WorldWideScience

Sample records for subnucleus caudalis vc

  1. Organization of hyperactive microglial cells in trigeminal spinal subnucleus caudalis and upper cervical spinal cord associated with orofacial neuropathic pain.

    Science.gov (United States)

    Shibuta, Kazuo; Suzuki, Ikuko; Shinoda, Masamichi; Tsuboi, Yoshiyuki; Honda, Kuniya; Shimizu, Noriyoshi; Sessle, Barry J; Iwata, Koichi

    2012-04-27

    The aim of this study was to evaluate spatial organization of hyperactive microglial cells in trigeminal spinal subnucleus caudalis (Vc) and upper cervical spinal cord (C1), and to clarify the involvement in mechanisms underlying orofacial secondary hyperalgesia following infraorbital nerve injury. We found that the head-withdrawal threshold to non-noxious mechanical stimulation of the maxillary whisker pad skin was significantly reduced in chronic constriction injury of the infraorbital nerve (ION-CCI) rats from day 1 to day 14 after ION-CCI. On day 3 after ION-CCI, mechanical allodynia was obvious in the orofacial skin areas innervated by the 1st and 3rd branches of the trigeminal nerve as well as the 2nd branch area. Hyperactive microglial cells in Vc and C1 were observed on days 3 and 7 after ION-CCI. On day 3 after ION-CCI, a large number of phosphorylated extracellular signal-regulated kinase (pERK)-immunoreactive (IR) cells were observed in Vc and C1. Many hyperactive microglial cells were also distributed over a wide area of Vc and C1 innervated by the trigeminal nerve. The intraperitoneal administration of minocycline significantly reduced the activation of microglial cells and the number of pERK-IR cells in Vc and C1, and also significantly attenuated the development of mechanical allodynia. Furthermore, enhanced background activity and mechanical evoked responses of Vc wide dynamic range neurons in ION-CCI rats were significantly reversed following minocycline administration. These findings suggest that activation of microglial cells over a wide area of Vc and C1 is involved in the enhancement of Vc and C1 neuronal excitability in the early period after ION-CCI, resulting in the neuropathic pain in orofacial areas innervated by the injured as well as uninjured nerves. Copyright © 2012 Elsevier B.V. All rights reserved.

  2. Involvement of trigeminal transition zone and laminated subnucleus caudalis in masseter muscle hypersensitivity associated with tooth inflammation.

    Directory of Open Access Journals (Sweden)

    Kohei Shimizu

    Full Text Available A rat model of pulpitis/periapical periodontitis was used to study mechanisms underlying extraterritorial enhancement of masseter response associated with tooth inflammation. Periapical bone loss gradually increased and peaked at 6 weeks after complete Freund's adjuvant (CFA application to the upper molar tooth pulp (M1. On day 3, the number of Fos-immunoreactive (IR cells was significantly larger in M1 CFA rats compared with M1 vehicle (veh rats in the trigeminal subnucleus interpolaris/caudalis transition zone (Vi/Vc. The number of Fos-IR cells was significantly larger in M1 CFA and masseter (Mass capsaicin applied (M1 CFA/Mass cap rats compared with M1 veh/Mass veh rats in the contralateral Vc and Vi/Vc. The number of phosphorylated extracellular signal-regulated kinase (pERK-IR cells was significantly larger in M1 CFA/Mass cap and M1 veh/Mass cap rats compared to Mass-vehicle applied rats with M1 vehicle or CFA in the Vi/Vc. Pulpal CFA application caused significant increase in the number of Fos-IR cells in the Vi/Vc but not Vc on week 6. The number of pERK-IR cells was significantly lager in the rats with capsaicin application to the Mass compared to Mass-vehicle treated rats after pulpal CFA- or vehicle-application. However, capsaicin application to the Mass did not further affect the number of Fos-IR cells in the Vi/Vc in pulpal CFA-applied rats. The digastric electromyographic (d-EMG activity after Mass-capsaicin application was significantly increased on day 3 and lasted longer at 6 weeks after pulpal CFA application, and these increase and duration were significantly attenuated by i.t. PD98059, a MEK1 inhibitor. These findings suggest that Vi/Vc and Vc neuronal excitation is involved in the facilitation of extraterritorial hyperalgesia for Mass primed with periapical periodontitis or acute pulpal-inflammation. Furthermore, phosphorylation of ERK in the Vi/Vc and Vc play pivotal roles in masseter hyperalgesia after pulpitis or

  3. Activation of Glycine and Extrasynaptic GABAA Receptors by Taurine on the Substantia Gelatinosa Neurons of the Trigeminal Subnucleus Caudalis

    Directory of Open Access Journals (Sweden)

    Thi Thanh Hoang Nguyen

    2013-01-01

    Full Text Available The substantia gelatinosa (SG of the trigeminal subnucleus caudalis (Vc has been known for the processing and transmission of orofacial nociceptive information. Taurine, one of the most plentiful free amino-acids in humans, has proved to be involved in pain modulation. In this study, using whole-cell patch clamp technique, we investigated the direct membrane effects of taurine and the action mechanism behind taurine-mediated responses on the SG neurons of the Vc. Taurine showed non-desensitizing and repeatable membrane depolarizations and inward currents which remained in the presence of amino-acid receptors blocking cocktail (AARBC with tetrodotoxin, indicating that taurine acts directly on the postsynaptic SG neurons. Further, application of taurine at different doses (10 μM to 3 mM showed a concentration dependent depolarizations and inward currents with the EC50 of 84.3 μM and 723 μM, respectively. Taurine-mediated responses were partially blocked by picrotoxin (50 μM and almost completely blocked by strychnine (2 μM, suggesting that taurine-mediated responses are via glycine receptor (GlyR activation. In addition, taurine (1 mM activated extrasynaptic GABAA receptor (GABAAR-mediated currents. Taken together, our results indicate that taurine can be a target molecule for orofacial pain modulation through the activation of GlyRs and/or extrasynaptic GABAARs on the SG neurons.

  4. Activation of Glycine and Extrasynaptic GABAA Receptors by Taurine on the Substantia Gelatinosa Neurons of the Trigeminal Subnucleus Caudalis

    Science.gov (United States)

    Bhattarai, Janardhan Prasad; Park, Soo Joung; Han, Seong Kyu

    2013-01-01

    The substantia gelatinosa (SG) of the trigeminal subnucleus caudalis (Vc) has been known for the processing and transmission of orofacial nociceptive information. Taurine, one of the most plentiful free amino-acids in humans, has proved to be involved in pain modulation. In this study, using whole-cell patch clamp technique, we investigated the direct membrane effects of taurine and the action mechanism behind taurine-mediated responses on the SG neurons of the Vc. Taurine showed non-desensitizing and repeatable membrane depolarizations and inward currents which remained in the presence of amino-acid receptors blocking cocktail (AARBC) with tetrodotoxin, indicating that taurine acts directly on the postsynaptic SG neurons. Further, application of taurine at different doses (10 μM to 3 mM) showed a concentration dependent depolarizations and inward currents with the EC50 of 84.3 μM and 723 μM, respectively. Taurine-mediated responses were partially blocked by picrotoxin (50 μM) and almost completely blocked by strychnine (2 μM), suggesting that taurine-mediated responses are via glycine receptor (GlyR) activation. In addition, taurine (1 mM) activated extrasynaptic GABAA receptor (GABAAR)-mediated currents. Taken together, our results indicate that taurine can be a target molecule for orofacial pain modulation through the activation of GlyRs and/or extrasynaptic GABAARs on the SG neurons. PMID:24379976

  5. Involvement of ERK phosphorylation of trigeminal spinal subnucleus caudalis neurons in thermal hypersensitivity in rats with infraorbital nerve injury.

    Directory of Open Access Journals (Sweden)

    Ikuko Suzuki

    Full Text Available To evaluate the involvement of the mitogen-activated protein kinase (MAPK cascade in orofacial neuropathic pain mechanisms, this study assessed nocifensive behavior evoked by mechanical or thermal stimulation of the whisker pad skin, phosphorylation of extracellular signal-regulated kinase (ERK in trigeminal spinal subnucleus caudalis (Vc neurons, and Vc neuronal responses to mechanical or thermal stimulation of the whisker pad skin in rats with the chronic constriction nerve injury of the infraorbital nerve (ION-CCI. The mechanical and thermal nocifensive behavior was significantly enhanced on the side ipsilateral to the ION-CCI compared to the contralateral whisker pad or sham rats. ION-CCI rats had an increased number of phosphorylated ERK immunoreactive (pERK-IR cells which also manifested NeuN-IR but not GFAP-IR and Iba1-IR, and were significantly more in ION-CCI rats compared with sham rats following noxious but not non-noxious mechanical stimulation. After intrathecal administration of the MEK1 inhibitor PD98059 in ION-CCI rats, the number of pERK-IR cells after noxious stimulation and the enhanced thermal nocifensive behavior but not the mechanical nocifensive behavior were significantly reduced in ION-CCI rats. The enhanced background activities, afterdischarges and responses of wide dynamic range neurons to noxious mechanical and thermal stimulation in ION-CCI rats were significantly depressed following i.t. administration of PD98059, whereas responses to non-noxious mechanical and thermal stimulation were not altered. The present findings suggest that pERK-IR neurons in the Vc play a pivotal role in the development of thermal hypersensitivity in the face following trigeminal nerve injury.

  6. ERK-GluR1 phosphorylation in trigeminal spinal subnucleus caudalis neurons is involved in pain associated with dry tongue.

    Science.gov (United States)

    Nakaya, Yuka; Tsuboi, Yoshiyuki; Okada-Ogawa, Akiko; Shinoda, Masamichi; Kubo, Asako; Chen, Jui Yen; Noma, Noboru; Batbold, Dulguun; Imamura, Yoshiki; Sessle, Barry J; Iwata, Koichi

    2016-01-01

    Dry mouth is known to cause severe pain in the intraoral structures, and many dry mouth patients have been suffering from intraoral pain. In development of an appropriate treatment, it is crucial to study the mechanisms underlying intraoral pain associated with dry mouth, yet the detailed mechanisms are not fully understood. To evaluate the mechanisms underlying pain related to dry mouth, the dry-tongue rat model was developed. Hence, the mechanical or heat nocifensive reflex, the phosphorylated extracellular signal-regulated kinase and phosphorylated GluR1-IR immunohistochemistries, and the single neuronal activity were examined in the trigeminal spinal subnucleus caudalis of dry-tongue rats. The head-withdrawal reflex threshold to mechanical, but not heat, stimulation of the tongue was significantly decreased on day 7 after tongue drying. The mechanical, but not heat, responses of trigeminal spinal subnucleus caudalis nociceptive neurons were significantly enhanced in dry-tongue rats compared to sham rats on day 7. The number of phosphorylated extracellular signal-regulated kinase-immunoreactive cells was also significantly increased in the trigeminal spinal subnucleus caudalis following noxious stimulation of the tongue in dry-tongue rats compared to sham rats on day 7. The decrement of the mechanical head-withdrawal reflex threshold (HWT) was reversed during intracisternal administration of the mitogen-activated protein kinase kinase 1 inhibitor, PD98059. The trigeminal spinal subnucleus caudalis neuronal activities and the number of phosphorylated extracellular signal-regulated kinase-immunoreactive cells following noxious mechanical stimulation of dried tongue were also significantly decreased following intracisternal administration of PD98059 compared to vehicle-administrated rats. Increased number of the phosphorylated GluR1-IR cells was observed in the trigeminal spinal subnucleus caudalis of dry-tongue rats, and the number of phosphorylated GluR1-IR cells

  7. Association of occlusal interference-induced masseter muscle hyperalgesia and P2X3 receptors in the trigeminal subnucleus caudalis and midbrain periaqueductal gray.

    Science.gov (United States)

    Sun, Shuzhen; Qi, Dong; Yang, Yingying; Ji, Ping; Kong, Jingjing; Wu, Qingting

    2016-03-02

    P2X3 receptor plays a role in nociception transmission of orofacial pain in temporomandibular disorder patients. A previous study found that P2X3 receptors in masseter muscle afferent neurons and the trigeminal ganglia were involved in masseter muscle pain induced by inflammation caused by chemical agents or eccentric muscle contraction. In this study, we attempted to investigate changes in P2X3 receptors in the trigeminal subnucleus caudalis (Vc) and midbrain periaqueductal gray (PAG) in relation to the hyperalgesia of masseter muscles induced by occlusal interference. Experimental occlusal interference by crown application was established in 30 rats and another 30 rats were treated as sham controls. On days 1, 3, 7, 14, and 28 after crown application, the mechanical pain threshold was examined by von-Frey filaments. The expression of the P2X3 receptor in Vc and PAG was investigated by immunohistochemistry and quantitative PCR. We found that mechanical pain threshold of bilateral masseter muscles decreased significantly after occlusal interference, which remained for the entire experimental period. The mRNA expression of the P2X3 receptor increased significantly and the number of P2X3R-positive neurons increased markedly in Vc and PAG accordingly. These results indicate that the upregulated expression of P2X3 receptors in Vc and PAG may contribute toward the development of orofacial pain induced by occlusal interference and P2X3 receptors in the PAG may play a key role in the supraspinal antiociception effect.

  8. Chronic tooth pulp inflammation induces persistent expression of phosphorylated ERK (pERK) and phosphorylated p38 (pp38) in trigeminal subnucleus caudalis

    Science.gov (United States)

    Worsley, M.A.; Allen, C.E.; Billinton, A.; King, A.E.; Boissonade, F.M.

    2014-01-01

    Background Extracellular signal-regulated kinase (ERK) and p38 mitogen-activated protein kinase are transiently phosphorylated (activated) in the spinal cord and trigeminal nucleus by acute noxious stimuli. Acute stimulation of dental pulp induces short-lived ERK activation in trigeminal subnucleus caudalis (Vc), and p38 inhibition attenuates short-term sensitization in Vc induced by acute pulpal stimulation. We have developed a model to study central changes following chronic inflammation of dental pulp that induces long-term sensitization. Here, we examine the effects of chronic inflammation and acute stimulation on the expression of phosphorylated ERK (pERK), phosphorylated p38 (pp38) and Fos in Vc. Results Chronic inflammation alone induced bilateral expression of pERK and pp38 in Vc, but did not induce Fos expression. Stimulation of both non-inflamed and inflamed pulps significantly increased pERK and pp38 bilaterally; expression was greatest in inflamed, stimulated animals, and was similar following 10-min and 60-min stimulation. Stimulation for 60 min, but not 10 min, induced Fos in ipsilateral Vc; Fos expression was significantly greater in inflamed, stimulated animals. pERK was present in both neurons and astrocytes; pp38 was present in neurons and other non-neuronal, non-astrocytic cell types. Conclusions This study provides the first demonstration that chronic inflammation of tooth pulp induces persistent bilateral activation of ERK and p38 within Vc, and that this activation is further increased by acute stimulation. This altered activity in intracellular signaling is likely to be linked to the sensitization that is seen in our animal model and in patients with pulpitis. Our data indicate that pERK and pp38 are more accurate markers of central change than Fos expression. In our model, localization of pERK and pp38 within specific cell types differs from that seen following acute stimulation. This may indicate specific roles for different cell types in

  9. Metabotropic glutamate receptor 5 contributes to inflammatory tongue pain via extracellular signal-regulated kinase signaling in the trigeminal spinal subnucleus caudalis and upper cervical spinal cord

    Directory of Open Access Journals (Sweden)

    Liu Ming-Gang

    2012-11-01

    Full Text Available Abstract Background In the orofacial region, limited information is available concerning pathological tongue pain, such as inflammatory pain or neuropathic pain occurring in the tongue. Here, we tried for the first time to establish a novel animal model of inflammatory tongue pain in rats and to investigate the roles of metabotropic glutamate receptor 5 (mGluR5-extracellular signal-regulated kinase (ERK signaling in this process. Methods Complete Freund’s adjuvant (CFA was submucosally injected into the tongue to induce the inflammatory pain phenotype that was confirmed by behavioral testing. Expression of phosphorylated ERK (pERK and mGluR5 in the trigeminal subnucleus caudalis (Vc and upper cervical spinal cord (C1-C2 were detected with immunohistochemical staining and Western blotting. pERK inhibitor, a selective mGluR5 antagonist or agonist was continuously administered for 7 days via an intrathecal (i.t. route. Local inflammatory responses were verified by tongue histology. Results Submucosal injection of CFA into the tongue produced a long-lasting mechanical allodynia and heat hyperalgesia at the inflamed site, concomitant with an increase in the pERK immunoreactivity in the Vc and C1-C2. The distribution of pERK-IR cells was laminar specific, ipsilaterally dominant, somatotopically relevant, and rostrocaudally restricted. Western blot analysis also showed an enhanced activation of ERK in the Vc and C1-C2 following CFA injection. Continuous i.t. administration of the pERK inhibitor and a selective mGluR5 antagonist significantly depressed the mechanical allodynia and heat hyperalgesia in the CFA-injected tongue. In addition, the number of pERK-IR cells in ipsilateral Vc and C1-C2 was also decreased by both drugs. Moreover, continuous i.t. administration of a selective mGluR5 agonist induced mechanical allodynia in naive rats. Conclusions The present study constructed a new animal model of inflammatory tongue pain in rodents, and

  10. Involvement of AMPA receptor GluR2 and GluR3 trafficking in trigeminal spinal subnucleus caudalis and C1/C2 neurons in acute-facial inflammatory pain.

    Directory of Open Access Journals (Sweden)

    Makiko Miyamoto

    Full Text Available To evaluate the involvement of trafficking of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor (AMPAR GluR2 and GluR3 subunits in an acute inflammatory orofacial pain, we analyzed nocifensive behavior, phosphorylated extracellular signal-regulated kinase (pERK and Fos expression in Vi/Vc, Vc and C1/C2 in GluR2 delta7 knock-in (KI, GluR3 delta7 KI mice and wild-type mice. We also studied Vc neuronal activity to address the hypothesis that trafficking of GluR2 and GluR3 subunits plays an important role in Vi/Vc, Vc and C1/C2 neuronal activity associated with orofacial inflammation in these mice. Late nocifensive behavior was significantly depressed in GluR2 delta7 KI and GluR3 delta7 KI mice. In addition, the number of pERK-immunoreactive (IR cells was significantly decreased bilaterally in the Vi/Vc, Vc and C1/C2 in GluR2 delta7 KI and GluR3 delta7 KI mice compared to wild-type mice at 40 min after formalin injection, and was also significantly smaller in GluR3 delta7 KI compared to GluR2 delta7 KI mice. The number of Fos protein-IR cells in the ipsilateral Vi/Vc, Vc and C1/C2 was also significantly smaller in GluR2 delta7 KI and GluR3 delta7 KI mice compared to wild-type mice 40 min after formalin injection. Nociceptive neurons functionally identified as wide dynamic range neurons in the Vc, where pERK- and Fos protein-IR cell expression was prominent, showed significantly lower spontaneous activity in GluR2 delta7 KI and GluR3 delta7 KI mice than wild-type mice following formalin injection. These findings suggest that GluR2 and GluR3 trafficking is involved in the enhancement of Vi/Vc, Vc and C1/C2 nociceptive neuronal excitabilities at 16-60 min following formalin injection, resulting in orofacial inflammatory pain.

  11. The role of trigeminal nucleus caudalis orexin 1 receptors in orofacial pain transmission and in orofacial pain-induced learning and memory impairment in rats.

    Science.gov (United States)

    Kooshki, Razieh; Abbasnejad, Mehdi; Esmaeili-Mahani, Saeed; Raoof, Maryam

    2016-04-01

    It is widely accepted that the spinal trigeminal nuclear complex, especially the subnucleus caudalis (Vc), receives input from orofacial structures. The neuropeptides orexin-A and -B are expressed in multiple neuronal systems. Orexin signaling has been implicated in pain-modulating system as well as learning and memory processes. Orexin 1 receptor (OX1R) has been reported in trigeminal nucleus caudalis. However, its roles in trigeminal pain modulation have not been elucidated so far. This study was designed to investigate the role of Vc OX1R in the modulation of orofacial pain as well as pain-induced learning and memory deficits. Orofacial pain was induced by subcutaneous injection of capsaicin in the right upper lip of the rats. OX1R agonist (orexin-A) and antagonist (SB-334867-A) were microinjected into Vc prior capsaicin administration. After recording nociceptive times, learning and memory was investigated using Morris water maze (MWM) test. The results indicated that, orexin-A (150 pM/rat) significantly reduced the nociceptive times, while SB334867-A (80 nM/rat) exaggerated nociceptive behavior in response to capsaicin injection. In MWM test, capsaicin-treated rats showed a significant learning and memory impairment. Moreover, SB-334867-A (80 nM/rat) significantly exaggerated learning and memory impairment in capsaicin-treated rats. However, administration of orexin-A (100 pM/rat) prevented learning and memory deficits. Taken together, these results indicate that Vc OX1R was at least in part involved in orofacial pain transmission and orexin-A has also a beneficial inhibitory effect on orofacial pain-induced deficits in abilities of spatial learning and memory. Copyright © 2016 Elsevier Inc. All rights reserved.

  12. Organization of pERK-immunoreactive cells in trigeminal spinal nucleus caudalis, upper cervical cord, NTS and Pa5 following capsaicin injection into masticatory and swallowing-related muscles in rats.

    Science.gov (United States)

    Tsujimura, Takanori; Shinoda, Masamichi; Honda, Kuniya; Hitomi, Suzuro; Kiyomoto, Masaaki; Matsuura, Shingo; Katagiri, Ayano; Tsuji, Kojun; Inoue, Makoto; Shiga, Yoshi; Iwata, Koichi

    2011-10-12

    Many phosphorylated extracellular signal-regulated kinase (pERK)-immunoreactive (IR) cells are expressed in the trigeminal spinal subnucleus caudalis (Vc), upper cervical spinal cord (C1-C2), nucleus tractus solitarii (NTS) and paratrigeminal nucleus (Pa5) after capsaicin injection into the whisker pad (WP), masseter muscle (MM), digastric muscle (DM) or sternohyoideus muscle (SM). The pERK-IR cells also showed NeuN immunoreactivity, indicating that ERK phosphorylation occurs in neurons. The pERK-IR cells were significantly reduced after intrathecal injection of MEK 1/2 inhibitor PD98059. The pERK-IR cells expressed bilaterally in the Vc and C1-C2 after capsaicin injection into the unilateral DM or SM, whereas unilaterally in the Vc and C1-C2 after unilateral WP or MM injection. After capsaicin injection into the WP or MM, the pERK-IR cell expression in the Vc was restricted rostrocaudally within a narrow area. However, the distribution of pERK-IR cells was more wide spread without a clear peak in the Vc and C1-C2 after capsaicin injection into the DM or SM. In the NTS, the unimodal pERK-IR cell expression peaked at 0-720μm rostral from the obex following capsaicin injection into WP, MM, DM or SM. In the ipsilateral Pa5, many pERK-IR cells were observed following capsaicin injection into the SM. The number of swallows elicited by distilled water administration was significantly smaller after capsaicin injection into the WP, MM or DM but not SM compared to that of vehicle-injected rats. Various noxious inputs due to the masticatory or swallowing-related muscle inflammation may be differentially involved in muscle pain and swallowing reflex activity. Copyright © 2011 Elsevier B.V. All rights reserved.

  13. VC@C

    Indian Academy of Sciences (India)

    2012-03-09

    Mar 9, 2012 ... A novel approach to the fabrication of vanadium carbide encapsulated into carbon nanotube (VC@C) core-shell .... mixed solution was transferred into a 600 mL stainless steel autoclave after the solution became suspension. An auto- clave was sealed and maintained at 180. ◦. C for 48 h and then cooled to ...

  14. On VC-density over indiscernible sequences

    OpenAIRE

    Guingona, Vincent; Hill, Cameron Donnay

    2011-01-01

    In this paper, we study VC-density over indiscernible sequences (denoted VC_ind-density). We answer an open question in [1], showing that VC_ind-density is always integer valued. We also show that VC_ind-density and dp-rank coincide in the natural way.

  15. BRIC-100VC Biological Research in Canisters (BRIC)-100VC

    Science.gov (United States)

    Richards, Stephanie E.; Levine, Howard G. (Compiler); Romero, Vergel

    2016-01-01

    The Biological Research in Canisters (BRIC) is an anodized-aluminum cylinder used to provide passive stowage for investigations of the effects of space flight on small specimens. The BRIC 100 mm petri dish vacuum containment unit (BRIC-100VC) has supported Dugesia japonica (flatworm) within spring under normal atmospheric conditions for 29 days in space and Hemerocallis lilioasphodelus L. (daylily) somatic embryo development within a 5% CO2 gaseous environment for 4.5 months in space. BRIC-100VC is a completely sealed, anodized-aluminum cylinder (Fig. 1) providing containment and structural support of the experimental specimens. The top and bottom lids of the canister include rapid disconnect valves for filling the canister with selected gases. These specialized valves allow for specific atmospheric containment within the canister, providing a gaseous environment defined by the investigator. Additionally, the top lid has been designed with a toggle latch and O-ring assembly allowing for prompt sealing and removal of the lid. The outside dimensions of the BRIC-100VC canisters are 16.0 cm (height) x 11.4 cm (outside diameter). The lower portion of the canister has been equipped with sufficient storage space for passive temperature and relative humidity data loggers. The BRIC- 100VC canister has been optimized to accommodate standard 100 mm laboratory petri dishes or 50 mL conical tubes. Depending on storage orientation, up to 6 or 9 canisters have been flown within an International Space Station (ISS) stowage locker.

  16. VC-dimension of univariate decision trees.

    Science.gov (United States)

    Yildiz, Olcay Taner

    2015-02-01

    In this paper, we give and prove the lower bounds of the Vapnik-Chervonenkis (VC)-dimension of the univariate decision tree hypothesis class. The VC-dimension of the univariate decision tree depends on the VC-dimension values of its subtrees and the number of inputs. Via a search algorithm that calculates the VC-dimension of univariate decision trees exhaustively, we show that our VC-dimension bounds are tight for simple trees. To verify that the VC-dimension bounds are useful, we also use them to get VC-generalization bounds for complexity control using structural risk minimization in decision trees, i.e., pruning. Our simulation results show that structural risk minimization pruning using the VC-dimension bounds finds trees that are more accurate as those pruned using cross validation.

  17. Corticotrigeminal Projections from the Insular Cortex to the Trigeminal Caudal Subnucleus Regulate Orofacial Pain after Nerve Injury via Extracellular Signal-Regulated Kinase Activation in Insular Cortex Neurons.

    Science.gov (United States)

    Wang, Jian; Li, Zhi-Hua; Feng, Ban; Zhang, Ting; Zhang, Han; Li, Hui; Chen, Tao; Cui, Jing; Zang, Wei-Dong; Li, Yun-Qing

    2015-01-01

    Cortical neuroplasticity alterations are implicated in the pathophysiology of chronic orofacial pain. However, the relationship between critical cortex excitability and orofacial pain maintenance has not been fully elucidated. We recently demonstrated a top-down corticospinal descending pain modulation pathway from the anterior cingulate cortex (ACC) to the spinal dorsal horn that could directly regulate nociceptive transmission. Thus, we aimed to investigate possible corticotrigeminal connections that directly influence orofacial nociception in rats. Infraorbital nerve chronic constriction injury (IoN-CCI) induced significant orofacial nociceptive behaviors as well as pain-related negative emotions such as anxiety/depression in rats. By combining retrograde and anterograde tract tracing, we found powerful evidence that the trigeminal caudal subnucleus (Vc), especially the superficial laminae (I/II), received direct descending projections from granular and dysgranular parts of the insular cortex (IC). Extracellular signal-regulated kinase (ERK), an important signaling molecule involved in neuroplasticity, was significantly activated in the IC following IoN-CCI. Moreover, in IC slices from IoN-CCI rats, U0126, an inhibitor of ERK activation, decreased both the amplitude and the frequency of spontaneous excitatory postsynaptic currents (sEPSCs) and reduced the paired-pulse ratio (PPR) of Vc-projecting neurons. Additionally, U0126 also reduced the number of action potentials in the Vc-projecting neurons. Finally, intra-IC infusion of U0126 obviously decreased Fos expression in the Vc, accompanied by the alleviation of both nociceptive behavior and negative emotions. Thus, the corticotrigeminal descending pathway from the IC to the Vc could directly regulate orofacial pain, and ERK deactivation in the IC could effectively alleviate neuropathic pain as well as pain-related negative emotions in IoN-CCI rats, probably through this top-down pathway. These findings may help

  18. Rotationally resolved state-to-state photoionization and the photoelectron study of vanadium monocarbide and its cations (VC/VC(+)).

    Science.gov (United States)

    Chang, Yih Chung; Luo, Zhihong; Pan, Yi; Zhang, Zheng; Song, Ying-Nan; Kuang, Sophie Yajin; Yin, Qing Zhu; Lau, Kai-Chung; Ng, C Y

    2015-04-21

    By employing two-color visible (VIS)-ultraviolet (UV) laser photoionization and pulsed field ionization-photoelectron (PFI-PE) techniques, we have obtained highly rotationally resolved photoelectron spectra for vanadium monocarbide cations (VC(+)). The state-to-state VIS-UV-PFI-PE spectra thus obtained allow unambiguous assignments for the photoionization rotational transitions, resulting in a highly precise value for the adiabatic ionization energy (IE) of vanadium monocarbide (VC), IE(VC) = 57512.0 ± 0.8 cm(-1) (7.13058 ± 0.00010 eV), which is defined as the energy of the VC(+)(X(3)Δ1; v(+) = 0; J(+) = 1) ← VC(X(2)Δ3/2; v'' = 0; J'' = 3/2) photoionization transition. The spectroscopic constants for VC(+)(X(3)Δ1) determined in the present study include the harmonic vibrational frequency ωe(+) = 896.4 ± 0.8 cm(-1), the anharmonicity constant ωe(+)xe(+) = 5.7 ± 0.8 cm(-1), the rotational constants Be(+) = 0.6338 ± 0.0025 cm(-1) and αe(+) = 0.0033 ± 0.0007 cm(-1), the equilibrium bond length re(+) = 1.6549 ± 0.0003 Å, and the spin-orbit coupling constant A = 75.2 ± 0.8 cm(-1) for VC(+)(X(3)Δ1,2,3). These highly precise energetic and spectroscopic data are used to benchmark state-of-the-art CCSDTQ/CBS calculations. In general, good agreement is found between the theoretical predictions and experimental results. The theoretical calculations yield the values, IE(VC) = 7.126 eV; the 0 K bond dissociation energies: D0(V-C) = 4.023 eV and D0(V(+)-C) = 3.663 eV; and heats of formation: ΔH°(f0)(VC) = 835.2, ΔH°(f298)(VC) = 840.4, ΔH°(f0)(VC(+)) = 1522.8, and ΔH°(f298)(VC(+)) = 1528.0 kJ mol(-1).

  19. Dietary grape seed polyphenols repress neuron and glia activation in trigeminal ganglion and trigeminal nucleus caudalis

    Directory of Open Access Journals (Sweden)

    Durham Paul L

    2010-12-01

    Full Text Available Abstract Background Inflammation and pain associated with temporomandibular joint disorder, a chronic disease that affects 15% of the adult population, involves activation of trigeminal ganglion nerves and development of peripheral and central sensitization. Natural products represent an underutilized resource in the pursuit of safe and effective ways to treat chronic inflammatory diseases. The goal of this study was to investigate effects of grape seed extract on neurons and glia in trigeminal ganglia and trigeminal nucleus caudalis in response to persistent temporomandibular joint inflammation. Sprague Dawley rats were pretreated with 200 mg/kg/d MegaNatural-BP grape seed extract for 14 days prior to bilateral injections of complete Freund's adjuvant into the temporomandibular joint capsule. Results In response to grape seed extract, basal expression of mitogen-activated protein kinase phosphatase 1 was elevated in neurons and glia in trigeminal ganglia and trigeminal nucleus caudalis, and expression of the glutamate aspartate transporter was increased in spinal glia. Rats on a normal diet injected with adjuvant exhibited greater basal levels of phosphorylated-p38 in trigeminal ganglia neurons and spinal neurons and microglia. Similarly, immunoreactive levels of OX-42 in microglia and glial fibrillary acidic protein in astrocytes were greatly increased in response to adjuvant. However, adjuvant-stimulated levels of phosphorylated-p38, OX-42, and glial fibrillary acidic protein were significantly repressed in extract treated animals. Furthermore, grape seed extract suppressed basal expression of the neuropeptide calcitonin gene-related peptide in spinal neurons. Conclusions Results from our study provide evidence that grape seed extract may be beneficial as a natural therapeutic option for temporomandibular joint disorders by suppressing development of peripheral and central sensitization.

  20. Structure and properties of TiC, VC, and TiC/VC thin films deposited by pulsed laser deposition

    International Nuclear Information System (INIS)

    Krzanowski, J.E.; Leuchtner, R.E.

    1996-01-01

    A study has been conducted on the mechanical, tribological and chemical properties of pulsed laser deposited (PLD) TiC, VC and TiC/VC thin films. The TiC films were deposited at 375 C and 5 mTorr Ar, while the TiC/VC films were deposited from a composite target at 475 C at pressures of base vacuum and 50 mTorr Ar. XRD analysis revealed the films had the expected B1 structure, although XPS analysis showed a significant oxygen content. Tribological studies were conducted using a ball-on-disk test, and the wear behavior depended on the surface condition and film composition. One TiC/VC film exhibited little wear but caused significant ball wear, indicating mixed carbide films are promising candidates for wear-resistant coatings

  1. Insights on the SO2 Poisoning of Pt3Co/VC and Pt/VC Fuel Cell Catalysts

    Science.gov (United States)

    2010-01-01

    catalyst is performed at the cathode of proton exchange membrane fuel cells ( PEMFCs ) in order to link previously reported results at the elec- trode...stripping voltammetry and underpotential deposition (upd) of copper adatoms. Then the performance of PEMFC cathodes employing 30wt.% Pt3Co/VC and 50wt.% Pt/VC...proton exchange membrane fuel cells( PEMFCs )in order to link previously reported results at the elec- trode/solution interface to the FC environment. First

  2. Lost in interpretation: should the highest VC value be used to calculate the FEV1/VC ratio?

    Directory of Open Access Journals (Sweden)

    Fortis S

    2016-09-01

    Full Text Available Spyridon FortisDepartment of Medicine, Division of Pulmonary, Critical Care and Occupational Medicine, University of Iowa, Iowa City, IA, USAAirflow obstruction or obstructive ventilatory defect (OVD is defined as low forced expiratory volume in 1 second (FEV1 to vital capacity (VC ratio. VC can be measured in various ways, and the definition of “low FEV1/VC” ratio varies.     VC can be measured during forced expiration before bronchodilators (forced vital capacity [FVC] and after bronchodilators (post-FVC, and during slow expiration (slow vital capacity [SVC] and during inspiration (inspiratory vital capacity [IVC]. Theoretically, in a healthy person, VC values should be the same regardless of the maneuver used. Nevertheless, SVC is usually larger than FVC except in patients with no OVD and body mass index <25 kg/m2.1 In obstructive lung diseases, FVC may be reduced, which may result in an increase of FEV1/FVC ratio and misdiagnosis.2 For that reason, American Thoracic Society–European Respiratory Society recommends using SVC or IVC to calculate the FEV1/VC ratio.2 Approximately, 10% of smokers have FEV1% predicted <80% and FEV1/FVC >70%, a pattern known as preserved ratio impaired spirometry.3 Of all the subjects with FVC below the lower limit of normal (LLN and FEV1/FVC > LLN, only 64% have restriction in lung volumes. The rest 36% have a nonspecific Pulmonary Function Test pattern.4 Approximately, 15% of patients with this nonspecific PFT pattern develop OVD in follow-up PFTs.4 It is possible that a portion of patients with obstructive lung disease remain underdiagnosed when FVC is used to compute FEV1/FVC ratio.View the original paper by Torén and colleagues.

