ubiquitous acoustic signature found across all oceans and arguably the dominant feature structuring the pelagic open ocean ecosystem. It is formed by mesopelagic fishes and pelagic invertebrates. The DSL animals are an important food source for marine megafauna and contribute to the biological carbon pump through the active flux of organic carbon transported in their daily vertical migrations. They occupy depths from 200 to 1000 m at daytime and migrate to a varying degree into surface waters at nighttime. Their daytime depth, which determines the migration amplitude, varies across the global ocean in concert with water mass properties, in particular the oxygen regime, but the causal underpinning of these correlations has been unclear. We present evidence that the broad variability in the oceanic DSL daytime depth observed during the Malaspina 2010 Circumnavigation Expedition is governed by variation in light penetration. We find that the DSL depth distribution conforms to a common optical depth layer across the global ocean and that a correlation between dissolved oxygen and light penetration provides a parsimonious explanation for the association of shallow DSL distributions with hypoxic waters. In enhancing understanding of this phenomenon, our results should improve the ability to predict and model the dynamics of one of the largest animal biomass components on earth, with key roles in the oceanic biological carbon pump and food web.

Yeast Interacting Proteins Database: YNL258C, YKR022C [Yeast Interacting Proteins Database

Lifescience Database Archive (English)

Full Text Available YNL258C DSL1 Peripheral membrane protein required for Golgi-to-ER retrograde traffi...equired for Golgi-to-ER retrograde traffic; component of the ER target site that interacts with coatomer, th...it ORF YNL258C Bait gene name DSL1 Bait description Peripheral membrane protein r

Near Real-Time Call Detail Record ETL Flows

Science.gov (United States)

Cochinwala, Munir; Panagos, Euthimios

Telecommunication companies face significant business challenges as they strive to reduce subscriber churn and increase average revenue per user (ARPU) by offering new services and incorporating new functionality into existing services. The increased number of service offerings and available functionality result in an ever growing volume of call detail records (CDRs). For many services (e.g., pre-paid), CDRs need to be processed and analyzed in near real-time for several reasons, including charging, on-line subscriber access to their accounts, and analytics for predicting subscriber usage and preventing fraudulent activity. In this paper, we describe the challenges associated with near real-time extract, transform, and load (ETL) of CDR data warehouse flows for supporting both the operational and business intelligence needs of telecommunication services, and we present our approach to addressing these challenges.

A flexible solution for the next generation EPON with hybrid bidirectional 1Gbps and 10Gbps

Science.gov (United States)

Zhang, Weixun; Qiao, Yaojun; Li, Hui; Ji, Yuefeng

2007-11-01

Ethernet PON (EPON) has been proved to be a successful technology among all the standardized PON systems [1, 2], in terms of its cost-effective and large bandwidth virtue. And EPON has become a network of a choice for subscriber oriented digital service delivery, taking over the market previously dominated by DSL. However, with the development of advanced video services, the bandwidth capacity of current EPON seems to be not well suited for the future large deployment of triple-play services. Many researches are now taken about the Next Generation EPON; and the recent 10G EPON system standardization effort in the IEEE [3] results a lot of interest in the evolution of current PON systems towards high data rate system capable of providing a future-proof platform for delivery of personalized triple-play services. In this paper, a novel architecture of TDM-based 10GE-PON system is proposed. It combines the GE-PON and 10GE-PON systems, and provides symmetric 1Gbps/10Gbps or asymmetric access simultaneously. According to the results of the simulation on the system throughput and latency performance, the system is verified to be one solution and an important step from 1Gbit/s to 10Gbit/s for the Next Generation EPON.

26 CFR 49.4252-7 - Wire and equipment service.

Science.gov (United States)

2010-04-01

... of illegal entry, fire, leakage, etc. (2) Wire lines or channels furnished between a point of origin... subscriber may obtain information as to a given condition at the remote point, such as water level, water pressure, gas pressure, etc. (4) Remote control wire lines or channels furnished between a remote point and...

A Domain-Specific Language for Railway Interlocking Systems

DEFF Research Database (Denmark)

Vu, Linh Hong; Haxthausen, Anne Elisabeth; Peleska, Jan

2014-01-01

). Furthermore, the paper describes an interlocking table generator (ITG) that generates automatically a well-formed interlocking table from a well-formed railway network layout. Experiments with the DSL and ITG using the RAISE tools and the C++ implementation show that the use of the DSL and ITG can increase...... the productivity and significantly reduce errors in the specifications of railway interlocking systems....

Inside... Platinum Jubilee 1934-2009

Indian Academy of Sciences (India)

2009-09-04

Sep 4, 2009 ... As a consequence, genetic analyses of disease patterns can yield ... Speed Digital Subscriber Line (or the VDSL). Twenty four newly elected .... In 2007, the International Union of Materials Research. Societies (IUMRS) ...

PTSD: National Center for PTSD

Medline Plus

Full Text Available ... Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required Button to subscribe to email VA HOME Notices Privacy FOIA Regulations Web Policies No FEAR Act Whistleblower ...

Model-based DSL frameworks

NARCIS (Netherlands)

Ivanov, Ivan; Bézivin, J.; Jouault, F.; Valduriez, P.

2006-01-01

More than five years ago, the OMG proposed the Model Driven Architecture (MDA™) approach to deal with the separation of platform dependent and independent aspects in information systems. Since then, the initial idea of MDA evolved and Model Driven Engineering (MDE) is being increasingly promoted to

Bit Error Rate Minimizing Channel Shortening Equalizers for Single Carrier Cyclic Prefixed Systems

National Research Council Canada - National Science Library

Martin, Richard K; Vanbleu, Koen; Ysebaert, Geert

2007-01-01

.... Previous work on channel shortening has largely been in the context of digital subscriber lines, a wireline system that allows bit allocation, thus it has focused on maximizing the bit rate for a given bit error rate (BER...

Cyberspace 101: taking a ride on the information superhighway.

Science.gov (United States)

Hayes, D; Forsell, G; Hansen, K; Homer-Trobaugh, J

1997-10-01

All you need to explore cyberspace is a computer, a modem, a phone line, and a local "on-ramp" to the infohighway. A litserv is an interactive mailing list that distributes information to a large number of people at the same time. Once you subscribe, you receive copies of all messages sent into listserv and have the opportunity to post questions and comments for other subscribers. Dietetics Online: A Network of Dietetic/Nutrition Professionals offers a range of cutting-edge services. Online marketing can reach a potentially larger audience for a fraction of the cost of traditional means and expand your business geographically.

Underwater Sound Scattering by Marine Organisms. A Review,

Science.gov (United States)

1979-08-01

Nematobrachion sp., stomiaLoid fish, Vinuguerria nimbaria, and myctophid fish, Notolychnus valiviae showed the strongest association with the main DSL...Partial migrators of the genus Argyropeleus ( stomiatoid fish) were also collected in the main DSL, but not in the combined upper layer. Several near-shore...287. 116. Gibbs, R.H. and Hurwitz, B. (1967). Systematics and zoogeography of Stomiatoid fishes Chauliodus pammelas and C. Sloani of Indian Ocean

Symbiosis between microorganisms from kombucha and kefir: Potential significance to the enhancement of kombucha function.

Science.gov (United States)

Yang, Zhiwei; Zhou, Feng; Ji, Baoping; Li, Bo; Luo, Yangchao; Yang, Li; Li, Tao

2010-01-01

Gluconacetobacter sp. A4 (G. sp. A4), which had strong ability to produce d-saccharic acid 1, 4 lactone (DSL), was the key functional bacteria isolated from the kombucha preserved. This paper investigated the interaction between G. sp. A4 and ten different strains of lactic acid bacteria (LAB) obtained from kefir. The result suggested that the LAB promoted DSL production of G. sp. A4 to different extents, ranging from 4.86% to 86.70%. Symbiosis between G. sp. A4 and LAB was studied. LAB's metabolites, xylitol, and acetic acid, were utilized by G. sp. A4, and it promoted the growth of G. sp. A4 and yield of DSL. Therefore, in developing starter cultures for kombucha fermentation process, a mixed flora of LAB and G. sp. A4 would be the optimal combination.

Unbundling in Current Broadband and Next-Generation Ultra-Broadband Access Networks

Science.gov (United States)

Gaudino, Roberto; Giuliano, Romeo; Mazzenga, Franco; Valcarenghi, Luca; Vatalaro, Francesco

2014-05-01

This article overviews the methods that are currently under investigation for implementing multi-operator open-access/shared-access techniques in next-generation access ultra-broadband architectures, starting from the traditional "unbundling-of-the-local-loop" techniques implemented in legacy twisted-pair digital subscriber line access networks. A straightforward replication of these copper-based unbundling-of-the-local-loop techniques is usually not feasible on next-generation access networks, including fiber-to-the-home point-to-multipoint passive optical networks. To investigate this issue, the article first gives a concise description of traditional copper-based unbundling-of-the-local-loop solutions, then focalizes on both next-generation access hybrid fiber-copper digital subscriber line fiber-to-the-cabinet scenarios and on fiber to the home by accounting for the mix of regulatory and technological reasons driving the next-generation access migration path, focusing mostly on the European situation.

Combining Diffusion Models and Macroeconomic Indicators with a Modified Genetic Programming Method: Implementation in Forecasting the Number of Mobile Telecommunications Subscribers in OECD Countries

Directory of Open Access Journals (Sweden)

Konstantinos Salpasaranis

2014-01-01

Full Text Available This paper proposes a modified Genetic Programming method for forecasting the mobile telecommunications subscribers’ population. The method constitutes an expansion of the hybrid Genetic Programming (hGP method improved by the introduction of diffusion models for technological forecasting purposes in the initial population, such as the Logistic, Gompertz, and Bass, as well as the Bi-Logistic and LogInLog. In addition, the aforementioned functions and models expand the function set of hGP. The application of the method in combination with macroeconomic indicators such as Gross Domestic Product per Capita (GDPpC and Consumer Prices Index (CPI leads to the creation of forecasting models and scenarios for medium- and long-term level of predictability. The forecasting module of the program has also been improved with the multi-levelled use of the statistical indices as fitness functions and model selection indices. The implementation of the modified-hGP in the datasets of mobile subscribers in the Organisation for Economic Cooperation and Development (OECD countries shows very satisfactory forecasting performance.

Complex behaviour and predictability of the European dry spell regimes

Directory of Open Access Journals (Sweden)

X. Lana

2010-09-01

Full Text Available The complex spatial and temporal characteristics of European dry spell lengths, DSL, (sequences of consecutive days with rainfall amount below a certain threshold and their randomness and predictive instability are analysed from daily pluviometric series recorded at 267 rain gauges along the second half of the 20th century. DSL are obtained by considering four thresholds, R₀, of 0.1, 1.0, 5.0 and 10.0 mm/day. A proper quantification of the complexity, randomness and predictive instability of the different DSL regimes in Europe is achieved on the basis of fractal analyses and dynamic system theory, including the reconstruction theorem. First, the concept of lacunarity is applied to the series of daily rainfall, and the lacunarity curves are well fitted to Cantor and random Cantor sets. Second, the rescaled analysis reveals that randomness, persistence and anti-persistence are present on the European DSL series. Third, the complexity of the physical process governing the DSL series is quantified by the minimum number of nonlinear equations determined by the correlation dimension. And fourth, the loss of memory of the physical process, which is one of the reasons for the complex predictability, is characterized by the values of the Kolmogorov entropy, and the predictive instability is directly associated with positive Lyapunov exponents. In this way, new bases for a better prediction of DSLs in Europe, sometimes leading to drought episodes, are established. Concretely, three predictive strategies are proposed in Sect. 5. It is worth mentioning that the spatial distribution of all fractal parameters does not solely depend on latitude and longitude but also reflects the effects of orography, continental climate or vicinity to the Atlantic and Arctic Oceans and Mediterranean Sea.

Sexual dysfunction and dissatisfaction in chronic hepatitis C patients

Directory of Open Access Journals (Sweden)

Bruno Cópio Fábregas

2014-10-01

Full Text Available Introduction The prevalence of sexual dysfunction (SD and dissatisfaction with sexual life (DSL in patients with chronic hepatitis C virus infection (CHC was jointly investigated via a thorough psychopathological analysis, which included dimensions such as fatigue, impulsiveness, psychiatric comorbidity, health-related quality of life (HRQL and sociodemographic and clinical characteristics. Methods Male and female CHC patients from an outpatient referral center were assessed using the Brief Fatigue Inventory, the Barrat Impulsiveness Scale, the Beck Depression Inventory (BDI, the Hospital Anxiety and Depression Scale, the Hamilton Anxiety Scale (HAM-A, and the World Health Organization Quality of Life Scale-Brief Version (WHOQOL-BREF. Structured psychiatric interviews were performed according to the Mini-International Neuropsychiatric Interview. SD was assessed based on specific items in the BDI (item 21 and the HAM-A (item 12. DSL was assessed based on a specific question in the WHOQOL-BREF (item 21. Multivariate analysis was performed according to an ordinal linear regression model in which SD and DSL were considered as outcome variables. Results SD was reported by 60 (57.1% of the patients according to the results of the BDI and by 54 (51.4% of the patients according to the results of the HAM-A. SD was associated with older age, female gender, viral genotype 2 or 3, interferon-α use, impulsiveness, depressive symptoms, antidepressant and benzodiazepine use, and lower HRQL. DSL was reported by 34 (32.4% of the patients and was associated with depressive symptoms, anxiety symptoms, antidepressant use, and lower HRQL. Conclusions The prevalence of SD and DSL in CHC patients was high and was associated with factors, such as depressive symptoms and antidepressant use. Screening and managing these conditions represent significant steps toward improving medical assistance and the HRQL of CHC patients.

Dual Sensory Loss and Depressive Symptoms: The Importance of Hearing, Daily Functioning and Activity Engagement

Directory of Open Access Journals (Sweden)

Kim Matthew Kiely

2013-12-01

Full Text Available Background: The association between dual sensory loss (DSL and mental health has been well established. However, most studies have relied on self-report data and lacked measures that would enable researchers to examine causal pathways between DSL and depression. This study seeks to extend this research by examining the effects of DSL on mental health, and identify factors that explain the longitudinal associations between sensory loss and depressive symptoms. Methods: Piecewise linear-mixed models were used to analyse 16-years of longitudinal data collected on up to five occasions from 1611 adults (51% men aged between 65 and 103 years. Depressive symptoms were assessed by the Centre for Epidemiological Studies Depression (CES-D. Vision loss (VL was defined by corrected visual acuity greater than 0.3 logMAR in the better eye, blindness or glaucoma. Hearing loss (HL was defined by pure tone average (PTA greater than 25 dB in the better hearing ear. Analyses were adjusted for socio-demographics, medical conditions, lifestyle behaviours, Activities of Daily Living (ADLs, cognitive function, and social engagement. Results: Unadjusted models indicated that higher levels of depressive symptoms were associated with HL (B=1.16, SE=0.33 and DSL (B=2.15, SE=0.39 but not VL. Greater rates of change in depressive symptoms were also evident after the onset of HL (B=0.16, SE=0.06, p

PTSD: National Center for PTSD

Medline Plus

Full Text Available ... Veterans Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required Button to subscribe to email VA HOME Notices Privacy FOIA Regulations Web Policies No FEAR Act Whistleblower Rights & Protections Site Index USA.gov White House Inspector ...

Introducing modified TypeScript in an existing framework to improve error handling

OpenAIRE

Minder, Patrik

2016-01-01

Error messages in compilers is a topic that is often overlooked. The quality of the messages can have a big impact on development time and ease oflearning. Another method used to speed up development is to build a domainspecific language (DSL). This thesis migrates an existing framework to use TypeScript in order to speed up development time with compile-time error handling. Alternative methods for implementing a DSL are evaluated based onhow they affect the ability to generate good error mes...

PTSD: National Center for PTSD

Medline Plus

Full Text Available ... Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required Button to subscribe to email VA HOME Notices Privacy FOIA Regulations Web Policies No FEAR Act Whistleblower Rights & Protections Site Index USA.gov White House Inspector General QUICK ...

Link Power Budget and Traffict QoS Performance Analysis of Gygabit Passive Optical Network

Science.gov (United States)

Ubaidillah, A.; Alfita, R.; Toyyibah

2018-01-01

Data service of telecommunication network is needed widely in the world; therefore extra wide bandwidth must be provided. For this case, PT. Telekomunikasi Tbk. applies GPON (Gigabit Passive Optical Network) as optical fibre based on telecommunication network system. GPON is a point to a multipoint technology of FTTx (Fiber to The x) that transmits information signals to the subscriber over optical fibre. In GPON trunking system, from OLT (Optical Line Terminal), the network is split to many ONT (Optical Network Terminal) of the subscribers, so it causes path loss and attenuation. In this research, the GPON performance is measured from the link power budget system and the Quality of Service (QoS) of the traffic. And the observation result shows that the link power budget system of this GPON is in good condition. The link power budget values from the mathematical calculation and direct measurement are satisfy the ITU-T G984 Class B standard, that the power level must be between -8 dBm to -27 dBm. While from the traffic performance, the observation result shows that the network resource utility of the subscribers of the observed area is not optimum. The mean of subscriber utility rate is 27.985 bps for upstream and 79.687 bps for downstream. While maximally, It should be 60.800 bps for upstream and 486.400 bps for downstream.

Light penetration structures the deep acoustic scattering layers in the global ocean

DEFF Research Database (Denmark)

Aksnes, Dag L.; Rostad, Anders; Kaartvedt, Stein

2017-01-01

The deep scattering layer (DSL) is a ubiquitous acoustic signature found across all oceans and arguably the dominant feature structuring the pelagic open ocean ecosystem. It is formed by mesopelagic fishes and pelagic invertebrates. The DSL animals are an important food source for marine megafauna...... distributions with hypoxic waters. In enhancing understanding of this phenomenon, our results should improve the ability to predict and model the dynamics of one of the largest animal biomass components on earth, with key roles in the oceanic biological carbon pump and food web....

用戶著作權侵權之網路服務業者責任 Internet Service Provider Liability for Subscriber Copyright Infrigement

Directory of Open Access Journals (Sweden)

蔡蕙芳 Hui-Fang Tsai

2004-12-01

Full Text Available 網路服務業者的責任可說是網路上最具爭議的問題。本文的目的在於從一般性原則上討論用戶涉及著作權侵權時，網路服務業者是否可能成立民事侵權與刑事犯罪責任。個案的深入討論並不在本文範圍內。本文首先介紹美國侵權法上網路服務業者責任，內容包括法院判決、學說見解與國會立法。其次，本文將從刑法理論來分析用戶成立直接正犯之同時，網路服務業者可能構成共同正犯、正犯後正犯或共犯。此外，也將分別檢討正犯與共犯之成立要件。最後，本文將檢討我國法上相關法律如何適用以解決網路服務 業者責任，並提出增訂網路服務業者責任規定之建議。 The liability of internet service provider (ISP is perhaps the most controversial legal issue to emerge from cyberspace. The purpose of this paper is to explore the general principles as to whether there should be civil and criminal liability for ISP concerning subscriber copyright infringement. An in-depth treatment of case study is beyond the scope of this paper. The first section provides an overview of the doctrine of ISP copyright infringement liability in America, followed by the introduction of judicial decisions, opinions of scholars and new legislation. Focusing on criminal liability that could be imposed upon ISP for copyright infringement initiated by subscribers, the second section seeks to illustrate the observation that the individuals who post copyright infringement materials act as principals in the first degree, and ISP would qualify as an accomplice, principal in the second degree, or accessory to the crimes. Furthermore, this section discusses in turn the qualifications for the perpetrators and accomplices. Finally, the third section reviews the current Taiwan tort and criminal law and its application to ISP and concludes that the Taiwan copyright law should make specific provision for

75 FR 57761 - North American Electric Reliability Corporation; Notice of Filing September 14, 2010.

Science.gov (United States)

2010-09-22

... request for approval of implementation plans for Generator Owners and Generator Operators of nuclear power..., 888 First Street, NE., Washington, DC 20426. This filing is accessible on-line at http://www.ferc.gov... Washington, DC. There is an ``eSubscription'' link on the Web site that enables subscribers to receive e-mail...

The U-line line balancing problem

NARCIS (Netherlands)

Miltenburg, G.J.; Wijngaard, J.

1994-01-01

The traditional line balancing (LB) problem considers a production line in which stations are arranged consecutively in a line. A balance is determined by grouping tasks into stations while moving forward (or backward) through a precedence network. Recently many production lines are being arranged

Self-diffusion of charged colloidal tracer spheres in transparent porous glass media: Effect of ionic strength and pore size

Science.gov (United States)

Kluijtmans, Sebastiaan G. J. M.; de Hoog, Els H. A.; Philipse, Albert P.

1998-05-01

The influence of charge on diffusion in porous media was studied for fluorescent colloidal silica spheres diffusing in a porous glass medium. The bicontinuous porous silica glasses were optically matched with an organic solvent mixture in which both glass and tracers are negatively charged. Using fluorescence recovery after photobleaching, the long-time self-diffusion coefficient DSL of the confined silica particles was monitored in situ as a function of the ionic strength and particle to pore size ratio. At high salt concentration DSL reaches a relatively high plateau value, which depends on the particle to pore size ratio. This plateau value is unexpectedly higher than the value found for uncharged silica spheres in these porous glasses, but still significantly smaller than the free particle bulk diffusion coefficient of the silica spheres. At low salt concentration DSL reduces markedly, up to the point where colloids are nearly immobilized. This peculiar retardation probably originates from potential traps and barriers at pore intersections due to deviations from cylinder symmetry in the double layer interactions between tracers and pore walls. This indicates that diffusion of charged particles in tortuous porous media may be very different from transport in long capillaries without such intersections.

GCL – An Easy Way for Creating Graphical User Interfaces

Directory of Open Access Journals (Sweden)

Mariusz Trzaska

2011-02-01

Full Text Available Graphical User Interfaces (GUI can be created using several approaches. Beside using visual editors or a manually written source code, it is possible to employ a declarative method. Such a solution usually allows working on a higher abstraction level which saves the developers' time and reduces errors. The approach can follow many ideas. One of them is based on utilizing a Domain Specific Language (DSL. In this paper we present the results of our research concerning a DSL language called GCL (GUI Creating Language. The prototype is implemented as a library for Java with an API emulating the syntax and semantics of a DSL language. A programmer, using a few keywords, is able to create different types of GUIs, including forms, panels, dialogs, etc. The widgets of the GUI are built automatically during the run-time phase based on a given data instance (an ordinary Java object and optionally are to be customized by the programmer. The main contribution of our work is delivering a working library for a popular platform. The library could be easily ported for other programming languages such the MS C#.

Robust analysis of the hydrophobic basic analytes loratadine and desloratadine in pharmaceutical preparations and biological fluids by sweeping-cyclodextrin-modified micellar electrokinetic chromatography.

Science.gov (United States)

El-Awady, Mohamed; Belal, Fathalla; Pyell, Ute

2013-09-27

The analysis of hydrophobic basic analytes by micellar electrokinetic chromatography (MEKC) is usually challenging because of the tendency of these analytes to be adsorbed onto the inner capillary wall in addition to the difficulty to separate these compounds as they exhibit extremely high retention factors. A robust and reliable method for the simultaneous determination of loratadine (LOR) and its major metabolite desloratadine (DSL) is developed based on cyclodextrin-modified micellar electrokinetic chromatography (CD-MEKC) with acidic sample matrix and basic background electrolyte (BGE). The influence of the sample matrix on the reachable focusing efficiency is studied. It is shown that the application of a low pH sample solution mitigates problems associated with the low solubility of the hydrophobic basic analytes in aqueous solution while having advantages with regard to on-line focusing. Moreover, the use of a basic BGE reduces the adsorption of these analytes in the separation compartment. The separation of the studied analytes is achieved in less than 7min using a BGE consisting of 10mmolL(-1) disodium tetraborate buffer, pH 9.30 containing 40mmolL(-1) SDS and 20mmolL(-1) hydroxypropyl-β-CD while the sample solution is composed of 10mmolL(-1) phosphoric acid, pH 2.15. A full validation study of the developed method based on the pharmacopeial guidelines is performed. The method is successfully applied to the analysis of the studied drugs in tablets without interference of tablet additives as well as the analysis of spiked human urine without any sample pretreatment. Furthermore, DSL can be detected as an impurity in LOR bulk powder at the stated pharmacopeial limit (0.1%, w/w). The selectivity of the developed method allows the analysis of LOR and DSL in combination with the co-formulated drug pseudoephedrine. It is shown that in CD-MEKC with basic BGE, solute-wall interactions are effectively suppressed allowing the development of efficient and precise

47 CFR 64.2305 - Definitions.

Science.gov (United States)

2010-10-01

...) Business subscriber. Business subscriber refers to a subscriber to telephone exchange service for businesses. (c) Primary advertising classification. A primary advertising classification is the principal... advertising classification is the classification of a subscriber to telephone exchange service as a business...

Architecture and Design of IP Broadcasting System Using Passive Optical Network

Science.gov (United States)

Ikeda, Hiroki; Sugawa, Jun; Ashi, Yoshihiro; Sakamoto, Kenichi

We propose an IP broadcasting system architecture using passive optical networks (PON) utilizing the optical broadcast links of a PON with a downstream bandwidth allocation algorithm to provide a multi-channel IP broadcasting service to home subscribers on single broadband IP network infrastructures. We introduce the design and adaptation of the optical broadcast links to effectively broadcast video contents to home subscribers. We present a performance analysis that includes the downstream bandwidth utilization efficiency of the broadcast link and the bandwidth control of the IP broadcasting and Internet data. Our analysis and simulation results show that the proposed system can provide 100 HDTV channels to every user over fiber lines. We also propose an IPTV channel selection mechanism in an ONT by selecting a broadcast stream. We developed and evaluated a prototype that can achieve a 15-msec IPTV channel selection speed.

Line facilities outline

International Nuclear Information System (INIS)

1998-08-01

This book deals with line facilities. The contents of this book are outline line of wire telecommunication ; development of line, classification of section of line and theory of transmission of line, cable line ; structure of line, line of cable in town, line out of town, domestic cable and other lines, Optical communication ; line of optical cable, transmission method, measurement of optical communication and cable of the sea bottom, Equipment of telecommunication line ; telecommunication line facilities and telecommunication of public works, construction of cable line and maintenance and Regulation of line equipment ; regulation on technique, construction and maintenance.

Morphological keys to advance the understanding of protostrongylid biodiversity in caribou (Rangifer spp. at high latitudes

Directory of Open Access Journals (Sweden)

Pratap Kafle

2017-12-01

Full Text Available The Protostrongylidae is a diverse family of nematodes capable of causing significant respiratory and neuromuscular disease in their ungulate and lagomorph hosts. Establishing the species diversity and abundance of the protostrongylid fauna has been hindered because the first stage larvae, commonly referred as dorsal spined larvae (DSL, that are shed in the feces are morphologically very similar among several genera. We aimed to determine the protostrongylid diversity and distribution in caribou (Rangifer tarandus groenlandicus and R. t. pearyi in the central and high Canadian Arctic. We first developed, tested and validated a morphological diagnostic guide for the DSL of two important protostrongylids, Parelaphostrongylus andersoni and Varestrongylus eleguneniensis, and then applied this guide to determine the prevalence and intensity of infection of these parasites in fecal samples from 242 caribou. We found that DSL of V. eleguneniensis and P. andersoni can be differentiated morphologically based on the structural differences at the caudal extremity. The presentation and morphology of the dorsal spine, and caudoventral bulging at the start of the tail extension were identified as the key identifying features. The two species were found in caribou on the arctic mainland and southern Victoria Island in single and co-infections, but the prevalence and intensity of infection was low. No protostrongylids were detected in caribou from the high arctic islands. Through this study, we provide a simple, efficient, and robust method to distinguish the DSL of the two protostrongylids, and present the current status of infection in different herds of caribou of the central Canadian Arctic. We report new geographic and host records for P. andersoni infection in Dolphin and Union caribou herd. Keywords: Parelaphostrongylus andersoni, Varestrongylus eleguneniensis, Diagnostic parasitology, Morphological diagnosis, Dorsal spined larvae, Canadian Arctic

Enforcement of entailment constraints in distributed service-based business processes.

Science.gov (United States)

Hummer, Waldemar; Gaubatz, Patrick; Strembeck, Mark; Zdun, Uwe; Dustdar, Schahram

2013-11-01

A distributed business process is executed in a distributed computing environment. The service-oriented architecture (SOA) paradigm is a popular option for the integration of software services and execution of distributed business processes. Entailment constraints, such as mutual exclusion and binding constraints, are important means to control process execution. Mutually exclusive tasks result from the division of powerful rights and responsibilities to prevent fraud and abuse. In contrast, binding constraints define that a subject who performed one task must also perform the corresponding bound task(s). We aim to provide a model-driven approach for the specification and enforcement of task-based entailment constraints in distributed service-based business processes. Based on a generic metamodel, we define a domain-specific language (DSL) that maps the different modeling-level artifacts to the implementation-level. The DSL integrates elements from role-based access control (RBAC) with the tasks that are performed in a business process. Process definitions are annotated using the DSL, and our software platform uses automated model transformations to produce executable WS-BPEL specifications which enforce the entailment constraints. We evaluate the impact of constraint enforcement on runtime performance for five selected service-based processes from existing literature. Our evaluation demonstrates that the approach correctly enforces task-based entailment constraints at runtime. The performance experiments illustrate that the runtime enforcement operates with an overhead that scales well up to the order of several ten thousand logged invocations. Using our DSL annotations, the user-defined process definition remains declarative and clean of security enforcement code. Our approach decouples the concerns of (non-technical) domain experts from technical details of entailment constraint enforcement. The developed framework integrates seamlessly with WS-BPEL and the Web

Native Language Integrated Queries with CppLINQ in C++

Science.gov (United States)

Vassilev, V.

2015-05-01

Programming language evolution brought to us the domain-specific languages (DSL). They proved to be very useful for expressing specific concepts, turning into a vital ingredient even for general-purpose frameworks. Supporting declarative DSLs (such as SQL) in imperative languages (such as C++) can happen in the manner of language integrated query (LINQ). We investigate approaches to integrate LINQ programming language, native to C++. We review its usability in the context of high energy physics. We present examples using CppLINQ for a few types data analysis workflows done by the end-users doing data analysis. We discuss evidences how this DSL technology can simplify massively parallel grid system such as PROOF.

Similarity law for Widom lines and coexistence lines.

Science.gov (United States)

Banuti, D T; Raju, M; Ihme, M

2017-05-01

The coexistence line of a fluid separates liquid and gaseous states at subcritical pressures, ending at the critical point. Only recently, it became clear that the supercritical state space can likewise be divided into regions with liquidlike and gaslike properties, separated by an extension to the coexistence line. This crossover line is commonly referred to as the Widom line, and is characterized by large changes in density or enthalpy, manifesting as maxima in the thermodynamic response functions. Thus, a reliable representation of the coexistence line and the Widom line is important for sub- and supercritical applications that depend on an accurate prediction of fluid properties. While it is known for subcritical pressures that nondimensionalization with the respective species critical pressures p_{cr} and temperatures T_{cr} only collapses coexistence line data for simple fluids, this approach is used for Widom lines of all fluids. However, we show here that the Widom line does not adhere to the corresponding states principle, but instead to the extended corresponding states principle. We resolve this problem in two steps. First, we propose a Widom line functional based on the Clapeyron equation and derive an analytical, species specific expression for the only parameter from the Soave-Redlich-Kwong equation of state. This parameter is a function of the acentric factor ω and compares well with experimental data. Second, we introduce the scaled reduced pressure p_{r}^{*} to replace the previously used reduced pressure p_{r}=p/p_{cr}. We show that p_{r}^{*} is a function of the acentric factor only and can thus be readily determined from fluid property tables. It collapses both subcritical coexistence line and supercritical Widom line data over a wide range of species with acentric factors ranging from -0.38 (helium) to 0.34 (water), including alkanes up to n-hexane. By using p_{r}^{*}, the extended corresponding states principle can be applied within

A new mathematical formulation of the line-by-line method in case of weak line overlapping

Science.gov (United States)

Ishov, Alexander G.; Krymova, Natalie V.

1994-01-01

A rigorous mathematical proof is presented for multiline representation on the equivalent width of a molecular band which consists in the general case of n overlapping spectral lines. The multiline representation includes a principal term and terms of minor significance. The principal term is the equivalent width of the molecular band consisting of the same n nonoverlapping spectral lines. The terms of minor significance take into consideration the overlapping of two, three and more spectral lines. They are small in case of the weak overlapping of spectral lines in the molecular band. The multiline representation can be easily generalized for optically inhomogeneous gas media and holds true for combinations of molecular bands. If the band lines overlap weakly the standard formulation of line-by-line method becomes too labor-consuming. In this case the multiline representation permits line-by-line calculations to be performed more effectively. Other useful properties of the multiline representation are pointed out.

76 FR 51367 - China Shipping Container Lines Co., Ltd.; COSCO Container Lines Company Limited; Evergreen Line A...

Science.gov (United States)

2011-08-18

... FEDERAL MARITIME COMMISSION [Docket No. 11-12] China Shipping Container Lines Co., Ltd.; COSCO Container Lines Company Limited; Evergreen Line A Joint Service Agreement; Hanjin Shipping Co., Ltd... Maritime Commission (Commission) by China Shipping Container Lines Co., Ltd.; COSCO Container Lines Company...

Distance-Based Opportunistic Mobile Data Offloading.