  3. A Technique for Generating Volumetric Cine MRI (VC-MRI)

    Science.gov (United States)

    Harris, Wendy; Ren, Lei; Cai, Jing; Zhang, You; Chang, Zheng; Yin, Fang-Fang

    2016-01-01

    Purpose To develop a technique to generate on-board volumetric-cine MRI (VC-MRI) using patient prior images, motion modeling and on-board 2D-cine MRI. Methods One phase of a 4D-MRI acquired during patient simulation is used as patient prior images. 3 major respiratory deformation patterns of the patient are extracted from 4D-MRI based on principal-component-analysis. The on-board VC-MRI at any instant is considered as a deformation of the prior MRI. The deformation field is represented as a linear combination of the 3 major deformation patterns. The coefficients of the deformation patterns are solved by the data fidelity constraint using the acquired on-board single 2D-cine MRI. The method was evaluated using both XCAT simulation of lung cancer patients and MRI data from four real liver cancer patients. The accuracy of the estimated VC-MRI was quantitatively evaluated using Volume-Percent-Difference(VPD), Center-of-Mass-Shift(COMS), and target tracking errors. Effects of acquisition orientation, region-of-interest(ROI) selection, patient breathing pattern change and noise on the estimation accuracy were also evaluated. Results Image subtraction of ground-truth with estimated on-board VC-MRI shows fewer differences than image subtraction of ground-truth with prior image. Agreement between profiles in the estimated and ground-truth VC-MRI was achieved with less than 6% error for both XCAT and patient data. Among all XCAT scenarios, the VPD between ground-truth and estimated lesion volumes was on average 8.43±1.52% and the COMS was on average 0.93±0.58mm across all time-steps for estimation based on the ROI region in the sagittal cine images. Matching to ROI in the sagittal view achieved better accuracy when there was substantial breathing pattern change. The technique was robust against noise levels up to SNR=20. For patient data, average tracking errors were less than 2 mm in all directions for all patients. Conclusions Preliminary studies demonstrated the

  4. Bilateral descending hypothalamic projections to the spinal trigeminal nucleus caudalis in rats.

    Directory of Open Access Journals (Sweden)

    Khaled Abdallah

    Full Text Available Several lines of evidence suggest that the hypothalamus is involved in trigeminal pain processing. However, the organization of descending hypothalamic projections to the spinal trigeminal nucleus caudalis (Sp5C remains poorly understood. Microinjections of the retrograde tracer, fluorogold (FG, into the Sp5C, in rats, reveal that five hypothalamic nuclei project to the Sp5C: the paraventricular nucleus, the lateral hypothalamic area, the perifornical hypothalamic area, the A11 nucleus and the retrochiasmatic area. Descending hypothalamic projections to the Sp5C are bilateral, except those from the paraventricular nucleus which exhibit a clear ipsilateral predominance. Moreover, the density of retrogradely FG-labeled neurons in the hypothalamus varies according to the dorso-ventral localization of the Sp5C injection site. There are much more labeled neurons after injections into the ventrolateral part of the Sp5C (where ophthalmic afferents project than after injections into its dorsomedial or intermediate parts (where mandibular and maxillary afferents, respectively, project. These results demonstrate that the organization of descending hypothalamic projections to the spinal dorsal horn and Sp5C are different. Whereas the former are ipsilateral, the latter are bilateral. Moreover, hypothalamic projections to the Sp5C display somatotopy, suggesting that these projections are preferentially involved in the processing of meningeal and cutaneous inputs from the ophthalmic branch of the trigeminal nerve in rats. Therefore, our results suggest that the control of trigeminal and spinal dorsal horn processing of nociceptive information by hypothalamic neurons is different and raise the question of the role of bilateral, rather than unilateral, hypothalamic control.

  5. Design and realization of reports of database in VC++. net

    International Nuclear Information System (INIS)

    Zhu Haijun; Shen Liren; Liu Dekang

    2006-01-01

    The design and realization of reports of database on the basis of VC ++ . net is presented. In the first, report template using word format files is introduced, and the method of filling the data table up according to the database is expatiated. The function of preview and printing calling word software is analyzed. The key code of how to generate reports automatically with Visual C ++ . net is given. (authors)

  6. Transcript Profile of Flowering Regulatory Genes in VcFT-Overexpressing Blueberry Plants.

    Directory of Open Access Journals (Sweden)

    Aaron E Walworth

    Full Text Available In order to identify genetic components in flowering pathways of highbush blueberry (Vaccinium corymbosum L., a transcriptome reference composed of 254,396 transcripts and 179,853 gene contigs was developed by assembly of 72.7 million reads using Trinity. Using this transcriptome reference and a query of flowering pathway genes of herbaceous plants, we identified potential flowering pathway genes/transcripts of blueberry. Transcriptome analysis of flowering pathway genes was then conducted on leaf tissue samples of transgenic blueberry cv. Aurora ('VcFT-Aurora', which overexpresses a blueberry FLOWERING LOCUS T-like gene (VcFT. Sixty-one blueberry transcripts of 40 genes showed high similarities to 33 known flowering-related genes of herbaceous plants, of which 17 down-regulated and 16 up-regulated genes were identified in 'VcFT-Aurora'. All down-regulated genes encoded transcription factors/enzymes upstream in the signaling pathway containing VcFT. A blueberry CONSTANS-LIKE 5-like (VcCOL5 gene was down-regulated and associated with five other differentially expressed (DE genes in the photoperiod-mediated flowering pathway. Three down-regulated genes, i.e., a MADS-AFFECTING FLOWERING 2-like gene (VcMAF2, a MADS-AFFECTING FLOWERING 5-like gene (VcMAF5, and a VERNALIZATION1-like gene (VcVRN1, may function as integrators in place of FLOWERING LOCUS C (FLC in the vernalization pathway. Because no CONSTAN1-like or FLOWERING LOCUS C-like genes were found in blueberry, VcCOL5 and VcMAF2/VcMAF5 or VRN1 might be the major integrator(s in the photoperiod- and vernalization-mediated flowering pathway, respectively. The major down-stream genes of VcFT, i.e., SUPPRESSOR of Overexpression of Constans 1-like (VcSOC1, LEAFY-like (VcLFY, APETALA1-like (VcAP1, CAULIFLOWER 1-like (VcCAL1, and FRUITFULL-like (VcFUL genes were present and showed high similarity to their orthologues in herbaceous plants. Moreover, overexpression of VcFT promoted expression of all of

  7. Transcript Profile of Flowering Regulatory Genes in VcFT-Overexpressing Blueberry Plants

    Science.gov (United States)

    Walworth, Aaron E.; Chai, Benli; Song, Guo-qing

    2016-01-01

    In order to identify genetic components in flowering pathways of highbush blueberry (Vaccinium corymbosum L.), a transcriptome reference composed of 254,396 transcripts and 179,853 gene contigs was developed by assembly of 72.7 million reads using Trinity. Using this transcriptome reference and a query of flowering pathway genes of herbaceous plants, we identified potential flowering pathway genes/transcripts of blueberry. Transcriptome analysis of flowering pathway genes was then conducted on leaf tissue samples of transgenic blueberry cv. Aurora (‘VcFT-Aurora’), which overexpresses a blueberry FLOWERING LOCUS T-like gene (VcFT). Sixty-one blueberry transcripts of 40 genes showed high similarities to 33 known flowering-related genes of herbaceous plants, of which 17 down-regulated and 16 up-regulated genes were identified in ‘VcFT-Aurora’. All down-regulated genes encoded transcription factors/enzymes upstream in the signaling pathway containing VcFT. A blueberry CONSTANS-LIKE 5-like (VcCOL5) gene was down-regulated and associated with five other differentially expressed (DE) genes in the photoperiod-mediated flowering pathway. Three down-regulated genes, i.e., a MADS-AFFECTING FLOWERING 2-like gene (VcMAF2), a MADS-AFFECTING FLOWERING 5-like gene (VcMAF5), and a VERNALIZATION1-like gene (VcVRN1), may function as integrators in place of FLOWERING LOCUS C (FLC) in the vernalization pathway. Because no CONSTAN1-like or FLOWERING LOCUS C-like genes were found in blueberry, VcCOL5 and VcMAF2/VcMAF5 or VRN1 might be the major integrator(s) in the photoperiod- and vernalization-mediated flowering pathway, respectively. The major down-stream genes of VcFT, i.e., SUPPRESSOR of Overexpression of Constans 1-like (VcSOC1), LEAFY-like (VcLFY), APETALA1-like (VcAP1), CAULIFLOWER 1-like (VcCAL1), and FRUITFULL-like (VcFUL) genes were present and showed high similarity to their orthologues in herbaceous plants. Moreover, overexpression of VcFT promoted expression of all

  8. Transcript Profile of Flowering Regulatory Genes in VcFT-Overexpressing Blueberry Plants.

    Science.gov (United States)

    Walworth, Aaron E; Chai, Benli; Song, Guo-Qing

    2016-01-01

    In order to identify genetic components in flowering pathways of highbush blueberry (Vaccinium corymbosum L.), a transcriptome reference composed of 254,396 transcripts and 179,853 gene contigs was developed by assembly of 72.7 million reads using Trinity. Using this transcriptome reference and a query of flowering pathway genes of herbaceous plants, we identified potential flowering pathway genes/transcripts of blueberry. Transcriptome analysis of flowering pathway genes was then conducted on leaf tissue samples of transgenic blueberry cv. Aurora ('VcFT-Aurora'), which overexpresses a blueberry FLOWERING LOCUS T-like gene (VcFT). Sixty-one blueberry transcripts of 40 genes showed high similarities to 33 known flowering-related genes of herbaceous plants, of which 17 down-regulated and 16 up-regulated genes were identified in 'VcFT-Aurora'. All down-regulated genes encoded transcription factors/enzymes upstream in the signaling pathway containing VcFT. A blueberry CONSTANS-LIKE 5-like (VcCOL5) gene was down-regulated and associated with five other differentially expressed (DE) genes in the photoperiod-mediated flowering pathway. Three down-regulated genes, i.e., a MADS-AFFECTING FLOWERING 2-like gene (VcMAF2), a MADS-AFFECTING FLOWERING 5-like gene (VcMAF5), and a VERNALIZATION1-like gene (VcVRN1), may function as integrators in place of FLOWERING LOCUS C (FLC) in the vernalization pathway. Because no CONSTAN1-like or FLOWERING LOCUS C-like genes were found in blueberry, VcCOL5 and VcMAF2/VcMAF5 or VRN1 might be the major integrator(s) in the photoperiod- and vernalization-mediated flowering pathway, respectively. The major down-stream genes of VcFT, i.e., SUPPRESSOR of Overexpression of Constans 1-like (VcSOC1), LEAFY-like (VcLFY), APETALA1-like (VcAP1), CAULIFLOWER 1-like (VcCAL1), and FRUITFULL-like (VcFUL) genes were present and showed high similarity to their orthologues in herbaceous plants. Moreover, overexpression of VcFT promoted expression of all of these

  9. PACAP-38 but not VIP induces release of CGRP from trigeminal nucleus caudalis via a receptor distinct from the PAC1 receptor

    DEFF Research Database (Denmark)

    Jansen-Olesen, Inger; Baun, Michael; Amrutkar, Dipak V

    2014-01-01

    nucleus caudalis (TNC) was quantified by EIA. Regulation of NOS-enzymes caused by VIP and PACAP was investigated in dura mater, TG and TNC by measuring the conversion of L-[3H]arginine to L-[3H]citrulline. Co-expression of PACAP, neuronal nitric oxide synthase (nNOS) and CGRP was explored...

  10. CGRP infusion in unanesthetized rats increases expression of c-Fos in the nucleus tractus solitarius and caudal ventrolateral medulla, but not in the trigeminal nucleus caudalis

    DEFF Research Database (Denmark)

    Bhatt, Deepak K; Ramachandran, Roshni; Christensen, Sarah Louise Tangsgaard

    2015-01-01

    caudalis (TNC) was isolated at different time points after CGRP infusion. The level of c-Fos mRNA and protein expression in TNC were analyzed by qPCR and immunohistochemistry. c-Fos-stained nuclei were also counted in the nucleus tractus solitarius (NTS) and caudal ventrolateral medulla (CVLM), integrative...

  11. Erosion and corrosion resistance of laser cladded AISI 420 stainless steel reinforced with VC

    Science.gov (United States)

    Zhang, Zhe; Yu, Ting; Kovacevic, Radovan

    2017-07-01

    Metal Matrix Composites (MMC) fabricated by the laser cladding process have been widely applied as protective coatings in industries to improve the wear, erosion, and corrosion resistance of components and prolong their service life. In this study, the AISI 420/VC metal matrix composites with different weight percentage (0 wt.%-40 wt.%) of Vanadium Carbide (VC) were fabricated on a mild steel A36 by a high power direct diode laser. An induction heater was used to preheat the substrate in order to avoid cracks during the cladding process. The effect of carbide content on the microstructure, elements distribution, phases, and microhardness was investigated in detail. The erosion resistance of the coatings was tested by using the abrasive waterjet (AWJ) cutting machine. The corrosion resistance of the coatings was studied utilizing potentiodynamic polarization. The results showed that the surface roughness and crack susceptibility of the laser cladded layer were increased with the increase in VC fraction. The volume fraction of the precipitated carbides was increased with the increase in the VC content. The phases of the coating without VC consisted of martensite and austenite. New phases such as precipitated VC, V8C7, M7C3, and M23C6 were formed when the primary VC was added. The microhardness of the clads was increased with the increase in VC. The erosion resistance of the cladded layer was improved after the introduction of VC. The erosion resistance was increased with the increase in the VC content. No obvious improvement of erosion resistance was observed when the VC fraction was above 30 wt.%. The corrosion resistance of the clads was decreased with the increase in the VC content, demonstrating the negative effect of VC on the corrosion resistance of AISI 420 stainless steel

  12. Erosion and corrosion resistance of laser cladded AISI 420 stainless steel reinforced with VC

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Zhe [Center for Laser-aided Manufacturing, Lyle School of Engineering, Southern Methodist University, 3101 Dyer Street, Dallas, TX 75206 (United States); Yu, Ting [Center for Laser-aided Manufacturing, Lyle School of Engineering, Southern Methodist University, 3101 Dyer Street, Dallas, TX 75206 (United States); School of Mechanical and Electrical Engineering, Nanchang University, Nanchang, Jiangxi 330031 (China); Kovacevic, Radovan, E-mail: kovacevi@smu.edu [Center for Laser-aided Manufacturing, Lyle School of Engineering, Southern Methodist University, 3101 Dyer Street, Dallas, TX 75206 (United States)

    2017-07-15

    Highlights: • The coatings of 420 stainless steel reinforced with VC were fabricated by high power direct diode laser. • The erosion resistance of the cladded layer was increased with the increase in the VC fraction. • No obvious improvement of erosion resistance was observed when the VC fraction was above 30 wt.%. • The corrosion resistance of the cladded layer was decreased with the increase in the VC fraction. - Abstract: Metal Matrix Composites (MMC) fabricated by the laser cladding process have been widely applied as protective coatings in industries to improve the wear, erosion, and corrosion resistance of components and prolong their service life. In this study, the AISI 420/VC metal matrix composites with different weight percentage (0 wt.%–40 wt.%) of Vanadium Carbide (VC) were fabricated on a mild steel A36 by a high power direct diode laser. An induction heater was used to preheat the substrate in order to avoid cracks during the cladding process. The effect of carbide content on the microstructure, elements distribution, phases, and microhardness was investigated in detail. The erosion resistance of the coatings was tested by using the abrasive waterjet (AWJ) cutting machine. The corrosion resistance of the coatings was studied utilizing potentiodynamic polarization. The results showed that the surface roughness and crack susceptibility of the laser cladded layer were increased with the increase in VC fraction. The volume fraction of the precipitated carbides was increased with the increase in the VC content. The phases of the coating without VC consisted of martensite and austenite. New phases such as precipitated VC, V{sub 8}C{sub 7}, M{sub 7}C{sub 3}, and M{sub 23}C{sub 6} were formed when the primary VC was added. The microhardness of the clads was increased with the increase in VC. The erosion resistance of the cladded layer was improved after the introduction of VC. The erosion resistance was increased with the increase in the VC content

  13. Predissociation measurements of bond dissociation energies: VC, VN, and VS

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Eric L.; Davis, Quincy C.; Morse, Michael D. [Department of Chemistry, University of Utah, Salt Lake City, Utah 84112 (United States)

    2016-06-21

    The abrupt onset of predissociation in the congested electronic spectra of jet-cooled VC, VN, and VS has been observed using resonant two-photon ionization spectroscopy. It is argued that because of the high density of electronic states in these molecules, the predissociation threshold occurs at the thermochemical threshold for the production of separated atoms in their ground electronic states. As a result, the measured threshold represents the bond dissociation energy. Using this method, bond dissociation energies of D{sub 0}(V C) = 4.1086(25) eV, D{sub 0}(V N) = 4.9968(20) eV, and D{sub 0}(V S) = 4.5353(25) eV are obtained. From these values, enthalpies of formation are derived as Δ{sub f,0K}H°(V C(g)) = 827.0 ± 8 kJ mol{sup −1}, Δ{sub f,0K}H°(V N(g)) = 500.9 ± 8 kJ mol{sup −1}, and Δ{sub f,0K}H°(V S(g)) = 349.3 ± 8 kJ mol{sup −1}. Using a thermochemical cycle and the well-known ionization energies of V, VC, and VN, our results also provide D{sub 0}(V{sup +}–C) = 3.7242(25) eV and D{sub 0}(V{sup +}–N) = 4.6871(20) eV. These values are compared to previous measurements and to computational results. The precision of these bond dissociation energies makes them good candidates for testing computational chemistry methods, particularly those that employ density functional theory.

  14. Coaching Small Biotech Companies into Success: The Value-adding Function of VC

    OpenAIRE

    Terttu Luukkonen,; Mari Maunula,

    2006-01-01

    The paper reports an empirical study on the non-financial value-added provided by Venture Capital investors to their investee firms. This study will use a four-class grouping of the various non-financial value-adding capabilities provided by VC firms, namely, scouting, monitoring, signalling and value-adding services. The study examines biotechnology industry in Finland. Finland has a dual system with independent (partially ever-green) VC companies and public or semi-public VC organisations. ...

  15. CILOSTAZOL INDUCES C-FOS EXPRESSION IN THE TRIGEMINAL NUCLEUS CAUDALIS AND BEHAVIOURAL CHANGES SUGGESTIVE OF HEADACHE WITH MIGRAINE-LIKE MANIFESTATIONS IN RATS

    DEFF Research Database (Denmark)

    Christensen, S. L. T.; Petersen, S.; Sorensen, D. B.

    2016-01-01

    in rats. Also, we tested the response to sumatriptan in order to evaluate the predictive properties of the model. Methods: The effect of cilostazol (125 mg/kg p.o.) was evaluated on a range of spontaneous behavioural parameters, light sensitivity and mechanical sensitivity thresholds. To assess headache...... specificity we evaluated the c-fos expression in the trigeminal nucleus caudalis. All experiments were done in female Sprague Dawley rats and the oestrous cycle was included in the analyses. Results: We found that cilostazol increased the light sensitivity and grooming behaviour of the rats and decreased......: The altered behaviours are suggestive of headache with migraine features, but not specific. The c-fos response in the trigeminal nucleus caudalis implies that the rats had pain originating from the head. The lack of response to sumatriptan disqualifies the model as predictive, but confirms the translation...

  16. Cilostazol induces C-fos expression in the trigeminal nucleus caudalis and behavioural changes suggestive of headache with the migraine-like feature photophobia in female rats

    DEFF Research Database (Denmark)

    Christensen, S L; Petersen, Steffen; Sørensen, Dorte B

    2018-01-01

    -like behaviours and c-fos expression in rats. In order to evaluate the predictive validity of the model, we examined the response to the migraine specific drug sumatriptan. Methods The effect of cilostazol (125 mg/kg p.o.) in female Sprague Dawley rats was evaluated on a range of spontaneous behavioural...... parameters, light sensitivity and mechanical sensitivity thresholds. We also measured c-fos expression in the trigeminal nucleus caudalis. Results Cilostazol increased light sensitivity and grooming behaviour. These manifestations were not inhibited by sumatriptan. Cilostazol also induced c-fos expression...... in the trigeminal nucleus caudalis. Furthermore, trigeminal - but not hind paw hyperalgesia was observed. Conclusion The altered behaviours are suggestive of cilostazol induced headache with migraine-like features, but not specific. The presence of head specific hyperalgesia and the c-fos response in the trigeminal...

  17. Corrosion behaviour of WC-VC-Co hardmetals in acidic media

    CSIR Research Space (South Africa)

    Konadu, DS

    2010-09-01

    Full Text Available The effect of increasing vanadium carbide (VC) content on the corrosion behaviour of tungsten carbide – 10 wt% cobalt hard metals was investigated in 1 M hydrochloric (HCl), and sulphuric (H2SO4) acids solutions. Increasing VC content makes the open...

  18. Fine structural survey of the intermediate subnucleus of the nucleus tractus solitarii and its glossopharyngeal afferent terminals.

    Science.gov (United States)

    Hayakawa, Tetsu; Maeda, Seishi; Tanaka, Koichi; Seki, Makoto

    2005-10-01

    The intermediate subnucleus of the nucleus tractus solitarii (imNTS) receives somatosensory inputs from the soft palate and pharynx, and projects onto the nucleus ambiguus, thus serving as a relay nucleus for swallowing. The ultrastructure and synaptology of the rat imNTS, and its glossopharyngeal afferent terminals, have been examined with cholera toxin-conjugated horseradish peroxidase (CT-HRP) as an anterograde tracer. The imNTS contained oval or ellipsoid-shaped, small to medium-sized neurons (18.2 x 11.4 microm) with little cytoplasm, few cell organelles and an irregularly shaped nucleus. The cytoplasm often contained one or two nucleolus-like stigmoid bodies. The average number of axosomatic terminals was 1.8 per profile. About 83% of them contained round vesicles and formed asymmetric synaptic contacts (Gray's type I), while about 17% contained pleomorphic vesicles and formed symmetric synaptic contacts (Gray's type II). The neuropil contained small or large axodendritic terminals, and about 92% of them were Gray's type I. When CT-HRP was injected into the nodose ganglion, many labeled terminals were found in the imNTS. All anterogradely labeled terminals contacted dendrites but not somata. The labeled terminals were usually large (2.69+/-0.09 mum) and exclusively of Gray's type I. They often contacted more than two dendrites, were covered with glial processes, and formed synaptic glomeruli. A small unlabeled terminal occasionally made an asymmetric synaptic contact with a large labeled terminal. The large glossopharyngeal afferent terminals and the neurons containing stigmoid bodies characterized the imNTS neurons that received pharyngeal afferents.

  19. Ultrastructure of the central subnucleus of the nucleus tractus solitarii and the esophageal afferent terminals in the rat.

    Science.gov (United States)

    Hayakawa, Tetsu; Takanaga, Akinori; Tanaka, Koichi; Maeda, Seishi; Seki, Makoto

    2003-03-01

    The central subnucleus of the nucleus tractus solitarii (ceNTS) receives afferent projections from the esophageal wall and projects to the nucleus ambiguus, thus serving as a relay nucleus for peristalsis of the esophagus. Here we examine the synaptic organization of the ceNTS, and its esophageal afferents by using transganglionic anterograde transport of cholera toxin-conjugated horseradish peroxidase (CT-HRP). When CT-HRP was injected into the subdiaphragmatic esophagus, many anterogradely labeled terminals were found only in the ceNTS. The ceNTS was composed of round or oval-shaped, small neurons (14.7x8.7 micro m) containing sparse organelles and an irregularly shaped nucleus. The average number of axosomatic terminals was only 1.3 per section cut through the nucleolus. Most of them (92%) contained round vesicles and formed asymmetric synaptic contacts (Gray's type I), and a few (8%) contained pleomorphic vesicles and formed symmetric synaptic contacts (Gray's type II). All anterogradely labeled terminals contacted dendrites but not the neuronal somata. The labeled terminals were large (2.55+/-0.07 micro m) and exclusively Gray's type I. More than half of them (60%) contacted small dendrites (less than 1 micro m in diameter), and contained dense-cored vesicles. More than 40% of the labeled terminals contacted two to four dendrites, thus forming a synaptic glomerulus. Sometimes a labeled terminal that contacted an unlabeled terminal by an adherent junction was found within the glomerulus. The large terminals and these complex synaptic relations appeared to characterize the esophageal afferent projections in the ceNTS.

  20. [Accidents of the everyday life (AcVC) in children in Dakar: about 201 cases].

    Science.gov (United States)

    Mohamed, Azhar Salim; Sagna, Aloïse; Fall, Mbaye; Ndoye, Ndeye Aby; Mbaye, Papa Alassane; Fall, Aimé Lakh; Diaby, Alou; Ndour, Oumar; Ngom, Gabriel

    2017-01-01

    Accidents of everyday life (AcVC) are common in children and can led to disabling injuries and death. This study aimed to analyze the epidemiological aspects of AcVC and the related injury mechanisms in Dakar. We conducted a descriptive, cross-sectional study conducted from 1 January 2013 to 30 June 2013. All the children victims of domestic accidents, sport and leisure accidents or school accidents were included. We studied some general parameters and some parameters related to each type of AcVC. Two hundred and one children were included, accounting for 27% of emergency consultations. There were 148 boys and 53 girls. Children less than 5 years of age were most affected (37.8%). Football and wrestling game were the main causes of AcVC. AcVC occur mainly at home (58.2%) and in the areas of sport and recreation (31.8%). The fractures predominated in the different types of AcVC: 54.9% of domestic accidents, 68.8% of sport and recreation accidents and 40% of school accidents. From an epidemiological perspective, our results are superimposable to literature. Fractures predominated contrary to literature where bruises were preponderant. Wrestling game is the main cause of these fractures, after football. The acquisition of knowledge about the epidemiological aspects of AcVC and the related injury mechanisms will allow for prevention campaigns in Dakar.

  1. Design of Remote Power Plant Monitoring System Based on LabVIEW and VC++ Software

    Directory of Open Access Journals (Sweden)

    Dawei Tan

    2013-05-01

    Full Text Available This study designs a real-time remote monitoring system based on LabVIEW and Microsoft Visual C++ for Plant Units. The server written in LabVIEW uses for data acquisition and storage. The server adopts the TCP and DataSocket to communicate with the VC client. The remote VC client can accept real-time data and process data, enabling remote monitoring.

  2. Crystal Structure of VC0702 at 2.0 Angstrom: Conserved Hypothetical Protein from Vibrio Cholerae

    International Nuclear Information System (INIS)

    Ni, S.; Forouhar, F.; Bussiere, D.; Robinson, H.; Kennedy, M.

    2006-01-01

    VC0702, a conserved hypothetical protein of unknown function from Vibrio cholerae, resides in a three-gene operon containing the MbaA gene that encodes for a GGDEF and EAL domain-containing protein which is involved in regulating formation of the extracellular matrix of biofilms in Vibrio cholerae. The VC0702 crystal structure has been determined at 2.0 Angstroms and refined to R work = 22.8% and R free = 26.3%. VC0702 crystallized in an orthorhombic crystal lattice in the C2221 space group with dimensions of a = 66.61 Angstroms, b = 88.118 Angstroms, and c = 118.35 Angstroms with a homodimer in the asymmetric unit. VC0702, which forms a mixed α + β three-layered αβα sandwich, belongs to the Pfam DUF84 and COG1986 families of proteins. Sequence conservation within the DUF84 and COG1986 families was used to identify a conserved patch of surface residues that define a cleft and potential substrate-binding site in VC0702. The three-dimensional structure of VC0702 is similar to that of Mj0226 from Methanococcus janeschii, which has been identified as a novel NTPase that binds NTP in a deep cleft similarly located to the conserved patch of surface residues that define an analogous cleft in VC0702. Collectively, the data suggest that VC0702 may have a biochemical function that involves NTP binding and phosphatase activity of some kind, and is likely involved in regulation of the signaling pathway that controls biofilm formation and maintenance in Vibrio cholerae

  3. PERFORMANCE ANALYSIS OF OPTICAL CDMA SYSTEM USING VC CODE FAMILY UNDER VARIOUS OPTICAL PARAMETERS

    Directory of Open Access Journals (Sweden)

    HASSAN YOUSIF AHMED

    2012-06-01

    Full Text Available The intent of this paper is to study the performance of spectral-amplitude coding optical code-division multiple-access (OCDMA systems using Vector Combinatorial (VC code under various optical parameters. This code can be constructed by an algebraic way based on Euclidian vectors for any positive integer number. One of the important properties of this code is that the maximum cross-correlation is always one which means that multi-user interference (MUI and phase induced intensity noise are reduced. Transmitter and receiver structures based on unchirped fiber Bragg grating (FBGs using VC code and taking into account effects of the intensity, shot and thermal noise sources is demonstrated. The impact of the fiber distance effects on bit error rate (BER is reported using a commercial optical systems simulator, virtual photonic instrument, VPITM. The VC code is compared mathematically with reported codes which use similar techniques. We analyzed and characterized the fiber link, received power, BER and channel spacing. The performance and optimization of VC code in SAC-OCDMA system is reported. By comparing the theoretical and simulation results taken from VPITM, we have demonstrated that, for a high number of users, even if data rate is higher, the effective power source is adequate when the VC is used. Also it is found that as the channel spacing width goes from very narrow to wider, the BER decreases, best performance occurs at a spacing bandwidth between 0.8 and 1 nm. We have shown that the SAC system utilizing VC code significantly improves the performance compared with the reported codes.

  4. Total organizational team building at the V.C. Summer Nuclear Station

    International Nuclear Information System (INIS)

    Carswell, R.W.; Parks, J.W.

    1988-01-01

    The V.C. Summer station of South Carolina Electric and Gas Company began a total organizational team building program in 1985 as one of several methods by which to make overall operational improvements. The team model selected was developed by Carswell ampersand Associated, Inc. The model has been used successfully in a number of nonnuclear applications. This was its first usage in a nuclear power plant. Total organizational team building has had positive results at the V.C. Summer station. The data suggest that including all employees in decision making can assist with increasing efficiency, morale, and safety in a nuclear power plant

  5. Purinergic receptors are involved in tooth-pulp evoked nocifensive behavior and brainstem neuronal activity

    Directory of Open Access Journals (Sweden)

    Sessle Barry J

    2010-09-01

    Full Text Available Abstract Background To evaluate whether P2X receptors are involved in responses to noxious pulp stimulation, the P2X3 and P2X2/3 receptor agonist α,β-methyleneATP (α,β-meATP was applied to the molar tooth pulp and nocifensive behavior and extracellular-signal regulated kinase (ERK phosphorylation in trigeminal spinal subnucleus caudalis (Vc, trigeminal spinal subnucleus interpolaris (Vi, upper cervical spinal cord (C1/C2 and paratrigeminal nucleus (Pa5 neurons were analyzed in rats. Results Genioglossus (GG muscle activity was evoked by pulpal application of 100 mM α,β-meATP and was significantly larger than GG activity following vehicle (phosphate-buffered saline PBS application (p 1, P2X3 and, P2X2/3 antagonist. A large number of pERK-LI cells were expressed in the Vc, Vi/Vc, C1/C2 and Pa5 at 5 min following pulpal application of 100 mM α,β-meATP compared to PBS application to the pulp (p Conclusions The present findings suggest that activation of P2X3 and P2X2/3 receptors in the tooth pulp is sufficient to elicit nociceptive behavioral responses and trigeminal brainstem neuronal activity.

  6. Carbon Textile Decorated with Pseudocapacitive VC/Vx Oy for High-Performance Flexible Supercapacitors.

    Science.gov (United States)

    Van Lam, Do; Shim, Hyung Cheoul; Kim, Jae-Hyun; Lee, Hak-Joo; Lee, Seung-Mo

    2017-11-01

    It is demonstrated that, via V 2 O 5 coating by low temperature atomic layer deposition and subsequent pyrolysis, ubiquitous cotton textile can readily turn into high-surface-area carbon textile fully decorated with pseudocapacitive V x O y /VC widely usable as electrodes of high-performance supercapacitor. It is found that carbothermic reduction of V 2 O 5 (C + V 2 O 5 → C' + VC + CO/CO 2 (g)) leads to chemical/mechanical activation of carbon textile, thereby producing high-surface-area conductive carbon textile. In addition, sequential phase transformation and carbide formation (V 2 O 5 → V x O y → VC) occurred by carbothermic reduction trigger decoration of the carbon textile with redox-active V x O y /VC. Thanks to the synergistic effect of electrical double layer and pseudocapacitance, the supercapacitors made of the hybrid carbon textile exhibit far better energy density (over 30-fold increase) with excellent cycling stability than the carbon textile simply undergone pyrolysis. The method can open up a promising and facile way to synthesize hybrid electrode materials for electrochemical energy storages possessing advantages of both electrical double layer and pseudocapacitive material. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. Genetic characterization of ØVC8 lytic phage for Vibrio cholerae O1.

    Science.gov (United States)

    Solís-Sánchez, Alejandro; Hernández-Chiñas, Ulises; Navarro-Ocaña, Armando; De la Mora, Javier; Xicohtencatl-Cortes, Juan; Eslava-Campos, Carlos

    2016-03-22

    Epidemics and pandemics of cholera, a diarrheal disease, are attributed to Vibrio cholera serogroups O1 and O139. In recent years, specific lytic phages of V. cholera have been proposed to be important factors in the cyclic occurrence of cholera in endemic areas. However, the role and potential participation of lytic phages during long interepidemic periods of cholera in non-endemic regions have not yet been described. The purpose of this study was to isolate and characterize specific lytic phages of V. cholera O1 strains. Sixteen phages were isolated from wastewater samples collected at the Endhó Dam in Hidalgo State, Mexico, concentrated with PEG/NaCl, and purified by density gradient. The lytic activity of the purified phages was tested using different V. cholerae O1 and O139 strains. Phage morphology was visualized by transmission electron microscopy (TEM), and phage genome sequencing was performed using the Genome Analyzer IIx System. Genome assembly and bioinformatics analysis were performed using a set of high-throughput programs. Phage structural proteins were analyzed by mass spectrometry. Sixteen phages with lytic and lysogenic activity were isolated; only phage ØVC8 showed specific lytic activity against V. cholerae O1 strains. TEM images of ØVC8 revealed a phage with a short tail and an isometric head. The ØVC8 genome comprises linear double-stranded DNA of 39,422 bp with 50.8 % G + C. Of the 48 annotated ORFs, 16 exhibit homology with sequences of known function and several conserved domains. Bioinformatics analysis showed multiple conserved domains, including an Ig domain, suggesting that ØVC8 might adhere to different mucus substrates such as the human intestinal epithelium. The results suggest that ØVC8 genome utilize the "single-stranded cohesive ends" packaging strategy of the lambda-like group. The two structural proteins sequenced and analyzed are proteins of known function. ØVC8 is a lytic phage with specific activity against V. cholerae

  8. Trigeminal-Rostral Ventromedial Medulla circuitry is involved in orofacial hyperalgesia contralateral to tissue injury

    Directory of Open Access Journals (Sweden)

    Chai Bryan

    2012-10-01

    Full Text Available Abstract Background Our previous studies have shown that complete Freund’s adjuvant (CFA-induced masseter inflammation and microinjection of the pro-inflammatory cytokine interleukin-1β (IL-1β into the subnucleus interpolaris/subnucleus caudalis transition zone of the spinal trigeminal nucleus (Vi/Vc can induce contralateral orofacial hyperalgesia in rat models. We have also shown that contralateral hyperalgesia is attenuated with a lesion of the rostral ventromedial medulla (RVM, a critical site of descending pain modulation. Here we investigated the involvement of the RVM-Vi/Vc circuitry in mediating contralateral orofacial hyperalgesia after an injection of CFA into the masseter muscle. Results Microinjection of the IL-1 receptor antagonist (5 nmol, n=6 into the ipsilateral Vi/Vc attenuated the CFA-induced contralateral hyperalgesia but not the ipsilateral hyperalgesia. Intra-RVM post-treatment injection of the NK1 receptor antagonists, RP67580 (0.5-11.4 nmol and L-733,060 (0.5-11.4 nmol, attenuated CFA-induced bilateral hyperalgesia and IL-1β induced bilateral hyperalgesia. Serotonin depletion in RVM neurons prior to intra-masseter CFA injection prevented the development of contralateral hyperalgesia 1–3 days after CFA injection. Inhibition of 5-HT3 receptors in the contralateral Vi/Vc with direct microinjection of the select 5-HT3 receptor antagonist, Y-25130 (2.6-12.9 nmol, attenuated CFA-induced contralateral hyperalgesia. Lesions to the ipsilateral Vc prevented the development of ipsilateral hyperalgesia but did not prevent the development of contralateral hyperalgesia. Conclusions These results suggest that the development of CFA-induced contralateral orofacial hyperalgesia is mediated through descending facilitatory mechanisms of the RVM-Vi/Vc circuitry.

  9. Terrier Black Brant VC design characteristics and program status. [rocket development

    Science.gov (United States)

    Payne, B. R.; Mayo, E. E.

    1979-01-01

    In the present paper, the design analysis of the Terrier-Black Brant VC, representing the latest addition to the Black Brant rocket family, is discussed, including the aerodynamic, structural, thermal, and operational aspects. An appreciable increase in apogee, as compared to the BBVC and Nike/BBVC, is achieved without any modifications to the well-proven BBV motor or degradation of the thermal or dynamic flight environment.

  10. Intelligent MONitoring System for antiviral pharmacotherapy in patients with chronic hepatitis C (SiMON-VC

    Directory of Open Access Journals (Sweden)

    Luis Margusino-Framiñán

    2017-01-01

    Full Text Available Two out of six strategic axes of pharmaceutical care in our hospital are quality and safety of care, and the incorporation of information technologies. Based on this, an information system was developed in the outpatient setting for pharmaceutical care of patients with chronic hepatitis C, SiMON-VC, which would improve the quality and safety of their pharmacotherapy. The objective of this paper is to describe requirements, structure and features of Si- MON-VC. Requirements demanded were that the information system would enter automatically all critical data from electronic clinical records at each of the visits to the Outpatient Pharmacy Unit, allowing the generation of events and alerts, documenting the pharmaceutical care provided, and allowing the use of data for research purposes. In order to meet these requirements, 5 sections were structured for each patient in SiMON-VC: Main Record, Events, Notes, Monitoring Graphs and Tables, and Follow-up. Each section presents a number of tabs with those coded data needed to monitor patients in the outpatient unit. The system automatically generates alerts for assisted prescription validation, efficacy and safety of using antivirals for the treatment of this disease. It features a completely versatile Indicator Control Panel, where temporary monitoring standards and alerts can be set. It allows the generation of reports, and their export to the electronic clinical record. It also allows data to be exported to the usual operating systems, through Big Data and Business Intelligence. Summing up, we can state that SiMON-VC improves the quality of pharmaceutical care provided in the outpatient pharmacy unit to patients with chronic hepatitis C, increasing the safety of antiviral therapy.

  11. High hardness-high toughness WC-20Co nanocomposites: Effect of VC variation and sintering temperature

    International Nuclear Information System (INIS)

    Kumar, Devender; Singh, K.

    2016-01-01

    WC-Co nanocomposites with variable VC content are synthesized by liquid phase sintering at two different temperatures. The as synthesized samples are characterized by X-ray diffraction (XRD), field emission scanning electron microscope (FE-SEM) and optical microscope. The mechanical properties are obtained by Vickers indentation method. The high content of VC, lead to high porosity when sintering temperature is increased from 1350 to 1400 °C. The relative density of all the samples is more than 95%. Microstructure reveals that agglomeration of W-Co-C and V-W-C increases at 1400 °C, which generates layered interfaces in radial direction and hence the material inhomogeneity. XRD pattern shows that the formation of η phase increases at 1400 °C, which is responsible to decrease the fracture toughness of the present samples. The average particle size of 102 nm, highest hardness of 1870.6 kgf/mm"2 with fracture toughness of 14.4 MN/mm"3"/"2 is observed in sample having 7.5 wt% VC, sintered at 1350 °C for one minute. This combination shows the highest hardness and reasonably high toughness as compared to conventionally sintered materials reported so far.

  12. The bacterial dicarboxylate transporter VcINDY uses a two-domain elevator-type mechanism.

    Science.gov (United States)

    Mulligan, Christopher; Fenollar-Ferrer, Cristina; Fitzgerald, Gabriel A; Vergara-Jaque, Ariela; Kaufmann, Desirée; Li, Yan; Forrest, Lucy R; Mindell, Joseph A

    2016-03-01

    Secondary transporters use alternating-access mechanisms to couple uphill substrate movement to downhill ion flux. Most known transporters use a 'rocking bundle' motion, wherein the protein moves around an immobile substrate-binding site. However, the glutamate-transporter homolog GltPh translocates its substrate-binding site vertically across the membrane, through an 'elevator' mechanism. Here, we used the 'repeat swap' approach to computationally predict the outward-facing state of the Na(+)/succinate transporter VcINDY, from Vibrio cholerae. Our model predicts a substantial elevator-like movement of VcINDY's substrate-binding site, with a vertical translation of ~15 Å and a rotation of ~43°. Our observation that multiple disulfide cross-links completely inhibit transport provides experimental confirmation of the model and demonstrates that such movement is essential. In contrast, cross-links across the VcINDY dimer interface preserve transport, thus revealing an absence of large-scale coupling between protomers.

  13. Origin of VC-only plumes from naturally enhanced dechlorination in a peat-rich hydrogeologic setting

    Science.gov (United States)

    Filippini, Maria; Amorosi, Alessandro; Campo, Bruno; Herrero-Martìn, Sara; Nijenhuis, Ivonne; Parker, Beth L.; Gargini, Alessandro

    2016-09-01

    The occurrence of vinyl chloride (VC) is often a main concern at sites contaminated with chlorinated solvents due to its high degree of toxicity and carcinogenicity. VC occurrence in aquifers is most often related to the degradation of higher chlorinated ethenes or ethanes and it is generally detected in plumes along with parent contaminants. However, specific combination of stratigraphic, hydrogeologic and geochemical conditions can enhance the degradation of parents and lead to the formation of plumes almost entirely composed of VC (i.e. VC-only plumes). This paper investigates the causes of VC-only plumes in the aquifers below the city of Ferrara (northern Italy) by combining multiple lines of evidence. The City of Ferrara is located on an alluvial lowland, built by the River Po, and is made up of alternating unconsolidated sandy aquifer and silt-clay aquitard deposits of fluvial origin. This region has been strongly impacted by prior industrial activities, with the occurrence of chlorinated compounds at several sites. VC-only plumes with uncertain source location were found at two contaminated sites. The source zone of a third plume composed of chloroethenes from PCE to VC was investigated for high resolution depositional facies architecture and contaminant distribution (contaminant concentration and Compound Specific Isotope Analysis - CSIA). The investigation suggested that degradation of PCE and TCE takes place during contaminant migration through peat-rich (swamp) layers related to the Holocene transgression, which locally act as a ;reactor; for stimulating degradation with the accumulation of VC in the strongly reducing environment of the peat. Regional-scale stratigraphic architecture showed the ubiquitous occurrence of swamp layers at distinct stratigraphic levels in the investigated system and their apparent linkage to the in situ creation of the VC-only plumes.

  14. MICROSTRUCTURE AND TENSILE PROPERTIES OF Fe3Al-BASED ALLOYS WITH VC AND TiC ADDITIONS

    Institute of Scientific and Technical Information of China (English)

    W.L.Xu; Y.S.Sun; S.S.Ding

    2001-01-01

    Microstructure and tensile properties of Fe3Al-based alloys with additions of TiC andVC particles have been investigated.Results show that the formation of TiC particlesresults in the refinement of the macrostructure of as-cast ingots.Although the additionof VC particles does not cause significant change of the as-cast microstructure,themicrostructure of the alloy after hot-working and recrystallization has been found tobe refined.The formation of both VC and TiC particles results in the increase of yieldstrength,especially at high temperature of 600℃.

  15. Autoradiographic localization of substance P receptors in the rat and bovine spinal cord and the rat and cat spinal trigeminal nucleus pars caudalis and the effects of neonatal capsaicin

    Energy Technology Data Exchange (ETDEWEB)

    Mantyh, P.W.; Hunt, S.P. (Medical Research Council Centre, Cambridge (UK). Medical School, MRC Neurochemical Pharmacology Unit)

    1985-04-22

    Substance P (SP) is a putative neurotransmitter in the central nervous system. In the present report the authors have used autoradiographic receptor binding techniques to investigate the distribution of SP receptor binding sites in the rat and bovine spinal cord and in the rat and cat spinal trigeminal nucleus pars caudalis. Although some quantitative differences were evident, all species appeared to have a similar distribution of SP receptor binding sites in both the spinal cord and in the spinal trigeminal nucleus pars caudalis. In the spinal cord the heaviest concentration of SP receptors is located in lamina X, while moderate to heavy concentrations were found in laminae I, II and V-IX. Very low concentrations of SP receptors were present in laminae III and IV. Examination of the cat and rat spinal trigeminal nucleus pars caudalis revealed a moderate density of SP receptor binding sites in laminae I and II, very low concentrations in laminae III and IV, and low to moderate concentrations in lamina V. Rats treated neonatally with capsaicin showed a small (11%) but significant (P < 0.02) increase in the levels of SP receptor binding sites in laminae I and II of the cervical and lumbar spinal cord while in all other laminae the levels remained unchanged.

  16. Antigenotoxic and Antimutagenic Activities of Probiotic Lactobacillus rhamnosus Vc against N-Methyl-N'-Nitro-N-Nitrosoguanidine.

    Science.gov (United States)

    Pithva, Sheetal P; Ambalam, Padma S; Ramoliya, Jignesh M; Dave, Jayantilal M; Vyas, Bharatkumar Rajiv Manuel

    2015-01-01

    The present study provides experimental evidence of in vivo reduction of genotoxic and mutagenic activities of potent carcinogen N-methyl-N'-nitro-N-nitrosoguanidine (MNNG) by the strain Lactobacillus rhamnosus Vc. In vitro studies revealed that coincubation of MNNG with viable cells of L. rhamnosus Vc resulted in the detoxification of the parent compound accompanied with reduction in genotoxicity (69%) and mutagenicity (61%) as evaluated by SOS-Chromotest and Ames test, respectively. Oral feeding of probiotic bacteria L. rhamnosus Vc (10(9) cfu) to Gallus gallus (chicks) for 30 days provided protection against MNNG-induced damage as evidenced from the significant decrease (P = 0.009) in glutathione S-transferase activity in the L. rhamnosus Vc+MNNG-treated chicks in comparison to the MNNG-treated chicks. Histopathology of colon and liver showed intact cells and mild inflammation in the L. rhamnosus Vc+MNNG-treated chicks, whereas heavy inflammation and degenerative changes were observed in MNNG-treated chicks. The results indicate that the probiotic L. rhamnosus Vc provided in vivo protection against MNNG-induced colon damage by detoxification of MNNG to less toxic metabolites.

  17. Effect of cooling rate on the microstructure and properties of FeCrVC

    International Nuclear Information System (INIS)

    Bleckmann, M.; Gleinig, J.; Hufenbach, J.; Wendrock, H.; Giebeler, L.; Zeisig, J.; Diekmann, U.; Eckert, J.; Kühn, U.

    2015-01-01

    Highlights: • Effect of cooling rate on microstructure and microhardness of newly developed steel. • Intensive study of DSC measurements was done including different cooling rates. • Examinations by XRD, EDS and EBSD as well as microhardness on the DSC samples. • Matrix phase changes with cooling rates from ferrit to martensite. • Thermodynamic calculations of solidification process shows good agreement. - Abstract: In this work a systematic investigation of the influence of the cooling rate on the microstructure and properties of a newly developed Fe92.7Cr4.2V2.1C1 (FeCrVC) tool steel is presented. By applying a tailored casting process and sufficiently high cooling rates excellent mechanical properties are obtained for the presented alloy already in the as-cast state. Since no subsequent heat treatment is required, the cooling parameters applied during the casting process play a key role with respect to the evolving microstructure and resulting properties. In the present publication the effect of the cooling rate on the microstructure and properties of as-solidified FeCrVC was investigated. By using differential scanning calorimetry (DSC), several samples were heated up and cooled with continuous rates of 3–50 K/min. The received DSC data was used to investigate the alloy’s solidification and phase transformation behavior. Subsequently, these samples were studied regarding their properties and microstructure by different analysis methods (EDX/WDX, EBSD, XRD). With increasing cooling rates the liquidus and solidus temperature are lowered, whereas the solidification interval is enlarged. A higher cooling rate is accompanied by a lower solidification time which results in a refinement of the dendritic microstructure. Furthermore, with rising cooling rates the microhardness increased. This provides the opportunity to make predictions from the applied cooling parameters upon the hardness and vice versa and enables one to draw first conclusions on the

  18. Topical dura mater application of CFA induces enhanced expression of c-fos and glutamate in rat trigeminal nucleus caudalis: attenuated by KYNA derivate (SZR72).

    Science.gov (United States)

    Lukács, M; Warfvinge, K; Tajti, J; Fülöp, F; Toldi, J; Vécsei, L; Edvinsson, L

    2017-12-01

    Migraine is a debilitating neurological disorder where trigeminovascular activation plays a key role. We have previously reported that local application of Complete Freund's Adjuvant (CFA) onto the dura mater caused activation in rat trigeminal ganglion (TG) which was abolished by a systemic administration of kynurenic acid (KYNA) derivate (SZR72). Here, we hypothesize that this activation may extend to the trigeminal complex in the brainstem and is attenuated by treatment with SZR72. Activation in the trigeminal nucleus caudalis (TNC) and the trigeminal tract (Sp5) was achieved by application of CFA onto the dural parietal surface. SZR72 was given intraperitoneally (i.p.), one dose prior CFA deposition and repeatedly daily for 7 days. Immunohistochemical studies were performed for mapping glutamate, c-fos, PACAP, substance P, IL-6, IL-1β and TNFα in the TNC/Sp5 and other regions of the brainstem and at the C 1 -C 2 regions of the spinal cord. We found that CFA increased c-fos and glutamate immunoreactivity in TNC and C 1 -C 2 neurons. This effect was mitigated by SZR72. PACAP positive fibers were detected in the fasciculus cuneatus and gracilis. Substance P, TNFα, IL-6 and IL-1β immunopositivity were detected in fibers of Sp5 and neither of these molecules showed any change in immunoreactivity following CFA administration. This is the first study demonstrating that dural application of CFA increases the expression of c-fos and glutamate in TNC neurons. Treatment with the KYNA analogue prevented this expression.

  19. Signal Transduction Mechanisms Underlying Group I mGluR-mediated Increase in Frequency and Amplitude of Spontaneous EPSCs in the Spinal Trigeminal Subnucleus Oralis of the Rat

    Directory of Open Access Journals (Sweden)

    Ahn Dong-Kuk

    2009-09-01

    Full Text Available Abstract Group I mGluRs (mGluR1 and 5 pre- and/or postsynaptically regulate synaptic transmission at glutamatergic synapses. By recording spontaneous EPSCs (sEPSCs in the spinal trigeminal subnucleus oralis (Vo, we here investigated the regulation of glutamatergic transmission through the activation of group I mGluRs. Bath-applied DHPG (10 μM/5 min, activating the group I mGluRs, increased sEPSCs both in frequency and amplitude; particularly, the increased amplitude was long-lasting. The DHPG-induced increases of sEPSC frequency and amplitude were not NMDA receptor-dependent. The DHPG-induced increase in the frequency of sEPSCs, the presynaptic effect being further confirmed by the DHPG effect on paired-pulse ratio of trigeminal tract-evoked EPSCs, an index of presynaptic modulation, was significantly but partially reduced by blockades of voltage-dependent sodium channel, mGluR1 or mGluR5. Interestingly, PKC inhibition markedly enhanced the DHPG-induced increase of sEPSC frequency, which was mainly accomplished through mGluR1, indicating an inhibitory role of PKC. In contrast, the DHPG-induced increase of sEPSC amplitude was not affected by mGluR1 or mGluR5 antagonists although the long-lasting property of the increase was disappeared; however, the increase was completely inhibited by blocking both mGluR1 and mGluR5. Further study of signal transduction mechanisms revealed that PLC and CaMKII mediated the increases of sEPSC in both frequency and amplitude by DHPG, while IP3 receptor, NO and ERK only that of amplitude during DHPG application. Altogether, these results indicate that the activation of group I mGluRs and their signal transduction pathways differentially regulate glutamate release and synaptic responses in Vo, thereby contributing to the processing of somatosensory signals from orofacial region.

  20. Facial injections of pruritogens and algogens excite partly overlapping populations of primary and second-order trigeminal neurons in mice.

    Science.gov (United States)

    Akiyama, T; Carstens, M Iodi; Carstens, E

    2010-11-01

    Intradermal cheek injection of pruitogens or algogens differentially elicits hindlimb scratching or forelimb wiping, suggesting that these behaviors distinguish between itch and pain. We studied whether pruritogens and algogens excite separate or overlapping populations of primary afferent and second-order trigeminal neurons in mice. Calcium imaging of primary sensory trigeminal ganglion (TG) cells showed that 15.4% responded to histamine, 5.8% to the protease-activated receptor (PAR)-2 agonist, 13.4% to allyl isothiocyanate (AITC), and 36.7% to capsaicin. AITC and/or capsaicin activated the vast majority of histamine- and PAR-2 agonist-sensitive TG cells. A chemical search strategy identified second-order neurons in trigeminal subnucleus caudalis (Vc) responsive to histamine, the PAR-2 agonist, or AITC. A minority of histamine or PAR-2 agonist-responsive Vc neurons responded to the other pruritogen, whereas a large majority of puritogen-responsive Vc neurons responded to capsaicin and/or AITC. A minority of AITC-responsive Vc neurons responded to pruritogens, whereas most responded to capsaicin. These data indicate that most primary and higher-order trigeminal sensory neurons are activated by both pruritic and algesic stimuli, although a minority exhibit selectivity. The results are discussed in terms of population codes for itch and pain that result in distinct behavioral responses of hindlimb scratching and forelimb wiping that are mediated at lumbar and cervical segmental levels, respectively.

  1. Microstructure and Mechanical Properties of Highly Alloyed FeCrMoVC Steel Fabricated by Spark Plasma Sintering

    Science.gov (United States)

    Oh, Seung-Jin; Jun, Joong-Hwan; Lee, Min-Ha; Shon, In-Jin; Lee, Seok-Jae

    2018-05-01

    In this study, we successfully fabricated highly alloyed FeCrMoVC specimens within 2 min by using the spark plasma sintering (SPS) method. The densities of the sintered specimens were almost identical to their theoretical values. Fine (Mo, V)-rich carbides with lamellar structure were precipitated along the grain boundaries of the as-sintered specimen, whereas relatively large carbides were formed additionally in the transgranular region during the tempering treatment. Compared with the specimen produced by a conventional casting method, the FeCrMoVC specimens from SPS showed smaller grain size with finer carbides and higher hardness values.

  2. Lightcurves and Periods for Asteroids 1081 Reseda 2117 Danmark, 2315 Czechoslovakia, 2871 Schober, 6392 Takashimizuno, and (6409) 1992 VC

    Science.gov (United States)

    Yankov, Arten; Ditteon, Richard

    2009-01-01

    Ten asteroids were observed at the Oakley Southern Sky Observatory on six nights during the months of 2008 July and August. The asteroids were 1081 Reseda, 1421 Esperanto, 2117 Danmark, 2315 Czechoslovakia, 2871 Schober, 6392 Takashimizuno, (6409) 1992 VC, 7046 Reshetnev, (14276) 2000 CF2, and (32219) 2000 OU20.

  3. Telemedicine to Reduce Medical Risk in Austere Medical Environments: The Virtual Critical Care Consultation (VC3) Service.

    Science.gov (United States)

    Powell, Douglas; McLeroy, Robert D; Riesberg, Jamie; Vasios, William N; Miles, Ethan A; Dellavolpe, Jeffrey; Keenan, Sean; Pamplin, Jeremy C

    One of the core capabilities of prolonged field care is telemedicine. We developed the Virtual Critical Care Consult (VC3) Service to provide Special Operations Forces (SOF) medics with on-demand, virtual consultation with experienced critical care physicians to optimize management and improve outcomes of complicated, critically injured or ill patients. Intensive-care doctors staff VC3 continuously. SOF medics access this service via phone or e-mail. A single phone call reaches an intensivist immediately. An e-mail distribution list is used to share information such as casualty images, vital signs flowsheet data, and short video clips, and helps maintain situational awareness among the VC3 critical care providers and other key SOF medical leaders. This real-time support enables direct communication between the remote provider and the clinical subject matter expert, thus facilitating expert management from near the point of injury until definitive care can be administered. The VC3 pilot program has been extensively tested in field training exercises and validated in several real-world encounters. It is an immediately available capability that can reduce medical risk and is scalable to all Special Operations Command forces. 2016.

  4. Hemangiosarcoma of the liver in workers of the PVC industry and other VC-induced diseases with angiologic-dermatologic, hepatologic, radiologic and neurologic symptoms

    Energy Technology Data Exchange (ETDEWEB)

    Halama, J.; Becker-Stone, S.; Halama, J.M.

    1985-01-01

    Occupational diseases resulting from exposure to vinyl chloride (VC) include angiosarcoma of the liver and other neoplasms. Among workers exposed to VC the authors have found capillary abnormalities in the extremities, with scleroderma and Raynaud syndrome, acro-osteolysis, neurological and psychiatric diseases and chromosome abnormalities, as well as abnormal liver metabolism and haematological findings.

  5. An Autonomous Satellite Time Synchronization System Using Remotely Disciplined VC-OCXOs

    Directory of Open Access Journals (Sweden)

    Xiaobo Gu

    2015-07-01

    Full Text Available An autonomous remote clock control system is proposed to provide time synchronization and frequency syntonization for satellite to satellite or ground to satellite time transfer, with the system comprising on-board voltage controlled oven controlled crystal oscillators (VC-OCXOs that are disciplined to a remote master atomic clock or oscillator. The synchronization loop aims to provide autonomous operation over extended periods, be widely applicable to a variety of scenarios and robust. A new architecture comprising the use of frequency division duplex (FDD, synchronous time division (STDD duplex and code division multiple access (CDMA with a centralized topology is employed. This new design utilizes dual one-way ranging methods to precisely measure the clock error, adopts least square (LS methods to predict the clock error and employs a third-order phase lock loop (PLL to generate the voltage control signal. A general functional model for this system is proposed and the error sources and delays that affect the time synchronization are discussed. Related algorithms for estimating and correcting these errors are also proposed. The performance of the proposed system is simulated and guidance for selecting the clock is provided.

  6. Unified transform architecture for AVC, AVS, VC-1 and HEVC high-performance codecs

    Science.gov (United States)

    Dias, Tiago; Roma, Nuno; Sousa, Leonel

    2014-12-01

    A unified architecture for fast and efficient computation of the set of two-dimensional (2-D) transforms adopted by the most recent state-of-the-art digital video standards is presented in this paper. Contrasting to other designs with similar functionality, the presented architecture is supported on a scalable, modular and completely configurable processing structure. This flexible structure not only allows to easily reconfigure the architecture to support different transform kernels, but it also permits its resizing to efficiently support transforms of different orders (e.g. order-4, order-8, order-16 and order-32). Consequently, not only is it highly suitable to realize high-performance multi-standard transform cores, but it also offers highly efficient implementations of specialized processing structures addressing only a reduced subset of transforms that are used by a specific video standard. The experimental results that were obtained by prototyping several configurations of this processing structure in a Xilinx Virtex-7 FPGA show the superior performance and hardware efficiency levels provided by the proposed unified architecture for the implementation of transform cores for the Advanced Video Coding (AVC), Audio Video coding Standard (AVS), VC-1 and High Efficiency Video Coding (HEVC) standards. In addition, such results also demonstrate the ability of this processing structure to realize multi-standard transform cores supporting all the standards mentioned above and that are capable of processing the 8k Ultra High Definition Television (UHDTV) video format (7,680 × 4,320 at 30 fps) in real time.

  7. p38 phosphorylation in medullary microglia mediates ectopic orofacial inflammatory pain in rats.

    Science.gov (United States)

    Kiyomoto, Masaaki; Shinoda, Masamichi; Honda, Kuniya; Nakaya, Yuka; Dezawa, Ko; Katagiri, Ayano; Kamakura, Satoshi; Inoue, Tomio; Iwata, Koichi

    2015-08-12

    Orofacial inflammatory pain is likely to accompany referred pain in uninflamed orofacial structures. The ectopic pain precludes precise diagnosis and makes treatment problematic, because the underlying mechanism is not well understood. Using the established ectopic orofacial pain model induced by complete Freund's adjuvant (CFA) injection into trapezius muscle, we analyzed the possible role of p38 phosphorylation in activated microglia in ectopic orofacial pain. Mechanical allodynia in the lateral facial skin was induced following trapezius muscle inflammation, which accompanied microglial activation with p38 phosphorylation and hyperexcitability of wide dynamic range (WDR) neurons in the trigeminal spinal subnucleus caudalis (Vc). Intra-cisterna successive administration of a p38 mitogen-activated protein kinase selective inhibitor, SB203580, suppressed microglial activation and its phosphorylation of p38. Moreover, SB203580 administration completely suppressed mechanical allodynia in the lateral facial skin and enhanced WDR neuronal excitability in Vc. Microglial interleukin-1β over-expression in Vc was induced by trapezius muscle inflammation, which was significantly suppressed by SB203580 administration. These findings indicate that microglia, activated via p38 phosphorylation, play a pivotal role in WDR neuronal hyperexcitability, which accounts for the mechanical hypersensitivity in the lateral facial skin associated with trapezius muscle inflammation.

  8. Optimizing the calculation of DM,CO and VC via the single breath single oxygen tension DLCO/NO method.

    Science.gov (United States)

    Coffman, Kirsten E; Taylor, Bryan J; Carlson, Alex R; Wentz, Robert J; Johnson, Bruce D

    2016-01-15

    Alveolar-capillary membrane conductance (D(M,CO)) and pulmonary-capillary blood volume (V(C)) are calculated via lung diffusing capacity for carbon monoxide (DL(CO)) and nitric oxide (DL(NO)) using the single breath, single oxygen tension (single-FiO2) method. However, two calculation parameters, the reaction rate of carbon monoxide with blood (θ(CO)) and the D(M,NO)/D(M,CO) ratio (α-ratio), are controversial. This study systematically determined optimal θ(CO) and α-ratio values to be used in the single-FiO2 method that yielded the most similar D(M,CO) and V(C) values compared to the 'gold-standard' multiple-FiO2 method. Eleven healthy subjects performed single breath DL(CO)/DL(NO) maneuvers at rest and during exercise. D(M,CO) and V(C) were calculated via the single-FiO2 and multiple-FiO2 methods by implementing seven θ(CO) equations and a range of previously reported α-ratios. The RP θ(CO) equation (Reeves, R.B., Park, H.K., 1992. Respiration Physiology 88 1-21) and an α-ratio of 4.0-4.4 yielded DM,CO and VC values that were most similar between methods. The RP θ(CO) equation and an experimental α-ratio should be used in future studies. Copyright © 2015 Elsevier B.V. All rights reserved.

  9. Video coding standards AVS China, H.264/MPEG-4 PART 10, HEVC, VP6, DIRAC and VC-1

    CERN Document Server

    Rao, K R; Hwang, Jae Jeong

    2014-01-01

    Review by Ashraf A. Kassim, Professor, Department of Electrical & Computer Engineering, and Associate Dean, School of Engineering, National University of Singapore.     The book consists of eight chapters of which the first two provide an overview of various video & image coding standards, and video formats. The next four chapters present in detail the Audio & video standard (AVS) of China, the H.264/MPEG-4 Advanced video coding (AVC) standard, High efficiency video coding (HEVC) standard and the VP6 video coding standard (now VP10) respectively. The performance of the wavelet based Dirac video codec is compared with H.264/MPEG-4 AVC in chapter 7. Finally in chapter 8, the VC-1 video coding standard is presented together with VC-2 which is based on the intra frame coding of Dirac and an outline of a H.264/AVC to VC-1 transcoder.   The authors also present and discuss relevant research literature such as those which document improved methods & techniques, and also point to other related reso...

  10. Comparison of W-VC-C composites against Co-60, Se-75 and Sb-125 for gamma radioisotope sources

    Science.gov (United States)

    Demir, Ertugrul; Tugrul, A. Beril; Buyuk, Bulent; Yilmaz, Ozan; Ovecoglu, Lutfi

    2018-02-01

    Tungsten based materials are considered to be the promising materials for nuclear applications due to the good properties. The tungsten composite materials have so many advantages in nuclear technological applications especially fusion reactor systems. In this paper, Tungsten-Vanadium carbide-Graphite (W-VC-C) which include 93% tungsten (W), 6% vanadium carbide (VC) and 1% graphite (C) also which has three different alloying time (6-12-24 hours) were produced by mechanical alloying method. Co-60, Se-75 and Sb-125 gamma radioisotopeswere used as a gamma sources in order to determine behavior of gamma attenuation properties of the composite materials. The experimental results were compared with each other to clarify effects of varying gamma energies on the tungsten based composite materials. The mass attenuation coefficients of the samples were obtained by using XCOM computer code and compared with experimental data. The gamma linear attenuation, the mass attenuation coefficients and half value thickness (HVL) of the samples were evaluated and compared with Co-60, Se-75 and Sb-125 for gamma radioisotopes. Results showed that gamma attenuation coefficients of the samples depend on gamma energies and mechanical alloying time has negatively effect on the gamma shielding properties for the all studied W-VC-C.

  11. The Visi-Chroma VC-100: a new imaging colorimeter for dermatocosmetic research.

    Science.gov (United States)

    Barel, A O; Clarys, P; Alewaeters, K; Duez, C; Hubinon, J L; Mommaerts, M

    2001-02-01

    It was the aim of this study to carry out a comparative evaluation in vitro on standardized color charts and in vivo on healthy subjects using the Visi-Chroma VC-100, a new imaging tristimulus colorimeter and the Minolta Chromameter CR-200 as a reference instrument. The Visi-Chroma combines tristimulus color analysis with full color visualization of the skin area measured. The technical performances of both instruments were compared with the purpose of validating the use of this new imaging colorimeter in dermatocosmetic research. In vitro L*a*b* color parameters were taken with both instruments on standardized color charts (Macbeth and RAL charts) in order to evaluate accuracy, sensitivity range and repeatability. These measurements were completed by in vivo studies on different sites of human skin and studies of color changes induced by topical chemical agents on forearm skin. The accuracy, sensitivity range and repeatability of measurements of selected distances and surfaces in the measuring zone considered and specific color determinations of specific skin zones were also determined. The technical performance of this imaging colorimeter was rather good, with low coefficients of variation for repeatability of in vitro and vivo color measurements. High positive correlations were established in vitro and in vivo over a wide range of color measurements. The imaging colorimeter was able to measure the L*a*b* color parameters of specific chosen parts of the skin area considered and to measure accurately selected distances and surfaces in the same skin site considered. These comparative measurements show that both instruments have very similar technical performances and that high levels of correlation were obtained in vitro and in vivo using the L*a*b* color parameters. In addition, the Visi-Chroma presents the following improvements: 1) direct visualization and recording of the skin area considered with concomitant color measurements; 2) determination of the specific

  12. High photocatalytic degradation activity of the polyvinyl chloride (PVC)-vitamin C (VC)-TiO{sub 2} nano-composite film

    Energy Technology Data Exchange (ETDEWEB)

    Yang Changjun; Gong Chuqing; Peng Tianyou [College of Chemistry and Molecular Sciences, Wuhan University, Wuhan 430072 (China); Deng Kejian [Key Laboratory of Catalysis and Materials Science of the State Ethnic Affairs Commission and Ministry of Education, South-Central University for Nationalities, Wuhan 430074 (China); Zan Ling, E-mail: irlab@whu.edu.cn [College of Chemistry and Molecular Sciences, Wuhan University, Wuhan 430072 (China)

    2010-06-15

    A novel photodegradable polyvinyl chloride (PVC)-vitamin C (VC)-TiO{sub 2} nano-composite film was prepared by embedding VC modified nano-TiO{sub 2} photocatalyst into the commercial PVC plastic. The solid-phase photocatalytic degradation behavior of PVC-VC-TiO{sub 2} nano-composite film under UV light irradiation was investigated and compared with those of the PVC-TiO{sub 2} film and the pure PVC film, with the aid of UV-Vis spectroscopy, scanning electron microscopy (SEM), weight loss monitoring, and X-ray diffraction spectra (XRD). The results show that PVC-VC-TiO{sub 2} nano-composite film has a high photocatalytic activity; the photocatalytic degradation rate of it is two times higher than that of PVC-TiO{sub 2} film and fifteen times higher than that of pure PVC film. The optimal mass ratio of VC to TiO{sub 2} is found to be 0.5. The mechanism of enhancing photocatalytic activity is attributed to the formation of a Ti{sup IV}-VC charge-transfer complex with five-member chelate ring structure and a rapid photogenerated charge separation is thus achieved.