Science.gov (United States)

Lu, Xiaofeng; Lio, Pietro; Hui, Pan

2016-06-15

Cellular network data traffic can be offload onto opportunistic networks. This paper proposes a Distance-based Opportunistic Publish/Subscribe (DOPS) content dissemination model, which is composed of three layers: application layer, decision-making layer and network layer. When a user wants new content, he/she subscribes on a subscribing server. Users having the contents decide whether to deliver the contents to the subscriber based on the distance information. If in the meantime a content owner has traveled further in the immediate past time than the distance between the owner and the subscriber, the content owner will send the content to the subscriber through opportunistic routing. Simulations provide an evaluation of the data traffic offloading efficiency of DOPS.

Gender Instruments, Laws, Policies and Guidelines: A Tool for Human Resource Managers in Kenya

OpenAIRE

Catherine Kathure Kaimenyi; Anne Ngeretha

2014-01-01

The need for effective workplace policies and procedures has never been more important in today’s changing workplace. This is driven by changes to legislation, regulation and codes. Organizations policies must be in line with the national laws, procedures and policies, and since nations subscribe to various international laws and guidelines, these should accordingly be integrated in organization policies. Through a review of existing literature, this study examines important legislations that...

From Off-line to On-line Handwriting Recognition

NARCIS (Netherlands)

Lallican, P.; Viard-Gaudin, C.; Knerr, S.

2004-01-01

On-line handwriting includes more information on time order of the writing signal and on the dynamics of the writing process than off-line handwriting. Therefore, on-line recognition systems achieve higher recognition rates. This can be concluded from results reported in the literature, and has been

Synthesizing Flight Software (FSW) Discrete Controllers from Formal Specifications

Data.gov (United States)

National Aeronautics and Space Administration — This project will develop a Domain Specific Language (DSL) approach to interpret requirements and map them to formal specifications and legacy formats; explore and...

VT Digital Line Graph Miscellaneous Transmission Lines

Data.gov (United States)

Vermont Center for Geographic Information — (Link to Metadata) This datalayer is comprised of Miscellaineous Transmission Lines. Digital line graph (DLG) data are digital representations of cartographic...

Solidify, An LLVM pass to compile LLVM IR into Solidity

Energy Technology Data Exchange (ETDEWEB)

2017-07-12

The software currently compiles LLVM IR into Solidity (Ethereum’s dominant programming language) using LLVM’s pass library. Specifically, his compiler allows us to convert an arbitrary DSL into Solidity. We focus specifically on converting Domain Specific Languages into Solidity due to their ease of use, and provable properties. By creating a toolchain to compile lightweight domain-specific languages into Ethereum's dominant language, Solidity, we allow non-specialists to effectively develop safe and useful smart contracts. For example lawyers from a certain firm can have a proprietary DSL that codifies basic laws safely converted to Solidity to be securely executed on the blockchain. In another example, a simple provenance tracking language can be compiled and securely executed on the blockchain.

Distance-Based Opportunistic Mobile Data Offloading

Directory of Open Access Journals (Sweden)

Xiaofeng Lu

2016-06-01

Full Text Available Cellular network data traffic can be offload onto opportunistic networks. This paper proposes a Distance-based Opportunistic Publish/Subscribe (DOPS content dissemination model, which is composed of three layers: application layer, decision-making layer and network layer. When a user wants new content, he/she subscribes on a subscribing server. Users having the contents decide whether to deliver the contents to the subscriber based on the distance information. If in the meantime a content owner has traveled further in the immediate past time than the distance between the owner and the subscriber, the content owner will send the content to the subscriber through opportunistic routing. Simulations provide an evaluation of the data traffic offloading efficiency of DOPS.

ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2370 >orf19.2370; Contig19-10147; complement(50671..52716); DSL1*; retrogra...de ER-to-golgi transport; MPSIEQQLEDQELYLKDIEQNINKTLSKINKTTLENDNDFRKQFEEIPQDSNTTESN

Efficient algorithm for generating spectra using line-by-line methods

International Nuclear Information System (INIS)

Sonnad, V.; Iglesias, C.A.

2011-01-01

A method is presented for efficient generation of spectra using line-by-line approaches. The only approximation is replacing the line shape function with an interpolation procedure, which makes the method independent of the line profile functional form. The resulting computational savings for large number of lines is proportional to the number of frequency points in the spectral range. Therefore, for large-scale problems the method can provide speedups of two orders of magnitude or more. A method was presented to generate line-by-line spectra efficiently. The first step was to replace the explicit calculation of the profile by the Newton divided-differences interpolating polynomial. The second step is to accumulate the lines effectively reducing their number to the number of frequency points. The final step is recognizing the resulting expression as a convolution and amenable to FFT methods. The reduction in computational effort for a configuration-to-configuration transition array with large number of lines is proportional to the number of frequency points. The method involves no approximations except for replacing the explicit profile evaluation by interpolation. Specifically, the line accumulation and convolution are exact given the interpolation procedure. Furthermore, the interpolation makes the method independent of the line profile functional form contrary to other schemes using FFT methods to generate line-by-line spectra but relying on the analytic form of the profile Fourier transform. Finally, the method relies on a uniform frequency mesh. For non-uniform frequency meshes, however, the method can be applied by using a suitable temporary uniform mesh and the results interpolated onto the final mesh with little additional cost.

Analysis of some coplanar transmission lines: coplanar coupled lines, coplanar coupled striplines, and coplanar coupled lines with rectangular microshield

Science.gov (United States)

Yuan, Naichang; He, Jianguo; Yao, Demiao; Dai, Qin; Lin, Weigan

1995-06-01

Two types of coplanar transmission lines, rectangular microshield coplanar coupled lines (RMCCL) and coplanar coupled rectangular microshield lines (CCRML), are proposed for MMIC applications. These are developed from coplanar coupled lines (CCL) and coplanar coupled strip lines (CCS). Analytic formulas are presented for calculating the quasistatic TEM parameters of these coupled lines by means of exact conformal mapping techniques. Numerical results are also presented to illustrate the properties of these coplanar transmission lines.

75 FR 82034 - National Institute of Mental Health; Notice of Meeting

Science.gov (United States)

2010-12-29

... and, when applicable, the business or professional affiliation of the interested person. All written... Home, XP Pro, 2003 Server or Vista; (C) Stable 56k, cable modem, ISDN, DSL or better Internet...

INFLUENCE OF THE SKELETON HIERARCHICAL ORGANIZATION ON ELECTRONIC STATE OF IONS IN BONE MATRIX

Directory of Open Access Journals (Sweden)

A. S. Avrunin

2016-01-01

Full Text Available The authors suggested the 3D-superlattice (3DSL model to describe the effect of coplanar assembly of the hydroxyapatite (HA nanocrystallites on local electronic state of ions in mineralized bone. This model is based on the main structural and functional relationships between adjacent levels of the hierarchical organization of bone tissue. In the framework of the 3DSL model the authors predicted the distinct assembly-to-crystal red shift of the unoccupied electronic states located near the bottom of the conduction band in HA and dependence of this shift on the ratio of the thickness of the hydrated layer to the crystallite size. To check these predictions the experimental X-ray absorption studies of native bone are performed near the Ca2р1/2,3/2-, P2р1/2,3/2- и O1s edges. Comparison of the measured spectra with the known spectra of the reference compounds has confirmed appearance of the distinct assembly-to-crystal red shift. The observed effect is the ground for development of new diagnostic methods for bone status and imaging changes in the local electronic structure of bone tissue by using ultrasoft X-ray absorption spectroscopy and measuring the assembly-tocrystal shifts. The experimental data analysis proved the applicability of the 3DSL model for better understanding of the hierarchical organization of bone at nanolevel.

Optimization of line configuration and balancing for flexible machining lines

Science.gov (United States)

Liu, Xuemei; Li, Aiping; Chen, Zurui

2016-05-01

Line configuration and balancing is to select the type of line and allot a given set of operations as well as machines to a sequence of workstations to realize high-efficiency production. Most of the current researches for machining line configuration and balancing problems are related to dedicated transfer lines with dedicated machine workstations. With growing trends towards great product variety and fluctuations in market demand, dedicated transfer lines are being replaced with flexible machining line composed of identical CNC machines. This paper deals with the line configuration and balancing problem for flexible machining lines. The objective is to assign operations to workstations and find the sequence of execution, specify the number of machines in each workstation while minimizing the line cycle time and total number of machines. This problem is subject to precedence, clustering, accessibility and capacity constraints among the features, operations, setups and workstations. The mathematical model and heuristic algorithm based on feature group strategy and polychromatic sets theory are presented to find an optimal solution. The feature group strategy and polychromatic sets theory are used to establish constraint model. A heuristic operations sequencing and assignment algorithm is given. An industrial case study is carried out, and multiple optimal solutions in different line configurations are obtained. The case studying results show that the solutions with shorter cycle time and higher line balancing rate demonstrate the feasibility and effectiveness of the proposed algorithm. This research proposes a heuristic line configuration and balancing algorithm based on feature group strategy and polychromatic sets theory which is able to provide better solutions while achieving an improvement in computing time.

78 FR 2276 - National Institute of Mental Health; Notice of Meeting

Science.gov (United States)

2013-01-10

..., telephone number and when applicable, the business or professional affiliation of the interested person. All... Server or Vista; (C) Stable 56k, cable modem, ISDN, DSL or better Internet connection; (D) Minimum of...

LINE FUSION GENES: a database of LINE expression in human genes

Directory of Open Access Journals (Sweden)

Park Hong-Seog

2006-06-01

Full Text Available Abstract Background Long Interspersed Nuclear Elements (LINEs are the most abundant retrotransposons in humans. About 79% of human genes are estimated to contain at least one segment of LINE per transcription unit. Recent studies have shown that LINE elements can affect protein sequences, splicing patterns and expression of human genes. Description We have developed a database, LINE FUSION GENES, for elucidating LINE expression throughout the human gene database. We searched the 28,171 genes listed in the NCBI database for LINE elements and analyzed their structures and expression patterns. The results show that the mRNA sequences of 1,329 genes were affected by LINE expression. The LINE expression types were classified on the basis of LINEs in the 5' UTR, exon or 3' UTR sequences of the mRNAs. Our database provides further information, such as the tissue distribution and chromosomal location of the genes, and the domain structure that is changed by LINE integration. We have linked all the accession numbers to the NCBI data bank to provide mRNA sequences for subsequent users. Conclusion We believe that our work will interest genome scientists and might help them to gain insight into the implications of LINE expression for human evolution and disease. Availability http://www.primate.or.kr/line

Secukinumab.

Science.gov (United States)

Cada, Dennis J; Baker, Danial E; Panther, Shannon G; PharmD, Kyle Ingram

2015-09-01

Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are sent in print and are also available on-line. Monographs can be customized to meet the needs of a facility. A drug class review is now published monthly with The Formulary Monograph Service. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service, call The Formulary at 800-322-4349. The September 2015 monograph topics are cangrelor, lumacaftor/ivacaftor, brexpiprazole, talimogene laherparepvec, and lesinurad. The Safety MUE is on cangrelor.

Oritavancin diphosphate.

Science.gov (United States)

Cada, Dennis J; Baker, Danial E

2014-12-01

Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are sent in print and are also available on-line. Monographs can be customized to meet the needs of a facility. A drug class review is now published monthly with The Formulary Monograph Service. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service, call The Formulary at 800-322-4349. The December 2014 monograph topics are olodaterol, peginterferon beta-1a, testosterone nasal gel, ferric citrate corredination complex, and safinamide. The Safety MUE is on olodaterol.

Ivadradine.

Science.gov (United States)

Cada, Dennis J; Bindler, Ross; Baker, Danial E

2015-10-01

Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are sent in print and are also available on-line. Monographs can be customized to meet the needs of a facility. A drug class review is now published monthly with The Formulary Monograph Service. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service, call The Formulary at 800-322-4349. The October 2015 monograph topics are sacubitril/valsartan, daclatasvir, sonidegib, alirocumab, and sodium zirconium cyclosilicate. The Safety MUE is on sacubitril/valsartan.

Suvorexant.

Science.gov (United States)

Cada, Dennis J; Levien, Terri L; Baker, Danial E

2015-01-01

Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are sent in print and are also available on-line. Monographs can be customized to meet the needs of a facility. A drug class review is now published monthly with The Formulary Monograph Service. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service, call The Formulary at 800-322-4349. The January 2015 monograph topics are ledipasvir/sofosbuvir, eliglustat, naloxegol, pembrolizumab, and dulaglutide injection. The Safety MUE is on ledipasvir/sofosbuvir.

Netupitant/Palonosetron.

Science.gov (United States)

Cada, Dennis J; Leonard, James; Baker, Danial E

2015-04-01

Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are sent in print and are also available on-line. Monographs can be customized to meet the needs of a facility. A drug class review is now published monthly with The Formulary Monograph Service. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service, call The Formulary at 800-322-4349. The April 2015 monograph topics are edoxaban, diclofenac sodium injectable, olaparib, antihemophilic factor porcine, and blinatumomab. The Safety MUE is on edoxaban.

Ombitasvir/Paritaprevir/Ritonavir and Dasabuvir.

Science.gov (United States)

Cada, Dennis J; Leonard, James; Levien, Terri L; Baker, Danial E

2015-05-01

Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are sent in print and are also available on-line. Monographs can be customized to meet the needs of a facility. A drug class review is now published monthly with The Formulary Monograph Service. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service, call The Formulary at 800-322-4349. The May 2015 monograph topics are palbociclib, lenvatinib, nivolumab, ferric pyrophosphate citrate solution, and secukinumab. The Safety MUE is on non-opioid injectable pain or fever medications.

Cangrelor.

Science.gov (United States)

Baker, Danial E; Ingram, Kyle T

2015-11-01

Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are sent in print and are also available on-line. Monographs can be customized to meet the needs of a facility. A drug class review is now published monthly with The Formulary Monograph Service. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service , call The Formulary at 800-322-4349. The November 2015 monograph topics are evolocumab, dichlorphenamide, necitumumab, cobimetinib, and reslizumab. The Safety MUE is on alirocumab and evolocumab.

Ferric citrate.

Science.gov (United States)

Cada, Dennis J; Cong, Jasen; Baker, Danial E

2015-02-01

Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are sent in print and are also available on-line. Monographs can be customized to meet the needs of a facility. A drug class review is now published monthly with The Formulary Monograph Service. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service, call The Formulary at 800-322-4349. The February 2015 monograph topics are netupitant/palonosetron, naltrxone SR/bupropion SR, nintedanib, pirfenidone, and ivabradine. The Safety MUE is on netupitant/palonosetron.

Ceftolozane/Tazobactam.

Science.gov (United States)

Cada, Dennis J; Wageman, Jesse; Baker, Danial E; Levien, Terri L

2015-06-01

Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are sent in print and are also available on-line. Monographs can be customized to meet the needs of a facility. A drug class review is now published monthly with The Formulary Monograph Service. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service, call The Formulary at 800-322-4349. The June 2015 monograph topics are ceftazidime-avibactam, isavuconazonium sulfate, panobinostat, levodopa-carbidopa intestinal gel, and LCZ696. The Safety MUE is on ceftazidime-avibactam.

Edoxaban.

Science.gov (United States)

Cada, Dennis J; Baker, Danial E; Ingram, Kyle

2015-07-01

Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are sent in print and are also available on-line. Monographs can be customized to meet the needs of a facility. A drug class review is now published monthly with The Formulary Monograph Service. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service, call The Formulary at 800-322-4349. The July 2015 monograph topics are ivabradine, dinutuximab, glycopyrronium bromide/indacaterol, patriromer, and idarucizumab. The Safety MUE is on ivabradine.

Sacubitril/Valsartan.

Science.gov (United States)

Cada, Dennis J; Baker, Danial E; Leonard, James

2015-11-01

Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are sent in print and are also available on-line. Monographs can be customized to meet the needs of a facility. A drug class review is now published monthly with The Formulary Monograph Service. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service, call The Formulary at 800-322-4349. The December 2015 monograph topics are rolapitant, insulin degludec, flibanserin, coagulation factor IX (recombinant), and grazoprevir/elbasvir. The Safety MUE is on rolapitant.

Sacubitril/Valsartan

Science.gov (United States)

Cada, Dennis J.; Baker, Danial E.; Leonard, James

2015-01-01

Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are sent in print and are also available on-line. Monographs can be customized to meet the needs of a facility. A drug class review is now published monthly with The Formulary Monograph Service. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service, call The Formulary at 800-322-4349. The December 2015 monograph topics are rolapitant, insulin degludec, flibanserin, coagulation factor IX (recombinant), and grazoprevir/elbasvir. The Safety MUE is on rolapitant. PMID:27621510

Cable line engineering

International Nuclear Information System (INIS)

Jang, Hak Sin; Kim, Sin Yeong

1998-02-01

This book is about cable line engineering. It is comprised of nine chapters, which deals with summary of cable communication such as way, process of cable communication and optical communication, Line constant of transmission on primary constant, reflection and crosstalk, communication cable line of types like flat cable, coaxial cable and loaded cable, Install of communication line with types and facility of aerial line, construction method of communication line facility, Measurement of communication line, Carrier communication of summary, PCM communication with Introduction, regeneration relay system sampling and quantization and Electric communication service and general information network with mobile communication technique and satellite communication system.

A synoptic study of phytoplankton in the deep lakes south of the Alps (lakes Garda, Iseo, Como, Lugano and Maggiore

Directory of Open Access Journals (Sweden)

Delio RUGGIU

2003-08-01

Full Text Available This paper presents a synoptic account of the most important results emerging from studies on the phytoplankton communities in the deep southern subalpine lakes Garda, Iseo, Como, Lugano and Maggiore (DSL in the second half of the 1990s. At present, the trophogenic layers of these lakes are trophically different, ranging from the oligo-mesotrophy of lakes Maggiore and Garda to the meso-eutrophy of lakes Iseo and Lugano. The research confirmed the existence of a common pool of species developing in the DSL, as already suggested by early studies conducted on a seasonal basis from the end of the 1970s to the first half of the 1980s. However, multivariate analyses (Correspondence Analysis, CA, and a subsequent application of Non Metric Multidimensional Scaling demonstrated that the species in this common pool were developing differently or exclusively along a geographic and a trophic gradient. The major differences in the geographic distribution were found between the easternmost lakes (Garda and Iseo and those farthest to the West (Lugano and, partly, Maggiore, with intermediate characteristics in Lake Como. These differences were due mainly to changes in the dominance relationships and only secondarily to compositional changes. The detection of the ultimate causes of these differences should take into account other factors not considered in the paper (i.e. the specific analysis of the food webs, local climatic conditions, hydrology and seasonal input of nutrients. Despite the observed differences, common patterns in the sequence of seasonal assemblages in the DSL could be recognised and defined. The second gradient in the species distribution identified by CA was strongly correlated with the principal trophic descriptors (algal biomass and total phosphorus; this meant that the phytoplankton taxa could be ranked along a trophic spectrum, from oligotrophy to eutrophy. A brief examination of the main differences which have historically arisen with

Design and Implementation of Davis Social Links OSN Kernel

Science.gov (United States)

Tran, Thomas; Chan, Kelcey; Ye, Shaozhi; Bhattacharyya, Prantik; Garg, Ankush; Lu, Xiaoming; Wu, S. Felix

Social network popularity continues to rise as they broaden out to more users. Hidden away within these social networks is a valuable set of data that outlines everyone’s relationships. Networks have created APIs such as the Facebook Development Platform and OpenSocial that allow developers to create applications that can leverage user information. However, at the current stage, the social network support for these new applications is fairly limited in its functionality. Most, if not all, of the existing internet applications such as email, BitTorrent, and Skype cannot benefit from the valuable social network among their own users. In this paper, we present an architecture that couples two different communication layers together: the end2end communication layer and the social context layer, under the Davis Social Links (DSL) project. Our proposed architecture attempts to preserve the original application semantics (i.e., we can use Thunderbird or Outlook, unmodified, to read our SMTP emails) and provides the communicating parties (email sender and receivers) a social context for control and management. For instance, the receiver can set trust policy rules based on the social context between the pair, to determine how a particular email in question should be prioritized for delivery to the SMTP layer. Furthermore, as our architecture includes two coupling layers, it is then possible, as an option, to shift some of the services from the original applications into the social context layer. In the context of email, for example, our architecture allows users to choose operations, such as reply, reply-all, and forward, to be realized in either the application layer or the social network layer. And, the realization of these operations under the social network layer offers powerful features unavailable in the original applications. To validate our coupling architecture, we have implemented a DSL kernel prototype as a Facebook application called CyrusDSL (currently about

Potential for long-term transfer of dissolved organic carbon from riparian zones to streams in boreal catchments.

Science.gov (United States)

Ledesma, José L J; Grabs, Thomas; Bishop, Kevin H; Schiff, Sherry L; Köhler, Stephan J

2015-08-01

Boreal regions store most of the global terrestrial carbon, which can be transferred as dissolved organic carbon (DOC) to inland waters with implications for both aquatic ecology and carbon budgets. Headwater riparian zones (RZ) are important sources of DOC, and often just a narrow 'dominant source layer' (DSL) within the riparian profile is responsible for most of the DOC export. Two important questions arise: how long boreal RZ could sustain lateral DOC fluxes as the sole source of exported carbon and how its hydromorphological variability influences this role. We estimate theoretical turnover times by comparing carbon pools and lateral exports in the DSL of 13 riparian profiles distributed over a 69 km(2) catchment in northern Sweden. The thickness of the DSL was 36 ± 18 (average ± SD) cm. Thus, only about one-third of the 1-m-deep riparian profile contributed 90% of the lateral DOC flux. The 13 RZ exported 8.7 ± 6.5 g C m(-2) year(-1) , covering the whole range of boreal stream DOC exports. The variation could be explained by local hydromorphological characteristics including RZ width (R(2) = 0.90). The estimated theoretical turnover times were hundreds to a few thousands of years, that is there is a potential long-lasting supply of DOC. Estimates of net ecosystem production in the RZ suggest that lateral fluxes, including both organic and inorganic C, could be maintained without drawing down the riparian pools. This was supported by measurements of stream DO(14) C that indicated modern carbon as the predominant fraction exported, including streams disturbed by ditching. The transfer of DOC into boreal inland waters from new and old carbon sources has a major influence on surface water quality and global carbon balances. This study highlights the importance of local variations in RZ hydromorphology and DSL extent for future DOC fluxes under a changing climate. © 2015 The Authors. Global Change Biology Published by John Wiley & Sons Ltd.

77 FR 36565 - National Institute of Mental Health; Notice of Meeting

Science.gov (United States)

2012-06-19

... professional affiliation of the interested person. All written comments received by the deadlines for both oral..., 2003 Server or Vista; (C) Stable 56k, cable modem, ISDN, DSL or better Internet connection; (D) Minimum...

75 FR 60131 - National Institute of Mental Health; Notice of Meeting

Science.gov (United States)

2010-09-29

..., the business or professional affiliation of the interested person. All written comments received by...] 2000, XP Home, XP Pro, 2003 Server or Vista; (C) Stable 56k, cable modem, ISDN, DSL or better Internet...

Interrogative constructions in Danish Sign Language (DSL)

DEFF Research Database (Denmark)

Hansen, Julie

This study investigates the primary types of interrogative constructions: Polar and content questions. The aim is to identify how and in which types of interrogative constructions the non-manual patterns described by Engberg-Pedersen (1993, 1998)are used. Furthermore, the aim is to identify...

Calculations of a wideband metamaterial absorber using equivalent medium theory

Science.gov (United States)

Huang, Xiaojun; Yang, Helin; Wang, Danqi; Yu, Shengqing; Lou, Yanchao; Guo, Ling

2016-08-01

Metamaterial absorbers (MMAs) have drawn increasing attention in many areas due to the fact that they can achieve electromagnetic (EM) waves with unity absorptivity. We demonstrate the design, simulation, experiment and calculation of a wideband MMA based on a loaded double-square-loop (DSL) array of chip resisters. For a normal incidence EM wave, the simulated results show that the absorption of the full width at half maximum is about 9.1 GHz, and the relative bandwidth is 87.1%. Experimental results are in agreement with the simulations. More importantly, equivalent medium theory (EMT) is utilized to calculate the absorptions of the DSL MMA, and the calculated absorptions based on EMT agree with the simulated and measured results. The method based on EMT provides a new way to analysis the mechanism of MMAs.

Yeast Interacting Proteins Database: YNL258C, YGL145W [Yeast Interacting Proteins Database

Lifescience Database Archive (English)

Full Text Available YNL258C DSL1 Peripheral membrane protein required for Golgi-to-ER retrograde traffi...t description Peripheral membrane protein required for Golgi-to-ER retrograde traffic; component of the ER t

Dicty_cDB: CHE829 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available dsl**sx*frlw*rf*m*n*t*wfpmlcpfrkttpttt*xm**xmpxrp*m* s*stckrmmrccp*tttxmxfkmsxkt*m*sxplx*rmlcxxxpr*mfixmsxrp...xm*s* stwkrmxrccp*ttxkmxixmsxkt*m*nqsxw*rmlc*kxx*lf Frame B: lfnfifnhsn*kknnn*ls*

75 FR 33815 - National Institute of Mental Health; Notice of Meeting

Science.gov (United States)

2010-06-15

... and when applicable, the business or professional affiliation of the interested person. All written...) Windows[reg] 2000, XP Home, XP Pro, 2003 Server or Vista; (C) Stable 56k, cable modem, ISDN, DSL or better...

Powering FITL for Deutsche Telekom

Energy Technology Data Exchange (ETDEWEB)

Schulz, W. [T-Nova Deutsche Telekom Innovationsgesellschaft mbH Technologiezentrum (Germany)

2000-07-01

Deutsche Telekom introduced the project OPAL (optical access line) 8 years ago. The development of new applications for FITL (FTTH, FTTB, FTTC) leads to new challenges for power systems. For the establishment of an optical fibre infrastructure at the subscriber line level a wide variety of possible optical fibre network topologies can be imagined. Different powering architectures must be developed including remote or local powering. This paper presents results and performances of the powering configurations to feed the optical network units (ONU) and remote OLT. Compared to conventional powering the centralised powering with remote feeding supply was implemented to power the ONU in the field economically. (orig.)

77 FR 71427 - National Institute of Mental Health; Notice of Meeting

Science.gov (United States)

2012-11-30

... comments should include the name and, when applicable, the business or professional affiliation of the... 2003 Server Cable modem, DSL, or better Internet connection Dual-core 2.4GHz CPU or faster with 2GB of...

Rogue AP Detection in the Wireless LAN for Large Scale Deployment

OpenAIRE

Sang-Eon Kim; Byung-Soo Chang; Sang Hong Lee; Dae Young Kim

2006-01-01

The wireless LAN standard, also known as WiFi, has begun to use commercial purposes. This paper describes access network architecture of wireless LAN for large scale deployment to provide public service. A metro Ethernet and digital subscriber line access network can be used for wireless LAN with access point. In this network architecture, access point plays interface between wireless node and network infrastructure. It is important to maintain access point without any failure and problems to...

Data communications and computer communications network

International Nuclear Information System (INIS)

Kim, Jang Gwon; Gu, Chang Hoe

2005-03-01

This textbook is composed of twelve chapters, which are communication network introduction, foundation of data communication, data link control, circuit switching system, packet switching system, multiple access communication system, protocol and architecture, LAN, MAN communication network, integrated service digital network, internet and Asymmetric digital subscriber Line and Wireless Local Loop. Each chapter has the introduction of the technique, structure, function and practice problems. It also has the appendix on electricity and communication standards organization, characteristic table and glossary.

Resistance against brute-force attacks on stateless forwarding in information centric networking

OpenAIRE

Alzahrani, Bander A.; Reed, Martin J.; Vassilakis, Vassilios G.

2015-01-01

Line Speed Publish/Subscribe Inter-networking (LIPSIN) is one of the proposed forwarding mechanisms in Information Centric Networking (ICN). It is a stateless source-routing approach based on Bloom filters. However, it has been shown that LIPSIN is vulnerable to brute-force attacks which may lead to distributed denial-of-service (DDoS) attacks and unsolicited messages. In this work, we propose a new forwarding approach that maintains the advantages of Bloom filter based forwarding while allow...

Particle Physics and Programming Languages

OpenAIRE

Watts, Gordon

2017-01-01

A SeaLang meetup - a presentation discussing various programming languages used in particle physics, from pushing common modern languages a bit past where they should be pushed, to an embedded DSL, to some full blown ones written.

76 FR 72989 - Options Price Reporting Authority; Notice of Filing and Immediate Effectiveness of Proposed...

Science.gov (United States)

2011-11-28

... section replaces a Policy currently on the OPRA Web site that, although it is entitled ``Auditing... invoices for ``Professional Subscriber Device-based Fees'' that it sends directly to these Professional Subscribers. The Professional Subscribers to which the Vendor distributes OPRA data and for whose access it...

Transmission Line Ampacity Improvements of AltaLink Wind Plant Overhead Tie-Lines Using Weather-Based Dynamic Line Rating

Energy Technology Data Exchange (ETDEWEB)

Bhattarai, Bishnu P.; Gentle, Jake P.; Hill, Porter; McJunkin, Tim; Myers, Kurt S.; Abbound, Alex; Renwick, Rodger; Hengst, David

2017-07-01

Abstract—Overhead transmission lines (TLs) are conventionally given seasonal ratings based on conservative environmental assumptions. Such an approach often results in underutilization of the line ampacity as the worst conditions prevail only for a short period over a year/season. We presents dynamic line rating (DLR) as an enabling smart grid technology that adaptively computes ratings of TLs based on local weather conditions to utilize additional headroom of existing lines. In particular, general line ampacity state solver utilizes measured weather data for computing the real-time thermal rating of the TLs. The performance of the presented method is demonstrated from a field study of DLR technology implementation on four TL segments at AltaLink, Canada. The performance is evaluated and quantified by comparing the existing static and proposed dynamic line ratings, and the potential benefits of DLR for enhanced transmission assets utilization. For the given line segments, the proposed DLR results in real-time ratings above the seasonal static ratings for most of the time; up to 95.1% of the time, with a mean increase of 72% over static rating.

Directed line liquids

International Nuclear Information System (INIS)

Kamien, R.D.

1992-01-01

This thesis is devoted to the study of ensembles of dense directed lines. These lines are principally to be thought of as polymers, though they also have the morphology of flux lines in high temperature superconductors, strings of colloidal spheres in electrorheological fluids and the world lines of quantum mechanical bosons. The authors discuss how directed polymer melts, string-like formations in electrorheological and ferro-fluids, flux lines in high temperature superconductors and the world lines of quantum mechanical bosons all share similar descriptions. They study a continuous transition in all of these systems, and then study the critical mixing properties of binary mixtures of directed polymers through the renormalization group. They predict the exponents for a directed polymer blend consolute point and a novel two-phase superfluid liquid-gas critical point

JPRS Report, West Europe, Reference Aid, Glossary of Acronyms and Abbreviations of Denmark

Science.gov (United States)

1989-05-25

protected memorial 39 fm. fuldmaegtig fmd . formand fmk finsk(e) mark Fmk. formjzirkelsesfyr FMO Frimurerordenen FMS Foreningen af...Ft fosforsyretal for the time being phosphoric acid number 43 FTA Funktionaerernes og T j enestemaendenes Arbej dsl^shedskasse FTF

77 FR 49837 - Options Price Reporting Authority; Notice of Filing and Immediate Effectiveness of Proposed...

Science.gov (United States)

2012-08-17

... of four servers and the Professional Subscriber is already paying the OPRA Indirect Access Fee, the... the trading engine is comprised of four servers and the Professional Subscriber is not already paying... trading engine comprised of 22 servers, the Professional Subscriber would be required to pay device-based...

WiMAX technology and network evolution

CERN Document Server

Etemad, Kamran

2010-01-01

WiMAX, the Worldwide Interoperability for Microwave Access, represents a paradigm shift in telecommunications technology. It offers the promise of cheaper, smaller, and simpler technology compared to existing broadband options such as DSL, cable, fiber, and 3G wireless.

Wireless Access

Indian Academy of Sciences (India)

First page Back Continue Last page Overview Graphics. Wireless Access. Wireless connect to the Base station. Easy and Convenient access. Costlier as compared to the wired technology. Reliability challenges. We see it as a complementary technology to the DSL.

Multi-Scale Dissemination of Time Series Data

DEFF Research Database (Denmark)

Guo, Qingsong; Zhou, Yongluan; Su, Li

2013-01-01

In this paper, we consider the problem of continuous dissemination of time series data, such as sensor measurements, to a large number of subscribers. These subscribers fall into multiple subscription levels, where each subscription level is specified by the bandwidth constraint of a subscriber......, which is an abstract indicator for both the physical limits and the amount of data that the subscriber would like to handle. To handle this problem, we propose a system framework for multi-scale time series data dissemination that employs a typical tree-based dissemination network and existing time...

Method and system for a network mapping service

Science.gov (United States)

Bynum, Leo

2017-10-17

A method and system of publishing a map includes providing access to a plurality of map data files or mapping services between at least one publisher and at least one subscriber; defining a map in a map context comprising parameters and descriptors to substantially duplicate a map by reference to mutually accessible data or mapping services, publishing a map to a channel in a table file on server; accessing the channel by at least one subscriber, transmitting the mapping context from the server to the at least one subscriber, executing the map context by the at least one subscriber, and generating the map on a display software associated with the at least one subscriber by reconstituting the map from the references and other data in the mapping context.