  13. High photocatalytic degradation activity of the polyvinyl chloride (PVC)-vitamin C (VC)-TiO2 nano-composite film

    International Nuclear Information System (INIS)

    Yang Changjun; Gong Chuqing; Peng Tianyou; Deng Kejian; Zan Ling

    2010-01-01

    A novel photodegradable polyvinyl chloride (PVC)-vitamin C (VC)-TiO 2 nano-composite film was prepared by embedding VC modified nano-TiO 2 photocatalyst into the commercial PVC plastic. The solid-phase photocatalytic degradation behavior of PVC-VC-TiO 2 nano-composite film under UV light irradiation was investigated and compared with those of the PVC-TiO 2 film and the pure PVC film, with the aid of UV-Vis spectroscopy, scanning electron microscopy (SEM), weight loss monitoring, and X-ray diffraction spectra (XRD). The results show that PVC-VC-TiO 2 nano-composite film has a high photocatalytic activity; the photocatalytic degradation rate of it is two times higher than that of PVC-TiO 2 film and fifteen times higher than that of pure PVC film. The optimal mass ratio of VC to TiO 2 is found to be 0.5. The mechanism of enhancing photocatalytic activity is attributed to the formation of a Ti IV -VC charge-transfer complex with five-member chelate ring structure and a rapid photogenerated charge separation is thus achieved.

  14. Effects of chromium addition on microstructure and properties of TiC–VC reinforced Fe-based laser cladding coatings

    International Nuclear Information System (INIS)

    Zhang, Hui; Zou, Yong; Zou, Zengda; Shi, Chuanwei

    2014-01-01

    Highlights: • In situ TiC–VC reinforced Fe-based coatings with different Cr addition were obtained. • Some long strip Cr 3 C 2 synthesized while the Cr addition was 12.0% or more. • A moderate amount of Cr improved hardness and corrosion resistance significantly. • The cladding layer microhardness could reach as high as 1090HV 0.2 with 3.0% Cr. • The corrosion resistance could improve 4.5 times with 12.0% Cr. - Abstract: Effects of different addition of Cr on microstructure and properties (especially the corrosion resistance) of cladding layers were investigated by means of X-ray diffractometry (XRD), scanning electron microscopy (SEM), energy dispersive spectrometer (EDS), potentio-dynamic polarization and electrochemical impedance spectroscopy (EIS). Results showed that Fe–Ti–V–C alloy powders with different addition of Cr formed good cladding layers without defects such as cracking and porosity. Phases of the cladding layers were α-Fe, γ-Fe, TiC, VC and TiVC 2 . A certain amount of long strip Cr 3 C 2 synthesized while the addition of Cr was 12.0% or more. Microhardness and corrosion resistance of cladding layer both improved greatly with a moderate amount of Cr. The cladding layer with 3.0% Cr showed a highest microhardness 1090HV 0.2 , and the variation tendency of the hardness is not a linearly relationship with increasing the chromium addition. The cladding layer with 12.0% Cr addition showed the best corrosion resistance, which was about 4.5 times than that of the cladding layer without Cr. EIS spectrum of the cladding layer without Cr was composed of an inductive arc at low frequency and a capacitive arc at high frequency. However, the inductive arc at low frequency transformed into a capacitive arc gradually with the addition of Cr increasing

  15. Effects of chromium addition on microstructure and properties of TiC–VC reinforced Fe-based laser cladding coatings

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Hui; Zou, Yong, E-mail: yzou@sdu.edu.cn; Zou, Zengda; Shi, Chuanwei

    2014-11-25

    Highlights: • In situ TiC–VC reinforced Fe-based coatings with different Cr addition were obtained. • Some long strip Cr{sub 3}C{sub 2} synthesized while the Cr addition was 12.0% or more. • A moderate amount of Cr improved hardness and corrosion resistance significantly. • The cladding layer microhardness could reach as high as 1090HV{sub 0.2} with 3.0% Cr. • The corrosion resistance could improve 4.5 times with 12.0% Cr. - Abstract: Effects of different addition of Cr on microstructure and properties (especially the corrosion resistance) of cladding layers were investigated by means of X-ray diffractometry (XRD), scanning electron microscopy (SEM), energy dispersive spectrometer (EDS), potentio-dynamic polarization and electrochemical impedance spectroscopy (EIS). Results showed that Fe–Ti–V–C alloy powders with different addition of Cr formed good cladding layers without defects such as cracking and porosity. Phases of the cladding layers were α-Fe, γ-Fe, TiC, VC and TiVC{sub 2}. A certain amount of long strip Cr{sub 3}C{sub 2} synthesized while the addition of Cr was 12.0% or more. Microhardness and corrosion resistance of cladding layer both improved greatly with a moderate amount of Cr. The cladding layer with 3.0% Cr showed a highest microhardness 1090HV{sub 0.2}, and the variation tendency of the hardness is not a linearly relationship with increasing the chromium addition. The cladding layer with 12.0% Cr addition showed the best corrosion resistance, which was about 4.5 times than that of the cladding layer without Cr. EIS spectrum of the cladding layer without Cr was composed of an inductive arc at low frequency and a capacitive arc at high frequency. However, the inductive arc at low frequency transformed into a capacitive arc gradually with the addition of Cr increasing.

  16. Enhanced Oxidative Bioremediation of cis-Dichloroethene (cis-DCE) and Vinyl Chloride (VC) using Electron Shuttles

    Science.gov (United States)

    2010-02-01

    Analyses on a single grain of soil or a single crystal of a precipitate were accomplished using an EMP. Not only can analyses be made on particles as small...24Fe+32 (OH)12[ CO3 ] 54.5% Fe, 41.6% O, 2.0% C 6Fe+2 + CO3 -2 + 12H2O → [Fe+24Fe+32 (OH)12][ CO3 ] (s) + 12H+ + 2e- Mixed ferrous/ferric iron...400 mV DCE: 2,000 Sulfate: ញ mg/L VC: 63 µg/L Seneca Army Depot Activity (Ash Landfill site), New York October-06 Single Double- Wide

  17. The Vaccinium corymbosum FLOWERING LOCUS T-like gene (VcFT): a flowering activator reverses photoperiodic and chilling requirements in blueberry.

    Science.gov (United States)

    Song, Guo-qing; Walworth, Aaron; Zhao, Dongyan; Jiang, Ning; Hancock, James F

    2013-11-01

    The blueberry FLOWERING LOCUS T ( FT )-like gene ( VcFT ) cloned from the cDNA of a tetraploid, northern highbush blueberry ( Vaccinium corymbosum L.) is able to reverse the photoperiodic and chilling requirements and drive early and continuous flowering. Blueberry is a woody perennial bush with a longer juvenile period than annual crops, requiring vernalization to flower normally. Few studies have been reported on the molecular mechanism of flowering in blueberry or other woody plants. Because FLOWERING LOCUS T (FT) from Arabidopsis thaliana plays a multifaceted role in generating mobile molecular signals to regulate plant flowering time, isolation and functional analysis of the blueberry (Vaccinium corymbosum L.) FT-like gene (VcFT) will facilitate the elucidation of molecular mechanisms of flowering in woody plants. Based on EST sequences, a 525-bpVcFT was identified and cloned from the cDNA of a tetraploid, northern highbush blueberry cultivar, Bluecrop. Ectopic expression of 35S:VcFT in tobacco induced flowering an average of 28 days earlier than wild-type plants. Expression of the 35S:VcFT in the blueberry cultivar Aurora resulted in an extremely early flowering phenotype, which flowered not only during in vitro culture, a growth stage when nontransgenic shoots had not yet flowered, but also in 6-10-week old, soil-grown transgenic plants, in contrast to the fact that at least 1 year and 800 chilling hours are required for the appearance of the first flower of both nontransgenic 'Aurora' and transgenic controls with the gusA. These results demonstrate that the VcFT is a functional floral activator and overexpression of the VcFT is able to reverse the photoperiodic and chilling requirements and drive early and continuous flowering.

  18. Cloning, expression, purification, crystallization and preliminary X-ray analysis of the 31 kDa Vibrio cholerae heat-shock protein VcHsp31

    International Nuclear Information System (INIS)

    Das, Samir; Dey, Sanjay; Roy, Trina; Sen, Udayaditya

    2011-01-01

    A heat-shock protein from V. cholerae (VcHsp31) has been cloned, expressed, purified and crystallized. Crystals of VcHsp31 belonged to a monoclinic space group and diffracted to 1.9 Å resolution. The Gram-negative bacterium Vibrio cholerae, which is responsible for the diarrhoeal disease cholera in humans, induces the expression of numerous heat-shock genes. VcHsp31 is a 31 kDa putative heat-shock protein that belongs to the DJ-1/PfpI superfamily, functioning as both a chaperone and a protease. VcHsp31 has been cloned, overexpressed and purified by Ni 2+ –NTA affinity chromatography followed by gel filtration. Crystals of VcHsp31 were grown in the presence of PEG 6000 and MPD; they belonged to space group P2 1 and diffracted to 1.9 Å resolution. Assuming the presence of six molecules in the asymmetric unit, the Matthews coefficient was estimated to be 1.97 Å 3 Da −1 , corresponding to a solvent content of 37.4%

  19. New models of experimental parotitis and parotid gland distension in rats.

    Science.gov (United States)

    Okada-Ogawa, Akiko; Shinoda, Masamichi; Honda, Kuniya; Iwata, Koichi

    2012-01-01

    A significant reduction of the escape threshold to mechanical stimulation of the lateral facial skin was observed bilaterally at days 2 and 3 after unilateral complete Freund's adjuvant (CFA) administration into parotid gland. A slight reduction of mechanical escape threshold was also observed in rats with saline administration. The parotid gland inflammation was verified and quantified by measuring the tissue Evans' blue dye extravasation. The Evans' blue concentration in the parotid gland tissues was significantly greater in the CFA-injected rats than that of the saline-injected rats at 72 h after treatment. On day 10 after CFA administration into the parotid gland, the Evans' blue concentration was recovered to the control level. The administration of capsaicin into the parotid gland did not alter neuronal activities in the transition zone between the trigeminal spinal subnucleus interpolaris and caudalis (Vi/Vc). In contrast, capsaicin administration induced significant increases in the receptive field size and mechanical and cold responses of neurons located in superficial laminae of the C1/C2. The subgroup of C1/C2 neurons responded to mechanical distension of the parotid gland, whereas no Vi/Vc neurons responded to parotid distension.

  20. Inhibition of 2-arachydonoylgycerol degradation attenuates orofacial neuropathic pain in trigeminal nerve-injured mice.

    Science.gov (United States)

    Kamimura, Rantaro; Hossain, Mohammad Z; Unno, Shumpei; Ando, Hiroshi; Masuda, Yuji; Takahashi, Kojiro; Otake, Masanori; Saito, Isao; Kitagawa, Junichi

    2018-03-24

    Current therapeutics are not effective for orofacial neuropathic pain, and better options are needed. The present study used inferior orbital nerve (ION)-injured mice to investigate the effect of inhibiting monoacylglycerol lipase (MAGL), an enzyme that degrades the major endocannabinoid 2-arachydonoylgycerol (2-AG) in orofacial neuropathic pain. The head-withdrawal threshold to mechanical stimulation of the whisker pad was reduced on days 3, 5, and 7 after ION injury. Injection of JZL184, a selective inhibitor of MAGL, on day 7 after ION injury attenuated the reduction in head-withdrawal threshold at 2 h after administration. Moreover, the numbers of MAGL-immunoreactive neurons in the trigeminal subnucleus caudalis (Vc) and upper cervical spinal cord (C1-C2) were significantly greater in ION-injured mice than in sham-operated mice but were reduced after administration of JZL184. The increase in MAGL immunoreactivity suggests that increased 2-AG production is followed by rapid enzymatic degradation of 2-AG. JZL184 inhibited this degradation and thus increased 2-AG concentration in the brain, particularly in the Vc and C1-C2 regions, thus attenuating pain. Our findings suggest that inhibition of 2-AG degradation by MAGL inhibitors is a promising therapeutic option for treatment of orofacial neuropathic pain.

  1. Low Cost Design of a Hybrid Architecture of Integer Inverse DCT for H.264, VC-1, AVS, and HEVC

    Directory of Open Access Journals (Sweden)

    Muhammad Martuza

    2012-01-01

    Full Text Available The paper presents a unified hybrid architecture to compute the 8×8 integer inverse discrete cosine transform (IDCT of multiple modern video codecs—AVS, H.264/AVC, VC-1, and HEVC (under development. Based on the symmetric structure of the matrices and the similarity in matrix operation, we develop a generalized “decompose and share” algorithm to compute the 8×8 IDCT. The algorithm is later applied to four video standards. The hardware-share approach ensures the maximum circuit reuse during the computation. The architecture is designed with only adders and shifters to reduce the hardware cost significantly. The design is implemented on FPGA and later synthesized in CMOS 0.18 um technology. The results meet the requirements of advanced video coding applications.

  2. Molecular characterisation of a calmodulin gene, VcCaM1, that is differentially expressed under aluminium stress in highbush blueberry.

    Science.gov (United States)

    Inostroza-Blancheteau, C; Aquea, F; Loyola, R; Slovin, J; Josway, S; Rengel, Z; Reyes-Díaz, M; Alberdi, M; Arce-Johnson, P

    2013-11-01

    Calmodulin (CaM), a small acidic protein, is one of the best characterised Ca(2+) sensors in eukaryotes. This Ca(2+) -regulated protein plays a critical role in decoding and transducing environmental stress signals by activating specific targets. Many environmental stresses elicit changes in intracellular Ca(2+) activity that could initiate adaptive responses under adverse conditions. We report the first molecular cloning and characterisation of a calmodulin gene, VcCaM1 (Vaccinium corymbosum Calmodulin 1), in the woody shrub, highbush blueberry. VcCaM1 was first identified as VCAL19, a gene induced by aluminium stress in V. corymbosum L. A full-length cDNA of VcCaM1 containing a 766-bp open reading frame (ORF) encoding 149 amino acids was cloned from root RNA. The sequence encodes four Ca(2+) -binding motifs (EF-hands) and shows high similarity (99%) with the isoform CaM 201 of Daucus carota. Expression analyses showed that following Al treatment, VcCaM1 message level decreased in roots of Brigitta, an Al-resistant cultivar, and after 48 h, was lower than in Bluegold, an Al-sensitive cultivar. VcCAM1 message also decreased in leaves of both cultivars within 2 h of treatment. Message levels in leaves then increased by 24 h to control levels in Brigitta, but not in Bluegold, but then decreased again by 48 h. In conclusion, VcCaM1 does not appear to be directly involved in Al resistance, but may be involved in improved plant performance under Al toxicity conditions through regulation of Ca(2+) homeostasis and antioxidant systems in leaves. © 2013 German Botanical Society and The Royal Botanical Society of the Netherlands.

  3. Exposure of Daphnia magna to trichloroethylene (TCE) and vinyl chloride (VC): evaluation of gene transcription, cellular activity, and life-history parameters.

    Science.gov (United States)

    Houde, Magali; Douville, Mélanie; Gagnon, Pierre; Sproull, Jim; Cloutier, François

    2015-06-01

    Trichloroethylene (TCE) is a ubiquitous contaminant classified as a human carcinogen. Vinyl chloride (VC) is primarily used to manufacture polyvinyl chloride and can also be a degradation product of TCE. Very few data exist on the toxicity of TCE and VC in aquatic organisms particularly at environmentally relevant concentrations. The aim of this study was to evaluate the sub-lethal effects (10 day exposure; 0.1; 1; 10 µg/L) of TCE and VC in Daphnia magna at the gene, cellular, and life-history levels. Results indicated impacts of VC on the regulation of genes related to glutathione-S-transferase (GST), juvenile hormone esterase (JHE), and the vitelline outer layer membrane protein (VMO1). On the cellular level, exposure to 0.1, 1, and 10 µg/L of VC significantly increased the activity of JHE in D. magna and TCE increased the activity of chitinase (at 1 and 10 µg/L). Results for life-history parameters indicated a possible tendency of TCE to affect the number of molts at the individual level in D. magna (p=0.051). Measurement of VG-like proteins using the alkali-labile phosphates (ALP) assay did not show differences between TCE treated organisms and controls. However, semi-quantitative measurement using gradient gel electrophoresis (213-218 kDa) indicated significant decrease in VG-like protein levels following exposure to TCE at all three concentrations. Overall, results indicate effects of TCE and VC on genes and proteins related to metabolism, reproduction, and growth in D. magna. Crown Copyright © 2015. Published by Elsevier Inc. All rights reserved.

  4. Ulex europaeus agglutinin-I binding to dental primary afferent projections in the spinal trigeminal complex combined with double immunolabeling of substance P and GABA elements using peroxidase and colloidal gold.

    Science.gov (United States)

    Matthews, M A; Hoffmann, K D; Hernandez, T V

    1989-01-01

    Ulex europaeus agglutinin I (UEA-I) is a plant lectin with an affinity for L-fucosyl residues in the chains of lactoseries oligosaccharides associated with medium- and smaller-diameter dorsal root ganglion neurons and their axonal processes. These enter Lissauer's tract and terminate within the superficial laminae of the spinal cord overlapping projections known to have a nociceptive function. This implies that the surface coatings of neuronal membranes may have a relationship with functional modalities. The present investigation further examined this concept by studying a neuronal projection with a nociceptive function to determine whether fucosyl-lactoseries residues were incorporated in its primary afferent terminals. Transganglionic transport of horseradish peroxidase (HRP) following injection into tooth pulp chambers was employed to demonstrate dental pulp terminals in the trigeminal spinal complex, while peroxidase and fluorescent tags were used concomitantly to stain for UEA-I. Double immunolabeling for substance P (SP) and gamma-aminobutyric acid (GABA) using peroxidase and colloidal gold allowed a comparison of the distribution of a known excitatory nociceptive transmitter with that of UEA-I binding in specific subnuclei. Synaptic interrelationships between UEA-I positive dental pulp primary afferent inputs and specific inhibitory terminals were also examined. SP immunoreactivity occurred in laminae I and outer lamina II (IIo) of subnucleus caudalis (Vc) and in the ventrolateral and lateral marginal region of the caudal half of subnucleus interpolaris (Vi), including the periobex area in which Vi is slightly overlapped on its lateral aspect by cellular elements of Vc. The adjacent interstitial nucleus (IN) also showed an intense immunoreactivity for this peptide antibody. UEA-I binding displayed a similar distribution pattern in both Vc and Vi, but extended into lamina IIi and the superficial part of Lamina III in Vc. Dental pulp terminals were found to

  5. VC and ACIS/HOOPS based semi-physical virtual prototype design and motion simulation of 2D scanning mirror

    Science.gov (United States)

    Liu, Xiangyan; Dai, Xiaobing; He, Xudong; Gao, Pengcheng

    2013-10-01

    Image-spectrum integrated instrument is an infrared scanning system which integrates optics, mechanics, electrics and information processing. Not only can it achieve scene imaging, but also it can detect, track and identify targets of interests in the scene through acquiring their spectra. After having a brief introduction to image-spectrum integrated instrument and analyzing how 2D scanning mirror works, this paper built 3D model of 2D scanning mirror and simulated its motion using two PCs basing on VC++ and ACIS/HOOPS. Two PCs communicate with each other through serial ports. One PC serves as host computer, on which controlling software runs, is responsible for loading image sequence, image processing, target detecting, and generating and sending motion commands to scanning mirror. The other serves as slave computer, on which scanning mirror motion simulation software runs, is responsible for receiving motion commands to control scanning mirror to finish corresponding movements. This method proposed in this paper adopted semi-physical virtual prototype technology and used real scene image sequence to control virtual 2D scanning mirror and simulates motion of real 2D scanning mirror. It has no need for real scanning mirror and is of important practical significance for debugging controlling software of 2D scanning mirror.

  6. Statistical tools application on dextranase production from Pochonia chlamydosporia (VC4 and its application on dextran removal from sugarcane juice

    Directory of Open Access Journals (Sweden)

    BRUNA L. SUFIATE

    Full Text Available ABSTRACT The aim of this study was to optimize the dextranase production by fungus Pochonia chlamydosporia (VC4 and evaluate its activity in dextran reduction in sugarcane juice. The effects, over the P. chlamydosporia dextranase production, of different components from the culture medium were analyzed by Plackett-Burman design and central composite design. The response surface was utilized to determine the levels that, among the variables that influence dextranase production, provide higher production of these enzymes. The enzymatic effect on the removal of dextran present in sugarcane juice was also evaluated. It was observed that only NaNO3 and pH showed significant effect (p<0.05 over dextranase production and was determined that the levels which provided higher enzyme production were, respectively, 5 g/L and 5.5. The dextranases produced by fungus P. chlamydosporia reduced by 75% the dextran content of the sugarcane juice once treated for 12 hours, when compared to the control treatment.

  7. Accelerating volumetric cine MRI (VC-MRI) using undersampling for real-time 3D target localization/tracking in radiation therapy: a feasibility study

    Science.gov (United States)

    Harris, Wendy; Yin, Fang-Fang; Wang, Chunhao; Zhang, You; Cai, Jing; Ren, Lei

    2018-01-01

    Purpose. To accelerate volumetric cine MRI (VC-MRI) using undersampled 2D-cine MRI to provide real-time 3D guidance for gating/target tracking in radiotherapy. Methods. 4D-MRI is acquired during patient simulation. One phase of the prior 4D-MRI is selected as the prior images, designated as MRIprior. The on-board VC-MRI at each time-step is considered a deformation of the MRIprior. The deformation field map is represented as a linear combination of the motion components extracted by principal component analysis from the prior 4D-MRI. The weighting coefficients of the motion components are solved by matching the corresponding 2D-slice of the VC-MRI with the on-board undersampled 2D-cine MRI acquired. Undersampled Cartesian and radial k-space acquisition strategies were investigated. The effects of k-space sampling percentage (SP) and distribution, tumor sizes and noise on the VC-MRI estimation were studied. The VC-MRI estimation was evaluated using XCAT simulation of lung cancer patients and data from liver cancer patients. Volume percent difference (VPD) and Center of Mass Shift (COMS) of the tumor volumes and tumor tracking errors were calculated. Results. For XCAT, VPD/COMS were 11.93  ±  2.37%/0.90  ±  0.27 mm and 11.53  ±  1.47%/0.85  ±  0.20 mm among all scenarios with Cartesian sampling (SP  =  10%) and radial sampling (21 spokes, SP  =  5.2%), respectively. When tumor size decreased, higher sampling rate achieved more accurate VC-MRI than lower sampling rate. VC-MRI was robust against noise levels up to SNR  =  20. For patient data, the tumor tracking errors in superior-inferior, anterior-posterior and lateral (LAT) directions were 0.46  ±  0.20 mm, 0.56  ±  0.17 mm and 0.23  ±  0.16 mm, respectively, for Cartesian-based sampling with SP  =  20% and 0.60  ±  0.19 mm, 0.56  ±  0.22 mm and 0.42  ±  0.15 mm, respectively, for

  8. WE-G-BRD-06: Volumetric Cine MRI (VC-MRI) Estimated Based On Prior Knowledge for On-Board Target Localization

    International Nuclear Information System (INIS)

    Harris, W; Yin, F; Cai, J; Zhang, Y; Ren, L

    2015-01-01

    Purpose: To develop a technique to generate on-board VC-MRI using patient prior 4D-MRI, motion modeling and on-board 2D-cine MRI for real-time 3D target verification of liver and lung radiotherapy. Methods: The end-expiration phase images of a 4D-MRI acquired during patient simulation are used as patient prior images. Principal component analysis (PCA) is used to extract 3 major respiratory deformation patterns from the Deformation Field Maps (DFMs) generated between end-expiration phase and all other phases. On-board 2D-cine MRI images are acquired in the axial view. The on-board VC-MRI at any instant is considered as a deformation of the prior MRI at the end-expiration phase. The DFM is represented as a linear combination of the 3 major deformation patterns. The coefficients of the deformation patterns are solved by matching the corresponding 2D slice of the estimated VC-MRI with the acquired single 2D-cine MRI. The method was evaluated using both XCAT (a computerized patient model) simulation of lung cancer patients and MRI data from a real liver cancer patient. The 3D-MRI at every phase except end-expiration phase was used to simulate the ground-truth on-board VC-MRI at different instances, and the center-tumor slice was selected to simulate the on-board 2D-cine images. Results: Image subtraction of ground truth with estimated on-board VC-MRI shows fewer differences than image subtraction of ground truth with prior image. Excellent agreement between profiles was achieved. The normalized cross correlation coefficients between the estimated and ground-truth in the axial, coronal and sagittal views for each time step were >= 0.982, 0.905, 0.961 for XCAT data and >= 0.998, 0.911, 0.9541 for patient data. For XCAT data, the maximum-Volume-Percent-Difference between ground-truth and estimated tumor volumes was 1.6% and the maximum-Center-of-Mass-Shift was 0.9 mm. Conclusion: Preliminary studies demonstrated the feasibility to estimate real-time VC-MRI for on

  9. WE-G-BRD-06: Volumetric Cine MRI (VC-MRI) Estimated Based On Prior Knowledge for On-Board Target Localization

    Energy Technology Data Exchange (ETDEWEB)

    Harris, W; Yin, F; Cai, J; Zhang, Y; Ren, L [Duke University Medical Center, Durham, NC (United States)

    2015-06-15

    Purpose: To develop a technique to generate on-board VC-MRI using patient prior 4D-MRI, motion modeling and on-board 2D-cine MRI for real-time 3D target verification of liver and lung radiotherapy. Methods: The end-expiration phase images of a 4D-MRI acquired during patient simulation are used as patient prior images. Principal component analysis (PCA) is used to extract 3 major respiratory deformation patterns from the Deformation Field Maps (DFMs) generated between end-expiration phase and all other phases. On-board 2D-cine MRI images are acquired in the axial view. The on-board VC-MRI at any instant is considered as a deformation of the prior MRI at the end-expiration phase. The DFM is represented as a linear combination of the 3 major deformation patterns. The coefficients of the deformation patterns are solved by matching the corresponding 2D slice of the estimated VC-MRI with the acquired single 2D-cine MRI. The method was evaluated using both XCAT (a computerized patient model) simulation of lung cancer patients and MRI data from a real liver cancer patient. The 3D-MRI at every phase except end-expiration phase was used to simulate the ground-truth on-board VC-MRI at different instances, and the center-tumor slice was selected to simulate the on-board 2D-cine images. Results: Image subtraction of ground truth with estimated on-board VC-MRI shows fewer differences than image subtraction of ground truth with prior image. Excellent agreement between profiles was achieved. The normalized cross correlation coefficients between the estimated and ground-truth in the axial, coronal and sagittal views for each time step were >= 0.982, 0.905, 0.961 for XCAT data and >= 0.998, 0.911, 0.9541 for patient data. For XCAT data, the maximum-Volume-Percent-Difference between ground-truth and estimated tumor volumes was 1.6% and the maximum-Center-of-Mass-Shift was 0.9 mm. Conclusion: Preliminary studies demonstrated the feasibility to estimate real-time VC-MRI for on

  10. Evaluation of a rapid dipstick (Crystal VC for the diagnosis of cholera in Zanzibar and a comparison with previous studies.

    Directory of Open Access Journals (Sweden)

    Benedikt Ley

    Full Text Available The gold standard for the diagnosis of cholera is stool culture, but this requires laboratory facilities and takes at least 24 hours. A rapid diagnostic test (RDT that can be used by minimally trained staff at treatment centers could potentially improve the reporting and management of cholera outbreaks.We evaluated the Crystal VC™ RDT under field conditions in Zanzibar in 2009. Patients presenting to treatment centers with watery diarrhea provided a stool sample for rapid diagnostic testing. Results were compared to stool culture performed in a reference laboratory. We assessed the overall performance of the RDT and evaluated whether previous intake of antibiotics, intravenous fluids, location of testing, and skill level of the technician affected the RDT results.We included stool samples from 624 patients. Compared to culture, the overall sensitivity of the RDT was 93.1% (95%CI: 88.7 to 96.2%, specificity was 49.2% (95%CI: 44.3 to 54.1%, the positive predictive value was 47.0% (95%CI: 42.1 to 52.0% and the negative predictive value was 93.6% (95%CI: 89.6 to 96.5%. The overall false positivity rate was 50.8% (213/419; fieldworkers frequently misread very faint test lines as positive.The observed sensitivity of the Crystal VC RDT evaluated was similar compared to earlier versions, while specificity was poorer. The current version of the RDT could potentially be used as a screening tool in the field. Because of the high proportion of false positive results when field workers test stool specimens, positive results will need to be confirmed with stool culture.

  11. Effect of neonatal capsaicin treatment on neural activity in the medullary dorsal horn of neonatal rats evoked by electrical stimulation to the trigeminal afferents: an optical, electrophysiological, and quantitative study.

    Science.gov (United States)

    Takuma, S

    2001-07-06

    To elucidate which glutamate receptors, NMDA or non-NMDA, have the main role in synaptic transmission via unmyelinated afferents in the trigeminal subnucleus caudalis (the medullary dorsal horn), and to examine the early functional effects of neonatal capsaicin treatment to the subnucleus caudalis, optical recording, field potential recording, and quantitative study using electron micrographs were employed. A medulla oblongata isolated from a rat 5--7 days old was sectioned horizontally 400-microm thick or parasagittally and stained with a voltage-sensitive dye, RH482 or RH795. Single-pulse stimulation with high intensity to the trigeminal afferents evoked optical responses mainly in the subnucleus caudalis. The optical signals were composed of two phases, a fast component followed by a long-lasting component. The spatiotemporal properties of the optical signals were well correlated to those of the field potentials recorded simultaneously. The fast component was eliminated by 6-cyano-7-nitro-quinoxaline-2,3-dione (CNQX; 10 microM), while the long-lasting component was not. The latter increased in amplitude under a condition of low Mg(2+) but was significantly reduced by DL-2-amino-5-phosphonovaleric acid (AP5; 30 microM). Neonatal capsaicin treatment also reduced the long-lasting component markedly. In addition, the decreases in the ratio of unmyelinated axons to myelinated axons and in the ratio of unmyelinated axons to Schwann cell subunits of trigeminal nerve roots both showed significant differences (P<0.05, Student's t-test) between the control group and the neonatal capsaicin treatment group. This line of evidence indirectly suggests that synaptic transmission via unmyelinated afferents in the subnucleus caudalis is mediated substantially by NMDA glutamate receptors and documented that neonatal capsaicin treatment induced a functional alteration of the neural transmission in the subnucleus caudalis as well as a morphological alteration of primary afferents

  12. Hydrogen trapping by VC precipitates and structural defects in a high strength Fe–Mn–C steel studied by small-angle neutron scattering

    International Nuclear Information System (INIS)

    Malard, B.; Remy, B.; Scott, C.; Deschamps, A.; Chêne, J.; Dieudonné, T.; Mathon, M.H.

    2012-01-01

    Highlights: ► SANS was used to study the interaction between H and a Fe–Mn–C steel containing V. ► No interaction between H and V in solid solution has been detected. ► A reversible interaction between H and structural defects has been measured. ► 5 ppm wt. of H can be trapped in the VC nanoprecipitates. - Abstract: The trapping of hydrogen by VC precipitates and structural defects in high strength Fe–Mn–C steel was studied by small angle neutron scattering. No interaction between H and V in solid solution has been detected but a significant interaction between H and structural defects introduced by plastic deformation has been measured. This last effect was reversible upon outgassing of the H. Moreover a significant interaction between H and VC precipitates has been measured; 5 ppm wt. of H could be trapped in the precipitates. This is consistent with the homogeneous trapping of H within the precipitates rather than at the precipitate/matrix interface.

  13. Trigeminal nerve injury-induced thrombospondin-4 up-regulation contributes to orofacial neuropathic pain states in a rat model.

    Science.gov (United States)

    Li, K-W; Kim, D-S; Zaucke, F; Luo, Z D

    2014-04-01

    Injury to the trigeminal nerve often results in the development of chronic pain states including tactile allodynia, or hypersensitivity to light touch, in orofacial area, but its underlying mechanisms are poorly understood. Peripheral nerve injury has been shown to cause up-regulation of thrombospondin-4 (TSP4) in dorsal spinal cord that correlates with neuropathic pain development. In this study, we examined whether injury-induced TSP4 is critical in mediating orofacial pain development in a rat model of chronic constriction injury to the infraorbital nerve. Orofacial sensitivity to mechanical stimulation was examined in a unilateral infraorbital nerve ligation rat model. The levels of TSP4 in trigeminal ganglia and associated spinal subnucleus caudalis and C1/C2 spinal cord (Vc/C2) from injured rats were examined at time points correlating with the initiation and peak orofacial hypersensitivity. TSP4 antisense and mismatch oligodeoxynucleotides were intrathecally injected into injured rats to see if antisense oligodeoxynucleotide treatment could reverse injury-induced TSP4 up-regulation and orofacial behavioural hypersensitivity. Our data indicated that trigeminal nerve injury induced TSP4 up-regulation in Vc/C2 at a time point correlated with orofacial tactile allodynia. In addition, intrathecal treatment with TSP4 antisense, but not mismatch, oligodeoxynucleotides blocked both injury-induced TSP4 up-regulation in Vc/C2 and behavioural hypersensitivity. Our data support that infraorbital nerve injury leads to TSP4 up-regulation in trigeminal spinal complex that contributes to orofacial neuropathic pain states. Blocking this pathway may provide an alternative approach in management of orofacial neuropathic pain states. © 2013 European Pain Federation - EFIC®

  14. Effect of V addition on the hardness, adherence and friction coefficient of VC coatings produced by thermo-reactive diffusion deposition

    OpenAIRE

    Fredy Alejandro Orjuela-Guerrero; José Edgar Alfonso-Orjuela; Jhon Jairo Olaya-Flórez

    2015-01-01

    Se produjeron recubrimientos de carburo de vanadio (VC) sobre sustratos de acero AISI H13 y acero AISI D2 mediante deposito termoreactiva/ difusión (TRD) con el fin de evaluar sus propiedades mecánicas como una función del contenido de vanadio. Los recubrimientos se producen con diferentes porcentajes de concentración de ferrovanadio. La composición química de los recubrimientos se determinó mediante fluorescencia de rayos X (XRF), la estructura cristalina se analizó utilizando difracción de ...

  15. Cathepsin B Cleavage of vcMMAE-Based Antibody-Drug Conjugate Is Not Drug Location or Monoclonal Antibody Carrier Specific.

    Science.gov (United States)

    Gikanga, Benson; Adeniji, Nia S; Patapoff, Thomas W; Chih, Hung-Wei; Yi, Li

    2016-04-20

    Antibody-drug conjugates (ADCs) require thorough characterization and understanding of product quality attributes. The framework of many ADCs comprises one molecule of antibody that is usually conjugated with multiple drug molecules at various locations. It is unknown whether the drug release rate from the ADC is dependent on drug location, and/or local environment, dictated by the sequence and structure of the antibody carrier. This study addresses these issues with valine-citrulline-monomethylauristatin E (vc-MMAE)-based ADC molecules conjugated at reduced disulfide bonds, by evaluating the cathepsin B catalyzed drug release rate of ADC molecules with different drug distributions or antibody carriers. MMAE drug release rates at different locations on ADC I were compared to evaluate the impact of drug location. No difference in rates was observed for drug released from the V(H), V(L), or C(H)2 domains of ADC I. Furthermore, four vc-MMAE ADC molecules were chosen as substrates for cathepsin B for evaluation of Michaelis-Menten parameters. There was no significant difference in K(M) or k(cat) values, suggesting that different sequences of the antibody carrier do not result in different drug release rates. Comparison between ADCs and small molecules containing vc-MMAE moieties as substrates for cathepsin B suggests that the presence of IgG1 antibody carrier, regardless of its bulkiness, does not impact drug release rate. Finally, a molecular dynamics simulation on ADC II revealed that the val-cit moiety at each of the eight possible conjugation sites was, on average, solvent accessible over 50% of its maximum solvent accessible surface area (SASA) during a 500 ns trajectory. Combined, these results suggest that the cathepsin cleavage sites for conjugated drugs are exposed enough for the enzyme to access and that the drug release rate is rather independent of drug location or monoclonal antibody carrier. Therefore, the distribution of drug conjugation at different

  16. Intramuscular Immunization of Mice with the Live-Attenuated Herpes Simplex Virus 1 Vaccine Strain VC2 Expressing Equine Herpesvirus 1 (EHV-1) Glycoprotein D Generates Anti-EHV-1 Immune Responses in Mice.