MICROLENSING OF QUASAR BROAD EMISSION LINES: CONSTRAINTS ON BROAD LINE REGION SIZE

Energy Technology Data Exchange (ETDEWEB)

Guerras, E.; Mediavilla, E. [Instituto de Astrofisica de Canarias, Via Lactea S/N, La Laguna E-38200, Tenerife (Spain); Jimenez-Vicente, J. [Departamento de Fisica Teorica y del Cosmos, Universidad de Granada, Campus de Fuentenueva, E-18071 Granada (Spain); Kochanek, C. S. [Department of Astronomy and the Center for Cosmology and Astroparticle Physics, The Ohio State University, 4055 McPherson Lab, 140 West 18th Avenue, Columbus, OH 43221 (United States); Munoz, J. A. [Departamento de Astronomia y Astrofisica, Universidad de Valencia, E-46100 Burjassot, Valencia (Spain); Falco, E. [Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Motta, V. [Departamento de Fisica y Astronomia, Universidad de Valparaiso, Avda. Gran Bretana 1111, Valparaiso (Chile)

2013-02-20

We measure the differential microlensing of the broad emission lines between 18 quasar image pairs in 16 gravitational lenses. We find that the broad emission lines are in general weakly microlensed. The results show, at a modest level of confidence (1.8{sigma}), that high ionization lines such as C IV are more strongly microlensed than low ionization lines such as H{beta}, indicating that the high ionization line emission regions are more compact. If we statistically model the distribution of microlensing magnifications, we obtain estimates for the broad line region size of r{sub s} = 24{sup +22} {sub -15} and r{sub s} = 55{sup +150} {sub -35} lt-day (90% confidence) for the high and low ionization lines, respectively. When the samples are divided into higher and lower luminosity quasars, we find that the line emission regions of more luminous quasars are larger, with a slope consistent with the expected scaling from photoionization models. Our estimates also agree well with the results from local reveberation mapping studies.

Lining seam elimination algorithm and surface crack detection in concrete tunnel lining

Science.gov (United States)

Qu, Zhong; Bai, Ling; An, Shi-Quan; Ju, Fang-Rong; Liu, Ling

2016-11-01

Due to the particularity of the surface of concrete tunnel lining and the diversity of detection environments such as uneven illumination, smudges, localized rock falls, water leakage, and the inherent seams of the lining structure, existing crack detection algorithms cannot detect real cracks accurately. This paper proposed an algorithm that combines lining seam elimination with the improved percolation detection algorithm based on grid cell analysis for surface crack detection in concrete tunnel lining. First, check the characteristics of pixels within the overlapping grid to remove the background noise and generate the percolation seed map (PSM). Second, cracks are detected based on the PSM by the accelerated percolation algorithm so that the fracture unit areas can be scanned and connected. Finally, the real surface cracks in concrete tunnel lining can be obtained by removing the lining seam and performing percolation denoising. Experimental results show that the proposed algorithm can accurately, quickly, and effectively detect the real surface cracks. Furthermore, it can fill the gap in the existing concrete tunnel lining surface crack detection by removing the lining seam.

High Line

DEFF Research Database (Denmark)

Kiib, Hans

2015-01-01

At just over 10 meters above street level, the High Line extends three kilometers through three districts of Southwestern Manhattan in New York. It consists of simple steel construction, and previously served as an elevated rail line connection between Penn Station on 34th Street and the many....... The High Line project has been carried out as part of an open conversion strategy. The result is a remarkable urban architectural project, which works as a catalyst for the urban development of Western Manhattan. The greater project includes the restoration and reuse of many old industrial buildings...

Evidence of Diel Vertical Migration of Mesopelagic Sound-Scattering Organisms in the Arctic

Directory of Open Access Journals (Sweden)

Harald Gjøsæter

2017-10-01

Full Text Available While sound scattering layers (SSLs have been described previously from ice-covered waters in the Arctic, the existence of a viable mesopelagic community that also includes mesopelagic fishes in the Arctic has been questioned. In addition, it has been hypothesized that vertical migration would hardly exist in these areas. We wanted to check if deep scattering layers (DSLs was found to the west and north of Svalbard (79°30′N−82°10′N during autumn 2015, and if present; whether organisms in such DSLs undertook vertical migrations. Our null hypothesis was that there would be no evidence of diel vertical migration. Multi-frequency acoustic observations by hull mounted echo sounder (18, 38, and 120 kHz revealed a DSL at depths ~210–510 m in areas with bottom depths exceeding ~600 m. Investigating eight geographical locations that differed with respect to time periods, light cycle and sea ice conditions, we show that the deeper layer of DSL displayed a clear ascending movement during night time and a descending movement during daytime. The high-light weighted mean depth (WMD (343–514 m with respect to backscattered energy was statistically deeper than the low-light WMD (179–437 m for the locations studied. This behavior of the DSL was found to be consistent both when the sun was continuously above the horizon and after it started to set on 1 September, and both in open water and sea ice covered waters. The WMD showed an increasing trend, while the nautical area backscattering strength from the DSL showed a decreasing trend from south to north among the studied locations. Hydrographic observations revealed that the diel migration was found in the lower part of the north-flowing Atlantic Water, and was disconnected from the surface water masses above the Atlantic Water during day and night. The organisms conducting vertical migrations were studied by vertical and oblique hauls with zooplankton nets and pelagic trawls. These data suggest

Ledipasvir/Sofosbuvir.

Science.gov (United States)

Cada, Dennis J; Baker, Danial E; Bindler, Ross Jason

2015-03-01

Each month, subscribers to The Formulary Monograph Service receive 5 to 6 well-documented monographs on drugs that are newly released or are in late phase 3 trials. The monographs are targeted to Pharmacy & Therapeutics Committees. Subscribers also receive monthly 1-page summary monographs on agents that are useful for agendas and pharmacy/nursing in-services. A comprehensive target drug utilization evaluation/medication use evaluation (DUE/MUE) is also provided each month. With a subscription, the monographs are sent in print and are also available on-line. Monographs can be customized to meet the needs of a facility. A drug class review is now published monthly with The Formulary Monograph Service. Through the cooperation of The Formulary, Hospital Pharmacy publishes selected reviews in this column. For more information about The Formulary Monograph Service, call The Formulary at 800-322-4349. The March 2015 monograph topics are paritaprevir, ritonavir, ombitasvir, and dasabuvir; meningococcal B bivalent recombinant vaccine; alemtuzumab; ceftolozane/tazobactam; and peramivir solution. The Safety MUE is on peramivir solution.

An ultrafast line-by-line algorithm for calculating spectral transmittance and radiance

International Nuclear Information System (INIS)

Tan, X.

2013-01-01

An ultrafast line-by-line algorithm for calculating spectral transmittance and radiance of gases is presented. The algorithm is based on fast convolution of the Voigt line profile using Fourier transform and a binning technique. The algorithm breaks a radiative transfer calculation into two steps: a one-time pre-computation step in which a set of pressure independent coefficients are computed using the spectral line information; a normal calculation step in which the Fourier transform coefficients of the optical depth are calculated using the line of sight information and the coefficients pre-computed in the first step, the optical depth is then calculated using an inverse Fourier transform and the spectral transmittance and radiance are calculated. The algorithm is significantly faster than line-by-line algorithms that do not employ special speedup techniques by a factor of 10 3 –10 6 . A case study of the 2.7 μm band of H 2 O vapor is presented. -- Highlights: •An ultrafast line-by-line model based on FFT and a binning technique is presented. •Computationally expensive calculations are factored out into a pre-computation step. •It is 10 3 –10 8 times faster than LBL algorithms that do not employ speedup techniques. •Good agreement with experimental data for the 2.7 μm band of H 2 O

Towards a Framework for Modelling and Verification of Relay Interlocking Systems

DEFF Research Database (Denmark)

Haxthausen, Anne Elisabeth

2011-01-01

This paper describes a framework currently under development for modelling, simulation, and verification of relay interlocking systems as used by the Danish railways. The framework is centred around a domain-specific language (DSL) for describing such systems, and provides (1) a graphical editor...

Polymorphic Embedding of DSLs

DEFF Research Database (Denmark)

Hofer, Christian; Ostermann, Klaus; Rendel, Tillmann

2008-01-01

propose polymorphic embedding of DSLs, where many different interpretations of a DSL can be provided as reusable components, and show how polymorphic embedding can be realized in the programming language Scala. With polymorphic embedding, the static type-safety, modularity, composability and rapid...

Towards a Framework for Modelling and Verification of Relay Interlocking Systems

DEFF Research Database (Denmark)

Haxthausen, Anne Elisabeth

2010-01-01

This paper describes a framework currently under development for modelling, simulation, and verification of relay interlocking systems as used by the Danish railways. The framework is centred around a domain-specific language (DSL) for describing such systems, and provides (1) a graphical editor ...

Covariant electromagnetic field lines

Science.gov (United States)

Hadad, Y.; Cohen, E.; Kaminer, I.; Elitzur, A. C.

2017-08-01

Faraday introduced electric field lines as a powerful tool for understanding the electric force, and these field lines are still used today in classrooms and textbooks teaching the basics of electromagnetism within the electrostatic limit. However, despite attempts at generalizing this concept beyond the electrostatic limit, such a fully relativistic field line theory still appears to be missing. In this work, we propose such a theory and define covariant electromagnetic field lines that naturally extend electric field lines to relativistic systems and general electromagnetic fields. We derive a closed-form formula for the field lines curvature in the vicinity of a charge, and show that it is related to the world line of the charge. This demonstrates how the kinematics of a charge can be derived from the geometry of the electromagnetic field lines. Such a theory may also provide new tools in modeling and analyzing electromagnetic phenomena, and may entail new insights regarding long-standing problems such as radiation-reaction and self-force. In particular, the electromagnetic field lines curvature has the attractive property of being non-singular everywhere, thus eliminating all self-field singularities without using renormalization techniques.

The End of the Lines for OX 169: No Binary Broad-Line Region

Science.gov (United States)

Halpern, J. P.; Eracleous, M.

2000-03-01

We show that unusual Balmer emission-line profiles of the quasar OX 169, frequently described as either self-absorbed or double peaked, are actually neither. The effect is an illusion resulting from two coincidences. First, the forbidden lines are quite strong and broad. Consequently, the [N II] λ6583 line and the associated narrow-line component of Hα present the appearance of twin Hα peaks. Second, the redshift of 0.2110 brings Hβ into coincidence with Na I D at zero redshift, and ISM absorption in Na I D divides the Hβ emission line. In spectra obtained over the past decade, we see no substantial change in the character of the line profiles and no indication of intrinsic double-peaked structure. The Hγ, Mg II, and Lyα emission lines are single peaked, and all of the emission-line redshifts are consistent once they are correctly attributed to their permitted and forbidden-line identifications. A systematic shift of up to 700 km s-1 between broad and narrow lines is seen, but such differences are common and could be due to gravitational and transverse redshift in a low-inclination disk. Stockton & Farnham had called attention to an apparent tidal tail in the host galaxy of OX 169 and speculated that a recent merger had supplied the nucleus with a coalescing pair of black holes that was now revealing its existence in the form of two physically distinct broad-line regions. Although there is no longer any evidence for two broad emission-line regions in OX 169, binary black holes should form frequently in galaxy mergers, and it is still worthwhile to monitor the radial velocities of emission lines that could supply evidence of their existence in certain objects.

Who learns what?

DEFF Research Database (Denmark)

Meidell Sigsgaard, Anna-Vera

2015-01-01

data from a fifth grade DSL classroom during a History unit of study, this paper takes up broader issues of social equity in education. LCTs dimension of Specialisation provides a powerful yet simple tool for exposing the workings of the implicit pedagogy observed, and shows what little support......-student interactions shows why DSL students taught within the framework of a ‘mainstream’ fifth grade History unit have a hard time decoding what is expected of them. More specifically, the analysis shows that students have difficulty achieving teachers’ recognition throughout the unit of study, both in terms of what...... an example of a translational device, or language of description (Bernstein, 2000). Object of study and method Several transcribed examples of teacher-student talk from video-observations of a fifth grade History class are analysed in this paper. These will be supplemented by examples of tasks set forth...

Nasca Lines, Peru

Science.gov (United States)

2001-01-01

The Nasca Lines are located in the Pampa region of Peru, the desolate plain of the Peruvian coast 400 km south of Lima. The Lines were first spotted when commercial airlines began flying across the Peruvian desert in the 1920's. Passengers reported seeing 'primitive landing strips' on the ground below. The Lines were made by removing the iron-oxide coated pebbles which cover the surface of the desert. When the gravel is removed, they contrast with the light color underneath. In this way the lines were drawn as furrows of a lighter color. On the pampa, south of the Nasca Lines, archaeologists have now uncovered the lost city of the line-builders, Cahuachi. It was built nearly two thousand years ago and was mysteriously abandoned 500 years later. This ASTER sub-image covers an area of 14 x 18 km, was acquired on December 22, 2000, and is located at 14.7 degrees south latitude and 75.1 degrees west longitude. The U.S. science team is located at NASA's Jet Propulsion Laboratory, Pasadena, Calif. The Terra mission is part of NASA's Science Mission Directorate.

Malheur River Wildlife Mitigation Project : 2008 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Kesling, Jason; Abel, Chad; Schwabe, Laurence

2009-01-01

In 1998, the Burns Paiute Tribe (BPT) submitted a proposal to Bonneville Power Administration (BPA) for the acquisition of the Malheur River Wildlife Mitigation Project (Project). The proposed mitigation site was for the Denny Jones Ranch and included Bureau of Land Management (BLM) and Oregon Division of State Lands (DSL) leases and grazing allotments. The Project approval process and acquisition negotiations continued for several years until the BPT and BPA entered into a Memorandum of Agreement, which allowed for purchase of the Project in November 2000. The 31,781 acre Project is located seven miles east of Juntura, Oregon and is adjacent to the Malheur River (Figure 1). Six thousand three hundred eighty-five acres are deeded to BPT, 4,154 acres are leased from DSL, and 21,242 acres are leased from BLM (Figure 2). In total 11 grazing allotments are leased between the two agencies. Deeded land stretches for seven miles along the Malheur River. It is the largest private landholding on the river between Riverside and Harper, Oregon. Approximately 938 acres of senior water rights are included with the Ranch. The Project is comprised of meadow, wetland, riparian and shrub-steppe habitats. The BLM grazing allotment, located south of the ranch, is largely shrub-steppe habitat punctuated by springs and seeps. Hunter Creek, a perennial stream, flows through both private and BLM lands. Similarly, the DSL grazing allotment, which lies north of the Ranch, is predominantly shrub/juniper steppe habitat with springs and seeps dispersed throughout the upper end of draws (Figure 2).

An OCD perspective of line edge and line width roughness metrology

Science.gov (United States)

Bonam, Ravi; Muthinti, Raja; Breton, Mary; Liu, Chi-Chun; Sieg, Stuart; Seshadri, Indira; Saulnier, Nicole; Shearer, Jeffrey; Patlolla, Raghuveer; Huang, Huai

2017-03-01

Metrology of nanoscale patterns poses multiple challenges that range from measurement noise, metrology errors, probe size etc. Optical Metrology has gained a lot of significance in the semiconductor industry due to its fast turn around and reliable accuracy, particularly to monitor in-line process variations. Apart from monitoring critical dimension, thickness of films, there are multiple parameters that can be extracted from Optical Metrology models3. Sidewall angles, material compositions etc., can also be modeled to acceptable accuracy. Line edge and Line Width roughness are much sought of metrology following critical dimension and its uniformity, although there has not been much development in them with optical metrology. Scanning Electron Microscopy is still used as a standard metrology technique for assessment of Line Edge and Line Width roughness. In this work we present an assessment of Optical Metrology and its ability to model roughness from a set of structures with intentional jogs to simulate both Line edge and Line width roughness at multiple amplitudes and frequencies. We also present multiple models to represent roughness and extract relevant parameters from Optical metrology. Another critical aspect of optical metrology setup is correlation of measurement to a complementary technique to calibrate models. In this work, we also present comparison of roughness parameters extracted and measured with variation of image processing conditions on a commercially available CD-SEM tool.

Modification of the U-line of the RHIC injection line

International Nuclear Information System (INIS)

Xu, Jianming.

1991-09-01

The parameters of the U-line of the RHIC injection line with low β waist are described. In that lattice, the location of SA is not dispersion free and 14 quadrupoles are needed. This line has been modified to move SA to a dispersion free region (after the 8-degree bend), the length and maximum gradient of quadrupoles have been adjusted to fit the existing quadrupole parameters and the number of quadrupoles is reduced to 12. 2 refs., 3 tabs

Difference in membrane repair capacity between cancer cell lines and a normal cell line

DEFF Research Database (Denmark)

Frandsen, Stine Krog; McNeil, Anna K.; Novak, Ivana

2016-01-01

repair was investigated by disrupting the plasma membrane using laser followed by monitoring fluorescent dye entry over time in seven cancer cell lines, an immortalized cell line, and a normal primary cell line. The kinetics of repair in living cells can be directly recorded using this technique...... cancer cell lines (p immortalized cell line (p

Challenges for Technological Development in China’s Industry

OpenAIRE

Cao, Cong

2008-01-01

Since the late 1970s, and especially during the 1990s, foreign direct investment (FDI) has to a large extent recast China’s industrial base and upgraded its industrial technology. In 2001, China became the country with the highest number of mobile phone subscribers with 145 million users, and its 179 million fixed phone lines were the second highest, next to the United States. By 2010, if not earlier, and, after overtaking Japan in 2002, China is expected to overtake the United States to bec...

Anonymous authentication and location privacy preserving schemes for LTE-A networks

Directory of Open Access Journals (Sweden)

Zaher Jabr Haddad

2017-11-01

Full Text Available Long Term Evaluation Advanced (LTE-A is the third generation partnership project for cellular network that allows subscribers to roam into networks (i.e., the Internet and wireless connections using spacial purpose base-stations, such as wireless access points and home node B. In such LTE-A based networks, neither base-stations, nor the Internet and wireless connections are trusted because base-stations are operated by un-trusted subscribers. Attackers may exploit these vulnerabilities to violate the privacy of the LTE-A subscribers. On the other hand, the tradeoff between privacy and authentication is another challenge in such networks. Therefore, in this paper, we propose two anonymous authentication schemes based on one-time pseudonymes and Schnorr Zero Knowledge Protocols. Instead of the international mobile subscriber identity, these schemes enable the user equipment, base-stations and mobility management entity to mutually authenticate each others and update the location of the user equipment without evolving the home subscriber server. The security analysis demonstrate that the proposed schemes thwart security and privacy attacks, such as malicious, international mobile subscriber identity catching, and tracking attacks. Additionally, our proposed schemes preserve the location privacy of user equipment since no entity except the mobility management entity and Gate-Way Mobile Location Center can link between the pseudonymes and the international mobile subscriber identity. Also attackers have no knowledge about international mobile subscriber identity. Hence, the proposed schemes achieve backward/forward secrecy. Furthermore, the performance evaluation shows that the proposed handover schemes impose a small overhead on the mobile nodes and it has smaller computation and communication overheads than those in other schemes.

Facilitation of social learning in teacher education: the ‘Dimensions of Social Learning Framework’

NARCIS (Netherlands)

de Laat, M.M.; Vrieling, E.; van den Beemt, A.A.J.; McDonald, J.; Cater-Steel, A.

2017-01-01

To understand the organization of social learning by groups in practice, this chapter elaborates on the use of a framework of dimensions and indicators to explore social learning within (prospective) teacher groups. The applied framework that we call the ‘Dimensions of Social Learning (DSL)

Language Convergence Infrastructure

NARCIS (Netherlands)

V. Zaytsev (Vadim); J.M. Fernandes; R. Lämmel (Ralf); J.M.W. Visser (Joost); J. Saraiva

2011-01-01

htmlabstractThe process of grammar convergence involves grammar extraction and transformation for structural equivalence and contains a range of technical challenges. These need to be addressed in order for the method to deliver useful results. The paper describes a DSL and the infrastructure behind

TraceContract: A Scala DSL for Trace Analysis

Science.gov (United States)

Barringer, Howard; Havelund, Klaus

2011-01-01

In this paper we describe TRACECONTRACT, an API for trace analysis, implemented in the SCALA programming language. We argue that for certain forms of trace analysis the best weapon is a high level programming language augmented with constructs for temporal reasoning. A trace is a sequence of events, which may for example be generated by a running program, instrumented appropriately to generate events. The API supports writing properties in a notation that combines an advanced form of data parameterized state machines with temporal logic. The implementation utilizes SCALA's support for defining internal Domain Specific Languages (DSLs). Furthermore SCALA's combination of object oriented and functional programming features, including partial functions and pattern matching, makes it an ideal host language for such an API.

Purity, adulteration and price of drugs bought on-line versus off-line in the Netherlands.

Science.gov (United States)

van der Gouwe, Daan; Brunt, Tibor M; van Laar, Margriet; van der Pol, Peggy

2017-04-01

On-line drug markets flourish and consumers have high expectations of on-line quality and drug value. The aim of this study was to (i) describe on-line drug purchases and (ii) compare on-line with off-line purchased drugs regarding purity, adulteration and price. Comparison of laboratory analyses of 32 663 drug consumer samples (stimulants and hallucinogens) purchased between January 2013 and January 2016, 928 of which were bought on-line. The Netherlands. Primary outcome measures were (i) the percentage of samples purchased on-line and (ii) the chemical purity of powders (or dosage per tablet); adulteration; and the price per gram, blotter or tablet of drugs bought on-line compared with drugs bought off-line. The proportion of drug samples purchased on-line increased from 1.4% in 2013 to 4.1% in 2015. The frequency varied widely, from a maximum of 6% for controlled, traditional substances [ecstasy tablets, 3,4-methylenedioxy-methamphetamine (MDMA) powder, amphetamine powder, cocaine powder, 4-bromo-2,5-dimethoxyphenethylamine (2C-B) and lysergic acid diethylamide (LSD)] to more than a third for new psychoactive substances (NPS) [4-fluoroamphetamine (4-FA), 5/6-(2-aminopropyl)benzofuran (5/6-APB) and methoxetamine (MXE)]. There were no large differences in drug purity, yet small but statistically significant differences were found for 4-FA (on-line 59% versus off-line 52% purity for 4-FA on average, P = 0.001), MDMA powders (45 versus 61% purity for MDMA, P = 0.02), 2C-B tablets (21 versus 10 mg 2C-B/tablet dosage, P = 0.49) and ecstasy tablets (131 versus 121 mg MDMA/tablet dosage, P = 0.05). The proportion of adulterated samples purchased on-line and off-line did not differ, except for 4-FA powder, being less adulterated on-line (χ 2  = 8.3; P < 0.02). Drug prices were mainly higher on-line, ranging for various drugs from 10 to 23% higher than that of drugs purchased off-line (six of 10 substances: P < 0.05). Dutch drug users increasingly

Crossing the LINE toward genomic instability: LINE-1 retrotransposition in cancer

Science.gov (United States)

Kemp, Jacqueline; Longworth, Michelle

2015-12-01

Retrotransposons are repetitive DNA sequences that are positioned throughout the human genome. Retrotransposons are capable of copying themselves and mobilizing new copies to novel genomic locations in a process called retrotransposition. While most retrotransposon sequences in the human genome are incomplete and incapable of mobilization, the LINE-1 retrotransposon, which comprises approximately 17% of the human genome, remains active. The disruption of cellular mechanisms that suppress retrotransposon activity is linked to the generation of aneuploidy, a potential driver of tumor development. When retrotransposons insert into a novel genomic region, they have the potential to disrupt the coding sequence of endogenous genes and alter gene expression, which can lead to deleterious consequences for the organism. Additionally, increased LINE-1 copy numbers provide more chances for recombination events to occur between retrotransposons, which can lead to chromosomal breaks and rearrangements. LINE-1 activity is increased in various cancer cell lines and in patient tissues resected from primary tumors. LINE-1 activity also correlates with increased cancer metastasis. This review aims to give a brief overview of the connections between LINE-1 retrotransposition and the loss of genome stability. We will also discuss the mechanisms that repress retrotransposition in human cells and their links to cancer.

Theoretical Atomic Physics code development IV: LINES, A code for computing atomic line spectra

International Nuclear Information System (INIS)

Abdallah, J. Jr.; Clark, R.E.H.

1988-12-01

A new computer program, LINES, has been developed for simulating atomic line emission and absorption spectra using the accurate fine structure energy levels and transition strengths calculated by the (CATS) Cowan Atomic Structure code. Population distributions for the ion stages are obtained in LINES by using the Local Thermodynamic Equilibrium (LTE) model. LINES is also useful for displaying the pertinent atomic data generated by CATS. This report describes the use of LINES. Both CATS and LINES are part of the Theoretical Atomic PhysicS (TAPS) code development effort at Los Alamos. 11 refs., 9 figs., 1 tab

Second-line failure and first experience with third-line antiretroviral therapy in Mumbai, India

Directory of Open Access Journals (Sweden)

Samsuddin Khan

2014-07-01

Full Text Available Background: There are limited data on the failure of second-line antiretroviral therapy (ART and the use of third-line ART in people living with HIV in resource-limited settings. Since 2011, the Médecins Sans Frontières (MSF HIV/tuberculosis programme in Mumbai, India, has been providing third-line ART to patients in care. Objective: To describe the experiences and programmatic challenges during management of suspected second-line ART failure and third-line ART therapy for patients living with HIV, including the use of HIV viral load (VL testing. Design: This was a retrospective, observational cohort study of patients with suspected second-line ART treatment failure, who were followed for at least 12 months between January 2011 and March 2014. Results: A total of 47 patients with suspected second-line failure met the inclusion criteria during the study period. Twenty-nine of them (62% responded to enhanced adherence support, had a subsequent undetectable VL after a median duration of 3 months and remained on second-line ART. The other 18 patients had to be initiated on a third-line ART regimen, which consisted of darunavir–ritonavir, raltegravir, and one or more appropriate nucleoside or nucleotide reverse transcriptase inhibitors, based on the results of HIV genotype testing. Of the 13 patients for whom follow-up VL results were available, 11 achieved virological suppression after a median duration of 3 months on third-line ART (interquartile range: 2.5–3.0. No serious treatment-related adverse events were recorded. Conclusions: With intensive counselling and adherence support in those suspected of failing second-line ART, unnecessary switching to more expensive third-line ART can be averted in the majority of cases. However, there is an increasing need for access to third-line ART medications such as darunavir and raltegravir, for which national ART programmes should be prepared. The cost of such medications and inadequate access to VL

Survey of transmission line corridors. [Data on delays in transmission line construction

Energy Technology Data Exchange (ETDEWEB)

1979-01-05

The intent of this study is to determine the extent of delays experienced in planning and constructing transmission lines in the continental United States. The reasons for the delays are identified for each line studied and their effect on the total electrical system is sought. Data was collected for 136 different lines either recently built or currently under study. Statistics were developed for each line in several categories and comparisons of lines delayed were made by company, area served and generation capacity. From the study presented here it was found that: right-of-way acquisition procedures including condemnation and easement negotiation practices delay more projects than local, state and federal regulatory requirements combined; load growth reductions particularly in the east have reduced the impact of regulatory delays; the south, southeast and southwestern areas of the country experience fewer delays in constructing transmission lines than the more populated states, and the cost for corridor delays was responded to for only 17 of the 142 projects surveyed. By far the most costly delay is the expense of condemning land for transmission right-of-way.

Changes in extreme regional sea level under global warming

NARCIS (Netherlands)

Brunnabend, S. E.; Dijkstra, H. A.; Kliphuis, Michael; Bal, Henri E.; Seinstra, Frank J.; van Werkhoven, Ben; Maassen, J.; van Meersbergen, Maarten

2017-01-01

An important contribution to future changes in regional sea level extremes is due to the changes in intrinsic ocean variability, in particular ocean eddies. Here, we study a scenario of future dynamic sea level (DSL) extremes using a high-resolution version of the Parallel Ocean Program and

Determination of free insulin-like growth factor-I in human serum

DEFF Research Database (Denmark)

Frystyk, J.; Skjærbæk, C.; Ivarsen, P.

2001-01-01

Two fundamentally different methods are currently used for the determination of free insulin-like growth factor-I (IGF-I): ultrafiltration by centrifugation (UF) and direct immunoradiometric assay (IRMA). The aim was to evaluate a commercial IRMA (DSL, Webster, TX, USA) and to compare it with UF....

Research Article Special Issue

African Journals Online (AJOL)

pc

2018-03-07

Mar 7, 2018 ... in terms of performance based on simulations and experimental anal tion time. MATLAB/SIMULINK and dSPACE DSl104 controller pl .... of four process stages which are fuzzifier, inference engine, knowledge ..... control using algorithm control of stator flux estimation and space vector modulation based.

LINES

Directory of Open Access Journals (Sweden)

Minas Bakalchev

2015-10-01

Full Text Available The perception of elements in a system often creates their interdependence, interconditionality, and suppression. The lines from a basic geometrical element have become the model of a reductive world based on isolation according to certain criteria such as function, structure, and social organization. Their traces are experienced in the contemporary world as fragments or ruins of a system of domination of an assumed hierarchical unity. How can one release oneself from such dependence or determinism? How can the lines become less “systematic” and forms more autonomous, and less reductive? How is a form released from modernistic determinism on the new controversial ground? How can these elements or forms of representation become forms of action in the present complex world? In this paper, the meaning of lines through the ideas of Le Corbusier, Leonidov, Picasso, and Hitchcock is presented. Spatial research was made through a series of examples arising from the projects of the architectural studio “Residential Transformations”, which was a backbone for mapping the possibilities ranging from playfulness to exactness, as tactics of transformation in the different contexts of the contemporary world.

Hydrophobic mismatch in gramicidin A'/lecithin systems

International Nuclear Information System (INIS)

Watnick, P.I.; Chan, S.I.; Dea, P.

1990-01-01

Gramicidin A' (GA') has been added to three lipid systems of varying hydrophobic thickness: dimyristoyllecithin (DML), dipalmitoyllecithin (DPL), and distearoyllecithin (DSL). The similarity in length between the hydrophobic portion of GA' and the hydrocarbon chains of the lipid bilayers has been studied by using 31 P and 2 H NMR. Hydrophobic mismatch has been found to be most severe in the DML bilayer system and minimal in the case of DSL. In addition, the effects of hydrophobic mismatch on the cooperative properties of the bilayer have been obtained from 2 H NMR relaxation measurements. The results indicate that incorporation of the peptide into the bilayer disrupts the cooperative director fluctuations characteristic of pure multilamellar lipid dispersions. Finally, the GA'/lecithin ratio at which the well-known transformation from bilayer to reverse hexagonal (H II ) phase occurs is shown to depend on the acyl chain length of the phospholipid. A rationale is proposed for this chain length dependence

Monitoring with Data Automata

Science.gov (United States)

Havelund, Klaus

2014-01-01

We present a form of automaton, referred to as data automata, suited for monitoring sequences of data-carrying events, for example emitted by an executing software system. This form of automata allows states to be parameterized with data, forming named records, which are stored in an efficiently indexed data structure, a form of database. This very explicit approach differs from other automaton-based monitoring approaches. Data automata are also characterized by allowing transition conditions to refer to other parameterized states, and by allowing transitions sequences. The presented automaton concept is inspired by rule-based systems, especially the Rete algorithm, which is one of the well-established algorithms for executing rule-based systems. We present an optimized external DSL for data automata, as well as a comparable unoptimized internal DSL (API) in the Scala programming language, in order to compare the two solutions. An evaluation compares these two solutions to several other monitoring systems.

Transmission Lines or Poles, Electric - VOLUSIA COUNTY MAJOR POWER LINES (Arcs)

Data.gov (United States)

NSGIC Local Govt | GIS Inventory — Volusia County Power Line data was aggregated by using parcel data and visual inspection of 2005 aerial photography to determine centerline of Power Lines Right of...

Flow lines and export lines of Sabalo Gas Field - the engineering of a complex job; Flow lines e export lines de Sabalo - a engenharia da complexidade

Energy Technology Data Exchange (ETDEWEB)

Serodio, Conrado Jose Morbach [GDK Engenharia, Salvador, BA (Brazil)

2003-07-01

The construction of the natural gas flow lines and export lines system of the Sabalo field, in the far South of Bolivia is an unique job in the pipeline construction area. Its execution is a turning point in terms of engineering and construction technology in this industry. Among the Aguarague Cordillera (mountains), it runs across rocky canyons for more than 5 km, a 2.100 mt long narrow tunnel to overcome the mountains and steep hills along all the ROW length, with a total extension of 70 km, in line pipes ranging from 10'' and 12'' for the flow lines, 28'' for the gas export line and 8' for the condensate line. An integrated construction work plan was settled in order to face and overcome the complex construction situations found in every feet of the pipeline. Four simultaneous work sites were mobilized, 8 independent work fronts, 700 professionals and more than 150 pieces of heavy construction equipment, brought from 3 different countries. Special techniques were adopted also to handle the challenging detail engineering . All in all, the correct conjunction of a sound engineering work, planning, human resources and equipment and the managing flexibility to create alternatives and solutions at the fast pace required by a dynamic work schedule were essential to succeed, in a job with no room for mistakes. The successfully job completion open new possibilities to other challenging projects alike.(author)

Alternate Double Single Track Lines

Energy Technology Data Exchange (ETDEWEB)

Moraga Contreras, P.; Grande Andrade, Z.; Castillo Ron, E.

2016-07-01

The paper discusses the advantages and shortcomings of alternate double single track (ADST) lines with respect to double track lines for high speed lines. ADST lines consists of sequences of double and single track segments optimally selected in order to reduce the construction and maintenance costs of railway lines and to optimize the timetables used to satisfy a given demand. The single tracks are selected to coincide with expensive segments (tunnels and viaducts) and the double tracks are chosen to coincide with flat areas and only where they are necessary. At the same time, departure times are adjusted for trains to cross at the cheap double track segments. This alternative can be used for new lines and also for existing conventional lines where some new tracks are to be constructed to reduce travel time (increase speed). The ADST proposal is illustrated with some examples of both types (new lines and where conventional lines exist), including the Palencia-Santander, the Santiago-Valparaíso-Viña del Mar and the Dublin-Belfast lines, where very important reductions (90 %) are obtained, especially where a railway infrastructure already exist. (Author)

M-business as a global trend

Directory of Open Access Journals (Sweden)

Stojanović Zvezdan

2014-01-01

Full Text Available Due to the great advances in infrastructure and software, due to the huge capital invested in their development, and due to increasing demands for mobility customers and operations in real time, mobile networks are in a growing mode. According to relevant survey, the number of mobile subscribers in the global level has almost reached the total population of the Earth. There are predictions that in developed countries with a large number of Internet subscribers, subscribers who access the Internet via mobile devices very soon will exceed the number of subscribers that access the Internet through personal computers. Leadings world companies must deploy mobile business and build mobile strategy in order to remain cempetative in global market.

Determinants of durability of first-line antiretroviral therapy regimen and time from first-line failure to second-line antiretroviral therapy initiation

DEFF Research Database (Denmark)

Desmonde, Sophie; Eboua, François T; Malateste, Karen

2015-01-01

BACKGROUND: We described reasons for switching to second-line antiretroviral treatment (ART) and time to switch in HIV-infected children failing first-line ART in West Africa. METHODS: We included all children aged 15 years or less, starting ART (at least three drugs) in the paediatric Ie...... post-ART initiation, 188 (7%) had switched to second-line. The most frequent reasons were drug stock outs (20%), toxicity (18%), treatment failure (16%) and poor adherence (8%). Over the 24-month follow-up period, 322 (12%) children failed first-line ART after a median time of 7 months...... rare and switches after an immunological failure were insufficient. These gaps reveal that it is crucial to advocate for both sustainable access to first-line and alternative regimens to provide adequate roll-out of paediatric ART programmes....

Homotopic Polygonal Line Simplification

DEFF Research Database (Denmark)

Deleuran, Lasse Kosetski

This thesis presents three contributions to the area of polygonal line simplification, or simply line simplification. A polygonal path, or simply a path is a list of points with line segments between the points. A path can be simplified by morphing it in order to minimize some objective function...

About Military Sexual Trauma

Medline Plus

Full Text Available ... out why Close About Military Sexual Trauma Veterans Health Administration Loading... Unsubscribe from Veterans Health Administration? Cancel Unsubscribe Working... Subscribe Subscribed Unsubscribe 19K ...

About Military Sexual Trauma

Medline Plus

Full Text Available ... out why Close About Military Sexual Trauma Veterans Health Administration Loading... Unsubscribe from Veterans Health Administration? Cancel Unsubscribe Working... Subscribe Subscribed Unsubscribe 20K ...

About Military Sexual Trauma

Medline Plus

Full Text Available ... why Close About Military Sexual Trauma Veterans Health Administration Loading... Unsubscribe from Veterans Health Administration? Cancel Unsubscribe Working... Subscribe Subscribed Unsubscribe 20K Loading... ...

About Military Sexual Trauma

Medline Plus

Full Text Available ... why Close About Military Sexual Trauma Veterans Health Administration Loading... Unsubscribe from Veterans Health Administration? Cancel Unsubscribe Working... Subscribe Subscribed Unsubscribe 19K Loading... ...

On-line adaptive line frequency noise cancellation from a nuclear power measuring channel

Directory of Open Access Journals (Sweden)

Qadir Javed

2011-01-01

Full Text Available On-line software for adaptively canceling 50 Hz line frequency noise has been designed and tested at Pakistan Research Reactor 1. Line frequency noise causes much problem in weak signals acquisition. Sometimes this noise is so dominant that original signal is totally corrupted. Although notch filter can be used for eliminating this noise, but if signal of interest is in close vicinity of 50 Hz, then original signal is also attenuated and hence overall performance is degraded. Adaptive noise removal is a technique which could be employed for removing line frequency without degrading the desired signal. In this paper line frequency noise has been eliminated on-line from a nuclear power measuring channel. The adaptive LMS algorithm has been used to cancel 50 Hz noise. The algorithm has been implemented in labVIEW with NI 6024 data acquisition card. The quality of the acquired signal has been improved much as can be seen in experimental results.

How Alzheimer's Changes the Brain

Medline Plus

Full Text Available ... How Alzheimer's Changes the Brain National Institute On Aging Loading... Unsubscribe from National Institute On Aging? Cancel Unsubscribe Working... Subscribe Subscribed Unsubscribe 6.8K ...

How Alzheimer's Changes the Brain

Medline Plus

Full Text Available ... How Alzheimer's Changes the Brain National Institute On Aging Loading... Unsubscribe from National Institute On Aging? Cancel Unsubscribe Working... Subscribe Subscribed Unsubscribe 7K Loading... ...

Methods and Techniques for the Design and Implementation of Domain-Specific Languages

NARCIS (Netherlands)

Hemel, Z.

2012-01-01

Domain-Specific Languages (DSLs) are programming language aimed at a particular problem domain, e.g. banking, database querying or website page lay-outs. Through the use of high-level concepts, a DSL raises the level of abstraction and expressive power of the programmer, and reduces the size of

Using domain specific languages to improve the development of a power control unit

NARCIS (Netherlands)

Schuts, M.; Hooman, J.

2015-01-01

To improve the design of a power control unit at Philips, two Domain Specific Languages (DSLs) have been used. The first DSL provides a concise and readable notation for the essential state transitions. It is used to generate both configuration files and analysis models. In addition, we also

Language-driven system design

NARCIS (Netherlands)

Mauw, S.; Wiersma, W.T.; Willemse, T.A.C.

2002-01-01

Studies have shown significant benefits of the use of domain-specific languages. However, designing a DSL still seems to be an art, rather than a craft, following a clear methodology. In this paper we discuss a first step towards a methodology for designing such languages. The presented approach,

How-to boek “Fiber to the Home” ; Toegang tot de managed services lane

NARCIS (Netherlands)

Tijmes, M.R.; Nooren, P.A.; Koenen, R.H.

2012-01-01

Dit how-to boek legt uit hoe lokale aanbieders nieuwe elektronische diensten over Fiber-to-the-Home (FttH) netwerken kunnen leveren. FttH-netwerken zijn interessant voor dienstaanbieders omdat ze in de praktijk een aantal mogelijkheden bieden die in andere netwerken, zoals DSL en kabel, (nog) niet

Radiosensitivity of mesothelioma cell lines

International Nuclear Information System (INIS)

Haekkinen, A.M.; Laasonen, A.; Linnainmaa, K.; Mattson, K.; Pyrhoenen, S.

1996-01-01

The present study was carried out in order to examine the radiosensitivity of malignant pleural mesothelioma cell lines. Cell kinetics, radiation-induced delay of the cell cycle and DNA ploidy of the cell lines were also determined. For comparison an HeLa and a human foetal fibroblast cell line were simultaneously explored. Six previously cytogenetically and histologically characterized mesothelioma tumor cell lines were applied. A rapid tiazolyl blue microtiter (MTT) assay was used to analyze radiosensitivity and cell kinetics and DNA ploidy of the cultured cells were determined by flow cytometry. The survival fraction after a dose of 2 Gy (SF2), parameters α and β of the linear quadratic model (LQ-model) and mean inactivation dose (D MID ) were also estimated. The DNA index of four cell lines equaled 1.0 and two cell lines equaled 1.5 and 1.6. Different mesothelioma cell lines showed a great variation in radiosensitivity. Mean survival fraction after a radiation dose of 2 Gy (SF2) was 0.60 and ranged from 0.36 to 0.81 and mean α value was 0.26 (range 0.48-0.083). The SF2 of the most sensitive diploid mesothelioma cell line was 0.36: Less than that of the foetal fibroblast cell line (0.49). The survival fractions (0.81 and 0.74) of the two most resistant cell lines, which also were aneuploid, were equal to that of the HeLa cell line (0.78). The α/β ratios of the most sensitive cell lines were almost an order of magnitude greater than those of the two most resistant cell lines. Radiation-induced delay of the most resistant aneuploid cell line was similar to that of HeLa cells but in the most sensitive (diploid cells) there was practically no entry into the G1 phase following the 2 Gy radiation dose during 36 h. (orig.)

Radiosensitivity of mesothelioma cell lines

Energy Technology Data Exchange (ETDEWEB)

Haekkinen, A.M. [Dept. of Oncology, Univ. Central Hospital, Helsinki (Finland); Laasonen, A. [Dept. of Pathology, Central Hospital of Etelae-Pohjanmaa, Seinaejoki (Finland); Linnainmaa, K. [Dept. of Industrial Hygiene and Toxicology, Inst. of Occupational Health, Helsinki (Finland); Mattson, K. [Dept. Pulmonary Medicine, Univ. Central Hospital, Helsinki (Finland); Pyrhoenen, S. [Dept. of Oncology, Univ. Central Hospital, Helsinki (Finland)

1996-10-01

The present study was carried out in order to examine the radiosensitivity of malignant pleural mesothelioma cell lines. Cell kinetics, radiation-induced delay of the cell cycle and DNA ploidy of the cell lines were also determined. For comparison an HeLa and a human foetal fibroblast cell line were simultaneously explored. Six previously cytogenetically and histologically characterized mesothelioma tumor cell lines were applied. A rapid tiazolyl blue microtiter (MTT) assay was used to analyze radiosensitivity and cell kinetics and DNA ploidy of the cultured cells were determined by flow cytometry. The survival fraction after a dose of 2 Gy (SF2), parameters {alpha} and {beta} of the linear quadratic model (LQ-model) and mean inactivation dose (D{sub MID}) were also estimated. The DNA index of four cell lines equaled 1.0 and two cell lines equaled 1.5 and 1.6. Different mesothelioma cell lines showed a great variation in radiosensitivity. Mean survival fraction after a radiation dose of 2 Gy (SF2) was 0.60 and ranged from 0.36 to 0.81 and mean {alpha} value was 0.26 (range 0.48-0.083). The SF2 of the most sensitive diploid mesothelioma cell line was 0.36: Less than that of the foetal fibroblast cell line (0.49). The survival fractions (0.81 and 0.74) of the two most resistant cell lines, which also were aneuploid, were equal to that of the HeLa cell line (0.78). The {alpha}/{beta} ratios of the most sensitive cell lines were almost an order of magnitude greater than those of the two most resistant cell lines. Radiation-induced delay of the most resistant aneuploid cell line was similar to that of HeLa cells but in the most sensitive (diploid cells) there was practically no entry into the G1 phase following the 2 Gy radiation dose during 36 h. (orig.).

Soft Tissue Esthetics in Implant Dentistry

Directory of Open Access Journals (Sweden)

Rakesh V. Somanathan

2007-01-01

Full Text Available Dental implants have been considered to be a successful treatment modality. Recently, achieving a good osseointegration is not the ultimate goal for the restorative dentist. Successful implant treatment demands the best gingival esthetic success along with stability and function of the implant. This study was performed to obtain answers to some controversial points pertaining to esthetics and function of implants in maxilla. Immediate flapless implantation into the extraction sockets in maxillary anterior zone is an emerging treatment option in dentistry- the esthetic success of which was in debate for long. The proposed study compared the esthetic success of immediate flapless implants (ILA, to immediate implants with the need for flap (ILB and, delayed implants (DSL in single tooth restorations, in the anterior region of the maxilla. The other aim of the study was to find out if any relation exists between the interproximal crestal bone height and papilla height. Analysis was done irrespective of treatment procedure in the same study group using periodontal sounding and radiographs to find out the relation. From the study involving 106 participants, including 21 ILA, 22 ILB and 63 DSL cases, we received highest papillary index score of 2.6 average from group ILA, followed by ILB and DSL, after 3 months of prosthetic loading. From the periodontal sounding and radiographic study it was evident that, when the distance between the base of the contact point of crowns and height of interproximal bone was less than 5, the papilla was present 100 % of the time, but when the distance increased to 6 and more than 7 mm, the papilla was present only 46.5 and 24 percentage of the time respectively.

Shorter dialysis session length was not associated with lower mental health and physical functioning in elderly hemodialysis patients: Results from the Japan Dialysis Outcome and Practice Patterns Study (J-DOPPS.

Directory of Open Access Journals (Sweden)

Masashi Kitagawa

Full Text Available Health-related quality of life (HRQOL is often prioritized over long-term survival in elderly patients. Although a longer dialysis session length (DSL has been shown to reduce mortality, its effects on improving the HRQOL are unknown.Using data from the Japan Dialysis Outcomes and Practice Patterns Study (J-DOPPS, patients aged ≥ 65 years on maintenance hemodialysis were enrolled. DSL was categorized as short (240 minutes. The primary outcomes were changes in mental health (ΔMH and physical functioning (ΔPF scores assessed using the Japanese version of SF-12, in one year. The differences in the ΔMH and ΔPF among the three groups were assessed via regression (beta coefficients derived using a linear regression model.Of 1,187 patients at baseline, 319 (26.9% had a short length, 686 (57.8% a medium length, and 182 (15.3% a long length. We assessed the ΔMH data from 793 patients and the ΔPF data from 738. No significant differences in the ΔMH were noted for the short or long groups compared with the medium group (score difference: 0.26, 95% confidence interval [CI]: -4.17 to 4.69 for short; score difference: -1.15, 95% CI: -6.17 to 3.86 for long. Similarly, no significant differences were noted for these groups versus the medium group in ΔPF either (score difference: -1.43, 95% CI: -6.73 to 3.87 for short; score difference: -1.71, 95% CI: -7.63 to 4.22 for long.A shorter DSL might have no adverse effects on MH or PF for elderly patients.

World lines.

OpenAIRE

Waser Jürgen; Fuchs Raphael; Ribicic Hrvoje; Schindler Benjamin; Blöschl Günther; Gröller Eduard

2010-01-01

In this paper we present World Lines as a novel interactive visualization that provides complete control over multiple heterogeneous simulation runs. In many application areas decisions can only be made by exploring alternative scenarios. The goal of the suggested approach is to support users in this decision making process. In this setting the data domain is extended to a set of alternative worlds where only one outcome will actually happen. World Lines integrate simulation visualization and...

Research for the Influence of Distribution Network Line Reclosing Current on Line Protection

Directory of Open Access Journals (Sweden)

Yu Kansheng

2016-01-01

Full Text Available According to the distribution network line structure and reclosing control strategy, the system simulation model of distribution network lines has established based on the real-time digital simulation RTDS. Based on this, distribution network switching impulse current characteristic has researched with different capacity, different distribution and different load power factor under the different voltage switching angles. The results of the study provide a scientific basis for distribution network line protection setting, in order to further lay the foundation for improvement the validity and reliability of distribution network line protection action.

The last line effect explained

NARCIS (Netherlands)

Beller, M. (Moritz); Zaidman, A. (Andy); Karpov, A. (Andrey); R.A. Zwaan (Rolf)

2017-01-01

textabstractMicro-clones are tiny duplicated pieces of code; they typically comprise only few statements or lines. In this paper, we study the “Last Line Effect,” the phenomenon that the last line or statement in a micro-clone is much more likely to contain an error than the previous lines or

Why Are Drugs So Hard to Quit?

Medline Plus

Full Text Available ... So Hard to Quit? National Institute on Drug Abuse (NIDA/NIH) Loading... Unsubscribe from National Institute on Drug Abuse (NIDA/NIH)? Cancel Unsubscribe Working... Subscribe Subscribed Unsubscribe ...

Clean Hands Count

Medline Plus

Full Text Available ... why Close Clean Hands Count Centers for Disease Control and Prevention (CDC) Loading... Unsubscribe from Centers for Disease Control and Prevention (CDC)? Cancel Unsubscribe Working... Subscribe Subscribed ...

Dynamic Line Rating - Technologies and Challenges of PMU on Overhead Lines

DEFF Research Database (Denmark)

Alvarez, David; Rosero, Javier; Silva, Filipe Miguel Faria da

2016-01-01

for line rating computation and monitoring are identified, these are: sensors, communications, management information system and information analysis tools, which are part of integral dynamic line rating systems. Finally, the benefits and challenges of using phasor measurement units for real time capacity...

The last line effect explained

NARCIS (Netherlands)

Beller, M.M.; Zaidman, A.E.; Karpov, Andrey; Zwaan, Rolf A.

Micro-clones are tiny duplicated pieces of code; they typically comprise only few statements or lines. In this paper, we study the “Last Line Effect,” the phenomenon that the last line or statement in a micro-clone is much more likely to contain an error than the previous lines or statements. We do

Issues of medical necessity: a medical director's guide to good faith adjudication.

Science.gov (United States)

Quinn, C

1997-06-01

The term medical necessity is difficult to define, a problem for insurers who need to clearly describe what is and is not covered in their contracts with subscribers. An unclear, vague definition of medical necessity leaves insurers vulnerable to litigation by subscribers denied care deemed medically unnecessary. To avoid lawsuits, insurers must make every effort to educate their subscribers about their medical coverage, going beyond merely providing a lengthy subscriber handbook. In decisions on medical necessity, medical directors at insurance companies play a key role. They can bolster the insurer's position in denial-of-care cases in numerous ways, including keeping meticulous records, eliminating unreasonable financial incentives, maintaining a claims denial database, and consulting with other insurers to achieve a consensus on medical necessity.

Numerical simulations of sheared magnetic lines at the solar null line

Science.gov (United States)

Kuźma, B.; Murawski, K.; Solov'ev, A.

2015-05-01

Aims: We perform numerical simulations of sheared magnetic lines at the magnetic null line configuration of two magnetic arcades that are settled in a gravitationally stratified and magnetically confined solar corona. Methods: We developed a general analytical model of a 2.5D solar atmospheric structure. As a particular application of this model, we adopted it for the curved magnetic field lines with an inverted Y shape that compose the null line above two magnetic arcades, which are embedded in the solar atmosphere that is specified by the realistic temperature distribution. The physical system is described by 2.5D magnetohydrodynamic equations that are numerically solved by the FLASH code. Results: The magnetic field line shearing, implemented about 200 km below the transition region, results in Alfvén and magnetoacoustic waves that are able to penetrate solar coronal regions above the magnetic null line. As a result of the coupling of these waves, partial reflection from the transition region and scattering from inhomogeneous regions the Alfvén waves experience fast attenuation on time scales comparable to their wave periods, and the physical system relaxes in time. The attenuation time grows with the large amplitude and characteristic growing time of the shearing. Conclusions: By having chosen a different magnetic flux function, the analytical model we devised can be adopted to derive equilibrium conditions for a diversity of 2.5D magnetic structures in the solar atmosphere. Movie associated to Fig. 5 is available in electronic form at http://www.aanda.org

Characteristics of downward leaders in a cloud-to-ground lightning strike on a lightning rod

Science.gov (United States)

Wang, Caixia; Sun, Zhuling; Jiang, Rubin; Tian, Yangmeng; Qie, Xiushu

2018-05-01

A natural downward negative cloud-to-ground (CG) lightning was observed at a close distance of 370 m by using electric field change measurements and a high-speed camera at 5400 frames per second (fps). Two subsequent leader-return strokes of the lightning hit a lightning rod installed on the top of a seven-story building in Beijing city, while the grounding point for the stepped leader-first return stroke was 12 m away, on the roof of the building. The 2-D average speed of the downward stepped leader (L1) before the first return stroke (R1) was approximately 5.1 × 104 m/s during its propagation over the 306 m above the building, and those before the subsequent strokes (R2 and R3) ranged from 1.1 × 106 m/s to 2.2 × 106 m/s. An attempted leader (AL) occurred 201 ms after R1 and 10 ms before R2 reached approximately 99 m above the roof and failed to connect to the ground. The 2-D average speed of the AL was approximately 7.4 × 104 m/s. The luminosity at tip of the leader was brighter than the channel behind it. The leader inducing the R2 with an alteration of terminating point was a dart-stepped leader (DSL), which propagated through the channel of AL and continued to develop downward with new branches at about 17 m above the roof. The 2-D speed of the DSL at the bottom 99 m was 6.6 × 105 m/s. The average time interval between the stepped pulses of the DSL was approximately 10 μs, smaller than that of L1 with value of about 17 μs. The average step lengths of the DSL were approximately 6.6 m. The study shows that the stepped leader-first return stroke of lightning will not always hit the tip of a tall metal rod due to the significant branching property of the leader. However, under certain conditions, the subsequent return strokes may alter the grounding point to the tip of a tall metal rod. For the lightning rod, the protection against subsequent return strokes may be better than that against the first return stroke.

Research on Protection System of Subscribers' Rights and Interests from Mobile Resellers%移动转售商用户权益保护体系研究

Institute of Scientific and Technical Information of China (English)

杨德琛

2016-01-01

Since the ifrst batch of a total of 11 domestic mobile resale licenses were issued in the end of December, 2013, mobile resale market of our country has presented the trend of accelerated growth, with mobile resale business user scale reached about 20 million by early 2016. In the coming future, subscribers' rights protection is bound to cause concern. Firstly, this paper summarized experience of foreign mobile reseller regulators, followed by analysis of the requirements of the Mobile Telecommunication Resale Service Pilot Project and the current telecommunication service supervision organization system. Finally, from the perspective of the industry management department, mobile resellers, infrastructure operators, and users, the paper proposed strategy recommendations.%自2013年12月底国内第1批共计11家移动转售牌照发放以来，我国移动转售市场规模呈现加速增长趋势，截至2016年初移动转售业务用户规模已达到约2000万，未来用户权益保护势必引起关注。首先总结国际移动转售商监管机构用户权益保护经验，其次分析《移动通信转售业务试点方案》对用户权益保护的要求和当前电信服务监管组织体系，最后从行业管理部门、移动转售商、基础运营商及用户四个角度，提出移动转售用户权益保护策略建议。

Incentive-Compatible Robust Line Planning

Science.gov (United States)

Bessas, Apostolos; Kontogiannis, Spyros; Zaroliagis, Christos

The problem of robust line planning requests for a set of origin-destination paths (lines) along with their frequencies in an underlying railway network infrastructure, which are robust to fluctuations of real-time parameters of the solution. In this work, we investigate a variant of robust line planning stemming from recent regulations in the railway sector that introduce competition and free railway markets, and set up a new application scenario: there is a (potentially large) number of line operators that have their lines fixed and operate as competing entities issuing frequency requests, while the management of the infrastructure itself remains the responsibility of a single entity, the network operator. The line operators are typically unwilling to reveal their true incentives, while the network operator strives to ensure a fair (or socially optimal) usage of the infrastructure, e.g., by maximizing the (unknown to him) aggregate incentives of the line operators.

The Decision-making Study of 3G Standard in China

Institute of Scientific and Technical Information of China (English)

无

2005-01-01

@@ 1. Introduction Within the past decade, especially after 2G standards appeared, the mobile telephone industry in China has experienced a dramatic growth with the number of mobile subscribers increasing considerably each year. By the summer of 2001, the number of mobile subscribers in China exceeded that in the US for the first time, with around 200 million subscribers (or about 20% of the world total), making China the largest market for mobile telephones in the world.

Clean Hands Count

Medline Plus

Full Text Available ... Clean Hands Count Centers for Disease Control and Prevention (CDC) Loading... Unsubscribe from Centers for Disease Control and Prevention (CDC)? Cancel Unsubscribe Working... Subscribe Subscribed Unsubscribe 65K ...

Clean Hands Count

Medline Plus

Full Text Available ... Clean Hands Count Centers for Disease Control and Prevention (CDC) Loading... Unsubscribe from Centers for Disease Control and Prevention (CDC)? Cancel Unsubscribe Working... Subscribe Subscribed Unsubscribe 66K ...

Why Are Drugs So Hard to Quit?

Medline Plus

Full Text Available ... Drugs So Hard to Quit? National Institute on Drug Abuse (NIDA/NIH) Loading... Unsubscribe from National Institute on Drug Abuse (NIDA/NIH)? Cancel Unsubscribe Working... Subscribe Subscribed Unsubscribe ...

Golden Rays - July 2017 | Solar Research | Solar Research | NREL

Science.gov (United States)

, subscribe to the Solar Newsletter. SUBSCRIBE Hot Topics Two solar installers secure solar panels on the roof that has the potential to improve the efficiency of solar panels while leveraging existing

Development of a Handheld Line Information Reader and Generator for Efficient Management of Optical Communication Lines.

Science.gov (United States)

Lee, Jaeyul; Kwon, Hyungwoo; Song, Jaewon; Jeon, Mansik; Kim, Jeehyun

2017-08-24

A handheld line information reader and a line information generator were developed for the efficient management of optical communication lines. The line information reader consists of a photo diode, trans-impedance amplifier, voltage amplifier, microcontroller unit, display panel, and communication modules. The line information generator consists of a laser diode, laser driving circuits, microcontroller unit, and communication modules. The line information reader can detect the optical radiation field of the test line by bending the optical fiber. To enhance the sensitivity of the line information reader, an additional lens was used with a focal length of 4.51 mm. Moreover, the simulation results obtained through BeamPROP ® software from Synopsys, Inc. demonstrated a stronger optical radiation field of the fiber due to a longer transmission wavelength and larger bending angle of the fiber. Therefore, the developed devices can be considered as useful tools for the efficient management of optical communication lines.

Fault discovery protocol for passive optical networks

Science.gov (United States)

Hajduczenia, Marek; Fonseca, Daniel; da Silva, Henrique J. A.; Monteiro, Paulo P.

2007-06-01

All existing flavors of passive optical networks (PONs) provide an attractive alternative to legacy copper-based access lines deployed between a central office (CO) of the service provider (SP) and a customer site. One of the most challenging tasks for PON network planners is the reduction of the overall cost of employing protection schemes for the optical fiber plant while maintaining a reasonable level of survivability and reducing the downtime, thus ensuring acceptable levels of quality of service (QoS) for end subscribers. The recently growing volume of Ethernet PONs deployment [Kramer, IEEE 802.3, CFI (2006)], connected with low-cost electronic and optical components used in the optical network unit (ONU) modules, results in the situation where remote detection of faulty/active subscriber modules becomes indispensable for proper operation of an EPON system. The problem of the remote detection of faulty ONUs in the system is addressed where the upstream channel is flooded with the cw transmission from one or more damaged ONUs and standard communication is severed, providing a solution that is applicable in any type of PON network, regardless of the operating protocol, physical structure, and data rate.

The most-favoured-nation clause in tax treaties: tool for potential reduction of withholding income tax applicable to Chile and Canada

Directory of Open Access Journals (Sweden)

Renée Antonieta Villagra Cayamana

2013-07-01

Full Text Available Tax treaties to avoid the double taxation signed by a country have consequences for the future, but they can also modify the terms of treaties that are already in force, in case these contain most-favoured-nation clauses. In this line, taxpayers and companies, particularly, as well as the Tax Administration must be alert, regarding topotential modifications of the terms of the Peruvian tax treaties already in force; mainly about the withholding tax rate applied to royalties in the Convention subscribed with Chile and the withholding tax rates applied to dividends, interests and royalties in the Convention subscribed with Canada, taking into account that both of the mentioned tax treaties contain most-favoured-nation clauses for those kind of income. The Ministry of Economy, as the entity in charge of negotiations of the bilateral conventions, according to Law Decree 25883, has the responsibility of negotiating future treaties with full knowledge that the terms to be included could also cause the effect to decrease the withholding tax rates of the income tax in respect to conventions already in effect, as a consequence of the most-favoured-nation clause they contain.

GOSAT-2014 methane spectral line list

International Nuclear Information System (INIS)

Nikitin, A.V.; Lyulin, O.M.; Mikhailenko, S.N.; Perevalov, V.I.; Filippov, N.N.; Grigoriev, I.M.; Morino, I.; Yoshida, Y.; Matsunaga, T.

2015-01-01

The updated methane spectral line list GOSAT-2014 for the 5550–6240 cm −1 region with the intensity cutoff of 5×10 –25 cm/molecule at 296 K is presented. The line list is based on the extensive measurements of the methane spectral line parameters performed at different temperatures and pressures of methane without and with buffer gases N 2 , O 2 and air. It contains the following spectral line parameters of about 12150 transitions: line position, line intensity, energy of lower state, air-induced and self-pressure-induced broadening and shift coefficients and temperature exponent of air-broadening coefficient. The accuracy of the line positions and intensities are considerably improved in comparison with the previous version GOSAT-2009. The improvement of the line list is done mainly due to the involving to the line position and intensity retrieval of six new spectra recorded with short path way (8.75 cm). The air-broadening and air-shift coefficients for the J-manifolds of the 2ν 3 (F 2 ) band are refitted using the new more precise values of the line positions and intensities. The line assignment is considerably extended. The lower state J-value was assigned to 6397 lines representing 94.4% of integrated intensity of the considering wavenumber region. The complete assignment was done for 2750 lines. - Highlights: • The upgrade of the GOSAT methane line list in the 5550–6240 cm −1 region is done. • 12,146 experimental methane line positions and intensities are retrieved. • 6376 lower energy levels for methane lines are determined

Rapid line scan MR angiography

International Nuclear Information System (INIS)

Frahm, J.; Merboldt, K.D.; Hanicke, W.; Bruhn, H.

1987-01-01

Direct MR angiography may be performed using line scan imaging techniques combined with presaturation of stationary spins. Thus, a single line scan echo yields a projection of vessels due to the signal from reflowing unsaturated spins. Reconstruction of an angiographic image is performed line by line at slightly incremented positions. In particular, line scan angiography is direct and fast without a sensitivity to artifacts even for high flow rates. Image resolution and field of view may be chosen without restrictions, and zoom images using enhanced gradients may be recorded without aliasing artifacts. The method is robust with respect to eddy currents and pulsatile flow. Line scan MR angiograms of phantoms, animals, and human volunteers have been recorded using 90 0 radio frequency pulses and gradient-recalled echoes

Spotting Separator Points at Line Terminals in Compressed Document Images for Text-line Segmentation

OpenAIRE

R, Amarnath; Nagabhushan, P.

2017-01-01

Line separators are used to segregate text-lines from one another in document image analysis. Finding the separator points at every line terminal in a document image would enable text-line segmentation. In particular, identifying the separators in handwritten text could be a thrilling exercise. Obviously it would be challenging to perform this in the compressed version of a document image and that is the proposed objective in this research. Such an effort would prevent the computational burde...

VT Electric Transmission Line Corridors - corridor lines

Data.gov (United States)

Vermont Center for Geographic Information — (Link to Metadata) The ELTRN layer depicts electric transmission line corridors in Vermont. Various methods have been used to digitize features. The data layer...

High-resolution Laboratory Measurements of Coronal Lines near the Fe IX Line at 171 Å

Science.gov (United States)

Beiersdorfer, Peter; Träbert, Elmar

2018-02-01

We present high-resolution laboratory measurements in the spectral region between 165 and 175 Å that focus on the emission from various ions of C, O, F, Ne, S, Ar, Fe, and Ni. This wavelength region is centered on the λ171 Fe IX channel of the Atmospheric Imaging Assembly on the Solar Dynamics Observatory, and we place special emphasis on the weaker emission lines of Fe IX predicted in this region. In general, our measurements show a multitude of weak lines missing in the current databases, where the emission lines of Ni are probably most in need of further identification and reclassification. We also find that the wavelengths of some of the known lines need updating. Using the multi-reference Møller–Plesset method for wavelength predictions and collisional-radiative modeling of the line intensities, we have made tentative assignments of more than a dozen lines to the spectrum of Fe IX, some of which have formerly been identified as Fe VII, Fe XIV, or Fe XVI lines. Several Fe features remain unassigned, although they appear to be either Fe VII or Fe X lines. Further work will be needed to complete and correct the spectral line lists in this wavelength region.

VT Digital Line Graph Railroads

Data.gov (United States)

Vermont Center for Geographic Information — (Link to Metadata) This datalayer is comprised of major railroad lines for the state of Vermont. These railroad lines line up well along quadrangle boundaries, but...

The line makes the difference: line managers as effective HRM partners

NARCIS (Netherlands)

Bos-Nehles, Anna Christina

2010-01-01

The HR role of line managers is highly discussed and criticized but little empirically researched. It is argued that line managers are not able to effectively implement HR practices because they do not have the desire, capacity and competences needed to perform well and lack support and policies &

Optical solutions for unbundled access network

Science.gov (United States)

Bacîş Vasile, Irina Bristena

2015-02-01

The unbundling technique requires finding solutions to guarantee the economic and technical performances imposed by the nature of the services that can be offered. One of the possible solutions is the optic one; choosing this solution is justified for the following reasons: it optimizes the use of the access network, which is the most expensive part of a network (about 50% of the total investment in telecommunications networks) while also being the least used (telephone traffic on the lines has a low cost); it increases the distance between the master station/central and the terminal of the subscriber; the development of the services offered to the subscribers is conditioned by the subscriber network. For broadband services there is a need for support for the introduction of high-speed transport. A proper identification of the factors that must be satisfied and a comprehensive financial evaluation of all resources involved, both the resources that are in the process of being bought as well as extensions are the main conditions that would lead to a correct choice. As there is no single optimal technology for all development scenarios, which can take into account all access systems, a successful implementation is always done by individual/particularized scenarios. The method used today for the selection of an optimal solution is based on statistics and analysis of the various, already implemented, solutions, and on the experience that was already gained; the main evaluation criterion and the most unbiased one is the ratio between the cost of the investment and the quality of service, while serving an as large as possible number of customers.