    Science.gov (United States)

    Liu, Shiliang A; Stanfield, Brent A; Chouljenko, Vladimir N; Naidu, Shan; Langohr, Ingeborg; Del Piero, Fabio; Ferracone, Jacqueline; Roy, Alma A; Kousoulas, Konstantin G

    2017-06-15

    Vaccination remains the best option to combat equine herpesvirus 1 (EHV-1) infection, and several different strategies of vaccination have been investigated and developed over the past few decades. Herein, we report that the live-attenuated herpes simplex virus 1 (HSV-1) VC2 vaccine strain, which has been shown to be unable to enter into neurons and establish latency in mice, can be utilized as a vector for the heterologous expression of EHV-1 glycoprotein D (gD) and that the intramuscular immunization of mice results in strong antiviral humoral and cellular immune responses. The VC2-EHV-1-gD recombinant virus was constructed by inserting an EHV-1 gD expression cassette under the control of the cytomegalovirus immediate early promoter into the VC2 vector in place of the HSV-1 thymidine kinase (UL23) gene. The vaccines were introduced into mice through intramuscular injection. Vaccination with both the VC2-EHV-1-gD vaccine and the commercially available vaccine Vetera EHV XP 1/4 (Vetera; Boehringer Ingelheim Vetmedica) resulted in the production of neutralizing antibodies, the levels of which were significantly higher in comparison to those in VC2- and mock-vaccinated animals ( P < 0.01 or P < 0.001). Analysis of EHV-1-reactive IgG subtypes demonstrated that vaccination with the VC2-EHV-1-gD vaccine stimulated robust IgG1 and IgG2a antibodies after three vaccinations ( P < 0.001). Interestingly, Vetera-vaccinated mice produced significantly higher levels of IgM than mice in the other groups before and after challenge ( P < 0.01 or P < 0.05). Vaccination with VC2-EHV-1-gD stimulated strong cellular immune responses, characterized by the upregulation of both interferon- and tumor necrosis factor-positive CD4 + T cells and CD8 + T cells. Overall, the data suggest that the HSV-1 VC2 vaccine strain may be used as a viral vector for the vaccination of horses as well as, potentially, for the vaccination of other economically important animals. IMPORTANCE A novel virus

  17. Lattice QCD calculation of the B(s )→D(s) *ℓν form factors at zero recoil and implications for |Vc b|

    Science.gov (United States)

    Harrison, Judd; Davies, Christine T. H.; Wingate, Matthew; Hpqcd Collaboration

    2018-03-01

    We present results of a lattice QCD calculation of B →D* and Bs→Ds* axial vector matrix elements with both states at rest. These zero recoil matrix elements provide the normalization necessary to infer a value for the CKM matrix element |Vc b| from experimental measurements of B¯ 0→D*+ℓ-ν ¯ and B¯s0→Ds*+ℓ-ν¯ decay. Results are derived from correlation functions computed with highly improved staggered quarks (HISQ) for light, strange, and charm quark propagators, and nonrelativistic QCD for the bottom quark propagator. The calculation of correlation functions employs MILC Collaboration ensembles over a range of three lattice spacings. These gauge field configurations include sea quark effects of charm, strange, and equal-mass up and down quarks. We use ensembles with physically light up and down quarks, as well as heavier values. Our main results are FB→D *(1 )=0.895 ±0.01 0stat±0.024sys and FBs→Ds*(1 )=0.883 ±0.01 2stat±0.02 8sys . We discuss the consequences for |Vc b| in light of recent investigations into the extrapolation of experimental data to zero recoil.

  18. Atomic resolution crystal structure of VcLMWPTP-1 from Vibrio cholerae O395: Insights into a novel mode of dimerization in the low molecular weight protein tyrosine phosphatase family

    Energy Technology Data Exchange (ETDEWEB)

    Nath, Seema; Banerjee, Ramanuj; Sen, Udayaditya, E-mail: udayaditya.sen@saha.ac.in

    2014-07-18

    Highlights: • VcLMWPTP-1 forms dimer in solution. • The dimer is catalytically active unlike other reported dimeric LMWPTPs. • The formation of extended dimeric surface excludes the active site pocket. • The surface bears closer resemblance to eukaryotic LMWPTPs. - Abstract: Low molecular weight protein tyrosine phosphatase (LMWPTP) is a group of phosphotyrosine phosphatase ubiquitously found in a wide range of organisms ranging from bacteria to mammals. Dimerization in the LMWPTP family has been reported earlier which follows a common mechanism involving active site residues leading to an enzymatically inactive species. Here we report a novel form of dimerization in a LMWPTP from Vibrio cholera 0395 (VcLMWPTP-1). Studies in solution reveal the existence of the dimer in solution while kinetic study depicts the active form of the enzyme. This indicates that the mode of dimerization in VcLMWPTP-1 is different from others where active site residues are not involved in the process. A high resolution (1.45 Å) crystal structure of VcLMWPTP-1 confirms a different mode of dimerization where the active site is catalytically accessible as evident by a tightly bound substrate mimicking ligand, MOPS at the active site pocket. Although being a member of a prokaryotic protein family, VcLMWPTP-1 structure resembles very closely to LMWPTP from a eukaryote, Entamoeba histolytica. It also delineates the diverse surface properties around the active site of the enzyme.

  19. Microstructures and properties of low-chromium high corrosion-resistant TiC-VC reinforced Fe-based laser cladding layer

    International Nuclear Information System (INIS)

    Zhang, Hui; Zou, Yong; Zou, Zengda; Wu, Dongting

    2015-01-01

    Highlights: • The cladding layer with 3.0%Cr and 0.25%CeO 2 showed a good corrosion resistance. • Passive film formed on the cladding layer without Cr and CeO 2 was Fe 3 O 4 . • Fe 3 O 4 displayed p type semiconductivity. • Passive film formed on the cladding layer with Cr and CeO 2 was Fe(OH) 3 and Cr(OH) 3 . • Fe(OH) 3 displayed n type while Cr(OH) 3 displayed p type semiconductivity. - Abstract: Effects of 3.0 wt.%Cr and/or 0.25 wt.%CeO 2 on microstructures and properties of TiC-VC reinforced Fe-based cladding layer were investigated by using X-ray diffractometry (XRD), scanning electron microscopy (SEM), and electrochemical impedance spectroscopy (EIS). Passive films formed on cladding layers surface were investigated by using X-ray photoelectron spectroscopy (XPS) and Mott-Schottky analysis. Results showed that phases of cladding layers were α-Fe, γ-Fe, TiC, VC and TiVC 2 . There were no obvious effects of adding 3.0 wt.%Cr and/or 0.25 wt.%CeO 2 on cladding layers phases. The microstructure of the cladding layer with 3.0 wt.%Cr and 0.25 wt.%CeO 2 was lath martensite and retained austenite. Microhardness of the cladding layer with 0.25 wt.%CeO 2 decreased slightly. Microhardness and corrosion resistance of the cladding layer with 3.0 wt.%Cr and 0.25 wt.%CeO 2 both increased, the corrosion resistance increased 7.33 times while the EIS Nyquist spectrum transformed into a capacitive arc. The passive film formed on the cladding layer without Cr and CeO 2 was Fe 3 O 4 which displayed p type semiconductivity. The passive film formed on the cladding layer with 3.0 wt.%Cr and 0.25 wt.%CeO 2 was composed of Fe(OH) 3 and Cr(OH) 3 , which displayed n and p type semiconductivity respectively

  20. Microstructures and properties of low-chromium high corrosion-resistant TiC-VC reinforced Fe-based laser cladding layer

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Hui; Zou, Yong, E-mail: yzou@sdu.edu.cn; Zou, Zengda; Wu, Dongting

    2015-02-15

    Highlights: • The cladding layer with 3.0%Cr and 0.25%CeO{sub 2} showed a good corrosion resistance. • Passive film formed on the cladding layer without Cr and CeO{sub 2} was Fe{sub 3}O{sub 4}. • Fe{sub 3}O{sub 4} displayed p type semiconductivity. • Passive film formed on the cladding layer with Cr and CeO{sub 2} was Fe(OH){sub 3} and Cr(OH){sub 3}. • Fe(OH){sub 3} displayed n type while Cr(OH){sub 3} displayed p type semiconductivity. - Abstract: Effects of 3.0 wt.%Cr and/or 0.25 wt.%CeO{sub 2} on microstructures and properties of TiC-VC reinforced Fe-based cladding layer were investigated by using X-ray diffractometry (XRD), scanning electron microscopy (SEM), and electrochemical impedance spectroscopy (EIS). Passive films formed on cladding layers surface were investigated by using X-ray photoelectron spectroscopy (XPS) and Mott-Schottky analysis. Results showed that phases of cladding layers were α-Fe, γ-Fe, TiC, VC and TiVC{sub 2}. There were no obvious effects of adding 3.0 wt.%Cr and/or 0.25 wt.%CeO{sub 2} on cladding layers phases. The microstructure of the cladding layer with 3.0 wt.%Cr and 0.25 wt.%CeO{sub 2} was lath martensite and retained austenite. Microhardness of the cladding layer with 0.25 wt.%CeO{sub 2} decreased slightly. Microhardness and corrosion resistance of the cladding layer with 3.0 wt.%Cr and 0.25 wt.%CeO{sub 2} both increased, the corrosion resistance increased 7.33 times while the EIS Nyquist spectrum transformed into a capacitive arc. The passive film formed on the cladding layer without Cr and CeO{sub 2} was Fe{sub 3}O{sub 4} which displayed p type semiconductivity. The passive film formed on the cladding layer with 3.0 wt.%Cr and 0.25 wt.%CeO{sub 2} was composed of Fe(OH){sub 3} and Cr(OH){sub 3}, which displayed n and p type semiconductivity respectively.

  1. DFT Calculation of IR Absorption Spectra for PCE-nH2O, TCE-nH2O, DCE-nH2O, VC-nH2O for Small and Water-Dominated Molecular Clusters

    Science.gov (United States)

    2017-10-31

    VC-nH2O for Small and Water-Dominated Molecular Clusters October 31, 2017 Approved for public release; distribution is unlimited. L. Huang S.g...Calculation of IR Absorption Spectra for PCE-nH2O, TCE-nH2O, DCE-nH2O, VC-nH2O for Small and Water-Dominated Molecular Clusters L. Huang,1 S.G...nH2O molecular clusters using density function theory (DFT). DFT can provide interpretation of absorption spectra with respect to molecular

  2. Solid-phase extraction and on-disc derivatization of the major benzodiazepines in urine using enzyme hydrolysis and Toxi-Lab VC MP3 column.

    Science.gov (United States)

    King, J W; King, L J

    1996-01-01

    Because of the increase in use of the newer benzodiazepines, we explored the opportunity to develop a gas chromatographic-mass spectrometric (GC-MS) method that encompasses most of the widely prescribed benzodiazepines in use today. The benzodiazepines included in our study are nordiazepam, oxazepam, temazepam, lorazepam, alpha-hydroxyalprazolam, alpha-hydroxytriazolam, desalkylflurazepam, and 2-hydroxyethylflurazepam. Using 1.0 mL of urine as the matrix, we added the enzyme Glusulase and incubated the specimens for 2 h to obtain the free drugs. The hydrolyzed samples were then loaded onto a Toxi-Lab Spec VC MP3 column containing a 15-mg disc. On-disc derivatization was accomplished by adding N-methyl-N-(t-butyldimethylsilyl) trifluroacetamide (MTBSTFA) with 1% TBDMSCI to the disc. The derivatives were then placed in a GC vial and analyzed by GC-MS in the selected ion monitoring mode. These results were then compared to confirmed positives by the traditional acid hydrolysis GC-MS method.

  3. Insights into the mechanism of drug resistance: X-ray structure analysis of G48V/C95F tethered HIV-1 protease dimer/saquinavir complex

    International Nuclear Information System (INIS)

    Prashar, Vishal; Bihani, Subhash C.; Das, Amit; Rao, D.R.; Hosur, M.V.

    2010-01-01

    The mutation G48V in HIV-1 protease is a major resistance mutation against the drug saquinavir. Recently, G48V mutation is found to co-exist with the mutation C95F in AIDS patients treated with saquinavir. We report here the three-dimensional crystal structure of G48V/C95F tethered HIV-1 protease/saquinavir complex. The structure indicates following as the possible causes of drug resistance: (1) loss of direct van der Waals interactions between saquinavir and enzyme residues PHE-53 and PRO-1081, (2) loss of water-mediated hydrogen bonds between the carbonyl oxygen atoms in saquinavir and amide nitrogen atoms of flap residues 50 and 1050, (3) changes in inter-monomer interactions, which could affect the energetics of domain movements associated with inhibitor-binding, and (4) significant reduction in the stability of the mutant dimer. The present structure also provides a rationale for the clinical observation that the resistance mutations C95F/G48V/V82A occur as a cluster in AIDS patients.

  4. TU-AB-BRA-09: A Novel Method of Generating Ultrafast Volumetric Cine MRI (VC-MRI) Using Prior 4D-MRI and On-Board Phase-Skipped Encoding Acquisition for Radiotherapy Target Localization

    International Nuclear Information System (INIS)

    Wang, C; Yin, F; Harris, W; Cai, J; Chang, Z; Ren, L

    2016-01-01

    Purpose: To develop a technique generating ultrafast on-board VC-MRI using prior 4D-MRI and on-board phase-skipped encoding k-space acquisition for real-time 3D target tracking of liver and lung radiotherapy. Methods: The end-of-expiration (EOE) volume in 4D-MRI acquired during the simulation was selected as the prior volume. 3 major respiratory deformation patterns were extracted through the principal component analysis of the deformation field maps (DFMs) generated between EOE and all other phases. The on-board VC-MRI at each instant was considered as a deformation of the prior volume, and the deformation was modeled as a linear combination of the extracted 3 major deformation patterns. To solve the weighting coefficients of the 3 major patterns, a 2D slice was extracted from VC-MRI volume to match with the 2D on-board sampling data, which was generated by 8-fold phase skipped-encoding k-space acquisition (i.e., sample 1 phase-encoding line out of every 8 lines) to achieve an ultrafast 16–24 volumes/s frame rate. The method was evaluated using XCAT digital phantom to simulate lung cancer patients. The 3D volume of end-ofinhalation (EOI) phase at the treatment day was used as ground-truth onboard VC-MRI with simulated changes in 1) breathing amplitude and 2) breathing amplitude/phase change from the simulation day. A liver cancer patient case was evaluated for in-vivo feasibility demonstration. Results: The comparison between ground truth and estimated on-board VC-MRI shows good agreements. In XCAT study with changed breathing amplitude, the volume-percent-difference(VPD) between ground-truth and estimated tumor volumes at EOI was 6.28% and the Center-of-Mass-Shift(COMS) was 0.82mm; with changed breathing amplitude and phase, the VPD was 8.50% and the COMS was 0.54mm. The study of liver patient case also demonstrated a promising in vivo feasibility of the proposed method Conclusion: Preliminary results suggest the feasibility to estimate ultrafast VC-MRI for on

  5. TU-AB-BRA-09: A Novel Method of Generating Ultrafast Volumetric Cine MRI (VC-MRI) Using Prior 4D-MRI and On-Board Phase-Skipped Encoding Acquisition for Radiotherapy Target Localization

    Energy Technology Data Exchange (ETDEWEB)

    Wang, C; Yin, F; Harris, W; Cai, J; Chang, Z; Ren, L [Duke University Medical Center, Durham, NC (United States)

    2016-06-15

    Purpose: To develop a technique generating ultrafast on-board VC-MRI using prior 4D-MRI and on-board phase-skipped encoding k-space acquisition for real-time 3D target tracking of liver and lung radiotherapy. Methods: The end-of-expiration (EOE) volume in 4D-MRI acquired during the simulation was selected as the prior volume. 3 major respiratory deformation patterns were extracted through the principal component analysis of the deformation field maps (DFMs) generated between EOE and all other phases. The on-board VC-MRI at each instant was considered as a deformation of the prior volume, and the deformation was modeled as a linear combination of the extracted 3 major deformation patterns. To solve the weighting coefficients of the 3 major patterns, a 2D slice was extracted from VC-MRI volume to match with the 2D on-board sampling data, which was generated by 8-fold phase skipped-encoding k-space acquisition (i.e., sample 1 phase-encoding line out of every 8 lines) to achieve an ultrafast 16–24 volumes/s frame rate. The method was evaluated using XCAT digital phantom to simulate lung cancer patients. The 3D volume of end-ofinhalation (EOI) phase at the treatment day was used as ground-truth onboard VC-MRI with simulated changes in 1) breathing amplitude and 2) breathing amplitude/phase change from the simulation day. A liver cancer patient case was evaluated for in-vivo feasibility demonstration. Results: The comparison between ground truth and estimated on-board VC-MRI shows good agreements. In XCAT study with changed breathing amplitude, the volume-percent-difference(VPD) between ground-truth and estimated tumor volumes at EOI was 6.28% and the Center-of-Mass-Shift(COMS) was 0.82mm; with changed breathing amplitude and phase, the VPD was 8.50% and the COMS was 0.54mm. The study of liver patient case also demonstrated a promising in vivo feasibility of the proposed method Conclusion: Preliminary results suggest the feasibility to estimate ultrafast VC-MRI for on

  6. Jha, V.C. 61

    African Journals Online (AJOL)

    Dr Osondu

    Ethiopian Journal of Environmental Studies and Management Vol. 4 No.2 2011 ... The Kaliani River Basin situated in Karbi Anglong district (Diphu subdivision), Assam ..... using Landsat ETM data and GIS techniques: Zagros. Fold Belt (ZFB) ...

  7. Effect of V addition on the hardness, adherence and friction coefficient of VC coatings produced by thermo-reactive diffusion deposition

    Directory of Open Access Journals (Sweden)

    Fredy Alejandro Orjuela-Guerrero

    2015-01-01

    Full Text Available Se produjeron recubrimientos de carburo de vanadio (VC sobre sustratos de acero AISI H13 y acero AISI D2 mediante deposito termoreactiva/ difusión (TRD con el fin de evaluar sus propiedades mecánicas como una función del contenido de vanadio. Los recubrimientos se producen con diferentes porcentajes de concentración de ferrovanadio. La composición química de los recubrimientos se determinó mediante fluorescencia de rayos X (XRF, la estructura cristalina se analizó utilizando difracción de rayos X (XRD, la morfología se caracterizó usando microscopía electrónica de barrido (SEM, la dureza se midió a través de nanoindentaciòn, y las propiedades tribológicas mediante la prueba de bola sobre disco. El análisis XRF indicó que los recubrimientos crecidos en acero D2 disminuyó el porcentaje atómico de vanadio cuando el recubrimiento se produce con 20% de ferrovanadio. El análisis XRD estableció que los recubrimientos eran policristalinos, con una estructura cúbica. Las imágenes de SEM revelaron que los recubrimientos crecidos en acero D2 eran más compactos que los crecidos en el acero H13. Finalmente, las pruebas de desgaste establecieron que el coeficiente de fricción disminuyó con un aumento de vanadio en el recubrimiento.

  8. Constitutive expression of the K-domain of a Vaccinium corymbosum SOC1-like (VcSOC1-K) MADS-box gene is sufficient to promote flowering in tobacco.

    Science.gov (United States)

    Song, Guo-qing; Walworth, Aaron; Zhao, Dongyan; Hildebrandt, Britton; Leasia, Michael

    2013-11-01

    The K-domain of a blueberry-derived SOC1 -like gene promotes flowering in tobacco without negatively impacting yield, demonstrating potential for manipulation of flowering time in horticultural crops. The SUPPRESSOR OF OVEREXPRESSION OF CONSTANS 1 (SOC1) and SOC1-likes, belonging to the MIKC(c) (type II) MADS-box gene subfamily, are major floral activators and integrators of plant flowering. Both MADS-domains and K (Keratin)-domains are highly conserved in MIKC(c)-type MADS proteins. While there are many reports on overexpression of intact MIKC(c)-type MADS-box genes, few studies have been conducted to investigate the effects of the K-domains. In this report, a 474-bp K-domain of Vaccinium SOC1-like (VcSOC1-K) was cloned from the cDNA library of the northern highbush blueberry (Vaccinium corymbosum L.). Functional analysis of the VcSOC1-K was conducted by ectopically expressing of 35S:VcSOC1-K in tobacco. Reverse transcription PCR confirmed expression of the VcSOC1-K in T0 plants. Phenotypically, T1 transgenic plants (10 T1 plants/event) flowered sooner after seeding, and were shorter with fewer leaves at the time of flowering, than nontransgenic plants; but seed pod production of transgenic plants was not significantly affected. These results demonstrate that overexpression of the K-domain of a MIKC(c)-type MADS-box gene alone is sufficient to promote early flowering and more importantly without affecting seed production.

  9. TH-EF-BRA-08: A Novel Technique for Estimating Volumetric Cine MRI (VC-MRI) From Multi-Slice Sparsely Sampled Cine Images Using Motion Modeling and Free Form Deformation

    International Nuclear Information System (INIS)

    Harris, W; Yin, F; Wang, C; Chang, Z; Cai, J; Zhang, Y; Ren, L

    2016-01-01

    Purpose: To develop a technique to estimate on-board VC-MRI using multi-slice sparsely-sampled cine images, patient prior 4D-MRI, motion-modeling and free-form deformation for real-time 3D target verification of lung radiotherapy. Methods: A previous method has been developed to generate on-board VC-MRI by deforming prior MRI images based on a motion model(MM) extracted from prior 4D-MRI and a single-slice on-board 2D-cine image. In this study, free-form deformation(FD) was introduced to correct for errors in the MM when large anatomical changes exist. Multiple-slice sparsely-sampled on-board 2D-cine images located within the target are used to improve both the estimation accuracy and temporal resolution of VC-MRI. The on-board 2D-cine MRIs are acquired at 20–30frames/s by sampling only 10% of the k-space on Cartesian grid, with 85% of that taken at the central k-space. The method was evaluated using XCAT(computerized patient model) simulation of lung cancer patients with various anatomical and respirational changes from prior 4D-MRI to onboard volume. The accuracy was evaluated using Volume-Percent-Difference(VPD) and Center-of-Mass-Shift(COMS) of the estimated tumor volume. Effects of region-of-interest(ROI) selection, 2D-cine slice orientation, slice number and slice location on the estimation accuracy were evaluated. Results: VCMRI estimated using 10 sparsely-sampled sagittal 2D-cine MRIs achieved VPD/COMS of 9.07±3.54%/0.45±0.53mm among all scenarios based on estimation with ROI_MM-ROI_FD. The FD optimization improved estimation significantly for scenarios with anatomical changes. Using ROI-FD achieved better estimation than global-FD. Changing the multi-slice orientation to axial, coronal, and axial/sagittal orthogonal reduced the accuracy of VCMRI to VPD/COMS of 19.47±15.74%/1.57±2.54mm, 20.70±9.97%/2.34±0.92mm, and 16.02±13.79%/0.60±0.82mm, respectively. Reducing the number of cines to 8 enhanced temporal resolution of VC-MRI by 25% while

  10. TH-EF-BRA-08: A Novel Technique for Estimating Volumetric Cine MRI (VC-MRI) From Multi-Slice Sparsely Sampled Cine Images Using Motion Modeling and Free Form Deformation

    Energy Technology Data Exchange (ETDEWEB)

    Harris, W; Yin, F; Wang, C; Chang, Z; Cai, J; Zhang, Y; Ren, L [Duke University Medical Center, Durham, NC (United States)

    2016-06-15

    Purpose: To develop a technique to estimate on-board VC-MRI using multi-slice sparsely-sampled cine images, patient prior 4D-MRI, motion-modeling and free-form deformation for real-time 3D target verification of lung radiotherapy. Methods: A previous method has been developed to generate on-board VC-MRI by deforming prior MRI images based on a motion model(MM) extracted from prior 4D-MRI and a single-slice on-board 2D-cine image. In this study, free-form deformation(FD) was introduced to correct for errors in the MM when large anatomical changes exist. Multiple-slice sparsely-sampled on-board 2D-cine images located within the target are used to improve both the estimation accuracy and temporal resolution of VC-MRI. The on-board 2D-cine MRIs are acquired at 20–30frames/s by sampling only 10% of the k-space on Cartesian grid, with 85% of that taken at the central k-space. The method was evaluated using XCAT(computerized patient model) simulation of lung cancer patients with various anatomical and respirational changes from prior 4D-MRI to onboard volume. The accuracy was evaluated using Volume-Percent-Difference(VPD) and Center-of-Mass-Shift(COMS) of the estimated tumor volume. Effects of region-of-interest(ROI) selection, 2D-cine slice orientation, slice number and slice location on the estimation accuracy were evaluated. Results: VCMRI estimated using 10 sparsely-sampled sagittal 2D-cine MRIs achieved VPD/COMS of 9.07±3.54%/0.45±0.53mm among all scenarios based on estimation with ROI-MM-ROI-FD. The FD optimization improved estimation significantly for scenarios with anatomical changes. Using ROI-FD achieved better estimation than global-FD. Changing the multi-slice orientation to axial, coronal, and axial/sagittal orthogonal reduced the accuracy of VCMRI to VPD/COMS of 19.47±15.74%/1.57±2.54mm, 20.70±9.97%/2.34±0.92mm, and 16.02±13.79%/0.60±0.82mm, respectively. Reducing the number of cines to 8 enhanced temporal resolution of VC-MRI by 25% while

  11. Vaccination in Renal Transplant Patients (VcRtp study)

    LENUS (Irish Health Repository)

    Rathore, F

    2016-02-01

    Adverse outcomes of influenza & pneumococcal infections in solid organ transplant recipients have been well documented. Vaccinations are therefore recommended by multiple guidelines. Despite emerging evidence of the safety & effectiveness among immunosuppressed patients, most vaccines are still underutilized, we conducted a survey among the renal transplant patients in Beaumont Hospital to determine the awareness and uptake of vaccinations. Questionnaires were handed to patients during a clinic visit over a span of 2 weeks and 250 questionnaires were posted out to randomly selected transplant patients, The Questionnaire addressed various aspects including the awareness of importance of vaccinations, source of information, if they were up to date with the vaccines & where did they receive it?

  12. Design of acoustic emission monitoring system based on VC++

    Science.gov (United States)

    Yu, Yang; He, Wei

    2015-12-01

    At present, a lot of companies at home and abroad have researched and produced a batch of specialized monitoring instruments for acoustic emission (AE). Most of them cost highly and the system function exists in less stable and less portability for the testing environment and transmission distance and other aspects. Depending on the research background and the status quo, a dual channel intelligent acoustic emission monitoring system was designed based on Microsoft Foundation Classes in Visual Studio C++ to solve some of the problems in the acoustic emission research and meet the needs of actual monitoring task. It contains several modules such as main module, acquisition module, signal parameters setting module and so on. It could give out corrosion AE waveform and signal parameters results according to the main menu selected parameters. So the needed information could be extracted from the experiments datum to solve the problem deeply. This soft system is the important part of AE detection g system.

  13. Health physics training at V.C. Summer Nuclear Station

    International Nuclear Information System (INIS)

    Blue, L.A.; Bellmore, J.R.; Shultz, P.A.

    1981-01-01

    Health Physics training for radiation workers and Health Physics Specialists continues to receive full attention by regulatory agencies such as the NRC and ANI. Guidance for such training continues to develop in a direction which forces utilities to continuously increase the quality and quantity of their Health Physics Training Program. This occurs at a time when our rapidly growing industry is placing greatly increased demands on the available work force of highly trained nuclear workers

  14. Elucidating mechanical transition effects of invading cancer cells with a subnucleus-scaled microfluidic serial dimensional modulation device†

    OpenAIRE

    Mak, Michael; Reinhart-King, Cynthia A.; Erickson, David

    2013-01-01

    Mechanical boundaries that define and regulate biological processes, such as cell-cell junctions and dense extracellular matrix networks, exist throughout the physiological landscape. During metastasis, cancer cells are able to invade across these barriers and spread to distant tissues. While transgressing boundaries is a necessary step for distal colonies to form, little is known about interface effects on cell behavior during invasion. Here we introduce a device and metric to assess cell tr...

  15. Topical dura mater application of CFA induces enhanced expression of c-fos and glutamate in rat trigeminal nucleus caudalis

    DEFF Research Database (Denmark)

    Lukács, M; Warfvinge, K; Tajti, J

    2017-01-01

    BACKGROUND: Migraine is a debilitating neurological disorder where trigeminovascular activation plays a key role. We have previously reported that local application of Complete Freund's Adjuvant (CFA) onto the dura mater caused activation in rat trigeminal ganglion (TG) which was abolished......) was achieved by application of CFA onto the dural parietal surface. SZR72 was given intraperitoneally (i.p.), one dose prior CFA deposition and repeatedly daily for 7 days. Immunohistochemical studies were performed for mapping glutamate, c-fos, PACAP, substance P, IL-6, IL-1β and TNFα in the TNC/Sp5 and other...... regions of the brainstem and at the C1-C2 regions of the spinal cord. RESULTS: We found that CFA increased c-fos and glutamate immunoreactivity in TNC and C1-C2 neurons. This effect was mitigated by SZR72. PACAP positive fibers were detected in the fasciculus cuneatus and gracilis. Substance P, TNFα, IL-6...

  16. Sensitization of trigeminal brainstem pathways in a model for tear deficient dry eye.

    Science.gov (United States)

    Rahman, Mostafeezur; Okamoto, Keiichiro; Thompson, Randall; Katagiri, Ayano; Bereiter, David A

    2015-05-01

    Chronic dry eye disease (DE) is associated with an unstable tear film and symptoms of ocular discomfort. The characteristics of symptoms suggest a key role for central neural processing; however, little is known about central neuroplasticity and DE. We used a model for tear deficient DE and assessed effects on eye blink behavior, orbicularis oculi muscle activity (OOemg), and trigeminal brainstem neural activity in male rats. Ocular-responsive neurons were recorded at the interpolaris/caudalis transition (Vi/Vc) and Vc/upper cervical cord (Vc/C1) regions under isoflurane, whereas OOemg activity was recorded under urethane. Spontaneous tear volume was reduced by ∼50% at 14 days after exorbital gland removal. Hypertonic saline-evoked eye blink behavior in awake rats was enhanced throughout the 14 days after surgery. Saline-evoked neural activity at the Vi/Vc transition and in superficial and deep laminae at the Vc/C1 region was greatly enhanced in DE rats. Neurons from DE rats classified as wide dynamic range displayed enlarged convergent periorbital receptive fields consistent with central sensitization. Saline-evoked OOemg activity was markedly enhanced in DE rats compared with controls. Synaptic blockade at the Vi/Vc transition or the Vc/C1 region greatly reduced hypertonic saline-evoked OOemg activity in DE and sham rats. These results indicated that persistent tear deficiency caused sensitization of ocular-responsive neurons at multiple regions of the caudal trigeminal brainstem and enhanced OOemg activity. Central sensitization of ocular-related brainstem circuits is a significant factor in DE and likely contributes to the apparent weak correlation between peripheral signs of tear dysfunction and symptoms of irritation.

  17. On the nature of the afferent fibers of oculomotor nerve.

    Science.gov (United States)

    Manni, E; Draicchio, F; Pettorossi, V E; Carobi, C; Grassi, S; Bortolami, R; Lucchi, M L

    1989-03-01

    The oculogyric nerves contain afferent fibers originating from the ophthalmic territory, the somata of which are located in the ipsilateral semilunar ganglion. These primary sensory neurons project to the Subnucleus Gelatinosus of the Nucleus Caudalis Trigemini, where they make presynaptic contact with the central endings of the primary trigeminal afferents running in the fifth cranial nerve. After complete section of the trigeminal root, the antidromic volleys elicited in the trunk of the third cranial nerve by stimulating SG of NCT consisted of two waves belonging to the A delta and C groups. The area of both components of the antidromic volleys decreased both after bradykinin and hystamine injection into the corresponding cutaneous region and after thermic stimulation of the ipsilateral trigeminal ophthalmic territory. The reduction of such potentials can be explained in terms of collision between the antidromic volleys and those elicited orthodromically by chemical and thermic stimulation. Also, capsaicin applied on the nerve induced an immediate increase, followed by a long lasting decrease, of orthodromic evoked response area. These findings bring further support to the nociceptive nature of the afferent fibers running into the oculomotor nerve.

  18. Central projections and entries of capsaicin-sensitive muscle afferents.

    Science.gov (United States)

    Della Torre, G; Lucchi, M L; Brunetti, O; Pettorossi, V E; Clavenzani, P; Bortolami, R

    1996-03-25

    The entry pathway and central distribution of A delta and C muscle afferents within the central nervous system (CNS) were investigated by combining electron microscopy and electrophysiological analysis after intramuscular injection of capsaicin. The drug was injected into the rat lateral gastrocnemius (LG) and extraocular (EO) muscles. The compound action potentials of LG nerve and the evoked field potentials recorded in semilunar ganglion showed an immediate and permanent reduction in A delta and C components. The morphological data revealed degenerating unmyelinated axons and terminals in the inner sublamina II and in the border of laminae I-II of the dorsal horn at L4-L5 and C1-C2 (subnucleus caudalis trigemini) spinal cord segments. Most degenerating terminals were the central bouton (C) of type I and II synaptic glomeruli. Furthermore, degenerating peripheral axonal endings (V2) presynaptic to normal C were found. Since V2 were previously found degenerated after cutting the oculomotor nerve (ON) or L4 ventral root, we conclude that some A delta and C afferents from LG and EO muscles entering the CNS by ON or ventral roots make axoaxonic synapses on other primary afferents to promote an afferent control of sensory input.

  19. Afferent fibers and sensory ganglion cells within the oculomotor nerve in some mammals and man. II. Electrophysiological investigations.

    Science.gov (United States)

    Manni, E; Bortolami, R; Pettorossi, V E; Lucchi, M L; Callegari, E

    1978-01-01

    The main aim of the present study was to localize with electrophysiological techniques the central projections and terminations of the aberrant trigeminal fibres contained in the oculomotor nerve of the lamb. After severing a trigeminal root, single-shock electrical stimulation of the trigeminal axons present in the central stump of the ipsilateral oculomotor nerve evoked field potentials in the area of, i) the subnucleus gelatinosus of the nucleus caudalis trigemini at the level of C1-C2; ii) the main sensory trigeminal nucleus; iii) the descending trigeminal nucleus and tract; iv) the adjacent reticular formation. Units whose discharge rate was influenced by such a stimulation were also found in the same territories. These regions actually exhibited degenerations after cutting an oculomotor nerve. We conclude, therefore, that the trigeminal fibres which leave the Vth nerve at the level of the cavernous sinus and enter the brain stem through the IIIrd nerve, end in the same structures which receive the terminations of the afferent fibres entering the brain stem through the sensory trigeminal root.

  20. EFTEM-EELS characterization of VC and Cr3C2 doped cemented carbides

    International Nuclear Information System (INIS)

    Warbichler, P.; Hofer, F.; Grogger, W.; Lackner, A.

    2001-01-01

    Structure-property correlation plays an important role in the design of advanced materials which are increasingly based on sub-micrometer and sometimes even nanometer grains. In this respect, analytical electron microscopy (AEM) offers a comprehensive range of characterization techniques which are particularly well suited for hard materials: electron diffraction and high resolution electron microscopy for obtaining crystallographic information and especially new emerging techniques such as energy-filtering TEM (EFTEM) and electron energy-loss spectroscopy (EELS) which enable nearly atomic resolution analysis. In this paper we concentrate on EFTEM and HREM investigations of both WC precursor-powders and sintered WC-Co composites doped with vanadium and chromium carbides in order to control the grain growth during the sintering of the ultra fine WC powders. The aim was to locate the distribution of the doping elements in the powders and in the sintered materials. (author)

  1. Using DLL as Interface between API an VC#.NET Applications

    Directory of Open Access Journals (Sweden)

    Marian DARDALA

    2006-01-01

    Full Text Available This paper presents a solution for using complex Win32API data structures and functions in Visual C# .NET applications. We built DLL (Dynamic Link Library to manage the API functions and data structures and we used DLL modules in a C# application. This is an easier working way compared with the traditional way of importing and managing API’s functions in C# programs.

  2. Enhanced Absorption and Diffusion Properties of Lithium on B,N,VC-decorated Graphene

    Science.gov (United States)

    Jin, Mengting; Yu, L. C.; Shi, W. M.; Deng, J. G.; Zhang, Y. N.

    2016-01-01

    Systematic first-principles calculations were performed to investigate the adsorption and diffusion of Li on different graphene layers with B/N-doping and/or C-vacancy, so as to understand why doping heteroatoms in graphene anode could significantly improve the performance of lithium-ion batteries. We found that the formation of single or double carbon vacancies in graphene are critical for the adsorption of Li atoms. While the N-doping facilitates the formation of vacancies, it introduces over binding issue and hinders the Li diffusion. The presence of B takes the excessive electrons from Li and N and reduces the energy barrier of Li diffusion on substrates. We perceive that these clear insights are crucial for the further development of graphene based anode materials for lithium-ion batteries. PMID:27897202

  3. Venture financing of start-ups: A model of contract between VC fund and entrepreneur

    Directory of Open Access Journals (Sweden)

    Osintsev Yury

    2010-01-01

    Full Text Available Venture capital has become one of the main sources of innovation in the modern, global economy. It is not just a substitute for bank loans: it has proven to be a more efficient way of financing projects at different stages. On one hand, venture financing allows for projects with higher risk, which leads to the possibility of higher returns on investment. On the other hand, venture investors who usually have managerial experience often participate in governing the business, which certainly adds value to the enterprise. In this paper we establish the model of contract between the venture capital fund and the entrepreneur, focusing on probably the most important issue of this contract: the shares of the parties in the business. The shares in the company determine the distribution of the joint surplus. The expected joint profits are not just exogenously specified in the contract but are dependent on the behavioral variables of both parties at the stage of fulfilling the contract. We call the behavioral variable of the entrepreneur ‘effort’ and the one of the venture fund ‘advice’. The probability of the project’s success, and hence the expected joint revenues, are increased by these two. However, both kinds of effort are costly to the respective parties that have made them. Based on this fact we can elaborate the profit functions of both sides of the contract. Our model can be considered as a basis for specifying contracts concerning venture financing. It can provide the logic for how the equilibrium shares of entrepreneur and venture fund are obtained.

  4. Limit on parity violation on p-water scattering at 6 Ge V/c

    International Nuclear Information System (INIS)

    Mischke, R.E.; Bowman, J.D.; Hoffman, C.M.

    1977-01-01

    Preliminary results of an experiment aimed at a direct measurement of the weak interaction contributions to nucleon-nucleon scattering are reported. The transmission of a polarized proton beam through a water target has been measured as a function of the beam helicity. The experiment has been designed to exclude the hyperon effect to be sure that observed variations of the cross sections deal with a parity-violation in the p-water interaction. Preliminary analysis of the data shows the systematic error problems to be substantial. A regression analyais is outlined of the data planned to extract the transmission variations due to beam motion, intensity changes and residual transverse polarization. Preliminary results for the cross-section change (before regression) are of the 10 -6 order

  5. 75 FR 70690 - Visteon Corporation Springfield Plant Formerly Known as VC Regional Assembly & Manufacturing, LLC...

    Science.gov (United States)

    2010-11-18

    ... From MSX International, Adecco, and Manpower, Springfield, OH; Amended Certification Regarding... Corporation, Springfield Plant, including on-site leased workers from MSX International, Adecco, and Manpower... subject firm had their wages reported under a separate unemployment insurance (UI) tax account under the...

  6. Fajolu IB Ezenwa B Akintan P Ezeaka VC An 8-year review of major ...

    African Journals Online (AJOL)

    2016-05-04

    May 4, 2016 ... bolic disorders, which are present from birth, irrespec- tive of whether the defect is ... sumption in the mother,8,9 or are inherited via abnormal genes from the carrier or ..... and outcome of gross congenital abnormalities at birth ...

  7. Design of Intelligent Transportation Inquiry System Based on MapX in the Environment of VC++

    Directory of Open Access Journals (Sweden)

    Cheng Juan

    2016-01-01

    Full Text Available This paper applied MapInfo, the professional soft ware tool of GIS, integrated secondary exploiture combining with elctronic maps, and made use of the exploiture flat roof Visual C++ as the tool of visualize development, transferred MapX, a control of MapInfo, integrated them. The paper designed the Inquiry System in Intelligent Transportation, which including query system of road information, query system of bus information, query system of district information. It can be carried out space analysis and query function based on GIS. Adopted SQL Server manage attribute data, by data binding, attribute data in SQL Server and victor picture data were combined.

  8. Resources access needs and capabilities as mediators of the relationship between VC firm size and syndication

    NARCIS (Netherlands)

    E. Verwaal (Ernst); J. Bruining (Hans); D.M. Wright (Mike); S. Manigart (Sophie); A. Lockett (Andy)

    2010-01-01

    textabstractDrawing from the resource-based view and transaction costs economics, we develop a theoretical framework to explain why small and large firms face different levels of resource access needs and resource access capabilities, which mediate the relationship between firm size and hybrid

  9. Corrosion of WC-VC-Co hardmetal in neutral chloride containing media

    CSIR Research Space (South Africa)

    Machio, Christopher N

    2013-01-01

    Full Text Available , “Electrochemical oxidation of WC in acidic sulphate solution,” Corrosion Science, vol. 46, no. 2, pp. 453–469, 2004. [18] T. Kubo and Y. Nishikitani, “Deposition temperature depen- dence of optical gap and coloration efficiency spectrum in elec- trochromic tungsten...

  10. Late Pliocene carnivores from Včeláre 2 (Southeastern Slovakia)

    Czech Academy of Sciences Publication Activity Database

    Sabol, M.; Holec, P.; Wagner, Jan

    2008-01-01

    Roč. 42, č. 5 (2008), s. 531-543 ISSN 0031-0301 Institutional research plan: CEZ:AV0Z30130516 Keywords : Homotherium * Ursus * Parailurus * Včeláre 2 (Slovakia) Subject RIV: EG - Zoology Impact factor: 0.369, year: 2008

  11. Organization of projections from the spinal trigeminal subnucleus oralis to the spinal cord in the rat: a neuroanatomical substrate for reciprocal orofacial-cervical interactions.

    Science.gov (United States)

    Devoize, Laurent; Doméjean, Sophie; Melin, Céline; Raboisson, Patrick; Artola, Alain; Dallel, Radhouane

    2010-07-09

    The organization of efferent projections from the spinal trigeminal nucleus oralis (Sp5O) to the spinal cord in the rat was studied using the anterograde tracer Phaseolus vulgaris leucoagglutinin. Sp5O projections to the spinal cord are restricted to the cervical cord. No labeled terminal can be detected in the thoracic and lumbar cord. The organization of these projections happens to critically depend on the dorso-ventral location of the injection site. On the one hand, the dorsal part of the Sp5O projects to the medial part of the dorsal horn (laminae III-V) at the C1 level, on the ipsilateral side, and to the ventral horn, on both sides but mainly on the ipsilateral one. Ipsilateral labeled terminals are distributed throughout laminae VII to IX but tend to cluster around the dorso-medial motor nuclei, especially at C3-C5 levels. Within the contralateral ventral horn, label terminals are found particularly in the region of the ventro-medial motor nucleus. This projection extends as far caudally as C3 or C4 level. On the other hand, the ventral part of the Sp5O projects to the lateral part of the dorsal horn (laminae III-V) at the C1 level, on the ipsilateral side, and to the ventral horn, on both sides but mainly on the contralateral one. Contralateral labeled terminals are distributed within the region of the dorso- and ventro-medial motor nuclei at C1-C4 levels whereas they are restricted to the dorso-medial motor nucleus at C5-C8 levels. These findings suggest that Sp5O is involved in the coordination of neck movements and in the modulation of incoming sensory information at the cervical spinal cord. Copyright (c) 2010 Elsevier B.V. All rights reserved.

  12. VGLUT1 or VGLUT2 mRNA-positive neurons in spinal trigeminal nucleus provide collateral projections to both the thalamus and the parabrachial nucleus in rats.

    Science.gov (United States)

    Zhang, Chun-Kui; Li, Zhi-Hong; Qiao, Yu; Zhang, Ting; Lu, Ya-Cheng; Chen, Tao; Dong, Yu-Lin; Li, Yun-Qing; Li, Jin-Lian

    2018-04-12

    The trigemino-thalamic (T-T) and trigemino-parabrachial (T-P) pathways are strongly implicated in the sensory-discriminative and affective/emotional aspects of orofacial pain, respectively. These T-T and T-P projection fibers originate from the spinal trigeminal nucleus (Vsp). We previously determined that many vesicular glutamate transporter (VGLUT1 and/or VGLUT2) mRNA-positive neurons were distributed in the Vsp of the adult rat, and most of these neurons sent their axons to the thalamus or cerebellum. However, whether VGLUT1 or VGLUT2 mRNA-positive projection neurons exist that send their axons to both the thalamus and the parabrachial nucleus (PBN) has not been reported. Thus, in the present study, dual retrograde tract tracing was used in combination with fluorescence in situ hybridization (FISH) for VGLUT1 or VGLUT2 mRNA to identify the existence of VGLUT1 or VGLUT2 mRNA neurons that send collateral projections to both the thalamus and the PBN. Neurons in the Vsp that send collateral projections to both the thalamus and the PBN were mainly VGLUT2 mRNA-positive, with a proportion of 90.3%, 93.0% and 85.4% in the oral (Vo), interpolar (Vi) and caudal (Vc) subnucleus of the Vsp, respectively. Moreover, approximately 34.0% of the collateral projection neurons in the Vc showed Fos immunopositivity after injection of formalin into the lip, and parts of calcitonin gene-related peptide (CGRP)-immunopositive axonal varicosities were in direct contact with the Vc collateral projection neurons. These results indicate that most collateral projection neurons in the Vsp, particularly in the Vc, which express mainly VGLUT2, may relay orofacial nociceptive information directly to the thalamus and PBN via axon collaterals.

  13. Acute and chronic craniofacial pain: brainstem mechanisms of nociceptive transmission and neuroplasticity, and their clinical correlates.

    Science.gov (United States)

    Sessle, B J

    2000-01-01

    This paper reviews the recent advances in knowledge of brainstem mechanisms related to craniofacial pain. It also draws attention to their clinical implications, and concludes with a brief overview and suggestions for future research directions. It first describes the general organizational features of the trigeminal brainstem sensory nuclear complex (VBSNC), including its input and output properties and intrinsic characteristics that are commensurate with its strategic role as the major brainstem relay of many types of somatosensory information derived from the face and mouth. The VBSNC plays a crucial role in craniofacial nociceptive transmission, as evidenced by clinical, behavioral, morphological, and electrophysiological data that have been especially derived from studies of the relay of cutaneous nociceptive afferent inputs through the subnucleus caudalis of the VBSNC. The recent literature, however, indicates that some fundamental differences exist in the processing of cutaneous vs. other craniofacial nociceptive inputs to the VBSNC, and that rostral components of the VBSNC may also play important roles in some of these processes. Modulatory mechanisms are also highlighted, including the neurochemical substrate by which nociceptive transmission in the VBSNC can be modulated. In addition, the long-term consequences of peripheral injury and inflammation and, in particular, the neuroplastic changes that can be induced in the VBSNC are emphasized in view of the likely role that central sensitization, as well as peripheral sensitization, can play in acute and chronic pain. The recent findings also provide new insights into craniofacial pain behavior and are particularly relevant to many approaches currently in use for the management of pain and to the development of new diagnostic and therapeutic procedures aimed at manipulating peripheral inputs and central processes underlying nociceptive transmission and its control within the VBSNC.

  14. Temporomandibular joint inflammation activates glial and immune cells in both the trigeminal ganglia and in the spinal trigeminal nucleus

    Directory of Open Access Journals (Sweden)

    Jasmin Luc

    2010-12-01

    Full Text Available Abstract Background Glial cells have been shown to directly participate to the genesis and maintenance of chronic pain in both the sensory ganglia and the central nervous system (CNS. Indeed, glial cell activation has been reported in both the dorsal root ganglia and the spinal cord following injury or inflammation of the sciatic nerve, but no data are currently available in animal models of trigeminal sensitization. Therefore, in the present study, we evaluated glial cell activation in the trigeminal-spinal system following injection of the Complete Freund's Adjuvant (CFA into the temporomandibular joint, which generates inflammatory pain and trigeminal hypersensitivity. Results CFA-injected animals showed ipsilateral mechanical allodynia and temporomandibular joint edema, accompanied in the trigeminal ganglion by a strong increase in the number of GFAP-positive satellite glial cells encircling neurons and by the activation of resident macrophages. Seventy-two hours after CFA injection, activated microglial cells were observed in the ipsilateral trigeminal subnucleus caudalis and in the cervical dorsal horn, with a significant up-regulation of Iba1 immunoreactivity, but no signs of reactive astrogliosis were detected in the same areas. Since the purinergic system has been implicated in the activation of microglial cells during neuropathic pain, we have also evaluated the expression of the microglial-specific P2Y12 receptor subtype. No upregulation of this receptor was detected following induction of TMJ inflammation, suggesting that any possible role of P2Y12 in this paradigm of inflammatory pain does not involve changes in receptor expression. Conclusions Our data indicate that specific glial cell populations become activated in both the trigeminal ganglia and the CNS following induction of temporomandibular joint inflammation, and suggest that they might represent innovative targets for controlling pain during trigeminal nerve sensitization.

  15. [Changes in ingestive behavior during growth affects the functional maturation of temporomandibular joint nociceptive neurons of rats].

    Science.gov (United States)

    Hiranuma, Maya

    2013-03-01

    Temporomandibular joint (TMJ) loading during development promotes its growth and maintains normal structure/function. Continuous change in diet consistency is related to development and maturation of the peripheral nervous system, including the nociceptive system. However, the functional modulation of TMJ-nociceptive neurons under different ingestive behavior is unclear. We fed growing rats a liquid diet to investigate the effects of low TMJ loading on the response properties of neurons in the trigeminal spinal tract subnucleus caudalis (Sp5C). Forty 2-week-old male rats were used. They were fed chow pellets (n = 20, C group) or a liquid diet (n = 20, LD group) soon after weaning. Firing activities of single sensory units in response to TMJ pressure stimuli were recorded at 4, 5, 7 and 9 weeks. In TMJ-nociceptive neurons, the firing threshold (FT) in the LD group was significantly lower than that in the C group at each recording age. The FT in the C group remained unchanged throughout the recording period, whereas that in the LD group was the highest at 4 weeks, and gradually decreased. On the other hand, the initial firing frequency (IFF) was significantly higher in the LD group than in the C group at each recording age. The IFF in the C group remained unchanged throughout the experimental period, whereas that in the LD group was at its lowest at 4 weeks, and gradually increased. Based on these findings, ingestive behavior that results from continuous changes in the physical consistency of the diet during growth may affect the functional maturation of TMJ-nociceptive neurons.

  16. Involvement of ERK phosphorylation in brainstem neurons in modulation of swallowing reflex in rats

    Science.gov (United States)

    Tsujimura, Takanori; Kondo, Masahiro; Kitagawa, Junichi; Tsuboi, Yoshiyuki; Saito, Kimiko; Tohara, Haruka; Ueda, Koichiro; Sessle, Barry J; Iwata, Koichi

    2009-01-01

    In order to evaluate the neuronal mechanisms underlying functional abnormalities of swallowing in orofacial pain patients, this study investigated the effects of noxious orofacial stimulation on the swallowing reflex, phosphorylated extracellular signal-regulated kinase (pERK) and γ-aminobutyric acid (GABA) immunohistochemical features in brainstem neurons, and also analysed the effects of brainstem lesioning and of microinjection of GABA receptor agonist or antagonist into the nucleus tractus solitarii (NTS) on the swallowing reflex in anaesthetized rats. The swallowing reflex elicited by topical administration of distilled water to the pharyngolaryngeal region was inhibited after capsaicin injection into the facial (whisker pad) skin or lingual muscle. The capsaicin-induced inhibitory effect on the swallowing reflex was itself depressed after the intrathecal administration of MAPK kinase (MEK) inhibitor. No change in the capsaicin-induced inhibitory effect was observed after trigeminal spinal subnucleus caudalis lesioning, but the inhibitory effect was diminished by paratrigeminal nucleus (Pa5) lesioning. Many pERK-like immunoreactive neurons in the NTS showed GABA immunoreactivity. The local microinjection of the GABAA receptor agonist muscimol into the NTS produced a significant reduction in swallowing reflex, and the capsaicin-induced depression of the swallowing reflex was abolished by microinjection of the GABAA receptor antagonist bicuculline into the NTS. The present findings suggest that facial skin–NTS, lingual muscle–NTS and lingual muscle–Pa5–NTS pathways are involved in the modulation of swallowing reflex by facial and lingual pain, respectively, and that the activation of GABAergic NTS neurons is involved in the inhibition of the swallowing reflex following noxious stimulation of facial and intraoral structures. PMID:19124539

  17. Involvement of ERK phosphorylation in brainstem neurons in modulation of swallowing reflex in rats.

    Science.gov (United States)

    Tsujimura, Takanori; Kondo, Masahiro; Kitagawa, Junichi; Tsuboi, Yoshiyuki; Saito, Kimiko; Tohara, Haruka; Ueda, Koichiro; Sessle, Barry J; Iwata, Koichi

    2009-02-15

    In order to evaluate the neuronal mechanisms underlying functional abnormalities of swallowing in orofacial pain patients, this study investigated the effects of noxious orofacial stimulation on the swallowing reflex, phosphorylated extracellular signal-regulated kinase (pERK) and gamma-aminobutyric acid (GABA) immunohistochemical features in brainstem neurons, and also analysed the effects of brainstem lesioning and of microinjection of GABA receptor agonist or antagonist into the nucleus tractus solitarii (NTS) on the swallowing reflex in anaesthetized rats. The swallowing reflex elicited by topical administration of distilled water to the pharyngolaryngeal region was inhibited after capsaicin injection into the facial (whisker pad) skin or lingual muscle. The capsaicin-induced inhibitory effect on the swallowing reflex was itself depressed after the intrathecal administration of MAPK kinase (MEK) inhibitor. No change in the capsaicin-induced inhibitory effect was observed after trigeminal spinal subnucleus caudalis lesioning, but the inhibitory effect was diminished by paratrigeminal nucleus (Pa5) lesioning. Many pERK-like immunoreactive neurons in the NTS showed GABA immunoreactivity. The local microinjection of the GABA(A) receptor agonist muscimol into the NTS produced a significant reduction in swallowing reflex, and the capsaicin-induced depression of the swallowing reflex was abolished by microinjection of the GABA(A) receptor antagonist bicuculline into the NTS. The present findings suggest that facial skin-NTS, lingual muscle-NTS and lingual muscle-Pa5-NTS pathways are involved in the modulation of swallowing reflex by facial and lingual pain, respectively, and that the activation of GABAergic NTS neurons is involved in the inhibition of the swallowing reflex following noxious stimulation of facial and intraoral structures.

  18. Enhanced Oxidative Bioremediation of cis-dichloroethene (cis-DCE) and Vinyl Chloride (VC) using Electron Shuttles

    Science.gov (United States)

    2009-07-01

    NA NA 5.23E-013 mg/L 0.113 2, 5 Vitamin K3 , Menadione, Menadione sodium bisulfate, Menaquinone 2-Methyl-1,4-naphthoquinone 58-27-5 C11H8O2 172.18...version of vitamin K3 which is known to have electron shuttling ability. Thus, bisulfate modification resulted in loss of activity. AQS and lawsone

  19. Possible production of glueballs in anti p 4He reactions at 0.6 GeVc-1 incident momentum

    International Nuclear Information System (INIS)

    Balestra, F.; Bossolasco, S.; Bussa, M.P.; Busso, L.; Fava, L.; Ferrero, L.; Grasso, A.; Maggiora, A.; Panzieri, D.; Piragino, G.; Piragino, R.; Tosello, F.; Bendiscioli, G.; Filippini, V.; Rotondi, A.; Salvini, P.; Zenoni, A.; Batusov, Yu.; Bunyatov, S.A.; Falomkin, I.V.; Nichitiu, F.; Pontecorvo, G.B.; Rozhdestvensky, A.M.; Sapozhnikov, M.G.; Tretyak, V.I.; Guaraldo, C.; Lodi Rizzini, E.; Haatuft, A.; Halsteinslid, A.; Myklebost, K.; Olsen, J.M.; Breivik, F.O.; Danielsen, K.M.; Jacobsen, T.; Soerensen, S.O.

    1991-01-01

    A sharp peak at 1150 MeV c -2 in the π - π + π - π + -system in the final state of anti p 4 He-reactions at 0.6 GeV c -1 incident momentum is seen. This system probably has spin-parity = 0 + or 2 + , which are possible spin-parity assignments of a glueball. (orig.)

  20. RECUBRIMIENTOS DE VC Y NBC PRODUCIDOS POR DRT: TECNOLOGÍA ECONÓMICA, EFICIENTE Y AMBIENTALMENTE LIMPIA

    Directory of Open Access Journals (Sweden)

    Fabio Enrique Castillejo Nieto

    2012-01-01

    Full Text Available En este artículo se presentan los fundamentos del proceso de deposición por difusión termoreactiva (dtrdtrdtr, una técnica que permite producir recubrimientos duros de forma económica sin ser invasiva o agresiva con el medio ambiente. Se propone una metodología experimental para desarrollar recubrimientos de carburos de vanadio (vcvc, y carburos de niobio (NbC, sobre aceros aisi H13, utilizando en el proceso de fabricación DRT, bórax fundido, aluminio y ferroaleaciones a 1.020°C durante cuatro horas. Las muestras obtenidas fueron evaluadas utilizando difracción de rayos X (drdrx, para identificar las fases y microscopía electrónica de barrido (sem, para medir el espesor y la homogeneidad de los recubrimientos producidos. La dureza fue obtenida usando microdureza knoop con una carga de 50 g y la resistencia a la corrosión fue determinada con técnicas electroquímicas, utilizando polarización potenciodímica. Los resultados confirmaron la presencia de recubrimientos de carburo de vanadio y carburo niobio con buena regularidad en el espesor, altas durezas y una mejora en la resistencia a la corrosión en comparación con el acero sin recubrimiento.

  1. Strong spin-filtering and spin-valve effects in a molecular V-C-60-V contact

    DEFF Research Database (Denmark)

    Koleini, Mohammad; Brandbyge, Mads

    2012-01-01

    Motivated by the recent achievements in the manipulation of C-60 molecules in STM experiments, we study theoretically the structure and electronic properties of a C-60 molecule in an STM tunneljunction with a magnetic tip and magnetic adatom on a Cu(111) surface using first-principles calculations....... For the case of a vanadium tip/adatom, we demonstrate how spin coupling between the magnetic V atoms, mediated by the C-60, can be observed in the electronic transport, which display a strong spin-filtering effect, allowing mainly majority-spin electrons to pass (>95%). Moreover, we find a significant change...... in the conductance between parallel and anti-parallel spin polarizations in the junction (86%) which suggests that STM experiments should be able to characterize the magnetism and spin coupling for these systems....

  2. Beyond "Inert" Ideas to Teaching General Chemistry from Rich Contexts: Visualizing the Chemistry of Climate Change (VC3)

    Science.gov (United States)

    Mahaffy, Peter G.; Holme, Thomas A.; Martin-Visscher, Leah; Martin, Brian E.; Versprille, Ashley; Kirchhoff, Mary; McKenzie, Lallie; Town, Marcy

    2017-01-01

    As one approach to moving beyond transmitting "inert" ideas to chemistry students, we use the term "teaching from rich contexts" to describe implementations of case studies or context-based learning based on systems thinking that provide deep and rich opportunities for learning crosscutting concepts through contexts. This…

  3. Figurative Language in Malay to English Translation: An Analysis of the 2015 UniMAP VC's Keynote Speech

    Directory of Open Access Journals (Sweden)

    Sharmini A.

    2018-01-01

    Full Text Available Translating figurative language involves more than just replacing the figurative language with its equivalent in the target language. Therefore, it is not surprising for the translation of figurative language to have its own set of challenges. Problems the translator faces in translating the Malay Figurative Language into English include complexities in understanding, interpreting and recreating the Figurative language that are unique in the Source Language (SL culture; which have to be explained and described in Target Language (TL where such practices and customs are non - existent. Secondly, the Source Text (ST figurative language may appear in a variety of types and have a distinct denotative and connotative meaning and reference; most often, it is difficult to find an equivalent which totally matches the original meaning or concept. This particular paper analyses the translation of figurative language extracted from UniMAP's Vice Chancellor Keynote Speech in 2015. Findings reveal that the three categories of figurative language identified were namely idioms, metaphors and similes. Translation strategies used are either not translated, paraphrased or translated with a similar meaning but in different form.

  4. Stress recovery behaviour of an Fe–Mn–Si–Cr–Ni–VC shape memory alloy used for prestressing

    International Nuclear Information System (INIS)

    Lee, W J; Weber, B; Feltrin, G; Czaderski, C; Motavalli, M; Leinenbach, C

    2013-01-01

    This paper describes the stress recovery behaviour of an Fe–17Mn–5Si–10Cr–4Ni–1(V, C) (mass%) shape memory alloy used for prestressing of civil structures. The prestressing due to the shape memory effect was simulated by a series of tests with pre-straining of the material followed by heating and cooling back at constant strain. Different pre-strain and heating conditions were examined. Moreover, the response due to additional mechanical and thermal cyclic loading has been investigated. These results were used to predict the partial prestress loss in a structure due to variable loading during operation. Finally, a heating test at constant strain was performed after the cyclic loading to check the possibility of reactivating the prestress lost during an exceptionally high load. (paper)

  5. Distinctive response of CNS glial cells in oro-facial pain associated with injury, infection and inflammation

    Directory of Open Access Journals (Sweden)

    Ribeiro-da-Silva Alfredo

    2010-11-01

    Full Text Available Abstract Oro-facial pain following injury and infection is frequently observed in dental clinics. While neuropathic pain evoked by injury associated with nerve lesion has an involvement of glia/immune cells, inflammatory hyperalgesia has an exaggerated sensitization mediated by local and circulating immune mediators. To better understand the contribution of central nervous system (CNS glial cells in these different pathological conditions, in this study we sought to characterize functional phenotypes of glial cells in response to trigeminal nerve injury (loose ligation of the mental branch, infection (subcutaneous injection of lipopolysaccharide-LPS and to sterile inflammation (subcutaneous injection of complete Freund's adjuvant-CFA on the lower lip. Each of the three insults triggered a specific pattern of mechanical allodynia. In parallel with changes in sensory response, CNS glial cells reacted distinctively to the challenges. Following ligation of the mental nerve, both microglia and astrocytes in the trigeminal nuclear complex were highly activated, more prominent in the principal sensory nucleus (Pr5 and subnucleus caudalis (Sp5C area. Microglial response was initiated early (days 3-14, followed by delayed astrocytes activation (days 7-28. Although the temporal profile of microglial and astrocyte reaction corresponded respectively to the initiation and chronic stage of neuropathic pain, these activated glial cells exhibited a low profile of cytokine expression. Local injection of LPS in the lower lip skin also triggered a microglial reaction in the brain, which started in the circumventricular organs (CVOs at 5 hours post-injection and diffused progressively into the brain parenchyma at 48 hours. This LPS-induced microglial reaction was accompanied by a robust induction of IκB-α mRNA and pro-inflammatory cytokines within the CVOs. However, LPS induced microglial activation did not specifically occur along the pain signaling pathway. In

  6. Possible production of glueballs in anti p sup 4 He reactions at 0. 6 GeVc sup -1 incident momentum

    Energy Technology Data Exchange (ETDEWEB)

    Balestra, F.; Bossolasco, S.; Bussa, M.P.; Busso, L.; Fava, L.; Ferrero, L.; Grasso, A.; Maggiora, A.; Panzieri, D.; Piragino, G.; Piragino, R.; Tosello, F. (Ist. di Fisica Generale ' A. Avogadro' , Univ. of Turin and INFN (Italy)); Bendiscioli, G.; Filippini, V.; Rotondi, A.; Salvini, P.; Zenoni, A. (Dipt. di Fisica Nucleare e Teorica, Univ. of Pavia and INFN, Sezione di Pavia (Italy)); Batusov, Yu.; Bunyatov, S.A.; Falomkin, I.V.; Nichitiu, F.; Pontecorvo, G.B.; Rozhdestvensky, A.M.; Sapozhnikov, M.G.; Tretyak, V.I. (Joint Inst. for Nuclear Research, Dubna (USSR)); Guaraldo, C. (Lab. Nazionali di Frascati, INFN (Italy)); Lodi Rizzini, E. (Dipt. di Automazione Industriale, Univ. of Brescia and INFN, Turin (Italy)); Haatuft, A.; Halsteinslid, A.; Myklebost, K.; Olsen, J.M. (Physics Dept., Univ. of Bergen (Norway)); Breivik, F.O.; Danielsen, K.M.; Jacobsen, T.; Soerensen, S.O. (Inst. of Physics, Univ. of Oslo (Norway))

    1991-05-01

    A sharp peak at 1150 MeV c{sup -2} in the {pi}{sup -}{pi}{sup +}{pi}{sup -}{pi}{sup +}-system in the final state of anti p {sup 4}He-reactions at 0.6 GeV c{sup -1} incident momentum is seen. This system probably has spin-parity = 0{sup +} or 2{sup +}, which are possible spin-parity assignments of a glueball. (orig.).

  7. X-ray absorption edges and E.X.A.F.S.: application to the study of electronic and atomic structures of titanium and vanadium carbides TiC(1-x) and VC(1-x)

    International Nuclear Information System (INIS)

    Moisy-Maurice, Virginie.

    1980-09-01

    This text presents a systematic study of the X-ray absorption fine structures evolution, at the K edge of titanium, with vacancy concentration in TiC(1-x). The absorption edges are situated in the 50 eV following the coefficient discontinuity: from the evaluation of their general aspect, it is deduced that the positive charge of titanium atoms decreases when vacancy concentration increases in TiC(1-x). This allowed us to determine the best band structure calculation model. The interpretation of EXAFS spectra (modulation of the absorption coefficient until 1500 eV above the edge) gives indications about the local atomic structure. Here, the contraction of the average titanium-carbon interatomic distances compared to the distances between crystallographic sites is of the order of the experimental resolution 0.02 A for Ti C(0.8). The study of the damping of the spectra in terms of Debye-Waller factors gave an evaluation of the relative static atomic mean square displacements between first neighbours. Last, it has been established that the disordering of vacancies in the order-disorder transition of V 8 C 7 is an atomic scale phenomenon [fr

  8. The effects of L-carnitin in Budd-Chiari syndrome in a domestic cat

    OpenAIRE

    Aliye Sağkan Öztürk; Nuri Altuğ; Serkan İrfan Köse; Oktay Hasan Öztürk

    2016-01-01

    This paper describes a thrombosis in the vena cava caudalis of a 15 year-old cat with ascites. Trauma and eventually feline enteric corona virus infection in the cat were not detected. In the intrahepatic region, a blockage of vena cava caudalis was brought to light by ultrasonographic imaging. An aspirate of abdominal fl uid revealed modified transudate. Liver enzyme levels were increased in the serum sample of the cat. The levels of total oxidant status (TOS) and total antioxidant status (T...

  9. Dicty_cDB: VFJ888 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FKPKVKSGTDISQIDPVFTQERPMDSLVKQVL*vc*gkdtsxkvslmsxsi Translated Amino Acid sequence (All Frames) Frame A: vv...TKGGGEVKQHPWFKNIDWEKLDRKEVEVH FKPKVKSGTDISQIDPVFTQERPMDSLVKQVL*vc*gkdtsxkvslmsxsi

  10. Vitamin C nutrition in cattle.

    Science.gov (United States)

    Matsui, T

    2012-05-01

    Domestic animals, including ruminants, can synthesize vitamin C (VC) in their liver; as such, the dietary requirement for VC has not been confirmed in these animals. The adequacy of VC has been evaluated by quantifying VC levels in plasma, but the reported values in bovine plasma have been widely variable. Plasma VC concentration is decreased by heat stress, hepatic lesions, fattening, and infectious diseases such as mastitis in cattle. Therefore, VC supplementation is potentially beneficial for cattle with low plasma VC concentration. This review discusses the methods for determination of plasma VC concentration in cattle, VC nutrition, and the efficacy of VC supplementation in calves, dairy cattle, and beef cattle. Additionally I propose a reference range for plasma VC concentration in Japanese Black cattle.

  11. Vitamin C Nutrition in Cattle

    Directory of Open Access Journals (Sweden)

    T. Matsui

    2012-05-01

    Full Text Available Domestic animals, including ruminants, can synthesize vitamin C (VC in their liver; as such, the dietary requirement for VC has not been confirmed in these animals. The adequacy of VC has been evaluated by quantifying VC levels in plasma, but the reported values in bovine plasma have been widely variable. Plasma VC concentration is decreased by heat stress, hepatic lesions, fattening, and infectious diseases such as mastitis in cattle. Therefore, VC supplementation is potentially beneficial for cattle with low plasma VC concentration. This review discusses the methods for determination of plasma VC concentration in cattle, VC nutrition, and the efficacy of VC supplementation in calves, dairy cattle, and beef cattle. Additionally I propose a reference range for plasma VC concentration in Japanese Black cattle.