Power line communications theory and applications for narrowband and broadband communications over power lines

CERN Document Server

Ferreira, Hendrik C; Newbury, John; Swart, Theo G

2010-01-01

Power Line Communications (PLC) is a promising emerging technology, which has attracted much attention due to the wide availability of power distribution lines. This book provides a thorough introduction to the use of power lines for communication purposes, ranging from channel characterization, communications on the physical layer and electromagnetic interference, through to protocols, networks, standards and up to systems and implementations. With contributions from many of the most prominent international PLC experts from academia and industry, Power Line Communications brings togeth

CERN Diversity Newsletter - November 2015

CERN Document Server

Kaltenhauser, Kristin; CERN. Geneva. HR Department

2015-01-01

Quarterly CERN Diversity Newsletter, informing on recent and ongoing diversity activities, and interesting reads, videos and other links related to diversity. Subscribe here: https://diversity.web.cern.ch/2015/07/subscribe-diversity-newsletter

CERN Diversity Newsletter - April 2017

CERN Document Server

AUTHOR|(CDS)2069427; Koutava, Ioanna; CERN. Geneva. HR Department

2017-01-01

The CERN Diversity Newsletter, informing on recent and ongoing diversity activities, and interesting reads, videos and other links related to diversity. Subscribe here: https://diversity.web.cern.ch/2015/07/subscribe-diversity-newsletter

CERN Diversity Newsletter - March 2016

CERN Document Server

Kaltenhauser, Kristin; CERN. Geneva. HR Department

2016-01-01

Quarterly CERN Diversity Newsletter, informing on recent and ongoing diversity activities, and interesting reads, videos and other links related to diversity. Subscribe here: https://diversity.web.cern.ch/2015/07/subscribe-diversity-newsletter

CERN Diversity Newsletter - September 2016

CERN Document Server

Guinot, Genevieve

2016-01-01

Quarterly CERN Diversity Newsletter, informing on recent and ongoing diversity activities, and interesting reads, videos and other links related to diversity. Subscribe here: https://diversity.web.cern.ch/2015/07/subscribe-diversity-newsletter

Optical Variability of Narrow-line and Broad-line Seyfert 1 Galaxies

Science.gov (United States)

Rakshit, Suvendu; Stalin, C. S.

2017-06-01

We studied the optical variability (OV) of a large sample of narrow-line Seyfert 1 (NLSy1) and broad-line Seyfert 1 (BLSy1) galaxies with z anti-correlated with Fe II strength but correlated with the width of the Hβ line. The well-known anti-correlation of variability-luminosity and the variability-Eddington ratio is present in our data. Among the radio-loud sample, variability amplitude is found to be correlated with radio-loudness and radio-power, suggesting that jets also play an important role in the OV in radio-loud objects, in addition to the Eddington ratio, which is the main driving factor of OV in radio-quiet sources.

Videos, Podcasts and Livechats

Medline Plus

Full Text Available ... for Our Blog Subscribe to Blog Enter your email address to subscribe to this blog and receive notifications of new posts by email. Email Address CLOSE Home About Us Provider Directory ...

IDRC Bulletin #127

International Development Research Centre (IDRC) Digital Library (Canada)

Subscribe | Unsubscribe. Subscribe to IDRC's regional newsletters. Asia | Latin America and the Caribbean | Middle East and North Africa | Sub-Saharan Africa Questions or comments? Send us your feedback at bulletin@idrc.ca. Canada ...

Line Shape Variability in a Sample of AGN with Broad Lines

Indian Academy of Sciences (India)

2016-01-27

Jan 27, 2016 ... We give here a comparative review of the line shape variability in a sample of five type 1 AGNs, those with broad emission lines in their spectra, of the data obtained from the international long-term optical monitoring campaign coordinated by the Special Astrophysical Observatory of the Russian Academy ...

Atlas transmission line breakdown analysis

CERN Document Server

Nielsen, K E; Ballard, E O; Elizondo, J M; Gribble, R F; McCuistian, B T; Parsons, W M

1999-01-01

The Atlas facility will use 24 radially converging, vertically oriented and tapered, oil insulated, triplate transmission lines between the Marx generators and the central load region. Among the requirements of the transmission lines are low inductance and high reliability. The inter-conductor gap is nominally 2 cm and the lines taper from a height of 1.75 m at the Marx end to 0.32 m at the output end. The aluminum conductors, held together by 20 insulating spacers, are assembled and inserted as a unit into radial oil-filled steel tanks. The negative, high-voltage, center conductor is 2.54-cm thick and the outer ground conductors are 1.59-cm thick. All 24 triplate transmission lines connect to a transition section at near 1 m radius that couples the transmission lines to a disk/conical solid- dielectric-insulated power flow channel transmission line terminating at the load. Peak operating voltage on the lines can be as high as 240 kV with an effective stress time of 0.8 mu s. Testing of small sections of the ...

Optimization of antibody immobilization for on-line or off-line immunoaffinity chromatography

DEFF Research Database (Denmark)

Beyer, Natascha Helena; Schou, Christian; Højrup, Peter

2009-01-01

-POROS. Protein G-based matrices are very stable showing essentially no decline in performance after 50 application-wash-elution-reequilibration cycles and being easily prepared within 2-3 h of working time with a typical antibody coupling yield of above 80%. In off-line applications where constant flow....... A systematic study was conducted to determine the most versatile antibody immobilization method for use in on-line and off-line IA chromatography applications using commonly accessible immobilization methods. Four chemistries were examined using polyclonal and monoclonal antibodies and antibody fragments. We...

Line-shape asymmetry of water vapor absorption lines in the 720-nm wavelength region

Science.gov (United States)

Grossmann, Benoist E.; Browell, Edward V.

1991-01-01

Spectral line-shape analyses were performed for water vapor lines broadened by argon, oxygen, and xenon in the 720-nm wavelength region. A line-shape asymmetry was observed, which is attributed to statistical dependence or correlation between velocity- and state-changing collisions. The generalized (asymmetric) Galatry profile, which results from the soft-collision profile and includes correlation between velocity- and state-changing collisions, was fitted to the observed line shapes and was found to compare favorably with the observed data. The most prominent asymmetries were observed with xenon as the buffer gas.

China's Bilateral Currency Swap Lines

OpenAIRE

Zhitao, Lin; Wenjie, Zhan; Cheung, Yin-Wong

2016-01-01

We study the determinants of China’s bilateral local currency swap lines that were established since the recent global finance crisis. It is found that economic factors, political considerations, and institutional characteristics including trade intensity, economic size, strategic partnership, free trade agreement, corruption, and stability affect the decision of signing a swap line agreement. Once a swap line agreement decision is made, the size of the swap line is then mainly affected by tr...

Publishing bioethics and bioethics--reflections on academic publishing by a journal editor.

Science.gov (United States)

Schüklenk, Udo

2011-02-01

This article by one of the Editors of Bioethics, published in the 25th anniversary issue of the journal, describes some of the revolutionary changes academic publishing has undergone during the last decades. Many humanities journals went from typically small print-runs, counting by the hundreds, to on-line availability in thousands of university libraries worldwide. Article up-take by our subscribers can be measured efficiently. The implications of this and other changes to academic publishing are discussed. Important ethical challenges need to be addressed in areas such as the enforcement of plagiarism-related policies, the so-called 'impact factor' and its impact on academic integrity, and the question of whether on-line only publishing can currently guarantee the integrity of academic publishing histories. © 2010 Blackwell Publishing Ltd.

Series Transmission Line Transformer

Science.gov (United States)

Buckles, Robert A.; Booth, Rex; Yen, Boris T.

2004-06-29

A series transmission line transformer is set forth which includes two or more of impedance matched sets of at least two transmissions lines such as shielded cables, connected in parallel at one end ans series at the other in a cascading fashion. The cables are wound about a magnetic core. The series transmission line transformer (STLT) which can provide for higher impedance ratios and bandwidths, which is scalable, and which is of simpler design and construction.

Cell Line Data Base: structure and recent improvements towards molecular authentication of human cell lines.

Science.gov (United States)

Romano, Paolo; Manniello, Assunta; Aresu, Ottavia; Armento, Massimiliano; Cesaro, Michela; Parodi, Barbara

2009-01-01

The Cell Line Data Base (CLDB) is a well-known reference information source on human and animal cell lines including information on more than 6000 cell lines. Main biological features are coded according to controlled vocabularies derived from international lists and taxonomies. HyperCLDB (http://bioinformatics.istge.it/hypercldb/) is a hypertext version of CLDB that improves data accessibility by also allowing information retrieval through web spiders. Access to HyperCLDB is provided through indexes of biological characteristics and navigation in the hypertext is granted by many internal links. HyperCLDB also includes links to external resources. Recently, an interest was raised for a reference nomenclature for cell lines and CLDB was seen as an authoritative system. Furthermore, to overcome the cell line misidentification problem, molecular authentication methods, such as fingerprinting, single-locus short tandem repeat (STR) profile and single nucleotide polymorphisms validation, were proposed. Since this data is distributed, a reference portal on authentication of human cell lines is needed. We present here the architecture and contents of CLDB, its recent enhancements and perspectives. We also present a new related database, the Cell Line Integrated Molecular Authentication (CLIMA) database (http://bioinformatics.istge.it/clima/), that allows to link authentication data to actual cell lines.

Cell lines authentication and mycoplasma detection as minimun quality control of cell lines in biobanking.

Science.gov (United States)

Corral-Vázquez, C; Aguilar-Quesada, R; Catalina, P; Lucena-Aguilar, G; Ligero, G; Miranda, B; Carrillo-Ávila, J A

2017-06-01

Establishment of continuous cell lines from human normal and tumor tissues is an extended and useful methodology for molecular characterization of cancer pathophysiology and drug development in research laboratories. The exchange of these cell lines between different labs is a common practice that can compromise assays reliability due to contamination with microorganism such as mycoplasma or cells from different flasks that compromise experiment reproducibility and reliability. Great proportions of cell lines are contaminated with mycoplasma and/or are replaced by cells derived for a different origin during processing or distribution process. The scientific community has underestimated this problem and thousand of research experiment has been done with cell lines that are incorrectly identified and wrong scientific conclusions have been published. Regular contamination and authentication tests are necessary in order to avoid negative consequences of widespread misidentified and contaminated cell lines. Cell banks generate, store and distribute cell lines for research, being mandatory a consistent and continuous quality program. Methods implementation for guaranteeing both, the absence of mycoplasma and authentication in the supplied cell lines, has been performed in the Andalusian Health System Biobank. Specifically, precise results were obtained using real time PCR detection for mycoplasma and 10 STRs identification by capillary electrophoresis for cell line authentication. Advantages and disadvantages of these protocols are discussed.

An analysis model of the secondary tunnel lining considering ground-primary support-secondary lining interaction

Energy Technology Data Exchange (ETDEWEB)

Seo, Seong-Ho; Chang, Seok-Bue [Yooshin Engineering Corporation, Seoul(Korea); Lee, Sang-Duk [Ajou University, Suwon(Korea)

2002-06-30

It is the common practice to over design the reinforcement for the secondary tunnel lining due to the lack of rational insight into the ground loosening loads, and due to the conservative application of the empirical design methods. The main loads of the secondary lining are the ground loosening loads and the ground water pressure, and the ground load is critical in the reinforcement design of the secondary lining in the case of drained tunnel. If the external load is absent around a tunnel. the reasons of the load for secondary tunnel lining are the deterioration of the primary supports such as shotcrete, steel rib, and rock bolts. Accordingly, the analysis method considering the ground-primary supports-secondary lining interaction should be required for the rational design of the secondary tunnel lining. In this paper, the interaction was conceptually described by the simple mass-spring model and the load transfer from the ground and primary supports to the secondary lining is showed by the ground-primary supports-secondary lining reaction curves for the theoretical solution of a circular tunnel, And also, the application of this proposed model to numerical analysis is verified in order to check the potential for the tunnel with the complex analysis conditions. (author). 8 refs., 2 tabs., 7 figs.

Stokes line width

International Nuclear Information System (INIS)

Nikiskov, A.I.; Ritus, V.I.

1993-01-01

The concept of Stokes line width is introduced for the asymptotic expansions of functions near an essential singularity. Explicit expressions are found for functions (switching functions) that switch on the exponentially small terms for the Dawson integral, Airy function, and the gamma function. A different, more natural representation of a function, not associated with expansion in an asymptotic series, in the form of dominant and recessive terms is obtained by a special division of the contour integral which represents the function into contributions of higher and lower saddle points. This division leads to a narrower, natural Stokes line width and a switching function of an argument that depends on the topology of the lines of steepest descent from the saddle point

Comparisons on Genetic Diversity among the Isonuclear-Alloplasmic Male Sterile Lines and Their Maintainer Lines in Rice

Directory of Open Access Journals (Sweden)

Jin-quan LI

2007-06-01

Full Text Available Four sets of rice isonuclear-alloplasmic lines including 16 male sterile lines and their maintainer lines were analyzed by using 91 pairs of SSR primers to study the genetic diversity of nuclear genome and their relative relationships. A total of 169 alleles were detected in the 16 lines, with a frequency of polymorphic loci of 53.85% and an average number of alleles per locus of 1.8, and the average gene diversity was 0.228. Four sets of the isonuclear-alloplasmic male sterile lines shared 146 identical alleles, corresponding to 86.39% of the total alleles; meanwhile, there are 23 different alleles among the tested materials, being 13.61% of the total alleles. On average, 78.70% identical alleles and 21.30% different alleles of the total alleles were detected between the isonuclear-alloplasmic male sterile lines and their maintainer lines. There were 53.85% identical alleles and 46.15% different alleles of the total alleles among the homozygous allonucleus male sterile lines. The fingerprints were established for some male sterile lines and maintainer lines. All the materials tested were divided into three groups at the 0.2 genetic distance based on the cluster analysis. Eight lines of Huanong A and Huayu A (including Huanong B and Huayu B were in the first group, four lines of Kezhen A (including Kezhen B in the second group, and four lines of Zhenshan 97A (including Zhenshan 97B in the third group. For the isonuclear-alloplasmic male sterile lines, the similarity coefficient between Y (Yegong type and WA (wild abortive type or between CW (Raoping wild rice and WA type reached 87–98%.

Compensation: How to Apply

Science.gov (United States)

... Report Annual Benefits Report Media and Publications About VBA Subscribe to our Monthly Bulletin Enter your contact information to receive our monthly Benefits Bulletin newsletter or to access your subscriber preferences. Subscription Type Wireless Number Email ...

By-law from January 14, 2005, relative to the tariffs of use of public natural gas distribution networks

International Nuclear Information System (INIS)

2005-01-01

This by-law defines the tariffing rules for the different French gas utilities according to the delivered quantities or to the subscribed daily capacity. Tariffs increase for overstepping of subscribed daily capacity are detailed. (J.S.)

Slide 35

Indian Academy of Sciences (India)

First page Back Continue Last page Overview Graphics. Network Management System. A must with distributed deployment of Intelligent nodes. Convergence of Telecom and Internet management. Manage traffic, subscribers, subscriber equipment and network health from management centers.

U.S. Transplantation Data

Science.gov (United States)

... Research and data analytics Technology services Meeting planning Advertising Online store NEWS Media toolkit Subscribe to our ... Calendar of events Subscribe to our enewsletter Follow Facebook Facebook Instagram Instagram Twitter Twitter LinkedIn LinkedIn Youtube ...

Patient's Guide to Living Confidently with Chronic Heart Failure

Science.gov (United States)

... 1. ↵ Riegel B , Dickson VV . A situation-specific theory of heart failure self-care. J Cardiovasc Nurs . ... Information for: Advertisers Subscribers Subscriber Help Institutions / Librarians Institutional Subscriptions FAQ International Users National Center 7272 Greenville ...

Broadband network selection issues

Science.gov (United States)

Leimer, Michael E.

1996-01-01

Selecting the best network for a given cable or telephone company provider is not as obvious as it appears. The cost and performance trades between Hybrid Fiber Coax (HFC), Fiber to the Curb (FTTC) and Asymmetric Digital Subscriber Line networks lead to very different choices based on the existing plant and the expected interactive subscriber usage model. This paper presents some of the issues and trades that drive network selection. The majority of the Interactive Television trials currently underway or planned are based on HFC networks. As a throw away market trial or a short term strategic incursion into a cable market, HFC may make sense. In the long run, if interactive services see high demand, HFC costs per node and an ever shrinking neighborhood node size to service large numbers of subscribers make FTTC appear attractive. For example, thirty-three 64-QAM modulators are required to fill the 550 MHz to 750 MHz spectrum with compressed video streams in 6 MHz channels. This large amount of hardware at each node drives not only initial build-out costs, but operations and maintenance costs as well. FTTC, with its potential for digitally switching large amounts of bandwidth to an given home, offers the potential to grow with the interactive subscriber base with less downstream cost. Integrated telephony on these networks is an issue that appears to be an afterthought for most of the networks being selected at the present time. The major players seem to be videocentric and include telephony as a simple add-on later. This may be a reasonable view point for the telephone companies that plan to leave their existing phone networks untouched. However, a phone company planning a network upgrade or a cable company jumping into the telephony business needs to carefully weigh the cost and performance issues of the various network choices. Each network type provides varying capability in both upstream and downstream bandwidth for voice channels. The noise characteristics

A new technique for on-line and off-line high speed computation

International Nuclear Information System (INIS)

Hartouni, E.P.; Jensen, D.A.; Klima, B.; Kreisler, M.N.; Rabin, M.S.Z.; Uribe, J.; Gottschalk, E.; Gara, A.; Knapp, B.C.

1989-01-01

A new technique for both on-line and off-line computation has been developed. With this technique, a reconstruction analysis in Elementary Particle Physics, otherwise prohibitively long, has been accomplished. It will be used on-line in an upcoming Fermilab experiment to reconstruct more than 100,000 events per second and to trigger on the basis of that information. The technique delivers 40 Giga operations per second, has a bandwidth on the order of Gigabytes per second and has a modest cost. An overview of the program, details of the system, and performance measurements are presented in this paper

Go4Life

Medline Plus

Full Text Available Skip navigation Sign in Search National Institute On Aging Videos Playlists Channels Discussion About Home Trending History ... Visit www.nia.nih.gov National Institute On Aging Subscribe Subscribed Unsubscribe 6,839 Loading... Loading... Working... ...

Your Lung Operation: After Your Operation

Medline Plus

Full Text Available ... General Surgery Selected Readings in General Surgery CME Test Login SRGS Online Login Subscribe to SRGS Issues ... in Surgery Subscribe ACS Case Reviews Login CME Test Login Author Instructions Sample Article Chapter Competition Contact ...

Ostomy Home Skills Program

Medline Plus

Full Text Available ... General Surgery Selected Readings in General Surgery CME Test Login SRGS Online Login Subscribe to SRGS Issues ... in Surgery Subscribe ACS Case Reviews Login CME Test Login Author Instructions Sample Article Chapter Competition Contact ...

Your Lung Operation: After Your Operation

Medline Plus

Full Text Available ... General Surgery Selected Readings in General Surgery CME Test Login SRGS Online Login Subscribe to SRGS Issues ... in Surgery Subscribe ACS Case Reviews Login CME Test Login Author Instructions Sample Article Chapter Competition Editorial ...

Ostomy Home Skills Program

Medline Plus

Full Text Available ... General Surgery Selected Readings in General Surgery CME Test Login SRGS Online Login Subscribe to SRGS Issues ... in Surgery Subscribe ACS Case Reviews Login CME Test Login Author Instructions Sample Article Chapter Competition Editorial ...

Genetic Underpinnings of Alopecia Areata

Medline Plus

Full Text Available ... Liaison Greg Lavine Writer/Editor (301) 496-8190 Newsletters Stay informed by subscribing to the NIAMS e- ... espanol Community Outreach Initiative Subscribe to Our E-Newsletters Get the latest scientific news and resources on ...

Go4Life

Medline Plus

Full Text Available Skip navigation Sign in Search National Institute On Aging Videos Playlists Channels Discussion About Home Trending History ... Visit www.nia.nih.gov National Institute On Aging Subscribe Subscribed Unsubscribe 7,073 Loading... Loading... Working... ...

Generating Safety-Critical PLC Code From a High-Level Application Software Specification

Science.gov (United States)

2008-01-01

The benefits of automatic-application code generation are widely accepted within the software engineering community. These benefits include raised abstraction level of application programming, shorter product development time, lower maintenance costs, and increased code quality and consistency. Surprisingly, code generation concepts have not yet found wide acceptance and use in the field of programmable logic controller (PLC) software development. Software engineers at Kennedy Space Center recognized the need for PLC code generation while developing the new ground checkout and launch processing system, called the Launch Control System (LCS). Engineers developed a process and a prototype software tool that automatically translates a high-level representation or specification of application software into ladder logic that executes on a PLC. All the computer hardware in the LCS is planned to be commercial off the shelf (COTS), including industrial controllers or PLCs that are connected to the sensors and end items out in the field. Most of the software in LCS is also planned to be COTS, with only small adapter software modules that must be developed in order to interface between the various COTS software products. A domain-specific language (DSL) is a programming language designed to perform tasks and to solve problems in a particular domain, such as ground processing of launch vehicles. The LCS engineers created a DSL for developing test sequences of ground checkout and launch operations of future launch vehicle and spacecraft elements, and they are developing a tabular specification format that uses the DSL keywords and functions familiar to the ground and flight system users. The tabular specification format, or tabular spec, allows most ground and flight system users to document how the application software is intended to function and requires little or no software programming knowledge or experience. A small sample from a prototype tabular spec application is

Development of a case-mix funding system for adults with combined vision and hearing loss.

Science.gov (United States)

Guthrie, Dawn M; Poss, Jeffrey W

2013-04-15

Adults with vision and hearing loss, or dual sensory loss (DSL), present with a wide range of needs and abilities. This creates many challenges when attempting to set the most appropriate and equitable funding levels. Case-mix (CM) funding models represent one method for understanding client characteristics that correlate with resource intensity. A CM model was developed based on a derivation sample (n = 182) and tested with a replication sample (n = 135) of adults aged 18+ with known DSL who were living in the community. All items within the CM model came from a standardized, multidimensional assessment, the interRAI Community Health Assessment and the Deafblind Supplement. The main outcome was a summary of formal and informal service costs which included intervenor and interpreter support, in-home nursing, personal support and rehabilitation services. Informal costs were estimated based on a wage rate of half that for a professional service provider ($10/hour). Decision-tree analysis was used to create groups with homogeneous resource utilization. The resulting CM model had 9 terminal nodes. The CM index (CMI) showed a 35-fold range for total costs. In both the derivation and replication sample, 4 groups (out of a total of 18 or 22.2%) had a coefficient of variation value that exceeded the overall level of variation. Explained variance in the derivation sample was 67.7% for total costs versus 28.2% in the replication sample. A strong correlation was observed between the CMI values in the two samples (r = 0.82; p = 0.006). The derived CM funding model for adults with DSL differentiates resource intensity across 9 main groups and in both datasets there is evidence that these CM groups appropriately identify clients based on need for formal and informal support.

Modern prescription theory and application: realistic expectations for speech recognition with hearing AIDS.

Science.gov (United States)

Johnson, Earl E

2013-01-01

A major decision at the time of hearing aid fitting and dispensing is the amount of amplification to provide listeners (both adult and pediatric populations) for the appropriate compensation of sensorineural hearing impairment across a range of frequencies (e.g., 160-10000 Hz) and input levels (e.g., 50-75 dB sound pressure level). This article describes modern prescription theory for hearing aids within the context of a risk versus return trade-off and efficient frontier analyses. The expected return of amplification recommendations (i.e., generic prescriptions such as National Acoustic Laboratories-Non-Linear 2, NAL-NL2, and Desired Sensation Level Multiple Input/Output, DSL m[i/o]) for the Speech Intelligibility Index (SII) and high-frequency audibility were traded against a potential risk (i.e., loudness). The modeled performance of each prescription was compared one with another and with the efficient frontier of normal hearing sensitivity (i.e., a reference point for the most return with the least risk). For the pediatric population, NAL-NL2 was more efficient for SII, while DSL m[i/o] was more efficient for high-frequency audibility. For the adult population, NAL-NL2 was more efficient for SII, while the two prescriptions were similar with regard to high-frequency audibility. In terms of absolute return (i.e., not considering the risk of loudness), however, DSL m[i/o] prescribed more outright high-frequency audibility than NAL-NL2 for either aged population, particularly, as hearing loss increased. Given the principles and demonstrated accuracy of desensitization (reduced utility of audibility with increasing hearing loss) observed at the group level, additional high-frequency audibility beyond that of NAL-NL2 is not expected to make further contributions to speech intelligibility (recognition) for the average listener.

CLO : The cell line ontology

NARCIS (Netherlands)

Sarntivijai, Sirarat; Lin, Yu; Xiang, Zuoshuang; Meehan, Terrence F.; Diehl, Alexander D.; Vempati, Uma D.; Schuerer, Stephan C.; Pang, Chao; Malone, James; Parkinson, Helen; Liu, Yue; Takatsuki, Terue; Saijo, Kaoru; Masuya, Hiroshi; Nakamura, Yukio; Brush, Matthew H.; Haendel, Melissa A.; Zheng, Jie; Stoeckert, Christian J.; Peters, Bjoern; Mungall, Christopher J.; Carey, Thomas E.; States, David J.; Athey, Brian D.; He, Yongqun

2014-01-01

Background: Cell lines have been widely used in biomedical research. The community-based Cell Line Ontology (CLO) is a member of the OBO Foundry library that covers the domain of cell lines. Since its publication two years ago, significant updates have been made, including new groups joining the CLO

Microwave transmission-line impedance data

CERN Document Server

Gunston, M A R

1996-01-01

A compendium of data for computing the characteristic impedance of transmission lines based on physical dimensions. Covers both conventional structures and unusual geometries, including coaxial, eccentric and elliptic coaxial, twin-wire, wire-above-ground, microstrip and derivatives, stripline, slabline and trough line. Also details numerous configurations of coupled lines.

Parallel plate transmission line transformer

NARCIS (Netherlands)

Voeten, S.J.; Brussaard, G.J.H.; Pemen, A.J.M.

2011-01-01

A Transmission Line Transformer (TLT) can be used to transform high-voltage nanosecond pulses. These transformers rely on the fact that the length of the pulse is shorter than the transmission lines used. This allows connecting the transmission lines in parallel at the input and in series at the

Wood pole overhead lines

CERN Document Server

Wareing, Brian

2005-01-01

This new book concentrates on the mechanical aspects of distribution wood pole lines, including live line working, environmental influences, climate change and international standards. Other topics include statutory requirements, safety, profiling, traditional and probabilistic design, weather loads, bare and covered conductors, different types of overhead systems, conductor choice, construction and maintenance. A section has also been devoted to the topic of lightning, which is one of the major sources of faults on overhead lines. The book focuses on the effects of this problem and the strate

First Lessons From The Biarritz Trial Network [1

Science.gov (United States)

Touyarot, P.; Marc, B.; de Panafieu, A.

1986-07-01

Opened for commercial operation in 1984, the trial optical fiber network at Biarritz in south-west France gives 1,500 subscribers access to a whole range of broadband services - videophony, audiovisual databases, TV and stereo sound program distribution, and an on-line TV program library - in addition to conventional narrow-band services like telephony and videotex. The Biarritz network is an outstanding technology and engineering testbed. It is also a sociological testing ground for new services, unique in the world, with results of particular relevance to the interactive cable TV and visual communications networks of the future.

Parallel field line and stream line tracing algorithms for space physics applications

Science.gov (United States)

Toth, G.; de Zeeuw, D.; Monostori, G.

2004-05-01

Field line and stream line tracing is required in various space physics applications, such as the coupling of the global magnetosphere and inner magnetosphere models, the coupling of the solar energetic particle and heliosphere models, or the modeling of comets, where the multispecies chemical equations are solved along stream lines of a steady state solution obtained with single fluid MHD model. Tracing a vector field is an inherently serial process, which is difficult to parallelize. This is especially true when the data corresponding to the vector field is distributed over a large number of processors. We designed algorithms for the various applications, which scale well to a large number of processors. In the first algorithm the computational domain is divided into blocks. Each block is on a single processor. The algorithm folows the vector field inside the blocks, and calculates a mapping of the block surfaces. The blocks communicate the values at the coinciding surfaces, and the results are interpolated. Finally all block surfaces are defined and values inside the blocks are obtained. In the second algorithm all processors start integrating along the vector field inside the accessible volume. When the field line leaves the local subdomain, the position and other information is stored in a buffer. Periodically the processors exchange the buffers, and continue integration of the field lines until they reach a boundary. At that point the results are sent back to the originating processor. Efficiency is achieved by a careful phasing of computation and communication. In the third algorithm the results of a steady state simulation are stored on a hard drive. The vector field is contained in blocks. All processors read in all the grid and vector field data and the stream lines are integrated in parallel. If a stream line enters a block, which has already been integrated, the results can be interpolated. By a clever ordering of the blocks the execution speed can be

Minnesota County Boundaries - lines

Data.gov (United States)

Minnesota Department of Natural Resources — Minnesota county boundaries derived from a combination of 1:24,000 scale PLS lines, 1:100,000 scale TIGER, 1:100,000 scale DLG, and 1:24,000 scale hydrography lines....

CERN Diversity Newsletter - July 2015

CERN Document Server

Kaltenhauser, Kristin; CERN. Geneva. HR Department

2015-01-01

The first official edition of the CERN Diversity Newsletter, informing on recent and ongoing diversity activities, and interesting reads, videos and other links related to diversity. Subscribe here: https://diversity.web.cern.ch/2015/07/subscribe-diversity-newsletter

Why Are Drugs So Hard to Quit?

Medline Plus

Full Text Available ... it free Find out why Close Why Are Drugs So Hard to Quit? National Institute on Drug Abuse (NIDA/NIH) Loading... Unsubscribe from National Institute on Drug Abuse (NIDA/NIH)? Cancel Unsubscribe Working... Subscribe Subscribed ...

GSM Marketing Service Providers Operations and Customers Satisfaction in Nigeria: An Empirical Investigation

Directory of Open Access Journals (Sweden)

Adebisi Sunday Abayomi

2011-06-01

Full Text Available This study has been carried out on the GSM arm of the Nigerian Telecomunication sectorto primarily investigate the level of satisfaction that the subscribers of GSM service providers haveenjoyed in the seven years of operations in Nigeria. In testing this empirically, MTN, GLOBACOMand ZAIN were selected as case studies. 600 questionnaires were administered on the subscribers ofthese GSM service providers in the Six States of the South-Western Nigeria using the purposivesampling technique. In analyzing the collated data, three hypotheses were tested with the use ofPercentages, T-test, F-test, [at 95% confidence limit], Cross-tabulation [using the ‘Eta’ Directionalmeasure] and statistical charts. The results from the SPSS 16 output rejected the Null hypotheses.This further indicated that, the various factors that determined the level of subscribers’ satisfactionwere statistically significant. The study therefore concluded that, subscribers in Nigeria aredissatisfied with the services of their service providers hence, the need for the regulatory body; NCCto ensure that subscribers interests are protected. The study then suggested that,, the GSM serviceproviders should reposition themselves to give adequate value to subscribers money incommensuration with their own gains from the Nigeria Telecommunications market.

A tangent subsolar merging line

International Nuclear Information System (INIS)

Crooker, N.U.; Siscoe, G.L.; Toffoletto, F.R.

1990-01-01

The authors describe a global magnetospheric model with a single subsolar merging line whose position is determined neither locally by the relative orientations and strengths of the merging fields nor globally by the orientation of a separator line--the governing parameters of most previous models--but by the condition of tangential contact between the external field and the magnetopause. As in previous models, the tilt of the merging line varies with IMF orientation, but here it also depends upon the ratio of Earth's magnetic flux that leaks out of the magnetopause to IMF flux that penetrates in. In the limiting case treated by Alekseyev and Belen'kaya, with no leakage of Earth's field and total IMF penetration, the merging line forms a great circle around a spherical magnetosphere where undeviated IMF lines lie tangent to its surface. This tangent merging line lies perpendicular to the IMF. They extend their work to the case of finite leakage and partial penetration, which distort the IMF into a draped pattern, thus changing the locus of tangency to the sphere. In the special case where the penetrating IMF flux is balanced by an equal amount of Earth flux leakage, the tangent merging line bisects the angle between the IMF and Earth's northward subsolar field. This result is identical to the local merging line model result for merging fields with equal magnitude. Here a global flux balance condition replaces the local equal magnitude condition

Transmission line capital costs

International Nuclear Information System (INIS)

Hughes, K.R.; Brown, D.R.

1995-05-01

The displacement or deferral of conventional AC transmission line installation is a key benefit associated with several technologies being developed with the support of the U.S. Department of Energy's Office of Energy Management (OEM). Previous benefits assessments conducted within OEM have been based on significantly different assumptions for the average cost per mile of AC transmission line. In response to this uncertainty, an investigation of transmission line capital cost data was initiated. The objective of this study was to develop a database for preparing preliminary estimates of transmission line costs. An extensive search of potential data sources identified databases maintained by the Bonneville Power Administration (BPA) and the Western Area Power Administration (WAPA) as superior sources of transmission line cost data. The BPA and WAPA data were adjusted to a common basis and combined together. The composite database covers voltage levels from 13.8 to 765 W, with cost estimates for a given voltage level varying depending on conductor size, tower material type, tower frame type, and number of circuits. Reported transmission line costs vary significantly, even for a given voltage level. This can usually be explained by variation in the design factors noted above and variation in environmental and land (right-of-way) costs, which are extremely site-specific. Cost estimates prepared from the composite database were compared to cost data collected by the Federal Energy Regulatory Commission (FERC) for investor-owned utilities from across the United States. The comparison was hampered because the only design specifications included with the FERC data were voltage level and line length. Working within this limitation, the FERC data were not found to differ significantly from the composite database. Therefore, the composite database was judged to be a reasonable proxy for estimating national average costs

MEMS-based transmission lines for microwave applications

Science.gov (United States)

Wu, Qun; Fu, Jiahui; Gu, Xuemai; Shi, Huajuan; Lee, Jongchul

2003-04-01

This paper mainly presents a briefly review for recent progress in MEMS-based transmission lines for use in microwave and millimeterwave range. MEMS-based transmission lines including different transmission line structure such as membrane-supported microstrip line microstrip line, coplanar microshield transmission line, LIGA micromachined planar transmission line, micromachined waveguides and coplanar waveguide are discussed. MEMS-based transmission lines are characterized by low propagation loss, wide operation frequency band, low dispersion and high quality factor, in addition, the fabrication is compatible with traditional processing of integrated circuits (IC"s). The emergence of MEMS-based transmission lines provided a solution for miniaturizing microwave system and monolithic microwave integrated circuits.

Technical Evaluation Report 58: RSS Windows Editors: First impressions

Directory of Open Access Journals (Sweden)

Steve Swettenham

2006-12-01

Full Text Available An RSS feed is a list of topics made available from a webpage via a standard XML file format known as RSS, an abbreviation of either Really Simple Syndication or Rich Site Summary (Wikipedia, 2006. The end-user subscribes to their favorite Internet content site via RSS-aware software. Once subscribed, announcements with appropriate links are “pushed” from the publishing site whenever new material is added to that site (see Figure 1. This allows notification of new content of possible interest, fed with anonymity to subscribers, and reduces email clutter.

Silver linings.

Science.gov (United States)

Bultas, Margaret W; Pohlman, Shawn

2014-01-01

The purpose of this interpretive phenomenological study was to gain a better understanding of the experiences of 11 mothers of preschool children with autism spectrum disorder (ASD). Mothers were interviewed three times over a 6 week period. Interviews were analyzed using interpretive methods. This manuscript highlights one particular theme-a positive perspective mothers described as the "silver lining." This "silver lining" represents optimism despite the adversities associated with parenting a child with ASD. A deeper understanding of this side of mothering children with ASD may help health care providers improve rapport, communication, and result in more authentic family centered care. Copyright © 2014 Elsevier Inc. All rights reserved.

Constancy of spectral-line bisectors

International Nuclear Information System (INIS)

Gray, D.F.

1983-01-01

Bisectors of spectral line profiles in cool stars indicate the strength of convection in the photospheres of these objects. The present investigation is concerned with the feasibility of studying time variations in line bisectors, the reality of apparent line-to-line differences within the same stellar spectrum, and bisector differences between stars of identical spectral types. The differences considered pertain to the shape of the bisector. The material used in the investigation was acquired at the McDonald Observatory using a 1728 diode Reticon array at the coudefocus of the 2.1-m telescope. Observed bisector errors are discussed. It is established that different lines in the same star show significantly different bisectors. The observed error bands are shown by the shaded regions. The slope and curvature are unique for each case

Intra lines uniformity and inter lines variation of rice mutants resulting from irradiation of South Kalimantan local varieties

International Nuclear Information System (INIS)

Raihani Wahdah; Gusti Rumayadi; Rahmi Zulhidiani

2016-01-01

The preference of farmer in tidal swamp on local rice varieties are quite high, but local varieties have a long life and low yield characters, so it needs to be improved for the trait. This study is part of activities of the local rice varieties improvement to generate promising lines were short-moderate aged, but the slimming and pera (high amylose content) grains maintained. The aims of this study were to determine the intra lines uniformity and the inter lines variation of M5 generation of rice mutant lines. The experiment was carried out in the Experimental Station of Agriculture Faculty, Lambung Mangkurat University from March to September 2014. The experiment used 150 earliest flowering lines of 300 M5 mutant lines that were planted. Intra lines uniformity were analysed by comparing the variance of each mutant lines with variance of its parent, while the variation among lines were analyzed by comparing the variance of all lines with variance of its parent. More than 85 % M5 mutant lines from Siam Harli as parent and > 79 % of Siam Kuatek as parent are uniform. The uniform character at all M5 mutant lines, both of Siam Harli or Siam Kuatek parent are the harvest age, the filled grains number, and the empty grains number. There is no variability between M5 mutant lines, but some of M5 mutant lines from Siam Harli and Siam Kuatek have some better characters than their parents, so there is an opportunity for selection. (author)

Albania, offshore subscribed, offering EOR opportunities

International Nuclear Information System (INIS)

Anon.

1992-01-01

This paper reports that Albania is starting a campaign to offer field development/enhanced recovery projects to foreign companies. The fields chosen for EOR projects and their producing lithologies are: Patos-Marinza, sandstone. Kucova-Arrza, sandstone. Gorisht-Kocul, limestone. Ballsh-Hekal, limestone. Cakran-Mollaj, limestone. Visoka, limestone. Delvina, limestone. Field locations mostly lie along Albania's Adriatic Sea coast. Oil production began in Albania in 1929, peaked at about 60,000 b/d in 1975 and has steadily fallen

Mjollnir Rotational Line Scan Diagnostics.

Science.gov (United States)

1981-05-19

using long cavity. M8 Removable Pellicle Beam Splitter for He-Ne Lineup Beam. Removed before HF or DF laser is turned on. 27 A 27 * A r of the chopper...three probe laser lines, however three lines were sequentially measured to verify the diagnostic equipment. Two of the three lines have been monitored

VT DSL Broadband Availability by Census Block - 06-2010

Data.gov (United States)

Vermont Center for Geographic Information — (Link to Metadata) The VTBB201006 VT Broadband Availability Dataset represents wireline and wireless 'broadband service' availability in VT as of 6/30/2010. This...

VT DSL Broadband Availability by Census Block - 06-2011

Data.gov (United States)

Vermont Center for Geographic Information — (Link to Metadata) The VTBB201106 VT Broadband Availability Dataset represents wireline and wireless 'broadband service' availability in VT as of 6/30/2011. This...

VT DSL Broadband Availability by Census Block - 06-2013

Data.gov (United States)

Vermont Center for Geographic Information — (Link to Metadata) The VTBB201306 VT Broadband Availability Dataset represents wireline and wireless 'broadband service' availability in VT as of 6/30/2013. This...

VT DSL Broadband Availability by Census Block - 12-2011

Data.gov (United States)

Vermont Center for Geographic Information — (Link to Metadata) The VTBB201112 VT Broadband Availability Dataset represents wireline and wireless 'broadband service' availability in VT as of 12/31/2011. This...

VT DSL Broadband Availability by Census Block - 12-2012

Data.gov (United States)

Vermont Center for Geographic Information — (Link to Metadata) The VTBB201212 VT Broadband Availability Dataset represents wireline and wireless 'broadband service' availability in VT as of 12/31/2012. This...

VT DSL Broadband Availability by Census Block - 12-2010

Data.gov (United States)

Vermont Center for Geographic Information — (Link to Metadata) The VTBB201012 VT Broadband Availability Dataset represents wireline and wireless 'broadband service' availability in VT as of 12/31/2010. This...

QSOs with narrow emission lines

International Nuclear Information System (INIS)

Baldwin, J.A.; Mcmahon, R.; Hazard, C.; Williams, R.E.

1988-01-01

Observations of two new high-redshift, narrow-lined QSOs (NLQSOs) are presented and discussed together with observations of similar objects reported in the literature. Gravitational lensing is ruled out as a possible means of amplifying the luminosity for one of these objects. It is found that the NLQSOs have broad bases on their emission lines as well as the prominent narrow cores which define this class. Thus, these are not pole-on QSOs. The FWHM of the emission lines fits onto the smoothly falling tail of the lower end of the line-width distribution for complete QSO samples. The equivalent widths of the combined broad and narrow components of the lines are normal for QSOs of the luminosity range under study. However, the NLQSOs do show ionization differences from broader-lined QSOs; most significant, the semiforbidden C III/C IV intensity ratio is unusually low. The N/C abundance ratio in these objects is found to be normal; the Al/C abundance ratio may be quite high. 38 references

Teaching Braille Line Tracking Using Stimulus Fading

Science.gov (United States)

Scheithauer, Mindy C.; Tiger, Jeffrey H.

2014-01-01

Line tracking is a prerequisite skill for braille literacy that involves moving one's finger horizontally across a line of braille text and identifying when a line ends so the reader may reset his or her finger on the subsequent line. Current procedures for teaching line tracking are incomplete, because they focus on tracking lines with only…

Overcoming challenges

Medline Plus

Full Text Available ... breastfeeding means to them. Subscribe To receive Breastfeeding email updates Enter email Submit Overcoming challenges Breastfeeding has a long list ... breastfeeding means to them. Subscribe To receive Breastfeeding email updates Enter email Submit All material contained on ...

Breastfeeding: Planning Ahead

Medline Plus

Full Text Available ... your life Partner resources Subscribe To receive Breastfeeding email updates Enter email Submit Planning ahead From choosing the crib to ... Breastfeeding: The #First31 Days Subscribe To receive Breastfeeding email updates Enter email Submit All material contained on ...

ISSN 2070-0083

African Journals Online (AJOL)

FIRST LADY

The GSM subscribers on their part also face many problems, major of which is ... The primary source includes questionnaire and personal interaction. The secondary source ... Consumer/Subscriber Complaints-Implication and Consequences. Keaveney ... customs unpredictable clearance process and bad network of roads.

Line ratios and wavelengths of helium-like argon n=2 satellite transitions and resonance lines

International Nuclear Information System (INIS)

Biedermann, C.; Radtke, R.; Fournier, K.

2003-01-01

The characteristic X-ray emission from helium-like argon was investigated as a mean to diagnose hot plasmas. We have measured the radiation from n=2-1 parent lines and from KLn dielectronic recombination satellites with high wavelength resolution as function of the excitation energy using the Berlin Electron Beam Ion Trap. Values of wavelength relative to the resonance and forbidden line are tabulated and compared with references. The line intensity observed over a wide range of excitation energies is weighted with a Maxwellian electron-energy distribution to analyze line ratios as function of plasma temperature. Line ratios (j+z)/w and k/w compare nicely with theoretical predictions and demonstrate their applicability as temperature diagnostic. The ratio z/(x+y) shows not to depend on the electron density

LED-Based High-Voltage Lines Warning System

Directory of Open Access Journals (Sweden)

Eldar MUSA

2013-04-01

Full Text Available LED-based system, running with the current of high-voltage lines and converting the current flowing through the line into the light by using a toroid transformer, has been developed. The transformer’s primary winding is constituted by the high voltage power line. Toroidal core consists of two equal parts and the secondary windings are evenly placed on these two parts. The system is mounted on the high-voltage lines as a clamp. The secondary winding ends are connected in series by the connector on the clamp. LEDs are supplied by the voltage at the ends of secondary. Current flowing through highvoltage transmission lines is converted to voltage by the toroidal transformer and the light emitting LEDs are supplied with this voltage. The theory of the conversion of the current flowing through the line into the light is given. The system, running with the current of the line and converting the current into the light, has been developed. System has many application areas such as warning high voltage lines (warning winches to not hinder the high-voltage lines when working under the lines, warning planes to not touch the high-voltage lines, remote measurement of high-voltage line currents, and local illumination of the line area

Effect of splitting a mixed-model line on shortening the line length under open- and closed-boundary working area settings

Science.gov (United States)

Zhang, Donghao; Matsuura, Haruki; Asada, Akiko

2017-04-01

Some automobile factories have segmented mixed-model production lines into shorter sub-lines according to part group, such as engine, trim, and powertrain. The effects of splitting a line into sub-lines have been reported from the standpoints of worker motivation, productivity improvement, and autonomy based on risk spreading. There has been no mention of the possibility of shortening the line length by altering the product sequence using sub-lines. The purpose of the present paper is to determine the conditions under which sub-lines reduce the line length and the degree to which the line length may be shortened. The line lengths for a non-split line and a line that has been split into sub-lines are compared using three methods for determining the working area, the standard closed boundary, the optimized open boundary, and real-life constant-length stations. The results are discussed by analyzing the upper and lower bounds of the line length. Based on these results, a procedure for deciding whether or not to split a production line is proposed.

India's Unfinished Telecom Tasks

Indian Academy of Sciences (India)

India's Telecom Story is now well known · Indian Operators become an enviable force · At the same time · India Amongst the Leaders · Unfinished Tasks as Operators · LightGSM ON: Innovation for Rural Area from Midas · Broadband Access Options for India · Broadband driven by DSL: still too slow · Is Wireless the answer?

Development of Elite BPH-Resistant Wide-Spectrum Restorer Lines for Three and Two Line Hybrid Rice.

Science.gov (United States)

Fan, Fengfeng; Li, Nengwu; Chen, Yunping; Liu, Xingdan; Sun, Heng; Wang, Jie; He, Guangcun; Zhu, Yingguo; Li, Shaoqing

2017-01-01

Hybrid rice has contributed significantly to the world food security. Breeding of elite high-yield, strong-resistant broad-spectrum restorer line is an important strategy for hybrid rice in commercial breeding programs. Here, we developed three elite brown planthopper (BPH)-resistant wide-spectrum restorer lines by pyramiding big-panicle gene Gn8.1 , BPH-resistant genes Bph6 and Bph9 , fertility restorer genes Rf3, Rf4, Rf5 , and Rf6 through molecular marker assisted selection. Resistance analysis revealed that the newly developed restorer lines showed stronger BPH-resistance than any of the single-gene donor parent Luoyang-6 and Luoyang-9. Moreover, the three new restorer lines had broad spectrum recovery capabilities for Honglian CMS, Wild abortive CMS and two-line GMS sterile lines, and higher grain yields than that of the recurrent parent 9,311 under nature field conditions. Importantly, the hybrid crosses also showed good performance for grain yield and BPH-resistance. Thus, the development of elite BPH-resistant wide-spectrum restorer lines has a promising future for breeding of broad spectrum BPH-resistant high-yield varieties.

Cluster Analysis of Maize Inbred Lines

Directory of Open Access Journals (Sweden)

Jiban Shrestha

2016-12-01

Full Text Available The determination of diversity among inbred lines is important for heterosis breeding. Sixty maize inbred lines were evaluated for their eight agro morphological traits during winter season of 2011 to analyze their genetic diversity. Clustering was done by average linkage method. The inbred lines were grouped into six clusters. Inbred lines grouped into Clusters II had taller plants with maximum number of leaves. The cluster III was characterized with shorter plants with minimum number of leaves. The inbred lines categorized into cluster V had early flowering whereas the group into cluster VI had late flowering time. The inbred lines grouped into the cluster III were characterized by higher value of anthesis silking interval (ASI and those of cluster VI had lower value of ASI. These results showed that the inbred lines having widely divergent clusters can be utilized in hybrid breeding programme.

Authentication of M14 melanoma cell line proves misidentification of MDA‐MB‐435 breast cancer cell line

Science.gov (United States)

Korch, Christopher; Hall, Erin M.; Dirks, Wilhelm G.; Ewing, Margaret; Faries, Mark; Varella‐Garcia, Marileila; Robinson, Steven; Storts, Douglas; Turner, Jacqueline A.; Wang, Ying; Burnett, Edward C.; Healy, Lyn; Kniss, Douglas; Neve, Richard M.; Nims, Raymond W.; Reid, Yvonne A.; Robinson, William A.

2017-01-01

A variety of analytical approaches have indicated that melanoma cell line UCLA‐SO‐M14 (M14) and breast carcinoma cell line MDA‐MB‐435 originate from a common donor. This indicates that at some point in the past, one of these cell lines became misidentified, meaning that it ceased to correspond to the reported donor and instead became falsely identified (through cross‐contamination or other means) as a cell line from a different donor. Initial studies concluded that MDA‐MB‐435 was the misidentified cell line and M14 was the authentic cell line, although contradictory evidence has been published, resulting in further confusion. To address this question, we obtained early samples of the melanoma cell line (M14), a lymphoblastoid cell line from the same donor (ML14), and donor serum preserved at the originator's institution. M14 samples were cryopreserved in December 1975, before MDA‐MB‐435 cells were established in culture. Through a series of molecular characterizations, including short tandem repeat (STR) profiling and cytogenetic analysis, we demonstrated that later samples of M14 and MDA‐MB‐435 correspond to samples of M14 frozen in 1975, to the lymphoblastoid cell line ML14, and to the melanoma donor's STR profile, sex and blood type. This work demonstrates conclusively that M14 is the authentic cell line and MDA‐MB‐435 is misidentified. With clear provenance information and authentication testing of early samples, it is possible to resolve debates regarding the origins of problematic cell lines that are widely used in cancer research. PMID:28940260

Line lessons: Enbridge's Northern Line provides valuable information

Energy Technology Data Exchange (ETDEWEB)

Ross, E.

2000-02-01

Experiences gained from the 14-year old Norman Wells crude oil pipeline in the Northwest Territories may provide operators with valuable insights in natural gas pipeline developments in northern Canada. The Norman Wells line is the first and only long-distance pipeline in North America buried in permafrost and has proven to be a veritable laboratory on pipeline behaviour in extremely cold climates which also happen to be discontinuous at the same time. The line was built by Enbridge with a 'limit state' design, i e. it was built to move within the permafrost within certain limits, the amount of movement depending upon the area in which the line was built. This technology, which is still cutting edge, allows the pipeline to react to the freeze-thaw cycle without being affected by the heaving and resettling. The knowledge gained from the Norman Wells Line has come in very useful in the more recent AltaGas Services project transporting natural gas from a nearby well into the the town of Inuvik. Enbridge also contributed to the development of various pipeline inspection tools such as the 'Geopig' which travels within the pipeline and can pinpoint the location of problems practically within a matter of inches, and the 'Rolligon' an amphibious vehicle with five-foot diameter rubber tires that displaces only two pounds per square inch, leaving barely a track as it travels along the right-of-way during times other than winter.

Line width and line shape analysis in the inductively coupled plasma by high resolution Fourier transform spectrometry

International Nuclear Information System (INIS)

Faires, L.M.; Palmer, B.A.; Brault, J.W.

1984-01-01

High resolution Fourier transform spectrometry has been used to perform line width and line shape analysis of eighty-one iron I emision lines in the spectral range 290 to 390nm originating in the normal analytical zone of an inductively coupled plasma. Computer programs using non-linear least squares fitting techniques for line shape analysis were applied to the fully resolved spectra to determine Gaussian and Lorentzian components of the total observed line width. The effect of noise in the spectrum on the precision of the line fitting technique was assessed, and the importance of signal to noise ratio for line shape analysis is discussed. Translational (Doppler) temperatures were calculated from the Gaussian components of the line width and were found to be on the order of 6300 0 K. The excitation temperature of iron I was also determined from the same spectral data by the spectroscopic slope method based on the Einstein-Boltzmann expression for spectral intensity and was found to be on the order of 4700 0 K. 31 references

Nuclear gamma ray lines from supernovae

International Nuclear Information System (INIS)

Jardim, J.O.D.

1980-01-01

From theoretical considerations of the behaviour of gamma ray line fluxes occurring after a supernova explosion, the 1.156 and 0.847 MeV lines are seen to be the most likely to be observed. The 1.156 MeV line has been previously observed by other investigators. Observations of the 0.847 MeV line, and 1.332, 1.173 and 0.059 MeV lines using a Ge(Li) telescope aboard a stratospheric balloon which was flown in Brazil in 1977 are reported. The observation using a NaI(Tl) detector of a line in the energy interval 1.5 - 1.6 MeV, which may be due to 0 18 (p,p') 0 18 sup (*) reaction is also reported. (Author) [pt

Line profile variations in selected Seyfert galaxies

International Nuclear Information System (INIS)

Kollatschny, W; Zetzl, M; Ulbrich, K

2010-01-01

Continua as well as the broad emission lines in Seyfert 1 galaxies vary in different galaxies with different amplitudes on typical timescales of days to years. We present the results of two independent variability campaigns taken with the Hobby-Eberly Telescope. We studied in detail the integrated line and continuum variations in the optical spectra of the narrow-line Seyfert galaxy Mrk 110 and the very broad-line Seyfert galaxy Mrk 926. The broad-line emitting region in Mrk 110 has radii of four to 33 light-days as a function of the ionization degree of the emission lines. The line-profile variations are matched by Keplerian disk models with some accretion disk wind. The broad-line region in Mrk 926 is very small showing an extension of two to three light-days only. We could detect a structure in the rms line-profiles as well as in the response of the line profile segments of Mrk 926 indicating the BLR is structured.

47 CFR 36.2 - Fundamental principles underlying procedures.

Science.gov (United States)

2010-10-01

... trunk transmission equipment. Within the exchange classification there are four board types of plant, i.e., operator systems, switching plant, truck equipment and subscriber plant. Subscriber plant... PROPERTY COSTS, REVENUES, EXPENSES, TAXES AND RESERVES FOR TELECOMMUNICATIONS COMPANIES 1 General § 36.2...

Second-Line Therapy for Advanced NSCLC.

Science.gov (United States)

Weiss, Jared M; Stinchcombe, Thomas E

2013-01-01

Most patients with lung cancer have non-small cell lung cancer (NSCLC) subtype and have advanced disease at the time of diagnosis. Improvements in both first-line and subsequent therapies are allowing longer survival and enhanced quality of life for these patients. The median overall survival observed in many second-line trials is approximately 9 months, and many patients receive further therapy after second-line therapy. The cytotoxic agents pemetrexed and docetaxel and the epidermal growth factor receptor (EGFR) tyrosine kinase inhibitors (TKIs) erlotinib and gefitinib are standard second-line therapies. For patients with EGFR mutation, a TKI is the favored second-line therapy if not already used in first-line therapy. For patients without the EGFR mutation, TKIs are an option, but many oncologists favor cytotoxic therapy. The inhibitor of the EML4/ALK fusion protein, crizotinib, has recently become a standard second-line treatment for patients with the gene rearrangement and has promise for patients with the ROS1 rearrangement.

PIXE analysis of U and Pu from hot particles: K-lines vs L-lines

DEFF Research Database (Denmark)

Jiménez-Ramos, M.C.; García López, J.; Eriksson, M.

2012-01-01

. (2007) [1] and Jiménez-Ramos et al. (2010) [2], radioactive particles from aircraft accidents in Palomares and Thule have been characterized. Using micro-Proton Induced X-ray Emission (μ-PIXE) and confocal X-ray fluorescence microprobe (μ-XRF), the L-lines of the main components in these particles, U......-lines present not overlapping between the main peaks in the spectra and the X-ray absorption in the sample is much lower than for L-lines....

Transmission Line Security Monitor: Final Report

Energy Technology Data Exchange (ETDEWEB)

John Svoboda

2011-04-01

The Electric Power Transmission Line Security Monitor System Operational Test is a project funded by the Technical Support Working Group (TSWG). TSWG operates under the Combating Terrorism Technical Support Office that functions under the Department of Defense. The Transmission Line Security Monitor System is based on technology developed by Idaho National Laboratory. The technology provides a means for real-time monitoring of physical threats and/or damage to electrical transmission line towers and conductors as well as providing operational parameters to transmission line operators to optimize transmission line operation. The end use is for monitoring long stretches of transmission lines that deliver electrical power from remote generating stations to cities and industry. These transmission lines are generally located in remote transmission line corridors where security infrastructure may not exist. Security and operational sensors in the sensor platform on the conductors take power from the transmission line and relay security and operational information to operations personnel hundreds of miles away without relying on existing infrastructure. Initiated on May 25, 2007, this project resulted in pre-production units tested in realistic operational environments during 2010. A technology licensee, Lindsey Manufacturing of Azusa California, is assisting in design, testing, and ultimately production. The platform was originally designed for a security monitoring mission, but it has been enhanced to include important operational features desired by electrical utilities.

Reduction of the visual impact of overhead transmission line systems through utilisation of line surge arresters as lightning protection

DEFF Research Database (Denmark)

Sørensen, Thomas Kjærsgaard; Holbøll, Joachim

2008-01-01

with the Technical University of Denmark, on how to lessen the visual impact of 400 kV overhead line transmission systems. In this paper omission of shield wires combined with installation of a suitable number of line surge arresters is investigated as a possible alternative to transmission lines equipped...... with shielding wires thereby reducing tower height, allowing more compact designs of towers thus minimizing the visual environment impact of the lines. Omission of shield wires in the system and instead utilizing a larger number of surge arresters in the (upper) phases of an overhead line without reduction...... will be investigated by transient simulations on a 400 kV line with either shield wires or line surge arresters. These simulations will also be used to estimate number and location of the line surge arresters in the line to ensure a satisfactory performance of the line when omitting shield wires in the tower top...

Transmission of radioiodine through sampling lines

International Nuclear Information System (INIS)

Unrein, P.J.; Pelletier, C.A.; Cline, J.E.; Voilleque, P.G.

1985-01-01

An experimental program to measure radioiodine transmission through sampling lines is described. The transmission depends upon both deposition on and resuspension from the walls of the line. The deposition and resuspension processes are themselves controlled by the length, diameter, and material of the line and the conditions under which it is operated. The operating conditions under study are sampling flow rate, temperature and relative humidity. Measurement results have been interpreted in terms of a four-compartment model of radioiodine deposition and resuspension. The model is applied to each of twenty or more segments of the line. Experimental measurements of short-term transmission fractions and the deposition velocities derived from them are presented for six lines. Data on resuspension rates for the same lines were obtained and are also discussed

DETECTION OF REST-FRAME OPTICAL LINES FROM X-SHOOTER SPECTROSCOPY OF WEAK EMISSION-LINE QUASARS

International Nuclear Information System (INIS)

Plotkin, Richard M.; Gallo, Elena; Shemmer, Ohad; Trakhtenbrot, Benny; Anderson, Scott F.; Brandt, W. N.; Luo, Bin; Schneider, Donald P.; Fan, Xiaohui; Lira, Paulina; Richards, Gordon T.; Strauss, Michael A.; Wu, Jianfeng

2015-01-01

Over the past 15 yr, examples of exotic radio-quiet quasars with intrinsically weak or absent broad emission line regions (BELRs) have emerged from large-scale spectroscopic sky surveys. Here, we present spectroscopy of seven such weak emission line quasars (WLQs) at moderate redshifts (z = 1.4–1.7) using the X-shooter spectrograph, which provides simultaneous optical and near-infrared spectroscopy covering the rest-frame ultraviolet (UV) through optical. These new observations effectively double the number of WLQs with spectroscopy in the optical rest-frame, and they allow us to compare the strengths of (weak) high-ionization emission lines (e.g., C iv) to low-ionization lines (e.g., Mg ii, Hβ, Hα) in individual objects. We detect broad Hβ and Hα emission in all objects, and these lines are generally toward the weaker end of the distribution expected for typical quasars (e.g., Hβ has rest-frame equivalent widths ranging from 15–40 Å). However, these low-ionization lines are not exceptionally weak, as is the case for high-ionization lines in WLQs. The X-shooter spectra also display relatively strong optical Fe ii emission, Hβ FWHM ≲ 4000 km s −1 , and significant C iv blueshifts (≈1000–5500 km s −1 ) relative to the systemic redshift; two spectra also show elevated UV Fe ii emission, and an outflowing component to their (weak) Mg ii emission lines. These properties suggest that WLQs are exotic versions of “wind-dominated” quasars. Their BELRs either have unusual high-ionization components, or their BELRs are in an atypical photoionization state because of an unusually soft continuum

Spectral Line Shapes. Proceedings

International Nuclear Information System (INIS)

Zoppi, M.; Ulivi, L.

1997-01-01

These proceedings represent papers presented at the 13th International Conference on Spectral Line Shapes which was held in Firenze,Italy from June 16-21, 1996. The topics covered a wide range of subjects emphasizing the physical processes associated with the formation of line profiles: high and low density plasma; atoms and molecules in strong laser fields, Dopple-free and ultra-fine spectroscopy; the line shapes generated by the interaction of neutrals, atoms and molecules, where the relavant quantities are single particle properties, and the interaction-induced spectroscopy. There were 131 papers presented at the conference, out of these, 6 have been abstracted for the Energy Science and Technology database

Database of emission lines

Science.gov (United States)

Binette, L.; Ortiz, P.; Joguet, B.; Rola, C.

1998-11-01

A widely accessible data bank (available through Netscape) and consiting of all (or most) of the emission lines reported in the litterature is being built. It will comprise objects as diverse as HII regions, PN, AGN, HHO. One of its use will be to define/refine existing diagnostic emission line diagrams.

APOBEC3DE Inhibits LINE-1 Retrotransposition by Interacting with ORF1p and Influencing LINE Reverse Transcriptase Activity.

Directory of Open Access Journals (Sweden)

Weizi Liang

Full Text Available Human long interspersed elements 1 (LINE-1 or L1 is the only autonomous non-LTR retroelement in humans and has been associated with genome instability, inherited genetic diseases, and the development of cancer. Certain human APOBEC3 family proteins are known to have LINE-1 restriction activity. The mechanisms by which APOBEC3 affects LINE-1 retrotransposition are not all well characterized; here, we confirm that both A3B and A3DE have a strong ability to inhibit LINE-1 retrotransposition. A3DE interacts with LINE-1 ORF1p to target LINE-1 ribonucleoprotein particles in an RNA-dependent manner. Moreover, A3DE binds to LINE-1 RNA and ORF1 protein in cell culture system. Fluorescence microscopy demonstrated that A3DE co-localizes with ORF1p in cytoplasm. Furthermore, A3DE inhibits LINE-1 reverse transcriptase activity in LINE-1 ribonucleoprotein particles in a cytidine deaminase-independent manner. In contrast, A3B has less inhibitory effects on LINE-1 reverse transcriptase activity despite its strong inhibition of LINE-1 retrotransposition. This study demonstrates that different A3 proteins have been evolved to inhibit LINE-1 activity through distinct mechanisms.

Building Bridges One Line at a Time

Science.gov (United States)

Grigsby, Cathy Murray

2012-01-01

In this article, first-grade students were taught the different kinds of lines that were part of the construction of various bridges--the curved lines of the arches of stone bridges, straight lines connecting the cables of a suspension bridge, vertical lines, horizontal lines, and so on. They gained practice in drawing structures and in fine brush…

The division of labor among egalitarian and traditional women : Differences in discontent, social comparison, and false consensus

NARCIS (Netherlands)

Buunk, Abraham (Bram); Kluwer, Esther; Schuurman, M.K; Siero, F.W.

We compared 118 egalitarian women (subscribers to the Dutch feminist magazine Opzij) with 118 traditional women (subscribers to the widely read Dutch women's magazine Margriet). On average, egalitarian women had a more equal division of household labor at home than did traditional women but

77 FR 21125 - Self-Regulatory Organizations; The NASDAQ Stock Market LLC; Notice of Filing and Immediate...

Science.gov (United States)

2012-04-09

... firms leveraging powerful servers running sophisticated algorithms and consuming massive quantities of..., delivered, and executed by firm servers using non-displayed data. Non-Display Usage is used not only for... Professional and Non-Professional Subscribers, offering lower fees to Non-Professional Subscribers in order to...

Along the line

DEFF Research Database (Denmark)

Dinesen, Cort Ross

2011-01-01

Embarking on a work of art constitutes a reduction of information – because we grasp the diversity and plurality of the manifestations we encounter by abstracting them and transforming them into manageable concepts; as we do when we draw contour lines on the landscape – they are imaginary...... and invisible but an abstraction essential for noting a difference or marking a place on a map. In the same way, a stroke in a sketch or a line in the sand is a manifestation of our ability to draw a boundary that both includes and excludes information. Where the line makes the birth of an idea visible......, it expresses through movement our tendency to mark a difference by drawing attention to and enclosing a whole series of relations that confront our preconceived notions. It is in the process of transformation in which we reduce the complexity of how we work, and rethink our ideas anew by refining the very same...

Program of telluric lines monitoring

Directory of Open Access Journals (Sweden)

Vince I.

2006-01-01

Full Text Available A new observational program of telluric lines monitoring was introduced at Belgrade Astronomical Observatory. The ultimate goal of this program is to investigate the properties of Earth’s atmosphere through modeling the observed profiles of telluric lines. The program is intend to observe infrared molecular oxygen lines that were selected according to spectral sensitivity of the available CCD camera. In this paper we give the initial and the final selection criteria for spectral lines included in the program the description of equipment and procedures used for observations and reduction, a review of preliminary observational results with the estimated precision, and a short discussion on the comparison of the theoretical predictions and the measurements.

[The smile line, a literature search].

Science.gov (United States)

van der Geld, P A; van Waas, M A

2003-09-01

Beautiful teeth, visible when smiling, are in line with the present ideal of beauty. The display of teeth when smiling is determined by the smile line: the projection of the lower border of the upper lip on the maxillary teeth when smiling. On the basis of a literature search the determining methods of the smile line are discussed, demographic data of the position of the smile line are given, and factors of influence are examined. There is no unequivocal method for determining the position of the smile line. A rough distinction can be made between qualitative and (semi)-quantitative methods. The (semi)-quantitative methods have clear advantages for research purposes, but their reliability is unknown. It was demonstrated that among minimally 40% of subjects the maxillary gingiva was not visible when smiling. The mandibular gingiva was not visible when smiling among more than 90% of subjects. Furthermore, it appeared that among women the smile line was on average higher situated than among men and that it has not yet been proven that the smile line will be situated lower when growing older.