  12. Vitamin C impacts anxiety-like behavior and stress-induced anorexia relative to social environment in SMP30/GNL knockout mice.

    Science.gov (United States)

    Koizumi, Miwako; Kondo, Yoshitaka; Isaka, Ayumi; Ishigami, Akihito; Suzuki, Emiko

    2016-12-01

    The role of endogenous vitamin C (VC) in emotion and psychiatric measures has long been uncertain. We aimed to investigate how an individual's VC status impacts his or her mental health. Our hypothesis is that body VC levels modulate anxiety, anorexia, and depressive phenotypes under the influence of psychosocial rearing environments and sex. The VC status of senescence marker protein-30/gluconolactonase knockout mice, which lack the ability to synthesize VC, were continuously shifted from adequate (VC+) to depleted (VC-) by providing a water with or without VC. Despite weight loss in both sexes, suppressed feeding was specifically seen in males only during the VC- phase. Anxiety responses in the novelty-suppressed feeding paradigm were worse during the VC-, especially in females. Sensitivity to the forced swim test as determined by the initial latency was significantly shorter in the socially stable animals compared with socially unstable animals during the VC+ condition. The stress coping underlying depressive phenotypes was assessed by immobility duration in a series of forced swim tests. No significant differences were apparent between contrasting VC status. Homeostatic symptoms following stressful behavioral tests consisted of a great loss of appetite during the VC-. It should be noted that anorexia is extremely serious for the females. We conclude that endogenous VC status is critical for determining vulnerability to anxiety and anorexia in a sex-specific manner. Copyright © 2016 Elsevier Inc. All rights reserved.

  13. Comparative histological study of the mammalian facial nucleus.

    Science.gov (United States)

    Furutani, Rui; Sugita, Shoei

    2008-04-01

    We performed comparative Nissl, Klüver-Barrera and Golgi staining studies of the mammalian facial nucleus to classify the morphologically distinct subdivisions and the neuronal types in the rat, rabbit, ferret, Japanese monkey (Macaca fuscata), pig, horse, Risso's dolphin (Grampus griseus), and bottlenose dolphin (Tursiops truncatus). The medial subnucleus was observed in all examined species; however, that of the Risso's and bottlenose dolphins was a poorly-developed structure comprised of scattered neurons. The medial subnuclei of terrestrial mammals were well-developed cytoarchitectonic structures, usually a rounded column comprised of densely clustered neurons. Intermediate and lateral subnuclei were found in all studied mammals, with differences in columnar shape and neuronal types from species to species. The dorsolateral subnucleus was detected in all mammals but the Japanese monkey, whose facial neurons converged into the intermediate subnucleus. The dorsolateral subnuclei of the two dolphin species studied were expanded subdivisions comprised of densely clustered cells. The ventromedial subnuclei of the ferret, pig, and horse were richly-developed columns comprised of large multipolar neurons. Pig and horse facial nuclei contained another ventral cluster, the ventrolateral subnucleus. The facial nuclei of the Japanese monkey and the bottlenose dolphin were similar in their ventral subnuclear organization. Our findings show species-specific subnuclear organization and distribution patterns of distinct types of neurons within morphological discrete subdivisions, reflecting functional differences.

  14. mRNA expression profile of prostaglandin D2 receptors in rat trigeminovascular system, and effect of prostaglandins in rat migraine models

    DEFF Research Database (Denmark)

    Sekeroglu, A.; Jansen-Olesen, I.; Gupta, S.

    2015-01-01

    not changed in the trigeminal nucleus caudalis. Conclusions: PGD2 induced vasodilation of MMA is mainly mediated by activation of DP1 receptors. Furthermore, high expression of DP1 mRNA in TG and DRG suggest that PGD2 might play a role in migraine pathophysiology. However, infusion of PG mix in awake rats did...

  15. Macroscopic Study of Celiac, Cranial Mesenteric and Caudal Mesenteric Arteries in the European Hare

    Directory of Open Access Journals (Sweden)

    Flešárová S.

    2018-03-01

    Full Text Available The aim of this paper was to describe the branching schema of the ventral branches of the abdominal aorta: the a. celiaca, the a. mesenterica cranialis and the a. mesenterica caudalis. The study was carried out on nine adult European hares using the corrosion cast technique. After the euthanasia, the vascular network was perfused with saline. Batson’s corrosion casting kit No. 17 was used as a casting medium. After polymerisation of the medium, the maceration was carried out in KOH solution. In all specimens, the first branch originating from the a. celiaca was the a. lienalis. The a. hepatica was present as the second branch in four cases and as the third branch also in four cases. The first branch of the a. mesenterica cranialis was the a. colica media in seven cases. The second branch was represented by the a. pancreaticoduodenalis caudalis also in seven cases. Two aa. jejunales originated as the third branch. In seven cases, the fourth branch formed the truncus jejunalis and the fifth branch the a. ileocecalis. The a. mesenterica caudalis had a uniform arrangement in all of the specimens. The results enabled us to conclude that there was higher variability of the branching pattern of the a. celiaca in comparison with the a. mesenterica cranialis and the a. mesenterica caudalis in the European hare.

  16. WSe2

    KAUST Repository

    Tran, Kha; Singh, Akshay; Seifert, Joe; Wang, Yiping; Hao, Kai; Huang, Jing-Kai; Li, Lain-Jong; Taniguchi, Takashi; Watanabe, Kenji; Li, Xiaoqin

    2017-01-01

    the inhomogeneously broadened exciton resonance. We find that disorder plays a critical role in the exciton VC, while affecting VP less. For different monolayer samples with disorder characterized by their Stokes shift (SS), VC decreases in samples with higher SS

  17. Efficacy of vitamin C and ethanolic extract of Sesamum indicum in promoting fertility in male Wistar rats

    Directory of Open Access Journals (Sweden)

    E A Ashamu

    2010-01-01

    Full Text Available Aims: This study investigates the efficacy of ethanolic extract of Sesamum indicum (EES, vitamin C (VC, and EES + VC in promoting fertility and finding a possible link between their profertility effects and their antioxidant activities. Materials and Methods: Forty adult male Wistar rats [Body weight (BW 186.56 ± 0.465 g] were randomly analyzed into four groups of ten rats each: Control, EES G (EES only, VC G (vitamin C only, and EES + VC G (EES in conjunction with vitamin C. Control was given 5 ml/kg BW/day of normal saline orally; EES G was administered 0.3 g/kg BW/day of EES; VC G was administered 15 mg/kg BW/ day of VC; while EES + VC G was administered both 0.3 g/kg BW/day of EES and 15 mg/kg BW/day of VC. All treatments were for 10 weeks. Statistical Analysis Used: Independent-sample T test was used to analyze the obtained results. Results: The results obtained showed that EES, VC, and more importantly EES + VC are capable of significantly increasing BW gain, seminal parameters, testosterone level, and body antioxidant activities. Conclusions: These findings lead to the conclusion that EES + VC as well as ESS and VC promote fertility due to both their testosterone-increasing effects and their antioxidant effects.

  18. oordrag van eiendomsreg in die vulgêre reg in die wes-romeinse ryk

    African Journals Online (AJOL)

    Mnr F Schutte

    klassieke. Romeinse reg (250vC-27vC), klassieke Romeins reg (27vC-250nC), na-klassieke Romeinse reg. (250nC-1100nC). Sien verder ook Van Zyl Romeinse Privaatreg. 3 Die vulgêre reg het die klassieke reg in die tydperk tussen 350 en ...

  19. Growth of Vanadium Carbide by Halide-Activated Pack Diffusion

    DEFF Research Database (Denmark)

    Fernandes, Frederico Augusto Pires; Christiansen, Thomas Lundin; Dahl, Kristian Vinter

    The present work investigates growth of vanadium carbide (VC) layers by the pack diffusion method on a Vanadis 6 tool steel. The VC layers were produced by pack diffusion at 1000°C for 1, 4 and 16 hours. The VC layers were characterized with optical and electron microscopy, Vickers hardness tests...... and X-ray diffraction. Homogeneous VC mono-phase layers with Vickers hardness of more than 2400 HV were obtained. Hardening and tempering of the vanadized Vanadis 6 steel did not affect the VC layers....

  20. Overexpression of blueberry FLOWERING LOCUS T is associated with changes in the expression of phytohormone-related genes in blueberry plants

    Science.gov (United States)

    Gao, Xuan; Walworth, Aaron E; Mackie, Charity; Song, Guo-qing

    2016-01-01

    Flowering locus T (FT) is a primary integrator in the regulation of plant flowering. Overexpressing a blueberry (Vaccinium corymbosum L.) FT gene (VcFT) (herein VcFT-OX) resulted in early flowering and dwarfing in ‘Aurora’ plants (herein ‘VcFT-Aurora’). In this study, we found that VcFT-OX reduced shoot regeneration from leaf explants. To investigate the potential roles of the phytohormone pathway genes associated with VcFT-OX, differentially expressed (DE) genes in leaf tissues of ‘VcFT-Aurora’ plants were annotated and analyzed using non-transgenic ‘Aurora’ plants as a control. Three DE floral genes, including the blueberry SUPPRESSOR of Overexpression of constans 1 (VcSOC1) (gibberellin related), Abscisic acid responsive elements-binding factor 2 (VcABF2) and protein related to ABI3/VP1 (VcABI3/VP1) (ethylene-related), are present under both the phytohormone-responsive and the dwarfing-related Gene Ontology terms. The gene networks of the DE genes overall showed the molecular basis of the multifunctional aspects of VcFT overexpression beyond flowering promotion and suggested that phytohormone changes could be signaling molecules with important roles in the phenotypic changes driven by VcFT-OX. PMID:27818778

  1. Overexpression of blueberry FLOWERING LOCUS T is associated with changes in the expression of phytohormone-related genes in blueberry plants.

    Science.gov (United States)

    Gao, Xuan; Walworth, Aaron E; Mackie, Charity; Song, Guo-Qing

    2016-01-01

    Flowering locus T ( FT ) is a primary integrator in the regulation of plant flowering. Overexpressing a blueberry ( Vaccinium corymbosum L.) FT gene ( VcFT ) (herein VcFT -OX) resulted in early flowering and dwarfing in 'Aurora' plants (herein 'VcFT-Aurora'). In this study, we found that VcFT -OX reduced shoot regeneration from leaf explants. To investigate the potential roles of the phytohormone pathway genes associated with VcFT -OX, differentially expressed ( DE ) genes in leaf tissues of 'VcFT-Aurora' plants were annotated and analyzed using non-transgenic 'Aurora' plants as a control. Three DE floral genes, including the blueberry SUPPRESSOR of Overexpression of constans 1 ( VcSOC1 ) (gibberellin related), Abscisic acid responsive elements-binding factor 2 ( VcABF2 ) and protein related to ABI3/VP1 ( VcABI3/VP1 ) (ethylene-related), are present under both the phytohormone-responsive and the dwarfing-related Gene Ontology terms. The gene networks of the DE genes overall showed the molecular basis of the multifunctional aspects of VcFT overexpression beyond flowering promotion and suggested that phytohormone changes could be signaling molecules with important roles in the phenotypic changes driven by VcFT -OX.

  2. The in vitro antitumor activity of vitamins C and K3 against ovarian carcinoma.

    Science.gov (United States)

    von Gruenigen, Vivian E; Jamison, James M; Gilloteaux, Jacques; Lorimer, Heather E; Summers, Marcia; Pollard, Robert R; Gwin, Carley A; Summers, Jack L

    2003-01-01

    The objective was to evaluate the cytotoxic effect and mechanism of action of vitamins C (VC) and K3 (VK3) on ovarian carcinoma. Cytotoxicity assays were performed on ovarian cancer cell lines with VC, VK3 or a VC/VK3 combination. FIC index was employed to evaluate synergism. Flow cytometry was accomplished at 90% cytotoxic doses. Light, transmission electron microscopy and DNA isolation were performed. Antitumor activity was exhibited by both VC, VK3 and VC/VK3. VC/VK3 demonstrated synergistic activity. VC/VK3 may induce a G1 block in the cell cycle. Combined vitamin treatment resulted in cells that maintain apparently intact nuclei while extruding pieces of organelle-free cytoplasm. Degradation of chromosomal DNA was observed. Cell death (autoschizis) displayed characteristics of both apoptosis and necrosis. The cytotoxic effects observed may enable vitamins C and K3 to play an adjuvant role in the treatment of ovarian cancer.

  3. SU-F-P-61: Does It Matter Not to Use Optimization Points at the Apex for Vaginal Cylinder HDR Brachytherapy Planning?

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Y [University Of Iowa, College of Medicine, Iowa City, IN (United States)

    2016-06-15

    Purpose: To test the impact of the use of apex optimization points for new vaginal cylinder (VC) applicators. Methods: New “ClickFit” single channel VC applicators (Varian) that have a different top thicknesses but the same diameters as the old VC applicators (2.3 cm diameter, 2.6 cm, 3.0 cm, and 3.5 cm) were compared using phantom studies. Old VC applicator plans without apex optimization points were also compared to the plans with the optimization points. The apex doses were monitored at 5 mm depth doses (8 points) where a prescription dose (Rx) of 6Gy was prescribed. VC surface doses (8 points) were also analyzed. Results: The new VC applicator plans without apex optimization points presented significantly lower 5mm depth doses than Rx (on average −31 ± 7%, p <0.00001) due to their thicker VC tops (3.4 ± 1.1 mm thicker with the range of 1.2 to 4.4 mm) than the old VC applicators. Old VC applicator plans also showed a statistically significant reduction (p <0.00001) due to Ir-192 source anisotropic effect at the apex region but the % reduction over Rx was only −7 ± 9%. However, by adding apex optimization points to the new VC applicator plans, the plans improved 5 mm depth doses (−7 ± 9% over Rx) that were not statistically different from old VC plans (p = 0.923), along with apex VC surface doses (−22 ± 10% over old VC versus −46 ± 7% without using apex optimization points). Conclusion: The use of apex optimization points are important in order to avoid significant additional cold doses (−24 ± 2%) at the prescription depth (5 mm) of apex, especially for the new VC applicators that have thicker tops.

  4. Radiolytic Preparation of Electrocatalysts with Pt-Co and Pt-Sn Nanoparticles for a Proton Exchange Membrane Fuel Cell

    Directory of Open Access Journals (Sweden)

    Sang Kyum Kim

    2014-01-01

    Full Text Available Nanosized Pt-Sn/VC and Pt-Co/VC electrocatalysts were prepared by a one-step radiation-induced reduction (30 kGy process using distilled water as the solvent and Vulcan XC72 as the supporting material. While the Pt-Co/VC electrodes were compared with Pt/VC (40 wt%, HiSpec 4000, in terms of their electrocatalytic activity towards the oxidation of H2, the Pt-Co/VC electrodes were evaluated in terms of their activity towards the hydrogen oxidation reaction (HOR and compared with Pt/VC (40 wt%, HiSpec 4000, Pt-Co/VC, and Pt-Sn/VC in a single cell. Additionally, the prepared electrocatalyst samples (Pt-Co/VC and Pt-Sn/VC were characterized by transmission electron microscopy (TEM, scanning electron microscope (SEM, thermogravimetric analysis (TGA, X-ray diffraction (XRD, X-ray photoelectron spectroscopy (XPS, electrochemical surface area (ECSA, and fuel cell polarization performance.

  5. The common iliac artery in the ground squirrel (Citellus citellus

    Directory of Open Access Journals (Sweden)

    Blagojević M.

    2013-01-01

    Full Text Available The common iliac arteries (a. iliaca communis dextra et a. iliaca communis sinistra are the terminal branches of the abdominal aorta. The paired external iliac artery (a. iliaca externa dextra et a. iliaca externa sinistra is a stronger branch of the paired common iliac artery. Before they leave the abdominal cavity and continue as the femoral arteries (a. femoralis dextra et a. femoralis sinistra each external iliac artery forms the following branches: 1. The internal pudendal artery (a. pudenda interna which, with its branches, supplies the tensor fasciae latae and quadriceps muscles (a. circumflexa femoris lateralis, cranial region of the urinary bladder, cranial end of the uterine horn in females, the deferent duct and tail of the epididymis in males (a. umbilicalis the rectum, the external anal sphincter and perineum (a. rectalis caudalis with blood. 2. The obturator artery (a. obturatoria, which supplies both of the obturator muscles, as well as the proximal end of the adductor muscle. 3. The pudendoepigastric trunk (truncus pudendoepigastricus is a short vessel, which with its branches (a. pudenda externa, a. epigastrica caudalis et a. urethrogenitalis supplies the caudal end of the rectus abdominis muscle, tip of the penis, preputium, superficial inguinal lymph nodes, scrotum in males and inguinal mamma in females, transversus and internus abdominis muscles, neck of the urinary bladder, urethra, vagina and vulva in females and accessory glands in males. 4. Paired internal iliac arteries (a. iliaca interna dextra et a. iliaca interna sinistra are thinner branches than the external iliac arteries. The internal iliac artery with its branches supplies the cranial and caudal parts of the gluteal muscles (a. glutea cranialis et a. glutea caudalis, as well as the muscles of the lateral side of the tail (a. caudalis lateralis. [Projekat Ministarstva nauke Republike Srbije, br. 143018

  6. Intercomparison of diffusion coefficient derived from the through-diffusion experiment using different numerical methods

    International Nuclear Information System (INIS)

    Chih-Lung Chen; Institute of Nuclear Energy Research, Taoyuan, Taiwan; Tsing-Hai Wang; Shi-Ping Teng; Ching-Hor Lee

    2014-01-01

    Diffusion is a dominant mechanism regulating the transport of released nuclides. The through-diffusion method is typically applied to determine the diffusion coefficients (D). Depending on the design of the experiment, the concentrations in the source term [i.e., inlet reservoir (IR)] or the end term [i.e., outlet reservoir (OR)] can be fixed or vary. The combinations involve four distinct models (i.e., the CC-CC model, CC-VC model, VC-CC model, and the VC-VC model). Studies discussing the VC-CC model are scant. An analytical method considering the decay effect is required to accurately interpret the radioactive nuclide diffusion experiment results. Therefore, we developed a CC-CC model and a CC-VC model with a decay effect and the simplified formulas of these two models to determine the diffusion coefficient (i.e., the CC-CC method and CC-VC method). We also proposed two simplified methods using the VC-VC model to determine the diffusion coefficient straightforwardly based upon the concentration variation in IR and OR. More importantly, the best advantage of proposed method over others is that one can derive three diffusion coefficients based on one run of experiment. In addition, applying our CC-VC method to those data reported from Radiochemica Acta 96:111-117, 2008; and J Contam Hydrol 35:55-65, 1998, derived comparable diffusion coefficient lying in the identical order of magnitude. Furthermore, we proposed a formula to determine the conceptual critical time (Tc), which is particularly beneficial for the selection of using CC-VC or VC-VC method. Based on our proposed method, it becomes possible to calculate diffusion coefficient from a through-diffusion experiment in a shorter period of time. (author)

  7. The effects of L-carnitin in Budd-Chiari syndrome in a domestic cat

    Directory of Open Access Journals (Sweden)

    Aliye Sağkan Öztürk

    2016-03-01

    Full Text Available This paper describes a thrombosis in the vena cava caudalis of a 15 year-old cat with ascites. Trauma and eventually feline enteric corona virus infection in the cat were not detected. In the intrahepatic region, a blockage of vena cava caudalis was brought to light by ultrasonographic imaging. An aspirate of abdominal fl uid revealed modified transudate. Liver enzyme levels were increased in the serum sample of the cat. The levels of total oxidant status (TOS and total antioxidant status (TAS were elevated in the peritoneal fluid. Liver protection diet with L-carnitine, diuretic therapy and antimicrobial drugs were administrated for treatment of the cat. During the continuous treatment, the amount of abdominal fluid decreased, but never completely absorbed. L-carnitine was administered to the cat during the time of treatment, and subsequently the levels of liver enzymes decreased. However, the cat died because of recurrent ascites and persistent thrombosis. In conclusion, ultrasonographic examination was very reliable, non-invasive and highly useful diagnostic method for BCS and L-carnitine has crucial effects on the quality of life, energy metabolism and liver enzyme levels. However, the blockage of the vena cava caudalis could not completely respond to medical treatment and thrombosis should be eliminated by surgical intervention.

  8. Peripheral axotomy of the rat mandibular trigeminal nerve leads to an increase in VIP and decrease of other primary afferent neuropeptides in the spinal trigeminal nucleus.

    Science.gov (United States)

    Atkinson, M E; Shehab, S A

    1986-12-01

    In the vasoactive intestinal polypeptide (VIP)-rich lumbosacral spinal cord, VIP increases at the expense of other neuropeptides after primary sensory nerve axotomy. This study was undertaken to ascertain whether similar changes occur in peripherally axotomised cranial sensory nerves. VIP immunoreactivity increased in the terminal region of the mandibular nerve in the trigeminal nucleus caudalis following unilateral section of the sensory root of the mandibular trigeminal nerve at the foramen orale. Other primary afferent neuropeptides (substance P, cholecystokinin and somatostatin) were depleted and fluoride-resistant acid phosphatase activity was abolished in the same circumscribed areas of the nucleus caudalis. The rise in VIP and depletion of other markers began 4 days postoperatively and was maximal by 10 days, these levels remaining unchanged up to 1 year postoperatively. VIP-immunoreactive cell bodies were absent from trigeminal ganglia from the unoperated side but small and medium cells stained intensely in the ganglia of the operated side after axotomy. These observations indicate that increase of VIP in sensory nerve terminals is a general phenomenon occurring in both cranial and spinal sensory terminal areas. The intense VIP immunoreactivity in axotomised trigeminal ganglia suggests that the increased levels of VIP in the nucleus caudalis are of peripheral origin, indicating a change in expression of neuropeptides within primary afferent neurons following peripheral axotomy.

  9. Identification and expression analysis of MATE genes involved in flavonoid transport in blueberry plants.

    Science.gov (United States)

    Chen, Li; Liu, Yushan; Liu, Hongdi; Kang, Limin; Geng, Jinman; Gai, Yuzhuo; Ding, Yunlong; Sun, Haiyue; Li, Yadong

    2015-01-01

    Multidrug and toxic compound extrusion (MATE) proteins are the most recently identified family of multidrug transporters. In plants, this family is remarkably large compared to the human and bacteria counterpart, highlighting the importance of MATE proteins in this kingdom. Here 33 Unigenes annotated as MATE transporters were found in the blueberry fruit transcriptome, of which eight full-length cDNA sequences were identified and cloned. These proteins are composed of 477-517 residues, with molecular masses ~54 kDa, and theoretical isoelectric points from 5.35 to 8.41. Bioinformatics analysis predicted 10-12 putative transmembrane segments for VcMATEs, and localization to the plasma membrane without an N-terminal signal peptide. All blueberry MATE proteins shared 32.1-84.4% identity, among which VcMATE2, VcMATE3, VcMATE5, VcMATE7, VcMATE8, and VcMATE9 were more similar to the MATE-type flavonoid transporters. Phylogenetic analysis showed VcMATE2, VcMATE3, VcMATE5, VcMATE7, VcMATE8 and VcMATE9 clustered with MATE-type flavonoid transporters, indicating that they might be involved in flavonoid transport. VcMATE1 and VcMATE4 may be involved in the transport of secondary metabolites, the detoxification of xenobiotics, or the export of toxic cations. Real-time quantitative PCR demonstrated that the expression profile of the eight VcMATE genes varied spatially and temporally. Analysis of expression and anthocyanin accumulation indicated that there were some correlation between the expression profile and the accumulation of anthocyanins. These results showed VcMATEs might be involved in diverse physiological functions, and anthocyanins across the membranes might be mutually maintained by MATE-type flavonoid transporters and other mechanisms. This study will enrich the MATE-based transport mechanisms of secondary metabolite, and provide a new biotechonology strategy to develop better nutritional blueberry cultivars.

  10. Using Virtual Technology to Promote Functional Communication in Aphasia: Preliminary Evidence From Interactive Dialogues With Human and Virtual Clinicians.

    Science.gov (United States)

    Kalinyak-Fliszar, Michelene; Martin, Nadine; Keshner, Emily; Rudnicky, Alex; Shi, Justin; Teodoro, Gregory

    2015-11-01

    We investigated the feasibility of using a virtual clinician (VC) to promote functional communication abilities of persons with aphasia (PWAs). We aimed to determine whether the quantity and quality of verbal output in dialogues with a VC would be the same or greater than those with a human clinician (HC). Four PWAs practiced dialogues for 2 sessions each with a HC and VC. Dialogues from before and after practice were transcribed and analyzed for content. We compared measures taken before and after practice in the VC and HC conditions. Results were mixed. Participants either produced more verbal output with the VC or showed no difference on this measure between the VC and HC conditions. Participants also showed some improvement in postpractice narratives. Results provide support for the feasibility and applicability of virtual technology to real-life communication contexts to improve functional communication in PWAs.

  11. Treatment of Severe Edema in Children with Nephrotic Syndrome with Diuretics Alone — A Prospective Study

    Science.gov (United States)

    Kapur, Gaurav; Valentini, Rudolph P.; Imam, Abubakr A.; Mattoo, Tej K.

    2009-01-01

    Background and objective: Severe edema in children with nephrotic syndrome (NS) may be associated with volume contraction (VC) or volume expansion (VE). Usually, severe edema in children is treated with intravenous (IV) albumin and diuretics, which is appropriate for VC patients. However, in VE patients, this can precipitate fluid overload. The objective of this study was to evaluate treatment of severe edema in NS with diuretics alone. Design, setting, participants, & measurements: Thirty NS patients with severe edema were enrolled in this prospective study in two phases. VC was diagnosed based on fractional excretion of sodium (FeNa) diuretics alone and 9 VC patients received albumin and furosemide. There was no difference in hospital stay and weight loss in VC and VE groups after treatment. Conclusions: FeNa is useful in distinguishing VC versus VE in NS children with severe edema. The use of diuretics alone in VE patients is safe and effective. PMID:19406963

  12. Cheating prevention in visual cryptography.

    Science.gov (United States)

    Hu, Chih-Ming; Tzeng, Wen-Guey

    2007-01-01

    Visual cryptography (VC) is a method of encrypting a secret image into shares such that stacking a sufficient number of shares reveals the secret image. Shares are usually presented in transparencies. Each participant holds a transparency. Most of the previous research work on VC focuses on improving two parameters: pixel expansion and contrast. In this paper, we studied the cheating problem in VC and extended VC. We considered the attacks of malicious adversaries who may deviate from the scheme in any way. We presented three cheating methods and applied them on attacking existent VC or extended VC schemes. We improved one cheat-preventing scheme. We proposed a generic method that converts a VCS to another VCS that has the property of cheating prevention. The overhead of the conversion is near optimal in both contrast degression and pixel expansion.

  13. Vital capacity helps predict pulmonary complications after rib fractures.

    Science.gov (United States)

    Carver, Thomas W; Milia, David J; Somberg, Chloe; Brasel, Karen; Paul, Jasmeet

    2015-09-01

    Traumatic rib fractures are associated with significant morbidity. Vital capacity (VC) assesses pulmonary function; however, limited data link VC to patient outcomes. Our objective was to determine if VC predicted complications and disposition in patients with rib fractures. This is a retrospective chart review of all patients with fractured ribs admitted to a Level 1 trauma center during a 4-year period. Patients were excluded if no VC was performed within 48 hours of admission. Data collected included demographics, hospital/intensive care unit length of stay, epidural, discharge to home versus extended care facility, mortality, chest Abbreviated Injury Scale (AIS) score, Injury Severity Score (ISS), number of rib fractures, hemothorax/pneumothorax, presence of pulmonary contusion, presence of chest tube, chronic obstructive pulmonary disease, and average daily VC (percentage of predicted). Pulmonary complication was defined as pneumonia, need for intubation, new home O2 requirement, readmission for pulmonary issue, or intensive care unit transfer. Statistical analysis was performed using χ and multivariate logistic regression. Of 801 patients with rib fractures, 683 had VC performed within 48 hours. Average age was 53 years, median ISS was 13 (interquartile range, 9-18), and median length of stay was 5 days. Most (72%) were discharged home, and 26% went to extended care facility. Ten percent developed a pulmonary complication, and there were nine deaths. Every 10% increase in VC was associated with 36% decrease in likelihood of pulmonary complication. Patients with a VC greater than 50% had a significantly lower association of pulmonary complication (p = 0.017), and a VC of less than 30% was independently associated with pulmonary complication (odds ratio, 2.36). Patients with fractured ribs and VC of less than 30% have significant association for pulmonary complication. Higher VC is associated with lower likelihood of pulmonary complication. VC may help

  14. Riskirahoituksen merkitys biotekniikka-alalla: Pääomasijoittajien vertailu yritysten näkökulmasta

    OpenAIRE

    Luukkonen, Terttu; Maunula, Mari

    2006-01-01

    The paper reports an empirical study on the overall importance and non-financial value-added provided by Venture Capital (VC) investors to their investee firms in biotechnology. The study compares the characteristics of firms that have obtained VC funding with those of firms that have not. Furthermore, it pays attention to the activities and non-financial value-added by different types of VC organization : informal investors (business angels), public sector VCs, and private sector VCs. The st...

  15. Prototype 350 MHz niobium spoke-loaded cavities

    International Nuclear Information System (INIS)

    Delayen, J. R.; Kedzie, M.; Mammosser, J.; Piller, C.; Shepard, K. W.

    1999-01-01

    This paper reports the development of 350 MHz superconducting cavities of a spoke-loaded geometry, intended for the velocity range 0.2 < v/c < 0.6. Two prototype single-cell cavities have been designed, one optimized for velocity v/c = 0.4, and the other for v/c = 0.29. Construction of the prototype niobium cavities is nearly complete. Details of the design and construction are discussed, along with the results of cold tests

  16. Prototype 350 MHz niobium spoke-loaded cavities.

    Energy Technology Data Exchange (ETDEWEB)

    Delayen, J. R.; Kedzie, M.; Mammosser, J.; Piller, C.; Shepard, K. W.

    1999-05-10

    This paper reports the development of 350 MHz superconducting cavities of a spoke-loaded geometry, intended for the velocity range 0.2 < v/c < 0.6. Two prototype single-cell cavities have been designed, one optimized for velocity v/c = 0.4, and the other for v/c = 0.29. Construction of the prototype niobium cavities is nearly complete. Details of the design and construction are discussed, along with the results of cold tests.

  17. Conversion de l’identité de la voix par modélisation et transformation de caractéristiques etendues de la voix

    OpenAIRE

    Huber , Stefan

    2015-01-01

    Voice Conversion (VC) aims at transforming the characteristics of a source speaker’s voice in such a way that itwill be perceived as being uttered by a target speaker. The principle of VC is to define mapping functions for theconversion from one source speaker’s voice to one target speaker’s voice. The transformation functions of commonSTAte-of-the-ART (START) VC system adapt instantaneously to the characteristics of the source voice.While recent VC systems have made considerable progress ove...

  18. Disorder-dependent valley properties in monolayer WSe2

    KAUST Repository

    Tran, Kha

    2017-07-19

    We investigate the effect of disorder on exciton valley polarization and valley coherence in monolayer WSe2. By analyzing the polarization properties of photoluminescence, the valley coherence (VC) and valley polarization (VP) are quantified across the inhomogeneously broadened exciton resonance. We find that disorder plays a critical role in the exciton VC, while affecting VP less. For different monolayer samples with disorder characterized by their Stokes shift (SS), VC decreases in samples with higher SS while VP does not follow a simple trend. These two methods consistently demonstrate that VC as defined by the degree of linearly polarized photoluminescence is more sensitive to disorder, motivating further theoretical studies.

  19. Solid waste management of temple floral offerings by vermicomposting using Eisenia fetida

    International Nuclear Information System (INIS)

    Singh, Akanksha; Jain, Akansha; Sarma, Birinchi K.; Abhilash, P.C.; Singh, Harikesh B.

    2013-01-01

    Highlights: ► Effective management of temple floral offerings using E. fetida. ► Physico-chemical properties in TW VC were better especially EC, C/N, C/P and TK. ► TW VC as plant growth promoter at much lower application rates than KW and FYW VC. - Abstract: Recycling of temple waste (TW) mainly comprising of floral offerings was done through vermitechnology using Eisenia fetida and its impact on seed germination and plant growth parameters was studied by comparing with kitchen waste (KW) and farmyard waste (FYW) vermicompost (VC). The worm biomass was found to be maximum in TW VC compared to KW and FYW VCs at both 40 and 120 days old VCs. Physico-chemical analysis of worm-worked substrates showed better results in TW VC especially in terms of electrical conductivity, C/N, C/P and TK. 10% TW VC–water extract (VCE) showed stimulatory effect on germination percentage of chickpea seeds while KW and FYW VCE proved effective at higher concentration. Variation in growth parameters was also observed with change in the VC–soil ratio and TW VC showed enhanced shoot length, root length, number of secondary roots and total biomass at 12.5% VC compared to KW and FYW VC

  20. Solid waste management of temple floral offerings by vermicomposting using Eisenia fetida

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Akanksha, E-mail: bhuaks29@gmail.com [Department of Botany, Banaras Hindu University, Varanasi 221 005 (India); Jain, Akansha, E-mail: akansha007@rediffmail.com [Department of Botany, Banaras Hindu University, Varanasi 221 005 (India); Sarma, Birinchi K., E-mail: birinchi_ks@yahoo.com [Department of Mycology and Plant Pathology, Institute of Agricultural Sciences, Banaras Hindu University, Varanasi 221 005 (India); Abhilash, P.C., E-mail: pca.iesd@bhu.ac.in [Institute for Environment and Sustainable Development, Banaras Hindu University, Varanasi 221 005 (India); Singh, Harikesh B., E-mail: hbs1@rediffmail.com [Department of Mycology and Plant Pathology, Institute of Agricultural Sciences, Banaras Hindu University, Varanasi 221 005 (India)

    2013-05-15

    Highlights: ► Effective management of temple floral offerings using E. fetida. ► Physico-chemical properties in TW VC were better especially EC, C/N, C/P and TK. ► TW VC as plant growth promoter at much lower application rates than KW and FYW VC. - Abstract: Recycling of temple waste (TW) mainly comprising of floral offerings was done through vermitechnology using Eisenia fetida and its impact on seed germination and plant growth parameters was studied by comparing with kitchen waste (KW) and farmyard waste (FYW) vermicompost (VC). The worm biomass was found to be maximum in TW VC compared to KW and FYW VCs at both 40 and 120 days old VCs. Physico-chemical analysis of worm-worked substrates showed better results in TW VC especially in terms of electrical conductivity, C/N, C/P and TK. 10% TW VC–water extract (VCE) showed stimulatory effect on germination percentage of chickpea seeds while KW and FYW VCE proved effective at higher concentration. Variation in growth parameters was also observed with change in the VC–soil ratio and TW VC showed enhanced shoot length, root length, number of secondary roots and total biomass at 12.5% VC compared to KW and FYW VC.