Bandwidth provisioning in infrastructure-based wireless networks employing directional antennas

Energy Technology Data Exchange (ETDEWEB)

Hasiviswanthan, Shiva [Los Alamos National Laboratory; Zhao, Bo [PENN STATE UNIV.; Vasudevan, Sudarshan [UNIV OF MASS AMHERST; Yrgaonkar, Bhuvan [PENN STATE UNIV.

2009-01-01

Motivated by the widespread proliferation of wireless networks employing directional antennas, we study the problem of provisioning bandwidth in such networks. Given a set of subscribers and one or more access points possessing directional antennas, we formalize the problem of orienting these antennas in two fundamental settings: (1) subscriber-centric, where the objective is to fairly allocate bandwidth among the subscribers and (2) provider-centric, where the objective is to maximize the revenue generated by satisfying the bandwidth requirements of subscribers. For both the problems, we first design algorithms for a network with only one access point working under the assumption that the number of antennas does not exceed the number of noninterfering channels. Using the well-regarded lexicographic max-min fair allocation as the objective for a subscriber-centric network, we present an optimum dynamic programming algorithm. For a provider-centric network, the allocation problem turns out to be NP-hard. We present a greedy heuristic based algorithm that guarantees almost half of the optimum revenue. We later enhance both these algorithms to operate in more general networks with multiple access points and no restrictions on the relative numbers of antennas and channels. A simulation-based evaluation using OPNET demonstrates the efficacy of our approaches and provides us further in insights into these problems.

A specialized bioengineering ion beam line

International Nuclear Information System (INIS)

Yu, L.D.; Sangyuenyongpipat, S.; Sriprom, C.; Thongleurm, C.; Suwanksum, R.; Tondee, N.; Prakrajang, K.; Vilaithong, T.; Brown, I.G.; Wiedemann, H.

2007-01-01

A specialized bioengineering ion beam line has recently been completed at Chiang Mai University to meet rapidly growing needs of research and application development in low-energy ion beam biotechnology. This beam line possesses special features: vertical main beam line, low-energy (30 keV) ion beams, double swerve of the beam, a fast pumped target chamber, and an in-situ atomic force microscope (AFM) system chamber. The whole beam line is situated in a bioclean environment, occupying two stories. The quality of the ion beam has been studied. It has proved that this beam line has significantly contributed to our research work on low-energy ion beam biotechnology

Illustrative Line Styles for Flow Visualization

NARCIS (Netherlands)

Everts, Maarten H.; Bekker, Hendrik; Roerdink, Jos B. T. M.; Isenberg, Tobias

2011-01-01

We present a flexible illustrative line style model for the visualization of streamline data. Our model partitions view-oriented line strips into parallel bands whose basic visual properties can be controlled independently. We thus extend previous line stylization techniques specifically for

Flow Visualization using Illustrative Line Styles

NARCIS (Netherlands)

Everts, Maarten H.; Bekker, Hendrik; Roerdink, Jos B. T. M.; Isenberg, Tobias; Bekker, Paulus

2011-01-01

We present a flexible illustrative line style model for the visualization of streamline data. Our model partitions view- oriented line strips into parallel bands whose basic visual properties can be controlled independently. We thus extend previous line stylization techniques specifically for

Computer-based mechanical design of overhead lines

Science.gov (United States)

Rusinaru, D.; Bratu, C.; Dinu, R. C.; Manescu, L. G.

2016-02-01

Beside the performance, the safety level according to the actual standards is a compulsory condition for distribution grids’ operation. Some of the measures leading to improvement of the overhead lines reliability ask for installations’ modernization. The constraints imposed to the new lines components refer to the technical aspects as thermal stress or voltage drop, and look for economic efficiency, too. The mechanical sizing of the overhead lines is after all an optimization problem. More precisely, the task in designing of the overhead line profile is to size poles, cross-arms and stays and locate poles along a line route so that the total costs of the line's structure to be minimized and the technical and safety constraints to be fulfilled.The authors present in this paper an application for the Computer-Based Mechanical Design of the Overhead Lines and the features of the corresponding Visual Basic program, adjusted to the distribution lines. The constraints of the optimization problem are adjusted to the existing weather and loading conditions of Romania. The outputs of the software application for mechanical design of overhead lines are: the list of components chosen for the line: poles, cross-arms, stays; the list of conductor tension and forces for each pole, cross-arm and stay for different weather conditions; the line profile drawings.The main features of the mechanical overhead lines design software are interactivity, local optimization function and high-level user-interface

Veterans Crisis Line: 1-800-273-8255

Science.gov (United States)

Veterans Crisis Line Skip to Main Content SuicidePreventionLifeline.org Get Help Materials Get Involved Crisis Centers About Be There ... Line FAQs Veteran Suicide Welcome to the Veterans Crisis Line Website The Veterans Crisis Line connects Veterans ...

Reddening and He i{sup ∗} λ 10830 Absorption Lines in Three Narrow-line Seyfert 1 Galaxies

Energy Technology Data Exchange (ETDEWEB)

Zhang, Shaohua; Zhou, Hongyan; Shi, Xiheng; Pan, Xiang; Ji, Tuo; Jiang, Peng; Wang, Shufen [Polar Research Institute of China, 451 Jinqiao Road, Shanghai, 200136 (China); Liu, Wenjuan [Key Laboratory for the Structure and Evolution of Celestial Objects, Yunnan Observatories, Chinese Academy of Sciences, Kunming, Yunnan 650011 (China); Jiang, Ning, E-mail: zhangshaohua@pric.org.cn, E-mail: zhouhongyan@pric.org.cn [Key Laboratory for Researches in Galaxies and Cosmology, Department of Astronomy, University of Sciences and Technology of China, Chinese Academy of Sciences, Hefei, Anhui, 230026 (China)

2017-08-20

We report the detection of heavy reddening and the He i* λ 10830 absorption lines at the active galactic nucleus (AGN) redshift in three narrow-line Seyfert 1 galaxies: SDSS J091848.61+211717.0, SDSS J111354.66+124439.0, and SDSS J122749.13+321458.9. They exhibit very red optical to near-infrared colors, narrow Balmer/Paschen broad emission lines and He i* λ 10830 absorption lines. The ultraviolet-optical-infrared nucleus continua are reddened by the SMC extinction law of E ( B − V ) ∼ 0.74, 1.17, and 1.24 mag for three objects, which are highly consistent with the values obtained from the broad-line Balmer decrements, but larger than those of narrow emission lines. The reddening analysis suggests that the extinction dust simultaneously obscures the accretion disk, the broad emission-line region, and the hot dust from the inner edge of the torus. It is possible that the dust obscuring the AGN structures is the dusty torus itself. Furthermore, the Cloudy analysis of the He i* λ 10830 absorption lines proposes the distance of the absorption materials to be the extend scale of the torus, which greatly increases probabilities of the obscure and absorption materials being the dusty torus.

Magnetic pulse sharpener and delay-line

International Nuclear Information System (INIS)

Li Jin; Dai Guangsen; Xia Liansheng

2002-01-01

This paper describes a method to achieve short rise time pulse which has been delayed with a delay-line and magnetic pulse sharpener. A delay-line and two shock-lines are designed to carry pulsed signal with a maximum voltage magnitude up to 80 kV. A pulse of High voltage with arise time of 48 ns at a level of 0.1%-0.9% were achieved, and the attenuation in the line is very small

Research on Line Patrol Strategy of 110kV Transmission Line after Lightning Strike

Directory of Open Access Journals (Sweden)

Li Mingjun

2016-01-01

Full Text Available Lightning faults occupy in the majority of instantaneous fault and reclosing can usually be successful, so power supply can be restored without immediate patrol in many cases. Firstly, this paper introduces the lightning fault positioning and identifying method. Then test electrical performance of insulators after lightning strike from 110kV lines. Data shows that lightning strike has little effect on the electric performance of insulator. Finally, illustrating disposal process of the 110 kV transmission line after lightning fault, certifying that the power supply reliability be ensured without line patrol.

Your Lung Operation: After Your Operation

Medline Plus

Full Text Available ... Test Login SRGS Online Login Subscribe to SRGS Issues Contact and FAQs ACS Case Reviews in Surgery ACS Case Reviews in Surgery ACS Case Reviews in Surgery Subscribe ACS Case Reviews Login CME Test Login Author Instructions Sample Article Chapter Competition Contact Resources in ...

Ostomy Home Skills Program

Medline Plus

Full Text Available ... Test Login SRGS Online Login Subscribe to SRGS Issues Contact and FAQs ACS Case Reviews in Surgery ACS Case Reviews in Surgery ACS Case Reviews in Surgery Subscribe ACS Case Reviews Login CME Test Login Author Instructions Sample Article Chapter Competition Contact Resources in ...

Federal Communications Commission Semiannual Regulatory Agenda

Science.gov (United States)

2010-12-20

... Telecommunications Act of 1996 (CC Docket Nos. 96-146, 93-22)......... 498 Implementation of the Subscriber Selection... Regarding AM Radio Service 3060-AJ17 Directional Antenna Performance Verification (MM Docket No. 93-177) 545... 498. IMPLEMENTATION OF THE SUBSCRIBER SELECTION CHANGES PROVISION OF THE TELECOMMUNICATIONS ACT OF...

47 CFR 73.642 - Subscription TV service.

Science.gov (United States)

2010-10-01

... expressed or implied, that: (1) Prevents or hinders it from rejecting or refusing any subscription TV..., service may be terminated. (ii) Charges, terms and conditions of service to subscribers must be applied... impositions of different sets of terms and conditions may be applied to subscribers in different...

Infrared line intensities of chlorine monoxide

Science.gov (United States)

Kostiuk, T.; Faris, J. L.; Mumma, M. J.; Deming, D.; Hillman, J. J.

1986-01-01

Absolute infrared line intensities of several ClO lines in the rotational-vibrational (1-0) band were measured using infrared heterodyne spectroscopy near 12 microns. A measurement technique using combined ultraviolet absorption and infrared line measurements near 9.5 microns and 12 microns permitted an accurate determination of the column densities of O3 and ClO in the absorption cell and thus improved ClO line intensities. Results indicate ClO line and band intensities approximately 2.4 times lower than previous experimental results. Effects of possible failure of local thermodynamic equilibrium conditions in the absorption cell and the implication of the results for stratospheric ClO measurements in the infrared are discussed.

Plasma line observations in the auroral oval

International Nuclear Information System (INIS)

Valladares, C.E.; Kelley, M.C.; Vickrey, J.F.

1988-01-01

We report here a series of experiments conducted at the Sondre Stromfjord incoherent scatter radar, aimed at detected enhanced plasma lines associated with midnight sector auroral arcs. Using different receivers, we detected both ion and plasma lines simultaneously. The plasma line signal was recorded with the use of a filter bank of eight frequencies. Plasma lines were found to originate mainly from the topside of the particle-produced E layer. The enhanced plasma lines are sometimes a factor of 100 times larger than the thermal level. Our data show a rapid decay of the plasma lines, however. In some cases, only a 30-s integration time was needed in order to unambiguously detect both upshifted and downshifted lines. The level of the plasma lines reaches values of, for the larger cases, up to 40 0 K above the noise temperature. These are considerably higher than results from prior auroral zone plasma line experiments. In situ observations of enhanced plasma waves in this same region are reported in a companion paper. copyright American Geophysical Union 1988

Asymmetries of the solar Ca II lines

International Nuclear Information System (INIS)

Heasley, J.N.

1975-01-01

A theoretical study of the influence of propagating acoustic pulses in the solar chromosphere upon the line profiles of the Ca II resonance and infrared triplet lines has been made. The major objective has been to explain the observed asymmetries seen in the cores of the H and K lines and to predict the temporal behavior of the infrared lines caused by passing acoustic or shock pulses. The velocities in the pulses, calculated from weak shock theory, have been included consistently in the non-LTE calculations. The results of the calculations show that these lines are very sensitive to perturbations in the background atmosphere caused by the pulses. Only minor changes in the line shapes result from including the velocities consistently in the line source function calculations. The qualitative changes in the line profiles vary markedly with the strength of the shock pulses. The observed differences in the K line profiles seen on the quiet Sun can be explained in terms of a spectrum of pulses with different wavelengths and initial amplitudes in the photosphere. (Auth.)

The determinants of private medical insurance prevalence in England, 1997-2000.

Science.gov (United States)

King, Derek; Mossialos, Elias

2005-02-01

The aim of this paper is to identify the factors that determine the prevalence of private medical insurance (PMI) in England. Secondary data sources are the British Household Panel Survey (BHPS) 1997-2000, Laing's Healthcare Market Review 1999-2000, the United Kingdom (U.K.) Department of Health's National Health Service Waiting Times Team, and the Work Force Statistics Branch of the Department of Health. Logistic regression models for panel data were used to compare non-PMI subscribers with individual subscribers and those with employer-provided PMI. The BHPS data are collected by the Institute for Social and Economic Research at the University of Essex. Other data used were collected by Laing and Buisson and the U.K. Department of Health. Individual PMI is more prevalent among the well-educated and healthy. Income, age, sex, and political preference are key determinants of PMI prevalence for both individual and employer paid PMI. Individuals are also likely to reflect on information with regard to waiting times in deciding whether or not to purchase PMI cover. The withdrawal of the tax subsidy in 1997 to PMI subscribers over 60 years of age did not impact on their rate of withdrawal from PMI coverage relative to the rate among all PMI subscribers, but may have discouraged potential new subscribers. Current trends in the PMI market suggest that, over time, individually purchased PMI is likely to be partially displaced by PMI purchased as part of a company-based plan. However, having PMI is linked to economic factors in both groups, suggesting a similar segment of the population valuing the responsiveness that PMI provides. Geographic factors relating to waiting times and supply-side factors are associated with both individual and company-based PMI. The withdrawal of the tax subsidy to individual subscribers older than age of 60 resulted in a significant decline in the demand for PMI. In particular, the number of new subscribers in this group declined substantially.

Simultaneous influence of Stark effect and excessive line broadening on the Hα line

Science.gov (United States)

Cvetanović, Nikola; Ivković, Saša S.; Obradović, Bratislav M.; Kuraica, Milorad M.

2017-12-01

The aim of this paper is to study the combined influence of the Stark effect and the excessive Doppler broadening on the Balmer alpha line in hydrogen discharges. Since this line is a good candidate for measuring electric field in various types of discharges with different gas compositions, a simple method for field measurement based on polarization spectroscopy is developed, that includes all the excitation mechanisms. To simultaneously test the flexibility of the fitting procedure and investigate the excessive broadening, we applied the fitting procedure on line profiles obtained at a range of conditions from two different discharges. The range of pressures and voltages was examined in an abnormal glow and in dielectric barrier discharge operating with hydrogen gas. The model fitting function was able to respond and follow the change in the line profile caused by the change of conditions. This procedure can therefore be recommended for electric field measurement. Contribution to the "Topical Issue: Physics of Ionized Gases (SPIG 2016)", edited by Goran Poparic, Bratislav Obradovic, Dragana Maric and Aleksandar Milosavljevic.

Eccentric vision : adverse interactions between line segments

NARCIS (Netherlands)

Andriessen, J.J.; Bouma, H.

1976-01-01

The paper deals with adverse interactions between line stimuli ineccentric vision. Bothcontrast thresholdandjust noticeable difference of slanthave been measured for a test line as a function of the distance from a number of surrounding lines. Test lines were either parallel or perpendicular to the

Polarization of Coronal Forbidden Lines

Energy Technology Data Exchange (ETDEWEB)

Li, Hao; Qu, Zhongquan [Yunnan Observatories, Chinese Academy of Sciences, Kunming, Yunnan 650011 (China); Landi Degl’Innocenti, Egidio, E-mail: sayahoro@ynao.ac.cn [Dipartimento di Astronomia e Scienza dello Spazio, Università di Firenze, Largo E. Fermi 2, I-50125 Firenze (Italy)

2017-03-20

Since the magnetic field is responsible for most manifestations of solar activity, one of the most challenging problems in solar physics is the diagnostics of solar magnetic fields, particularly in the outer atmosphere. To this end, it is important to develop rigorous diagnostic tools to interpret polarimetric observations in suitable spectral lines. This paper is devoted to analyzing the diagnostic content of linear polarization imaging observations in coronal forbidden lines. Although this technique is restricted to off-limb observations, it represents a significant tool to diagnose the magnetic field structure in the solar corona, where the magnetic field is intrinsically weak and still poorly known. We adopt the quantum theory of polarized line formation developed in the framework of the density matrix formalism, and synthesize images of the emergent linear polarization signal in coronal forbidden lines using potential-field source-surface magnetic field models. The influence of electronic collisions, active regions, and Thomson scattering on the linear polarization of coronal forbidden lines is also examined. It is found that active regions and Thomson scattering are capable of conspicuously influencing the orientation of the linear polarization. These effects have to be carefully taken into account to increase the accuracy of the field diagnostics. We also found that linear polarization observation in suitable lines can give valuable information on the long-term evolution of the magnetic field in the solar corona.

service line analytics in the new era.

Science.gov (United States)

Spence, Jay; Seargeant, Dan

2015-08-01

To succeed under the value-based business model, hospitals and health systems require effective service line analytics that combine inpatient and outpatient data and that incorporate quality metrics for evaluating clinical operations. When developing a framework for collection, analysis, and dissemination of service line data, healthcare organizations should focus on five key aspects of effective service line analytics: Updated service line definitions. Ability to analyze and trend service line net patient revenues by payment source. Access to accurate service line cost information across multiple dimensions with drill-through capabilities. Ability to redesign key reports based on changing requirements. Clear assignment of accountability.

Eliminating harmonics in line to line voltage using genetic algorithm using multilevel inverter

Energy Technology Data Exchange (ETDEWEB)

Gunasekaran, R. [Excel College of Engineering and Technology, Komarapalayam (India). Electrical and Electronics Engineering; Karthikeyan, C. [K.S. Rangasamy College of Engineering, Tamil Nadu (India). Electrical and Electronics Engineering

2017-04-15

In this project the total harmonic distortion (THD) minimization of the multilevel inverters output voltage is discussed. The approach in reducing harmonics contents in inverters output voltage is THD elimination. The switching angles are varied with the fundamental frequency so the output THD is minimized. In three phase applications, the line voltage harmonics are of the main concern from the load point of view. Using a genetic algorithm, a THD minimization process is directly applied to the line to line voltage of the inverter. Genetic (GA) algorithm allows the determination of the optimized parameters and consequently an optimal operating point of the circuit and a wide pass band with a unity gain is obtained.

Isoeffect lines using TDF and CRE concepts

International Nuclear Information System (INIS)

Supe, S.J.; Sasane, J.B.; Gupta, M.K.; Supe, D.S.

1979-01-01

In most of the radiotherapy centres the treatment planning is based on isodose lines. Isoeffect lines are also being drawn based on the concepts of TDFs and CREs. A study has been made of whether the isoeffect lines based on the concepts of TDFs, CRes and the physical isodose lines are identical in all the treatment situations. Isoeffects lines for a few treatment schedules involving treatment of carcinoma of the bladder, treatment of cancer of the uterine cervix by combined intracavitary and external beam therapies and intracavitary therapy alone have been obtained and compared. The effect of treatment mode on the isoeffect lines has also been studied. It was found that the isodose curves and the isoeffect lines using the TDF and CRE concepts were not identical in all situations. Therefore, the ultimate treatment plans based on these isoeffect lines will not be exactly the same. The dependence of the isoeffect lines with the variation of the exponents of time and number of fractions used in the empirical relationship for NSD have also been investigated. Clinical trials have been initiated in the case of cancer of the bladder and cervix uterus based on the isodose curves and isoeffect lines using CRE and TDF concepts. (author)

2008 TIGER/Line Nationwide Dataset

Data.gov (United States)

California Natural Resource Agency — This dataset contains a nationwide build of the 2008 TIGER/Line datasets from the US Census Bureau downloaded in April 2009. The TIGER/Line Shapefiles are an extract...

Optical Variability of Narrow-line and Broad-line Seyfert 1 Galaxies

Energy Technology Data Exchange (ETDEWEB)

Rakshit, Suvendu; Stalin, C. S., E-mail: suvenduat@gmail.com [Indian Institute of Astrophysics, Block II, Koramangala, Bangalore-560034 (India)

2017-06-20

We studied the optical variability (OV) of a large sample of narrow-line Seyfert 1 (NLSy1) and broad-line Seyfert 1 (BLSy1) galaxies with z < 0.8 to investigate any differences in their OV properties. Using archival optical V -band light curves from the Catalina Real Time Transient Survey that span 5–9 years and modeling them using damped random walk, we estimated the amplitude of variability. We found that NLSy1 galaxies as a class show lower amplitude of variability than their broad-line counterparts. In the sample of both NLSy1 and BLSy1 galaxies, radio-loud sources are found to have higher variability amplitude than radio-quiet sources. Considering only sources that are detected in the X-ray band, NLSy1 galaxies are less optically variable than BLSy1 galaxies. The amplitude of variability in the sample of both NLSy1 and BLSy1 galaxies is found to be anti-correlated with Fe ii strength but correlated with the width of the H β line. The well-known anti-correlation of variability–luminosity and the variability–Eddington ratio is present in our data. Among the radio-loud sample, variability amplitude is found to be correlated with radio-loudness and radio-power, suggesting that jets also play an important role in the OV in radio-loud objects, in addition to the Eddington ratio, which is the main driving factor of OV in radio-quiet sources.

An Asian poverty line? Issues and options

OpenAIRE

Klasen, Stephan

2016-01-01

Given Asia's record of rapid economic growth and the conceptual and empirical problems of the current international income poverty line ('dollar-a-day'), this paper discusses whether there is merit to develop an Asia-specific poverty line that addresses some of the shortcomings of the dollar-a-day line and additionally considers Asia's particular economic situation. We consider various ways of creating an Asia-specific poverty line, including an Asia-specific international income poverty line...

GARLIC - A general purpose atmospheric radiative transfer line-by-line infrared-microwave code: Implementation and evaluation

Science.gov (United States)

Schreier, Franz; Gimeno García, Sebastián; Hedelt, Pascal; Hess, Michael; Mendrok, Jana; Vasquez, Mayte; Xu, Jian

2014-04-01

A suite of programs for high resolution infrared-microwave atmospheric radiative transfer modeling has been developed with emphasis on efficient and reliable numerical algorithms and a modular approach appropriate for simulation and/or retrieval in a variety of applications. The Generic Atmospheric Radiation Line-by-line Infrared Code - GARLIC - is suitable for arbitrary observation geometry, instrumental field-of-view, and line shape. The core of GARLIC's subroutines constitutes the basis of forward models used to implement inversion codes to retrieve atmospheric state parameters from limb and nadir sounding instruments. This paper briefly introduces the physical and mathematical basics of GARLIC and its descendants and continues with an in-depth presentation of various implementation aspects: An optimized Voigt function algorithm combined with a two-grid approach is used to accelerate the line-by-line modeling of molecular cross sections; various quadrature methods are implemented to evaluate the Schwarzschild and Beer integrals; and Jacobians, i.e. derivatives with respect to the unknowns of the atmospheric inverse problem, are implemented by means of automatic differentiation. For an assessment of GARLIC's performance, a comparison of the quadrature methods for solution of the path integral is provided. Verification and validation are demonstrated using intercomparisons with other line-by-line codes and comparisons of synthetic spectra with spectra observed on Earth and from Venus.

Design of LEIR Transfer Lines

CERN Document Server

Carli, Ch; Hemery, J-Y

2002-01-01

The LEIR transfer lines are designed to transport the ion beam from the Linac 3 to LEIR and, after accumulation and acceleration from LEIR to the PS. A part of the transfer line is used for both, injection and extraction. Thus, it is natural to design injection and extraction optics in common. Beside optics constraints, the geometry of the existing machines (Linac 3, LEIR and PS) and transfer tunnels have to be respected. A new proposal for the LEIR transfer lines is presented.

Conceptual design for transmission line inspection robot

International Nuclear Information System (INIS)

Jalal, M F Abdul; Sahari, K S Mohamed; Anuar, A; Arshad, A D Mohd; Idris, M S

2013-01-01

Power transmission line is used for power distribution purposes due to their cost effective measure compared to underlying cable. However, prolonged exposure to natural weather may cause fatigue stress to the lines as well as induce material failure. Therefore, periodical line inspection is considered uttermost important as a preventive measure to avoid power outage. However, transmission line inspection has always been a high risk and expensive work. Hazardous works that may harm operator as well as routine that requires precise handling can be performed by robots. Various types of robots have been designed and developed for line inspection but only perform well on a straight and continuous line. As these robots encounter an obstacle during the inspection, then the real problem in terms of robot stability and smooth operation arises. In this paper, conceptual design and evaluation for transmission line inspection robot is presented. The inspection robot mobile robot must be able to bypass or avoid obstacles as it travels along the power transmission line.

Iron forbidden lines in tokamak discharges

International Nuclear Information System (INIS)

Suckewer, S.; Hinnov, E.

1979-03-01

Several spectrum lines from forbidden transitions in the ground configurations of highly ionized atoms have been observed in the PLT tokamak discharges. Such lines allow localized observations, in the high-temperature regions of the plasma, of ion-temperatures, plasma motions, and spatial distributions of ions. Measured absolute intensities of the forbidden lines have been compared with simultaneous observations of the ion resonance lines and with model calculations in order to deduce the mechanism of level populaions by means of electron collisions and radiative transitions

Iron forbidden lines in tokamak discharges

Energy Technology Data Exchange (ETDEWEB)

Suckewer, S.; Hinnov, E.

1979-03-01

Several spectrum lines from forbidden transitions in the ground configurations of highly ionized atoms have been observed in the PLT tokamak discharges. Such lines allow localized observations, in the high-temperature regions of the plasma, of ion-temperatures, plasma motions, and spatial distributions of ions. Measured absolute intensities of the forbidden lines have been compared with simultaneous observations of the ion resonance lines and with model calculations in order to deduce the mechanism of level populaions by means of electron collisions and radiative transitions.

UV line emission of symbiotic stars

International Nuclear Information System (INIS)

Nussbaumer, H.

1982-01-01

General characteristics of emission line spectra from symbiotic stars are outlined. Data from some special line ratios in the 1000 A - 3000 A range, and others connecting the visual and the far UV lines are presented, and their application to symbiotic stars is discussed. Integrated fractional abundances for ions easily observed in the far UV are given to facilitate abundance determinations for nebular conditions. It is found that the physical conditions of the regions emitting the emission line spectra differ considerably among different symbiotic stars. (Auth.)

Line radiative transfer and statistical equilibrium*

Directory of Open Access Journals (Sweden)

Kamp Inga

2015-01-01

Full Text Available Atomic and molecular line emission from protoplanetary disks contains key information of their detailed physical and chemical structures. To unravel those structures, we need to understand line radiative transfer in dusty media and the statistical equilibrium, especially of molecules. I describe here the basic principles of statistical equilibrium and illustrate them through the two-level atom. In a second part, the fundamentals of line radiative transfer are introduced along with the various broadening mechanisms. I explain general solution methods with their drawbacks and also specific difficulties encountered in solving the line radiative transfer equation in disks (e.g. velocity gradients. I am closing with a few special cases of line emission from disks: Radiative pumping, masers and resonance scattering.

Composite Materials in Overhead Lines

DEFF Research Database (Denmark)

Sørensen, Thomas Kjærsgaard; Holbøll, Joachim

2009-01-01

towers and recently conductors based on composite materials are available at transmission levels. In this paper it is investigated which composite based solutions are available in connection with complete overhead line systems including insulators, towers and conductors. The components are reviewed......The use of composite materials, e.g. fibreglass materials, in overhead transmission line systems is nothing new. Composite based insulators have been applied to transmission lines for over 30 years, mainly as suspension and post insulators and often as an option for special applications. Also...... with respect to solved and persisting known failures/problems of both mechanical and electrical nature. Major challenges related to extensive use of composite materials in an overhead line system are identified, as are possible benefits - both when using standard as well as customised composite components, e...

78 FR 35632 - Wireline Competition Bureau Provides Guidance Regarding the 2013 Lifeline Recertification Process

Science.gov (United States)

2013-06-13

... every calendar year thereafter. The Bureau also describes the process by which ETCs can elect to have... same calendar year. GCI argues that ``annual'' means that ETCs recertify subscribers once every.... We agree with GCI and clarify that ETCs must recertify each new subscriber in the calendar year...

75 FR 17706 - Flint Hills Resources, LP, Complainant v. Mid-America Pipeline Company, LLC, Respondent; Notice...

Science.gov (United States)

2010-04-07

... ``eSubscription'' link on the Web site that enables subscribers to receive e-mail notification when a document is added to a subscribed docket(s). For assistance with any FERC Online service, please e-mail... rates for transporting butane, isobutane, natural gasoline, naphtha and refinery grade butane on the...

75 FR 35781 - Centana Intrastate Pipeline, LLC; Notice of Baseline Filing

Science.gov (United States)

2010-06-23

... the Web site that enables subscribers to receive e-mail notification when a document is added to a subscribed docket(s). For assistance with any FERC Online service, please e-mail [email protected] Intrastate Pipeline, LLC submitted a baseline filing of its Transport Statement of Operating Conditions for...

47 CFR 76.1603 - Customer service-rate and service changes.

Science.gov (United States)

2010-10-01

... both subscribers and local franchising authorities before implementing any rate or service change. Such... franchising authority. (e) To the extent the operator is required to provide notice of service and rate..., or franchising authority on the transaction between the operator and the subscriber. Note 1 to § 76...

Change and continuity in the management of diarrhoeal diseases in ...

African Journals Online (AJOL)

This paper discusses the changing perceptions about diarrhoea in under five children in western Rumphi. While young women also subscribed to the cultural ideas about the aetiology treatment and prevention of diarrhoea, they (unlike the elderly) at the same time subscribed to the biomedical diarrhoea explanatory models ...

76 FR 40154 - Unified Agenda of Federal Regulatory and Deregulatory Actions-Spring 2011

Science.gov (United States)

2011-07-07

... Nos. 96-146, 93-22). 332 Implementation of the 3060-AG46 Subscriber Selection Changes Provision of the... Policies and Rules Regarding AM Radio Service Directional Antenna Performance Verification (MM Docket [email protected] . RIN: 3060-AG42 332. Implementation of the Subscriber Selection Changes Provision of the...

WEAK LINE QUASARS AT HIGH REDSHIFT: EXTREMELY HIGH ACCRETION RATES OR ANEMIC BROAD-LINE REGIONS?

International Nuclear Information System (INIS)

Shemmer, Ohad; Trakhtenbrot, Benny; Netzer, Hagai; Anderson, Scott F.; Brandt, W. N.; Schneider, Donald P.; Diamond-Stanic, Aleksandar M.; Fan Xiaohui; Lira, Paulina; Plotkin, Richard M.; Richards, Gordon T.; Strauss, Michael A.

2010-01-01

We present Gemini-North K-band spectra of two representative members of the class of high-redshift quasars with exceptionally weak rest-frame ultraviolet emission lines (WLQs), SDSS J114153.34+021924.3 at z = 3.55 and SDSS J123743.08+630144.9 at z = 3.49. In both sources, we detect an unusually weak broad Hβ line and place tight upper limits on the strengths of their [O III] lines. Virial, Hβ-based black hole mass determinations indicate normalized accretion rates of L/L Edd =0.4 for these sources, which is well within the range observed for typical quasars with similar luminosities and redshifts. We also present high-quality XMM-Newton imaging spectroscopy of SDSS J114153.34+021924.3 and find a hard-X-ray photon index of Γ = 1.91 +0.24 -0.22 , which supports the virial L/L Edd determination in this source. Our results suggest that the weakness of the broad emission lines in WLQs is not a consequence of an extreme continuum-emission source but instead due to abnormal broad emission line region properties.

Applying TPM on Production Line of Huanwei

Directory of Open Access Journals (Sweden)

Zhai Yunkai

2017-01-01

The study based on the study and analysis of the TPM theory, based on my practice in the SMT2 production line of Victoria Electronics of Huanwei. Then it studied the promotion and implementation steps of TPM on SMT2 line. And it also introduced the improvement instance of SMT2 line. By contrasting the utilization of equipment on SMT2 line before and after the comprehensive of TPM, the necessity of implementing TPM is derived. For how to apply TPM on the production lines, and how to improve equipment comprehensive utilization, finish the order on time, provide high quality products to our customers, these are the main part of production line equipment management work. This article provides the reference for how to promote TPM on other production lines.

Atmospheric structure deduced from disturbed line profiles application to Ca II lines

International Nuclear Information System (INIS)

Mein, N.; Mein, P.; Malherbe, J.-M.; Dame, L.; Dumont, S.; CNRS, Laboratoire de Physique Stellaire et Planetaire, Verrieres-le-Buisson, France; College de France, Paris)

1985-01-01

A new method is described in order to derive physical quantities (temperature, pressure, radial velocities) from the observation of disturbed line profiles. A method of Fourier analysis is suggested with double profiles and a nonlinear expansion of the coefficient of the Fourier terms. An application to a sequence of H-Ca II lines is attempted. The method is a powerful tool allowing for the simultaneous determination of at least four physical quantities. 9 references

40 CFR Table 12 to Subpart Wwww of... - Data Requirements for New and Existing Continuous Lamination Lines and Continuous Casting Lines...

Science.gov (United States)

2010-07-01

... Continuous Lamination Lines and Continuous Casting Lines Complying With a Lbs/Ton Organic HAP Emissions Limit... Requirements for New and Existing Continuous Lamination Lines and Continuous Casting Lines Complying With a Lbs... with a lbs/ton organic HAP emissions limit for continuous lamination lines and continuous casting lines...

X-ray spectral line coincidences between fluorine VIII (and IX) and transition metal lines

International Nuclear Information System (INIS)

Charatis, G.; Rockett, P.D.; Burkhalter, P.G.

1983-01-01

X-ray spectroscopy was performed in the 12 to 15 A region, recording L-shell lines from selected laser-irradiated transition metals. Line coincidences and near coincidences were identified between Fe, Cr, Mn, and Ni L-spectra, and F VIII and F IX K-shell lines. Wavelengths were determined to accuracies of 1 to 3 mA and will be utilized in selecting potential pumping candidates in future x-ray lasing schemes. High-resolution x-ray spectra were collected under controlled illumination and target conditions using 1.05 μm and 0.527 μm laser excitation with the KMS CHROMA laser

Multiple gamma lines from semi-annihilation

International Nuclear Information System (INIS)

D'Eramo, Francesco; McCullough, Matthew; Thaler, Jesse

2013-01-01

Hints in the Fermi data for a 130 GeV gamma line from the galactic center have ignited interest in potential gamma line signatures of dark matter. Explanations of this line based on dark matter annihilation face a parametric tension since they often rely on large enhancements of loop-suppressed cross sections. In this paper, we pursue an alternative possibility that dark matter gamma lines could arise from ''semi-annihilation'' among multiple dark sector states. The semi-annihilation reaction ψ i ψ j → ψ k γ with a single final state photon is typically enhanced relative to ordinary annihilation ψ i ψ-bar i → γγ into photon pairs. Semi-annihilation allows for a wide range of dark matter masses compared to the fixed mass value required by annihilation, opening the possibility to explain potential dark matter signatures at higher energies. The most striking prediction of semi-annihilation is the presence of multiple gamma lines, with as many as order N 3 lines possible for N dark sector states, allowing for dark sector spectroscopy. A smoking gun signature arises in the simplest case of degenerate dark matter, where a strong semi-annihilation line at 130 GeV would be accompanied by a weaker annihilation line at 173 GeV. As a proof of principle, we construct two explicit models of dark matter semi-annihilation, one based on non-Abelian vector dark matter and the other based on retrofitting Rayleigh dark matter

33 CFR 183.562 - Metallic fuel lines.

Science.gov (United States)

2010-07-01

...) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Fuel Systems Manufacturer Requirements § 183.562 Metallic fuel lines. (a) Each metallic fuel line that is mounted to the boat structure must be connected to the engine by a flexible fuel line. (b) Each metallic fuel line must be attached to the boat's structure...

Managing first-line failure.

Science.gov (United States)

Cooper, David A

2014-01-01

WHO standard of care for failure of a first regimen, usually 2N(t)RTI's and an NNRTI, consists of a ritonavir-boosted protease inhibitor with a change in N(t)RTI's. Until recently, there was no evidence to support these recommendations which were based on expert opinion. Two large randomized clinical trials, SECOND LINE and EARNEST both showed excellent response rates (>80%) for the WHO standard of care and indicated that a novel regimen of a boosted protease inhibitor with an integrase inhibitor had equal efficacy with no difference in toxicity. In EARNEST, a third arm consisting of induction with the combined protease and integrase inhibitor followed by protease inhibitor monotherapy maintenance was inferior and led to substantial (20%) protease inhibitor resistance. These studies confirm the validity of the current recommendations of WHO and point to a novel public health approach of using two new classes for second line when standard first-line therapy has failed, which avoids resistance genotyping. Notwithstanding, adherence must be stressed in those failing first-line treatments. Protease inhibitor monotherapy is not suitable for a public health approach in low- and middle-income countries.

A Product Line Enhanced Unified Process

DEFF Research Database (Denmark)

Zhang, Weishan; Kunz, Thomas

2006-01-01

The Unified Process facilitates reuse for a single system, but falls short handling multiple similar products. In this paper we present an enhanced Unified Process, called UPEPL, integrating the product line technology in order to alleviate this problem. In UPEPL, the product line related activit...... activities are added and could be conducted side by side with other classical UP activities. In this way both the advantages of Unified Process and software product lines could co-exist in UPEPL. We show how to use UPEPL with an industrial mobile device product line in our case study....

Earthquake free design of pipe lines

International Nuclear Information System (INIS)

Kurihara, Chizuko; Sakurai, Akio

1974-01-01

Long structures such as cooling sea water pipe lines of nuclear power plants have a wide range of extent along the ground surface, and are incurred by not only the inertia forces but also forces due to ground deformations or the seismic wave propagation during earthquakes. Since previous reports indicated the earthquake free design of underground pipe lines, it is discussed in this report on behaviors of pipe lines on the ground during earthquakes and is proposed the aseismic design of pipe lines considering the effects of both inertia forces and ground deformations. (author)

ALFA: an automated line fitting algorithm

Science.gov (United States)

Wesson, R.

2016-03-01

I present the automated line fitting algorithm, ALFA, a new code which can fit emission line spectra of arbitrary wavelength coverage and resolution, fully automatically. In contrast to traditional emission line fitting methods which require the identification of spectral features suspected to be emission lines, ALFA instead uses a list of lines which are expected to be present to construct a synthetic spectrum. The parameters used to construct the synthetic spectrum are optimized by means of a genetic algorithm. Uncertainties are estimated using the noise structure of the residuals. An emission line spectrum containing several hundred lines can be fitted in a few seconds using a single processor of a typical contemporary desktop or laptop PC. I show that the results are in excellent agreement with those measured manually for a number of spectra. Where discrepancies exist, the manually measured fluxes are found to be less accurate than those returned by ALFA. Together with the code NEAT, ALFA provides a powerful way to rapidly extract physical information from observations, an increasingly vital function in the era of highly multiplexed spectroscopy. The two codes can deliver a reliable and comprehensive analysis of very large data sets in a few hours with little or no user interaction.

Ground-based transmission line conductor motion sensor

International Nuclear Information System (INIS)

Jacobs, M.L.; Milano, U.

1988-01-01

A ground-based-conductor motion-sensing apparatus is provided for remotely sensing movement of electric-power transmission lines, particularly as would occur during the wind-induced condition known as galloping. The apparatus is comprised of a motion sensor and signal-generating means which are placed underneath a transmission line and will sense changes in the electric field around the line due to excessive line motion. The detector then signals a remote station when a conditioning of galloping is sensed. The apparatus of the present invention is advantageous over the line-mounted sensors of the prior art in that it is easier and less hazardous to install. The system can also be modified so that a signal will only be given when particular conditions, such as specific temperature range, large-amplitude line motion, or excessive duration of the line motion, are occurring

Sprayed concrete linings

Energy Technology Data Exchange (ETDEWEB)

Hindle, D.

1999-12-01

Sprayed concrete, or shotcrete, was invented in the 1920s for preserving dinosaur skeletons and was used underground initially in coalmines for the preservation and fine proofing of timber supports. Its use as a support lining in rock tunnelling was developed in the 1950s and 60s. The article surveys equipment available from major manufacturers and suppliers of concrete spraying equipment (Aliva, Cifa, GIA, Industri, Ingersoll Rand, etc.), specialist cement and additive manufacturers (Castle, Cement, Moria Carbotech). manufacturers of lattice girders and fibre reinforcement, and manufacturers of instrumentation for tunnel linings. 5 tabs., 9 photos.

Capital Improvements Business Line

Science.gov (United States)

2012-08-08

NAVFAC Southwest Dan Waid Program & Business Mgmt NAVFAC SW Capital Improvements Business Line NAVFAC SW 8 August 2012 1 Report...REPORT TYPE 3. DATES COVERED 00-00-2012 to 00-00-2012 4. TITLE AND SUBTITLE Capital Improvements Business Line 5a. CONTRACT NUMBER 5b. GRANT...AVAILABILITY STATEMENT Approved for public release; distribution unlimited 13. SUPPLEMENTARY NOTES Presented at the 2012 Navy Gold Coast Small Business

Cavity lining after excavating caries lesions

DEFF Research Database (Denmark)

Schwendicke, Falk; Göstemeyer, Gerd; Gluud, Christian

2015-01-01

OBJECTIVES: After removal of dentin caries lesions, cavity lining has been advocated. Non-clinical data support this approach, but clinical data are sparse and ambiguous. We aimed at evaluating the benefits and harms of cavity lining using meta-analysis and Trial Sequential Analysis. DATA: We...... included randomized clinical trials comparing restorations without versus with cavity lining for treating primary caries lesions. Only trials reporting failure (defined as need to re-retreat) after ≥1 year follow-up were included. Trial selection, data extraction, and risk of bias assessment were conducted....... STUDY SELECTION: From 128 studies, three randomized trials (89/130 patients or teeth), all treating primary teeth, were included. The trials had high risk of bias. All trials compared no lining versus calcium hydroxide lining after selective caries removal followed by adhesive restoration. Follow...

New Stokes' line in WKB theory

International Nuclear Information System (INIS)

Berk, H.L.; Nevins, W.M.; Roberts, K.V.

1982-01-01

The WKB theory for differential equations of arbitrary order or integral equations in one dimension is investigated. The rules previously stated for the construction of Stokes' lines for Nth-order differential equations, N> or =3, or integral equations are found to be incomplete because these rules lead to asymptotic forms of the solutions that depend on path. This paradox is resolved by the demonstration that new Stokes' lines can arise when previously defined Stokes' lines cross. A new formulation of the WKB problem is given to justify the new Stokes' lines. With the new Stokes' lines, the asymptotic forms can be shown to be independent of path. In addition, the WKB eigenvalue problem is formulated, and the global dispersion relation is shown to be a functional of loop integrals of the action

Multiple Lines of Evidence

Energy Technology Data Exchange (ETDEWEB)

Amidan, Brett G. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Venzin, Alexander M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Bramer, Lisa M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

2015-06-03

This paper discusses the process of identifying factors that influence the contamination level of a given decision area and then determining the likelihood that the area remains unacceptable. This process is referred to as lines of evidence. These lines of evidence then serve as inputs for the stratified compliance sampling (SCS) method, which requires a decision area to be divided into strata based upon contamination expectations. This is done in order to focus sampling efforts more within stratum where contamination is more likely and to use the domain knowledge about these likelihoods of the stratum remaining unacceptable to buy down the number of samples necessary, if possible. Two different building scenarios were considered as an example (see Table 3.1). SME expertise was elicited concerning four lines of evidence factors (see Table 3.2): 1) amount of contamination that was seen before decontamination, 2) post-decontamination air sampling information, 3) the applied decontaminant information, and 4) the surface material. Statistical experimental design and logistic regression modelling were used to help determine the likelihood that example stratum remained unacceptable for a given example scenario. The number of samples necessary for clearance was calculated by applying the SCS method to the example scenario, using the estimated likelihood of each stratum remaining unacceptable as was determined using the lines of evidence approach. The commonly used simple random sampling (SRS) method was also used to calculate the number of samples necessary for clearance for comparison purposes. The lines of evidence with SCS approach resulted in a 19% to 43% reduction in total number of samples necessary for clearance (see Table 3.6). The reduction depended upon the building scenario, as well as the level of percent clean criteria. A sensitivity analysis was also performed showing how changing the estimated likelihoods of stratum remaining unacceptable affect the number

Domain-Specific Languages and Diagram Customization for a Concurrent Engineering Environment

Science.gov (United States)

Cole, Bjorn; Dubos, Greg; Banazadeh, Payam; Reh, Jonathan; Case, Kelley; Wang, Yeou-Fang; Jones, Susan; Picha, Frank

2013-01-01

A major open question for advocates of Model-Based Systems Engineering (MBSE) is the question of how system and subsystem engineers will work together. The Systems Modeling Language (SysML), like any language intended for a large audience, is in tension between the desires for simplicity and for expressiveness. In order to be more expressive, many specialized language elements may be introduced, which will unfortunately make a complete understanding of the language a more daunting task. While this may be acceptable for systems modelers, it will increase the challenge of including subsystem engineers in the modeling effort. One possible answer to this situation is the use of Domain-Specific Languages (DSL), which are fully supported by the Unified Modeling Language (UML). SysML is in fact a DSL for systems engineering. The expressive power of a DSL can be enhanced through the use of diagram customization. Various domains have already developed their own schematic vocabularies. Within the space engineering community, two excellent examples are the propulsion and telecommunication subsystems. A return to simple box-and-line diagrams (e.g., the SysML Internal Block Diagram) are in many ways a step backward. In order allow subsystem engineers to contribute directly to the model, it is necessary to make a system modeling tool at least approximate in accessibility to drawing tools like Microsoft PowerPoint and Visio. The challenge is made more extreme in a concurrent engineering environment, where designs must often be drafted in an hour or two. In the case of the Jet Propulsion Laboratory's Team X concurrent design team, a subsystem is specified using a combination of PowerPoint for drawing and Excel for calculation. A pilot has been undertaken in order to meld the drawing portion and the production of master equipment lists (MELs) via a SysML authoring tool, MagicDraw. Team X currently interacts with its customers in a process of sharing presentations. There are several

Sadhana | Indian Academy of Sciences

Indian Academy of Sciences (India)

The purpose of this work is to investigate the reduction in location management cost by profiling the subscriber with the sets of call data record (CDR) as inputs for a dynamic network simulation. We propose dynamic intelligent paging using the history of subscribers' behaviour directly from a CDR dataset along ...

75 FR 52737 - Meeting of the Mobile Sources Technical Review Subcommittee

Science.gov (United States)

2010-08-27

.... Jackson, preferably at least 10 days prior to the meeting, to give EPA as much time as possible to process... the Subcommittee's Web Site: http://www.epa.gov/air/caaac/mobile_sources.html . MSTRS listserver subscribers will receive notification when the agenda is available on the Subcommittee web site. To subscribe...

77 FR 13318 - Meeting of the Mobile Sources Technical Review Subcommittee

Science.gov (United States)

2012-03-06

... Ms. Krueger or Ms. Jackson, preferably at least 10 days prior to the meeting, to give EPA as much... the Subcommittee's Web site: http://www.epa.gov/air/caaac/mobile_sources.html . MSTRS listserver subscribers will receive notification when the agenda is available on the Subcommittee Web site. To subscribe...

76 FR 58275 - Meeting of the Mobile Sources Technical Review Subcommittee

Science.gov (United States)

2011-09-20

..., preferably at least 10 days prior to the meeting, to give EPA as much time as possible to process your... the Subcommittee's Web site: http://www.epa.gov/air/caaac/mobile_sources.html . MSTRS listserver subscribers will receive notification when the agenda is available on the Subcommittee Web site. To subscribe...

Tubular lining material for pipelines having bends

Energy Technology Data Exchange (ETDEWEB)

Moringa, A.; Sakaguchi, Y.; Hyodo, M.; Yagi, I.

1987-03-24

A tubular lining material for pipelines having bends or curved portions comprises a tubular textile jacket made of warps and wefts woven in a tubular form overlaid with a coating of a flexible synthetic resin. It is applicable onto the inner surface of a pipeline having bends or curved portions in such manner that the tubular lining material with a binder onto the inner surface thereof is inserted into the pipeline and allowed to advance within the pipeline, with or without the aid of a leading rope-like elongated element, while turning the tubular lining material inside out under fluid pressure. In this manner the tubular lining material is applied onto the inner surface of the pipeline with the binder being interposed between the pipeline and the tubular lining material. The lining material is characterized in that a part of all of the warps are comprised of an elastic yarn around which, over the full length thereof, a synthetic fiber yarn or yarns have been left-and/or right-handedly coiled. This tubular lining material is particularly suitable for lining a pipeline having an inner diameter of 25-200 mm and a plurality of bends, such as gas service pipelines or house pipelines, without occurrence of wrinkles in the lining material in a bend.

Interferometric measurement of lines shift in flames in connection with interpretation of lined absorption method in atomic absorption spectroscopy

International Nuclear Information System (INIS)

L'vov, B.V.; Polzik, L.K.; Katskov, D.A.; Kruglikova, L.P.

1975-01-01

This paper is concerned with interferometric measuring of the line shift in flames in the view of interpretation of absorption lines in the atomic absorption spectroscopy. The newly measured line shifts were compared to the known data on Lorentz broadening of the same lines obtained by methods free of the systematic errors. The resonant lines of the alkaline earth elements (Sr, Ca, Ba) were investigated. To reduce self-absorption in the flame the solutions with minimum concentrations of the elements were used. The computation scheme includes the spectrometer apparatus width and line broadening due to the self-absorption. Formulae are given for computing the values studied. Good agreement was observed between the computed and experimental results. Error analysis was performed. It was concluded that any line shifts in the hydrocarbons were correctly taken into an account in the absolute computations of absorption

Line Emission and X-ray Line Polarization of Multiply Ionized Mo Ions

Science.gov (United States)

Petkov, E. E.; Safronova, A. S.; Kantsyrev, V. L.; Shlyaptseva, V. V.; Stafford, A.; Safronova, U. I.; Shrestha, I. K.; Schultz, K. A.; Childers, R.; Cooper, M. C.; Beiersdorfer, P.; Hell, N.; Brown, G. V.

2016-10-01

We present a comprehensive experimental and theoretical study of the line emission from multiply ionized Mo ions produced by two different sets of experiments: at LLNL EBIT and the pulsed power generator Zebra at UNR. Mo line emission and polarization measurements were accomplished at EBIT for the first time. In particular, benchmarking experiments at the LLNL EBIT with Mo ions produced at electron beam energies from 2.75 keV up to 15 keV allowed us to break down these very complicated spectra into spectra with only few ionization stages and to select processes that influence them as well as to measure line polarization. The EBIT data were recorded using the EBIT Calorimeter Spectrometer and a crystal spectrometer with a Ge crystal. X-ray Mo spectra and pinhole images were collected from Z-pinch plasmas produced from various wire loads. Non-LTE modeling, high-precision relativistic atomic and polarization data were used to analyze L-shell Mo spectra. The influence of different plasma processes including electron beams on Mo line radiation is summarized. This work was supported by NNSA under DOE Grant DE-NA0002954. Experiments at the NTF/UNR were funded in part by DE-NA0002075. Work at LLNL was performed under the auspices of the U.S. DOE under contract DE-AC52-07NA27344.

Magnetization of topological line-node semimetals

Science.gov (United States)

Mikitik, G. P.; Sharlai, Yu. V.

2018-02-01

Using an approximate expression for the Landau levels of the electrons located near a nodal line of a topological line-node semimetal, we obtain formulas for the magnetization of this semimetal at an arbitrary shape of its line. It is also shown that the dependence of the chemical potential on the magnetic field can be strong in these materials, and this dependence can essentially influence the de Haas-van Alphen oscillations. The obtained results are applied to the rhombohedral graphite, which is one of the line-node semimetals. For this material, we find temperature and magnetic field dependencies of its magnetic susceptibility.

IPTV multicast with peer-assisted lossy error control

Science.gov (United States)

Li, Zhi; Zhu, Xiaoqing; Begen, Ali C.; Girod, Bernd

2010-07-01

Emerging IPTV technology uses source-specific IP multicast to deliver television programs to end-users. To provide reliable IPTV services over the error-prone DSL access networks, a combination of multicast forward error correction (FEC) and unicast retransmissions is employed to mitigate the impulse noises in DSL links. In existing systems, the retransmission function is provided by the Retransmission Servers sitting at the edge of the core network. In this work, we propose an alternative distributed solution where the burden of packet loss repair is partially shifted to the peer IP set-top boxes. Through Peer-Assisted Repair (PAR) protocol, we demonstrate how the packet repairs can be delivered in a timely, reliable and decentralized manner using the combination of server-peer coordination and redundancy of repairs. We also show that this distributed protocol can be seamlessly integrated with an application-layer source-aware error protection mechanism called forward and retransmitted Systematic Lossy Error Protection (SLEP/SLEPr). Simulations show that this joint PARSLEP/ SLEPr framework not only effectively mitigates the bottleneck experienced by the Retransmission Servers, thus greatly enhancing the scalability of the system, but also efficiently improves the resistance to the impulse noise.

The effect of a maternal history of childhood abuse on adrenocortical attunement in mothers and their toddlers.

Science.gov (United States)

Fuchs, Anna; Moehler, Eva; Resch, Franz; Kaess, Michael

2017-07-01

We investigated circadian mother-child adrenocortical attunement in the context of a maternal history of childhood abuse (HoA). Mothers were screened after birth using the Childhood Trauma Questionnaire. Women reporting moderate or severe abuse formed the HoA group (n = 37; HoAG) and were compared with a non-maltreated comparison group (n = 45; CG). Three years later, cortisol awakening response (CAR) and diurnal slope (DSL) were assessed. Mother-child interaction was coded using the Emotional Availability Scales at 12 months of age. For the CAR, we found adrenocortical attunement only in the HoAG (2-way interaction: p = .004), particularly if mothers scored low on structuring (3-way interaction: p = .042) and children scored low on responsiveness (3-way interaction: p = .044). DSL-attunement was dependent on maternal sensitivity (3-way interaction: p = .012) and child involvement (3-way interaction: p = .012). In the context of a maternal HoA, it seems possible for mother-child-dyads to show less optimal interactional quality but be stronger attuned to each other biologically. © 2017 Wiley Periodicals, Inc.

Dynamics of soil water evaporation during soil drying: laboratory experiment and numerical analysis.

Science.gov (United States)

Han, Jiangbo; Zhou, Zhifang

2013-01-01

Laboratory and numerical experiments were conducted to investigate the evolution of soil water evaporation during a continuous drying event. Simulated soil water contents and temperatures by the calibrated model well reproduced measured values at different depths. Results show that the evaporative drying process could be divided into three stages, beginning with a relatively high evaporation rate during stage 1, followed by a lower rate during transient stage and stage 2, and finally maintaining a very low and constant rate during stage 3. The condensation zone was located immediately below the evaporation zone in the profile. Both peaks of evaporation and condensation rate increased rapidly during stage 1 and transition stage, decreased during stage 2, and maintained constant during stage 3. The width of evaporation zone kept a continuous increase during stages 1 and 2 and maintained a nearly constant value of 0.68 cm during stage 3. When the evaporation zone totally moved into the subsurface, a dry surface layer (DSL) formed above the evaporation zone at the end of stage 2. The width of DSL also presented a continuous increase during stage 2 and kept a constant value of 0.71 cm during stage 3.

TraceContract

Science.gov (United States)

Kavelund, Klaus; Barringer, Howard

2012-01-01

TraceContract is an API (Application Programming Interface) for trace analysis. A trace is a sequence of events, and can, for example, be generated by a running program, instrumented appropriately to generate events. An event can be any data object. An example of a trace is a log file containing events that a programmer has found important to record during a program execution. Trace - Contract takes as input such a trace together with a specification formulated using the API and reports on any violations of the specification, potentially calling code (reactions) to be executed when violations are detected. The software is developed as an internal DSL (Domain Specific Language) in the Scala programming language. Scala is a relatively new programming language that is specifically convenient for defining such internal DSLs due to a number of language characteristics. This includes Scala s elegant combination of object-oriented and functional programming, a succinct notation, and an advanced type system. The DSL offers a combination of data-parameterized state machines and temporal logic, which is novel. As an extension of Scala, it is a very expressive and convenient log file analysis framework.

SimulaTE: simulating complex landscapes of transposable elements of populations.

Science.gov (United States)

Kofler, Robert

2018-04-15

Estimating the abundance of transposable elements (TEs) in populations (or tissues) promises to answer many open research questions. However, progress is hampered by the lack of concordance between different approaches for TE identification and thus potentially unreliable results. To address this problem, we developed SimulaTE a tool that generates TE landscapes for populations using a newly developed domain specific language (DSL). The simple syntax of our DSL allows for easily building even complex TE landscapes that have, for example, nested, truncated and highly diverged TE insertions. Reads may be simulated for the populations using different sequencing technologies (PacBio, Illumina paired-ends) and strategies (sequencing individuals and pooled populations). The comparison between the expected (i.e. simulated) and the observed results will guide researchers in finding the most suitable approach for a particular research question. SimulaTE is implemented in Python and available at https://sourceforge.net/projects/simulates/. Manual https://sourceforge.net/p/simulates/wiki/Home/#manual; Test data and tutorials https://sourceforge.net/p/simulates/wiki/Home/#walkthrough; Validation https://sourceforge.net/p/simulates/wiki/Home/#validation. robert.kofler@vetmeduni.ac.at.

Game-theoretic pricing for video streaming in mobile networks.

Science.gov (United States)

Lin, W Sabrina; Liu, K J Ray

2012-05-01

Mobile phones are among the most popular consumer devices, and the recent developments of 3G networks and smart phones enable users to watch video programs by subscribing data plans from service providers. Due to the ubiquity of mobile phones and phone-to-phone communication technologies, data-plan subscribers can redistribute the video content to nonsubscribers. Such a redistribution mechanism is a potential competitor for the mobile service provider and is very difficult to trace given users' high mobility. The service provider has to set a reasonable price for the data plan to prevent such unauthorized redistribution behavior to protect or maximize his/her own profit. In this paper, we analyze the optimal price setting for the service provider by investigating the equilibrium between the subscribers and the secondary buyers in the content-redistribution network. We model the behavior between the subscribers and the secondary buyers as a noncooperative game and find the optimal price and quantity for both groups of users. Based on the behavior of users in the redistribution network, we investigate the evolutionarily stable ratio of mobile users who decide to subscribe to the data plan. Such an analysis can help the service provider preserve his/her profit under the threat of the redistribution networks and can improve the quality of service for end users.

SAF line powder operations

International Nuclear Information System (INIS)

Frederickson, J.R.; Horgos, R.M.

1983-10-01

An automated nuclear fuel fabrication line is being designed for installation in the Fuels and Materials Examination Facility (FMEF) near Richland, Washington. The fabrication line will consist of seven major process systems: Receiving and Powder Preparation; Powder Conditioning; Pressing and Boat Loading; Debinding, Sintering, and Property Adjustment; Boat Transport; Pellet Inspection and Finishing; and Pin Operations. Fuel powder processing through pellet pressing will be discussed in this paper

Laser cutting system in bridge fabricating line; Kyoryo seisaku line ni okeru laser no setsudan system

Energy Technology Data Exchange (ETDEWEB)

Kitaguchi, Y.; Yokotani, K. [Hitachi Zosen Corp., Osaka (Japan)

1994-11-01

This paper describes the laser cutting system established at a new advanced plant that was constructed by Hitachi Shipbuilding and Engineering Co., Ltd. in 1993. At the plant, the cutting line consists of four NC cutting lines: the plasma cutting machine, gas cutting machine, frame planer, and laser cutting machine. The laser cutting machine is used to cut complex shapes of relatively thin (6 - 16 mm) materials with high accuracy. The machine consists of a 3 kW CO2 laser oscillator mounted gantry type NC cutter and a slat conveyor of about 30 m long, with the maximum cutting width of 3.6 m. The NC cutting machine is provided with the automatic printing function using NC data, marking function, scheduled operation function, steel plate detector, and coordinate rotation function, etc. These functions enable unattended operation of the machine to cut multiple materials. This NC laser cutting line has the same performance data collection function for data during the operating time as other production lines. Therefore, the NC laser cutting line can be subjected to the realtime centralized control together with the other lines. All these technologies have provided high accuracy and efficiency for production as well as an environment in which many female operators can successfully work. 10 figs., 4 tabs.

Marine line fish research programme

CSIR Research Space (South Africa)

SANCOR

1979-04-01

Full Text Available This report outlines the framework for a marine line fish programme under the aegis of the South African National Committee for Oceanographic Research (SANCOR). An attempt is made to assess the state of knowledge about South African marine line...

Line-mode browser development days

CERN Multimedia

Anna Pantelia

2013-01-01

Twelve talented web developers have travelled to CERN from all over the world to recreate a piece of web history: the line-mode browser. See the line-mode browser simulator that they created here. Read more about the birth of the web here.

Formation of extremely narrow metallic lines

International Nuclear Information System (INIS)

Harris, E.P.; Keyes, R.W.

1979-01-01

A method for forming metal lines, particularly lines which are superconductive, involves delineating a pattern on a thin metal film on a substrate by masking techniques, ion implanting the metal film to a desired depth, removing the mask and etching away the unimplanted portion of the metal film to leave the line whose width is equal to the implanted depth. (U.K.)

Revised Line Profile Function for Hydrogenic Species

Directory of Open Access Journals (Sweden)

Sapar A.

2012-09-01

Full Text Available Analytical series expansions for the hydrogenic spectral line profile functions are derived starting from the three single expressions, obtained by integrating twice the convolution of the Holtsmark, Lorentz and Doppler line profile functions. We get well converging series expansions for the line wings and centers by reducing the number of arguments in the profile function by one, introducing the module of the Holtsmark and Lorentz profiles as a new argument. In the intermediate part of the line, the parabolic cylinder functions expressed via the confluent hypergeometric series, are used. The multi-component Stark splitting of the hydrogenic spectral lines and the modeled stochastic electron transitions in the electric field of the adjacent ions generate wide Doppler plateaux at the line centers, with the characteristic widths estimated from the fit to the characteristic width of the Holtsmark profile. This additional Doppler broadening of the line profile function removes the central dip typical to the Holtsmark profile.

75 FR 8327 - Regency Intrastate Gas LP; Notice of Petition for Rate Approval

Science.gov (United States)

2010-02-24

... ``eSubscription'' link on the Web site that enables subscribers to receive e-mail notification when a document is added to a subscribed docket(s). For assistance with any FERC Online service, please e-mail... transported under section 311. Any person desiring to participate in this rate proceeding must file a motion...

76 FR 19095 - Meeting of the Mobile Sources Technical Review Subcommittee

Science.gov (United States)

2011-04-06

..., preferably at least 10 days prior to the meeting, to give EPA as much time as possible to process your... Subcommittee's Web site: http://www.epa.gov/air/caaac/mobile_sources.html . MSTRS listserver subscribers will receive notification when the agenda is available on the Subcommittee Web site. To subscribe to the MSTRS...

77 FR 60430 - Meeting of the Mobile Sources Technical Review Subcommittee

Science.gov (United States)

2012-10-03

... Ms. Krueger or Ms. Jackson, preferably at least 10 days prior to the meeting, to give EPA as much... Web site: http://www.epa.gov/air/caaac/mobile_sources.html . MSTRS listserver subscribers will receive notification when the agenda is available on the Subcommittee Web site. To subscribe to the MSTRS listserver...

Modeling operational behavior of a disassembly line

Science.gov (United States)

Kizilkaya, Elif A.; Gupta, Surendra M.

2004-12-01

In this paper we present a dynamic kanban (pull) system specifically developed for disassembly lines. This type of kanban system is much more complex than the traditional kanban system used in assembly lines. For instance, unlike the assembly line where the external demand occurs only at the last station, the demands in the disassembly case also occur at any of the intermittent stations. The reason is that as a product moves on the disassembly line, various parts are disassembled at every station and accumulated at that station. Therefore, there are as many demand sources as there are number of parts. We consider a case example involving the end-of-life products. Based on the precedence relationships and other criteria such as hazardous properties of the parts, we balance the disassembly line. The results of the disassembly line-balancing problem (DLBP) are used as input to the proposed dynamic kanban system for disassembly line (DKSDL). We compare the performance of the DKSDL to the modified kanban system for disassembly line (MKSDL), which was previously introduced by the authors. We show, via simulation, that the DKSDL is far superior to MKSDL considered.

Autoionization spectral line shapes in dense plasmas

International Nuclear Information System (INIS)

Rosmej, F.B.; Hoffmann, D.H.H.; Faenov, A.Ya.; Pikuz, T.A.; Suess, W.; Geissel, M.

2001-01-01

The distortion of resonance line shapes due to the accumulation of a large number of satellite transitions is discovered by means of X-ray optical methods with simultaneous high spectral (λ/δλ≅8000) and spatial resolution (δx≅7 μm). Disappearance of the He α resonance line emission near the target surface is observed while Rydberg satellite intensity accumulates near the resonance line position. He β and He γ resonance line shapes are also shown to be seriously affected by opacity, higher-order line emissions from autoionizing states and inhomogeneous spatial emission. Opposite to resonance line emissions the He β satellites originate only from a very narrow spatial interval. New temperature and density diagnostics employing the 1s2131' and 1s3131'-satellites are developed. Moreover, even-J components of the satellite line emissions were resolved in the present high resolution experiments. Line transitions from the autoionizing states 1s2131' are therefore also proposed for space resolved Stark broadening analysis and local high density probing. Theorists are encouraged to provide accurate Stark broadening data for the transitions 1s2131 ' →1s 2 21+hv

Displacement of location in illusory line motion.

Science.gov (United States)

Hubbard, Timothy L; Ruppel, Susan E

2013-05-01

Six experiments examined displacement in memory for the location of the line in illusory line motion (ILM; appearance or disappearance of a stationary cue is followed by appearance of a stationary line that is presented all at once, but the stationary line is perceived to "unfold" or "be drawn" from the end closest to the cue to the end most distant from the cue). If ILM was induced by having a single cue appear, then memory for the location of the line was displaced toward the cue, and displacement was larger if the line was closer to the cue. If ILM was induced by having one of two previously visible cues vanish, then memory for the location of the line was displaced away from the cue that vanished. In general, the magnitude of displacement increased and then decreased as retention interval increased from 50 to 250 ms and from 250 to 450 ms, respectively. Displacement of the line (a) is consistent with a combination of a spatial averaging of the locations of the cue and the line with a relatively weaker dynamic in the direction of illusory motion, (b) might be implemented in a spreading activation network similar to networks previously suggested to implement displacement resulting from implied or apparent motion, and (c) provides constraints and challenges for theories of ILM.