  1. Raising venture capital in the biopharma industry.

    Science.gov (United States)

    Leytes, Lev J

    2002-11-15

    Raising venture capital (VC) is both an art and a science. Future entrepreneurs should carefully consider the various issues of VC financing that have a strong impact on the success of their business. In addition to attracting the best venture capital firms, these issues include such subtle but important points as the timing of financing (especially of the first round), external support sources, desirable qualities of a VC firm, amount to be raised, establishing a productive interface between the founders and the venture capitalists, and most importantly the effects of well-executed VC funding on hiring senior executives and scientific leaders.

  2. Factors Affecting Re-usage Intentions of Virtual Communities Supporting Cosmetic Products

    Directory of Open Access Journals (Sweden)

    Jhong-Min Yang

    2017-01-01

    Full Text Available Aim/Purpose: This study uses a cosmetic virtual community (VC as the research context and the UTAUT model as the theoretical structure aim to explore factors affecting the re-usage intentions of VC members. Background: The Internet use rate of VC was up to 50%, thereby implying that VC gained the attention of Internet users. Therefore, operating a VC will be an effective way to communicate with customers. However, to maintain an existing member is more efficient than creating a new one. As such, understanding determinants of VC members’ re-use intentions becomes important for firms. Methodology: Through an online survey, 276 valid responses were gathered. The collected data were examined by performing confirmatory factor analysis, structural equation modelling procedures, as well as the moderator analysis. Contribution: This study shows the importance in the context of online cosmetics-related VC, which was rarely explored before. We provide issues for future research, despite the accumulated academic literature related to UTAUT and VC. Findings: Results show that only performance expectancy and social influence significantly affecting re-usage intentions and only gender has moderating effects on the path from performance expectancy to VC re-use intention and from trust to VC re-use intention. Recommendations for Practitioners\t: This study found that users emphasized performance expectancy most of all. A cosmetic product-related VC should introduce products abundantly, offer useful information, and help people accomplish tasks quickly and productively. Recommendation for Researchers: Future researchers may use our findings to conduct further positivist research in the area of social influence using different subjects and research contexts.

  3. Does vitamin C have the ability to augment the therapeutic effect of bone marrow-derived mesenchymal stem cells on spinal cord injury?

    Directory of Open Access Journals (Sweden)

    Nesrine Salem

    2017-01-01

    Full Text Available Methylprednisolone (MP is currently the only drug confirmed to exhibit a neuroprotective effect on acute spinal cord injury (SCI. Vitamin C (VC is a natural water-soluble antioxidant that exerts neuroprotective effects through eliminating free radical damage to nerve cells. Bone marrow mesenchymal stem cells (BMMSCs, as multipotent stem cells, are promising candidates in SCI repair. To evaluate the therapeutic effects of MP, VC and BMMSCs on traumatic SCI, 80 adult male rats were randomly divided into seven groups: control, SCI (SCI induction by weight-drop method, MP (SCI induction, followed by administration of 30 mg/kg MP via the tail vein, once every other 6 hours, for five times, VC (SCI induction, followed by intraperitoneal administration of 100 mg/kg VC once a day, for 28 days, MP + VC (SCI induction, followed by administration of MP and VC as the former, BMMSCs (SCI induction, followed by injection of 3 × 106 BMMSCs at the injury site, and BMMSCs + VC (SCI induction, followed by BMMSCs injection and VC administration as the former. Locomotor recovery was assessed using the Basso Mouse Scale. Injured spinal cord tissue was evaluated using hematoxylin-eosin staining and immunohistochemical staining. Expression of transforming growth factor-beta, tumor necrosis factor-alpha, and matrix metalloproteinase-2 genes was determined using real-time quantitative PCR. BMMSCs intervention better promoted recovery of nerve function of rats with SCI, mitigated nerve cell damage, and decreased expression of transforming growth factor-beta, tumor necrosis factor-alpha, and matrix metalloproteinase-2 genes than MP and/or VC. More importantly, BMMSCs in combination with VC induced more obvious improvements. These results suggest that VC can enhance the neuroprotective effects of BMMSCs against SCI.

  4. Response characteristics of pruriceptive and nociceptive trigeminoparabrachial tract neurons in the rat

    NARCIS (Netherlands)

    N.A. Jansen (Nico A.); G.J. Giesler (Glenn J.)

    2015-01-01

    textabstractWe tested the possibility that the trigeminoparabrachial tract (VcPbT), a projection thought to be importantly involved in nociception, might also contribute to sensation of itch. In anesthetized rats, 47 antidromically identified VcPbT neurons with receptive fields involving the cheek

  5. Influence of supplementing vitamin C to yearling steers fed a high sulfur diet during the finishing period on meat color, tenderness and protein degradation, and fatty acid profile of the longissimus muscle.

    Science.gov (United States)

    Pogge, Danielle J; Lonergan, Steven M; Hansen, Stephanie L

    2014-08-01

    The objective was to determine the influence of vitamin C (VC) supplemented for approximately 102 d during the finishing period on color, tenderness, and fatty acid profile of longissimus thoracis (LT; n=136) from steers fed a 0.55% sulfur diet. Treatments included 4 supplemental VC concentrations: 1) 0 (CON), 2) 5 (5VC), 3) 10 (10VC), or 4) 20 (20VC) gVC·h(-1)∙d(-1) in a common diet. Increasing supplemental VC decreased (Pvitamin E and tended to increase (P≤0.07) calcium and iron content of steaks. No VC (P≥0.25) effect was noted for WBSF, calpain-1 autolysis, troponin T degradation, or most fatty acid profiles. A quadratic effect (P≤0.03) was observed for cholesterol and CLA content of LT. Under the conditions of our study, supplementing VC to steers fed a 0.55% sulfur diet late in the finishing period did not influence color or tenderness, but increased the vitamin E content. Copyright © 2014 Elsevier Ltd. All rights reserved.

  6. Patients' Experiences with Specialist Care via Video Consultation in Primary Healthcare in Rural Areas

    Science.gov (United States)

    Johansson, Annette M.; Lindberg, Inger; Söderberg, Siv

    2014-01-01

    Introduction. Video consultation (VC) can improve access to specialist care, especially for individuals who live in rural areas that are long distances from specialist clinics. Aim. The aim of this study was to describe patients' experiences with specialist care via VC encounters. Method. Interviews were conducted with 26 patients who had participated in a VC encounter. The data were analysed using thematic content analysis. Result. The analysis resulted in two themes. The theme “confident with the technology” was constructed from the categories “possibilities and obstacles in using VC encounters” and “advantages and disadvantages of the technology.” The theme “personal satisfaction with the VC encounters” was constructed from the categories “support from the healthcare personnel,” “perceived security,” and “satisfaction with the specialist consultation.” Conclusion. The patients who did not think that the VC was the best care still considered that the visit was adequate because they did not have to travel. An important finding was that the patients' perceived even short distances to specialty care as expensive journeys because many patients had low incomes. Among the patients who had more than one VC, the second encounter was perceived as safer. Additionally, good communication was essential for the patient's perception of security during the VC encounter. PMID:25243009

  7. Microstructure, chemical states, and mechanical properties of V–C–Co coatings prepared by non-reactive magnetron sputtering

    International Nuclear Information System (INIS)

    Zhang, Xiaojuan; Wang, Bo; Zhan, Zhaolin; Huang, Feng

    2013-01-01

    V–C–Co coatings have been prepared by non-reactive magnetron co-sputtering from VC and Co targets. The microstructure, chemical states, and mechanical properties are examined as a function of Co content in the coatings. The coatings are dense, with columnar growth structures. High resolution transmission electron microscopy (HRTEM) studies identify a nanocomposite microstructure for the 12.4 at.% Co coating, in which ligament-like Co-rich regions partially separate the nanocrystalline VC grains. X-ray photoelectron spectroscopy studies reveal a noticeable charge transfer from Co 2p states to C 1s states. This charge transfer, in addition to the ligament-like Co-rich regions as revealed by HRTEM, points to the formation of a strong Co/VC interface. The nanoindentation hardness of the coatings drops steadily with the Co content, from 29 GPa for pure VC to ∼ 21 GPa for the 12.4 at.% Co coating. Meanwhile, the plasticity characteristic increased from 0.42 to 0.53. - Highlights: • Nanocomposite V–C–Co coatings with strong Co/VC interfaces were formed. • Found nanocrystalline VC grains separated by ∼ 1 nm thin Co-rich ligaments. • A noticeable amount of C-Co bonds between VC and Co is identified. • V–C–Co coatings exhibited a higher plasticity characteristic than VC

  8. Microstructure, chemical states, and mechanical properties of V–C–Co coatings prepared by non-reactive magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Xiaojuan [Ningbo Institute of Materials Technology and Engineering, Chinese Academy of Sciences, Ningbo, Zhejiang 315201 (China); School of Materials Science and Engineering, Kunming University of Science and Technology, Kunming, Yunnan 650000 (China); Wang, Bo [Ningbo Institute of Materials Technology and Engineering, Chinese Academy of Sciences, Ningbo, Zhejiang 315201 (China); Zhan, Zhaolin [School of Materials Science and Engineering, Kunming University of Science and Technology, Kunming, Yunnan 650000 (China); Huang, Feng, E-mail: huangfeng@nimte.ac.cn [Ningbo Institute of Materials Technology and Engineering, Chinese Academy of Sciences, Ningbo, Zhejiang 315201 (China)

    2013-07-01

    V–C–Co coatings have been prepared by non-reactive magnetron co-sputtering from VC and Co targets. The microstructure, chemical states, and mechanical properties are examined as a function of Co content in the coatings. The coatings are dense, with columnar growth structures. High resolution transmission electron microscopy (HRTEM) studies identify a nanocomposite microstructure for the 12.4 at.% Co coating, in which ligament-like Co-rich regions partially separate the nanocrystalline VC grains. X-ray photoelectron spectroscopy studies reveal a noticeable charge transfer from Co 2p states to C 1s states. This charge transfer, in addition to the ligament-like Co-rich regions as revealed by HRTEM, points to the formation of a strong Co/VC interface. The nanoindentation hardness of the coatings drops steadily with the Co content, from 29 GPa for pure VC to ∼ 21 GPa for the 12.4 at.% Co coating. Meanwhile, the plasticity characteristic increased from 0.42 to 0.53. - Highlights: • Nanocomposite V–C–Co coatings with strong Co/VC interfaces were formed. • Found nanocrystalline VC grains separated by ∼ 1 nm thin Co-rich ligaments. • A noticeable amount of C-Co bonds between VC and Co is identified. • V–C–Co coatings exhibited a higher plasticity characteristic than VC.

  9. Optimal quantum sample complexity of learning algorithms

    NARCIS (Netherlands)

    Arunachalam, S.; de Wolf, R.

    2017-01-01

    In learning theory, the VC dimension of a concept class C is the most common way to measure its "richness." A fundamental result says that the number of examples needed to learn an unknown target concept c 2 C under an unknown distribution D, is tightly determined by the VC dimension d of the

  10. Statistical mechanics of the vertex-cover problem

    Science.gov (United States)

    Hartmann, Alexander K.; Weigt, Martin

    2003-10-01

    We review recent progress in the study of the vertex-cover problem (VC). The VC belongs to the class of NP-complete graph theoretical problems, which plays a central role in theoretical computer science. On ensembles of random graphs, VC exhibits a coverable-uncoverable phase transition. Very close to this transition, depending on the solution algorithm, easy-hard transitions in the typical running time of the algorithms occur. We explain a statistical mechanics approach, which works by mapping the VC to a hard-core lattice gas, and then applying techniques such as the replica trick or the cavity approach. Using these methods, the phase diagram of the VC could be obtained exactly for connectivities c e, the solution of the VC exhibits full replica symmetry breaking. The statistical mechanics approach can also be used to study analytically the typical running time of simple complete and incomplete algorithms for the VC. Finally, we describe recent results for the VC when studied on other ensembles of finite- and infinite-dimensional graphs.

  11. Statistical mechanics of the vertex-cover problem

    International Nuclear Information System (INIS)

    Hartmann, Alexander K; Weigt, Martin

    2003-01-01

    We review recent progress in the study of the vertex-cover problem (VC). The VC belongs to the class of NP-complete graph theoretical problems, which plays a central role in theoretical computer science. On ensembles of random graphs, VC exhibits a coverable-uncoverable phase transition. Very close to this transition, depending on the solution algorithm, easy-hard transitions in the typical running time of the algorithms occur. We explain a statistical mechanics approach, which works by mapping the VC to a hard-core lattice gas, and then applying techniques such as the replica trick or the cavity approach. Using these methods, the phase diagram of the VC could be obtained exactly for connectivities c e, the solution of the VC exhibits full replica symmetry breaking. The statistical mechanics approach can also be used to study analytically the typical running time of simple complete and incomplete algorithms for the VC. Finally, we describe recent results for the VC when studied on other ensembles of finite- and infinite-dimensional graphs

  12. Toward a high-throughput method for determining vicine and convicine levels in faba bean seeds using flow injection analysis combined with tandem mass spectrometry.

    Science.gov (United States)

    Purves, Randy W; Khazaei, Hamid; Vandenberg, Albert

    2018-08-01

    Although faba bean provides environmental and health benefits, vicine and convicine (v-c) limit its use as a source of vegetable protein. Crop improvement efforts to minimize v-c concentration require low-cost, rapid screening methods to distinguish between high and low v-c genotypes to accelerate development of new cultivars and to detect out-crossing events. To assist crop breeders, we developed a unique and rapid screening method that uses a 60 s instrumental analysis step to accurately distinguish between high and low v-c genotypes. The method involves flow injection analysis (FIA) coupled with tandem mass spectrometry (i.e., selective reaction monitoring, SRM). Using seeds with known v-c levels as calibrants, measured v-c levels were comparable with liquid chromatography (LC)-SRM results and the method was used to screen 370 faba bean genotypes. Widespread use of FIA-SRM will accelerate breeding of low v-c faba bean, thereby alleviating concerns about anti-nutritional effects of v-c in this crop. Copyright © 2018 Elsevier Ltd. All rights reserved.

  13. Patients' Experiences with Specialist Care via Video Consultation in Primary Healthcare in Rural Areas.

    Science.gov (United States)

    Johansson, Annette M; Lindberg, Inger; Söderberg, Siv

    2014-01-01

    Introduction. Video consultation (VC) can improve access to specialist care, especially for individuals who live in rural areas that are long distances from specialist clinics. Aim. The aim of this study was to describe patients' experiences with specialist care via VC encounters. Method. Interviews were conducted with 26 patients who had participated in a VC encounter. The data were analysed using thematic content analysis. Result. The analysis resulted in two themes. The theme "confident with the technology" was constructed from the categories "possibilities and obstacles in using VC encounters" and "advantages and disadvantages of the technology." The theme "personal satisfaction with the VC encounters" was constructed from the categories "support from the healthcare personnel," "perceived security," and "satisfaction with the specialist consultation." Conclusion. The patients who did not think that the VC was the best care still considered that the visit was adequate because they did not have to travel. An important finding was that the patients' perceived even short distances to specialty care as expensive journeys because many patients had low incomes. Among the patients who had more than one VC, the second encounter was perceived as safer. Additionally, good communication was essential for the patient's perception of security during the VC encounter.

  14. Activity of the nematophagous fungi Pochonia chlamydosporia, Duddingtonia flagrans and Monacrosporium thaumasium on egg capsules of Dipylidium caninum.

    Science.gov (United States)

    Araujo, Juliana Milani; de Araújo, Jackson Victor; Braga, Fabio Ribeiro; Carvalho, Rogério Oliva; Ferreira, Sebastião Rodrigo

    2009-12-03

    Nematophagous fungi are potential biological control agents of helminths. The in vitro ovicidal effect of four isolates of the nematophagous fungi Pochonia chlamydosporia (VC1 and VC4), Duddingtonia flagrans (AC001) and Monacrosporium thaumasium (NF34) was evaluated on egg capsules of Dipylidium caninum, a cestode parasite of dogs, cats and humans. One thousand egg capsules of D. caninum were plated on 2% water-agar with the grown isolates and control without fungus. The ovicidal activity of these fungi was evaluated 5, 10 and 15 days after incubation. Only P. chlamydosporia showed ovicidal activity (pcaninum egg capsules, of 19.6% (VC1) and 20% (VC4) on the 5th day; 44.2% (VC1) and 31.5% (VC4) on the 10th day; and 49.2% (VC1) and 41.9% (VC4) on the 15th day. D. flagrans and M. thaumasium caused no morphological damage to egg capsules. The results demonstrated that P. chlamydosporia was in vitro effective against capsules and eggs of D. caninum, and can be considered as a potential biological control agent for this helminth.

  15. A comparison between four immobilization systems for pelvic radiation therapy using CBCT and paired kilovoltage portals based image-guided radiotherapy

    Directory of Open Access Journals (Sweden)

    Gagan Saini

    2014-01-01

    Conclusions: SM was low for all the four immobilization systems studied. There is no added benefit of using a VC with 6-clamped TM for pelvic RT. Use of a VC is recommended with 4-clamped TM to improve overall reproducibility. 6-clamped TM helps keep the errors low.

  16. Phytoscreening for vinyl chloride in groundwater discharging to a stream

    DEFF Research Database (Denmark)

    Ottosen, Cecilie Bang; Rønde, Vinni Kampman; Trapp, Stefan

    2018-01-01

    and hence different uptake/loss scenarios. Vinyl chloride (VC) as well as cis-dichloroethylene (cis-DCE), trichloroethylene (TCE), and tetrachloroethylene (PCE) were detected in the trees, documenting that phytoscreening is a viable method to locate chlorinated ethene plumes, including VC, discharging...

  17. Ghrelin improves vascular autophagy in rats with vascular calcification.

    Science.gov (United States)

    Xu, Mingming; Liu, Lin; Song, Chenfang; Chen, Wei; Gui, Shuyan

    2017-06-15

    This study aimed to investigate whether ghrelin ameliorated vascular calcification (VC) through improving autophagy. VC model was induced by nicotine plus vitamin D 3 in rats and β-glycerophosphate in vascular smooth muscle cell (VSMC). Calcium deposition was detected by von Kossa staining or alizarin red S staining. ALP activity was also detected. Western blot was used to assess the protein expression. Ghrelin treatment attenuated the elevation of calcium deposition and ALP activity in VC model both in vivo and in vitro. Interesting, the protein levels of autophagy markers, LC3 and beclin1 were significantly upregulated by ghrelin in VC model. An autophagy inhibitor, 3-methyladenine blocks the ameliorative effect of ghrelin on VC. Furthermore, protein expressions of phosphate-AMPK were increased by ghrelin treatment both in calcified aorta and VSMC. The effect of ghrelin on autophagy induction and VC attenuation was prevented by AMPK inhibitor, compound C. Our results suggested that ghrelin improved autophagy through AMPK activation, which was resulted in VC amelioration. These data maybe throw light on prevention and therapy of VC. Copyright © 2016 Elsevier Inc. All rights reserved.

  18. Mimicking vernix caseosa-Preparation and characterization of synthetic biofilms

    NARCIS (Netherlands)

    Rissmann, R.; Oudshoorn, M.H.M.; Zwier, R.; Ponec, M.; Bouwstra, J.A.; Hennink, W.E.

    2009-01-01

    The multiple protecting and barrier-supporting properties of the creamy, white biofilm vernix caseosa (VC) before and after birth suggest that a VC biomimetic could be an innovative barrier cream for barrier-deficient skin. The aim of this study was the rational design and preparation of synthetic

  19. Verrucous Carcinoma of the Foot - Report of Two Cases

    Directory of Open Access Journals (Sweden)

    Lalošević Jovan

    2016-09-01

    Full Text Available Verrucous carcinoma (VC is a rare variant of a well-differentiated squamous cell carcinoma (SCC with a low grade of malignancy. Epithelioma cuniculatum (EC is a subtype of VC, usually found on the sole of the foot.

  20. Patients’ Experiences with Specialist Care via Video Consultation in Primary Healthcare in Rural Areas

    Directory of Open Access Journals (Sweden)

    Annette M. Johansson

    2014-01-01

    Full Text Available Introduction. Video consultation (VC can improve access to specialist care, especially for individuals who live in rural areas that are long distances from specialist clinics. Aim. The aim of this study was to describe patients’ experiences with specialist care via VC encounters. Method. Interviews were conducted with 26 patients who had participated in a VC encounter. The data were analysed using thematic content analysis. Result. The analysis resulted in two themes. The theme “confident with the technology” was constructed from the categories “possibilities and obstacles in using VC encounters” and “advantages and disadvantages of the technology.” The theme “personal satisfaction with the VC encounters” was constructed from the categories “support from the healthcare personnel,” “perceived security,” and “satisfaction with the specialist consultation.” Conclusion. The patients who did not think that the VC was the best care still considered that the visit was adequate because they did not have to travel. An important finding was that the patients’ perceived even short distances to specialty care as expensive journeys because many patients had low incomes. Among the patients who had more than one VC, the second encounter was perceived as safer. Additionally, good communication was essential for the patient’s perception of security during the VC encounter.

  1. Mechanisms, Chemistry, and Kinetics of Anaerobic Biodegradation of cis-Dichloroethene and Vinyl Chloride

    Energy Technology Data Exchange (ETDEWEB)

    McCarty, P.L.; Spormann, A.M.

    2000-12-01

    Anaerobic biological processes can result in PCE and TCE destruction through conversion to cis-dichloroethene (cDCE) then to vinyl chloride (VC), and finally to ethene. Here, the chlorinated aliphatic hydrocarbons (CAHs) serve as electron acceptors in energy metabolism, requiring electron donors such as hydrogen from an external source. The purpose of this study was to learn more about the biochemistry of cDCE and VC conversion to ethene, to better understand the requirements for electron donors, and to determine factors affecting the rates of CAH degradation and organism growth. The biochemistry of reductive dehalogenation of VC was studied with an anaerobic mixed culture enriched on VC. In other studies on electron donor needs for dehalogenation of cDCE and VC, competition for hydrogen was found to occur between the dehalogenators and other microorganisms such as methanogens and homoacetogens in a benzoate-acclimated dehalogenating methanogenic mixed culture. Factors affecting the relative rates of destruction of the solvents and their intermediate products were evaluated. Studies using a mixed PCE-dehalogenating culture as well as the VC enrichment for biochemical studies suggested that the same species was involved in both cDCE and VC dechlorination, and that cDCE and VC competitively inhibited each other's dechlorination rate.

  2. Angiosarcoma of the liver and other occupational diseases in vinyl chloride workers

    International Nuclear Information System (INIS)

    Halama, J.; Becker-Stone, S.; Halama, J.M.

    1985-01-01

    Occupational diseases resulting from exposure to vinyl chloride (VC) include angiosarcoma of the liver and other neoplasms. Among workers exposed to VC we have found capillary abnormalities in the extremities, with scleroderma and Raynaud syndrome, acro-osteolysis, neurological and psychiatric diseases and chromosome abnormalities, as well as abnormal liver metabolism and haematological findings.(orig.)

  3. A Critical Review of Videoconferencing Software to Support School Consultation

    Science.gov (United States)

    Fischer, Aaron J.; Schultz, Brandon K.; Collier-Meek, Melissa A.; Zoder-Martell, Kimberly A.; Erchul, William P.

    2018-01-01

    With recent advances in technology, several viable options now exist for school consultants to communicate with teachers via synchronous online videoconferencing (VC) without the need for specialized equipment. Unfortunately, few studies have evaluated the effectiveness of school consultation through VC, so practitioners are provided little…

  4. Development of a vernix caseosa substitute : a novel strategy to improve skin barrier function and repair

    NARCIS (Netherlands)

    Rißmann, Robert

    2009-01-01

    Vernix caseosa (VC) is the cheesy, white cream that covers the skin of the human fetus and the newborn. VC is a protective cream, which consists of water containing dead cells that are embedded in lipids. This natural cream is suggested to feature multiple biological functions such as facilitating

  5. Efficiency of voluntary closing hand and hook prostheses

    NARCIS (Netherlands)

    Smit, G.; Plettenburg, D.H.

    2010-01-01

    The Delft Institute of Prosthetics and Orthotics has started a research program to develop an improved voluntary closing, body-powered hand prosthesis. Five commercially available voluntary closing terminal devices were mechanically tested: three hands [Hosmer APRL VC hand, Hosmer Soft VC Male hand,

  6. Comparative Genomics of Vibrio cholerae O1 Isolated from Cholera Patients in Bangladesh

    DEFF Research Database (Denmark)

    Hossain, Zenat Zebin; Leekitcharoenphon, Pimlapas; Dalsgaard, Anders

    patients was co-infected with two V. cholerae strains (VC-1 and VC-3). Major virulence factors, biotype and antimicrobial resistance genes were identified by WGS. A global phylogenetic tree was inferred using genome wide SNPs (Single Nucleotide Polymorphism) analysis. RESULTS: All the V. cholerae strains...

  7. An analysis of decrements in vital capacity as an index of pulmonary oxygen toxicity.

    Science.gov (United States)

    Harabin, A L; Homer, L D; Weathersby, P K; Flynn, E T

    1987-09-01

    Decrements in vital capacity (% delta VC) were proposed by the Pennsylvania group in the early 1970s as an index of O2-induced lung damage. These workers used the combined effects of PO2 and time of exposure to develop recommendations to limit expected % delta VC. Adopting this general approach, we fitted human pulmonary O2 toxicity data to the hyperbolic equation % delta VC = Bs.(PO2 - B1).(time)B3 using a nonlinear least squares analysis. In addition to the data considered in 1970, our analysis included new data available from the literature. The best fit was obtained when 1) an individual slope parameter, Bs, was estimated for each subject instead of an average slope; 2) PO2 asymptote B1 = 0.38 ATA; and 3) exponent B3 = 1.0. Wide individual variation imposed large uncertainty on any % delta VC prediction. A 12-h exposure to a PO2 of 1 ATA would be expected to yield a median VC decrement of 4%. The 80% confidence limits, however, included changes from +1.0 and -12% delta VC. Until an improved index of pulmonary O2 toxicity is developed, a simplified expression % delta VC = -0.011.(PO2 - 0.5).time (PO2 in ATA and time in min) can be used to predict a median response with little loss in predictability. The limitations of changes in VC as an index are discussed.

  8. Large-angle production of charged pions by 3 GeV/c - 12 GeV/c protons on carbon, copper and tin targets

    CERN Document Server

    Catanesi, M.G.; Ellis, Malcolm; Robbins, S.; Soler, F.J.P.; Gossling, C.; Bunyatov, S.; Krasnoperov, A.; Popov, B.; Serdiouk, V.; Tereschenko, V.; Di Capua, E.; Vidal-Sitjes, G.; Artamonov, A.; Arce, P.; Giani, S.; Gilardoni, S.; Gorbunov, P.; Grant, A.; Grossheim, A.; Gruber, P.; Ivanchenko, V.; Kayis-Topaksu, A.; Panman, J.; Papadopoulos, I.; Pasternak, J.; Tcherniaev, E.; Tsukerman, I.; Veenhof, R.; Wiebusch, C.; Zucchelli, P.; Blondel, A.; Borghi, S.; Campanelli, M.; Morone, M.C.; Prior, G.; Schroeter, R.; Engel, R.; Meurer, C.; Kato, I.; Gastaldi, U.; Mills, G.B.; Graulich, J.S.; Gregoire, G.; Bonesini, M.; Ferri, F.; Paganoni, M.; Paleari, F.; Kirsanov, M.; Bagulya, A.; Grichine, V.; Polukhina, M.; Palladino, V.; Coney, L.; Schmitz, D.; Barr, G.; De Santo, A.; Pattison, C.; Zuber, K.; Bobisut, F.; Gibin, D.; Guglielmi, A.; Mezzetto, M.; Dumarchez, J.; Vannucci, F.; Dore, U.; Orestano, D.; Pastore, F.; Tonazzo, A.; Tortora, L.; Booth, C.; Buttar, C.; Hodgson, P.; howlett, L.; Bogomilov, M.; Chizhov, M.; Kolev, D.; Tsenov, R.; Piperov, Stefan; Temnikov, P.; Apollonio, M.; Chimenti, P.; Giannini, G.; Santin, G.; Burguet-Castell, J.; Cervera-Villanueva, A.; Gomez-Cadenas, J.J.; Martin-Albo, J.; Novella, P.; Sorel, M.; Tornero, A.

    2008-01-01

    A measurement of the double-differential $\\pi^{\\pm}$ production cross-section in proton--carbon, proton--copper and proton--tin collisions in the range of pion momentum $100 \\MeVc \\leq p < 800 \\MeVc$ and angle $0.35 \\rad \\le \\theta <2.15 \\rad$ is presented. The data were taken with the HARP detector in the T9 beam line of the CERN PS. The pions were produced by proton beams in a momentum range from 3 \\GeVc to 12 \\GeVc hitting a target with a thickness of 5% of a nuclear interaction length. The tracking and identification of the produced particles was done using a small-radius cylindrical time projection chamber (TPC) placed in a solenoidal magnet. An elaborate system of detectors in the beam line ensured the identification of the incident particles. Results are shown for the double-differential cross-sections at four incident proton beam momenta (3 \\GeVc, 5 \\GeVc, 8 \\GeVc and 12 \\GeVc).

  9. PERFORMANCE IN ART NATURE AND MEANING

    African Journals Online (AJOL)

    USER

    2012-04-25

    Apr 25, 2012 ... Baseline Assessment of Vulnerable Children and HIV. Burden Alleviation in ... from six political wards in the LGAs. There were 51% .... line with the National Guidelines and Standard of Practice on VC and VC. National Plan of ...

  10. Studies on reproductive abscission and seed yield of mungbean ...

    African Journals Online (AJOL)

    A field study was conducted on the Research and Experimental Farm of the University of Agriculture Makurdi (7o41'N, 08o37'N, and 400 m above mean sea level), Nigeria, in 2001 and 2002 to examine the abscission of reproductive structures in mungbean (Vigna radiata). Four exotic cultivars (VC 2768A, VC 1178A, VC ...

  11. Cardiovascular alcification in diabetic nephropathy patients in uremic stage and analysis on its risk factors

    International Nuclear Information System (INIS)

    Xue Yang; Lin Shan; Jia Junya; Yan Tiekun

    2010-01-01

    Objective: To investigate the prevalence of arterial vascular calcification (VC) in uremic patients undergoing diabetic nephropathy (DN) and explore its risk factors. Methods: Demographic and clinical data were collected in the patients latest diagnosed as uremia and not received dialysis treatment. The uremic patients were divided into DN group and non-diabetic nephropathy (NDN) group. And 20 healthy subjects were chosen as control group from the Physical Examination Room. The patients'sex and ages were similar in the 3 groups. VC was semi-quantitatively evaluated by plain radiographic films from abdomen, pelvis and hands. The clinical and laboratorial parameters related to VC were detected and analyzed. Results: 1)The present study included 20 (51.28%) DN uremic patients and 19 (48.72%) NDN uremic patients. The average diabetic duration in the DN patients was (8.11 ± 7.39) years. 2)Among the 39 uremic patients, VC was found on radiographic films in 29 cases (74.36%), including 23 cases (58.97%) with the con-score 1-3 and 6 cases (15.38%) with 3-6 scores. And VC was not detected in control group. Bone density analysis showed that osteopenia occupied 14 cases (35.90%) in all and the T-score was-0.81 ± 0.87. 3)Linear correlation analysis revealed that VC was correlated with serum calcium and phosphate (r=0.026, P 0.05). VC score was significantly correlated with the diabetic duration (r=0.790, P<0.001). Logistic regression revealed that the diabetes duration was the independent risk factors (P<0.05) for VC. The reflections of serum calcium and phosphate were rejected. 4)The prevalence of VC in DN group (95.0%) was higher than that in NDN group (42.1%, P<0.05). And the VC score in DN group(3.18 ± 1.77) was higher than that in NDN group (1.56 ± 0.97, P<0.05). Conclusion: There is a higher VC prevalence rate and more VC severity in DN uremic patients than in NDN patients. Diabetes duration is an independent risk factor for VC. Preventing from the high serum glucose

  12. Unconditioned stimulus pathways to the amygdala: effects of lesions of the posterior intralaminar thalamus on foot-shock-induced c-Fos expression in the subdivisions of the lateral amygdala.

    Science.gov (United States)

    Lanuza, E; Moncho-Bogani, J; Ledoux, J E

    2008-08-26

    The lateral nucleus of the amygdala (LA) is a site of convergence for auditory (conditioned stimulus) and foot-shock (unconditioned stimulus) inputs during fear conditioning. The auditory pathways to LA are well characterized, but less is known about the pathways through which foot shock is transmitted. Anatomical tracing and physiological recording studies suggest that the posterior intralaminar thalamic nucleus, which projects to LA, receives both auditory and somatosensory inputs. In the present study we examined the expression of the immediate-early gene c-fos in the LA in rats in response to foot-shock stimulation. We then determined the effects of posterior intralaminar thalamic lesions on foot-shock-induced c-Fos expression in the LA. Foot-shock stimulation led to an increase in the density of c-Fos-positive cells in all LA subnuclei in comparison to controls exposed to the conditioning box but not shocked. However, some differences among the dorsolateral, ventrolateral and ventromedial subnuclei were observed. The ventrolateral subnucleus showed a homogeneous activation throughout its antero-posterior extension. In contrast, only the rostral aspect of the ventromedial subnucleus and the central aspect of the dorsolateral subnucleus showed a significant increment in c-Fos expression. The density of c-Fos-labeled cells in all LA subnuclei was also increased in animals placed in the box in comparison to untreated animals. Unilateral electrolytic lesions of the posterior intralaminar thalamic nucleus and the medial division of the medial geniculate body reduced foot-shock-induced c-Fos activation in the LA ipsilateral to the lesion. The number of c-Fos labeled cells on the lesioned side was reduced to the levels observed in the animals exposed only to the box. These results indicate that the LA is involved in processing information about the foot-shock unconditioned stimulus and receives this kind of somatosensory information from the posterior intralaminar

  13. Maturation profile of inferior olivary neurons expressing ionotropic glutamate receptors in rats: role in coding linear accelerations.

    Science.gov (United States)

    Li, Chuan; Han, Lei; Ma, Chun-Wai; Lai, Suk-King; Lai, Chun-Hong; Shum, Daisy Kwok Yan; Chan, Ying-Shing

    2013-07-01

    Using sinusoidal oscillations of linear acceleration along both the horizontal and vertical planes to stimulate otolith organs in the inner ear, we charted the postnatal time at which responsive neurons in the rat inferior olive (IO) first showed Fos expression, an indicator of neuronal recruitment into the otolith circuit. Neurons in subnucleus dorsomedial cell column (DMCC) were activated by vertical stimulation as early as P9 and by horizontal (interaural) stimulation as early as P11. By P13, neurons in the β subnucleus of IO (IOβ) became responsive to horizontal stimulation along the interaural and antero-posterior directions. By P21, neurons in the rostral IOβ became also responsive to vertical stimulation, but those in the caudal IOβ remained responsive only to horizontal stimulation. Nearly all functionally activated neurons in DMCC and IOβ were immunopositive for the NR1 subunit of the NMDA receptor and the GluR2/3 subunit of the AMPA receptor. In situ hybridization studies further indicated abundant mRNA signals of the glutamate receptor subunits by the end of the second postnatal week. This is reinforced by whole-cell patch-clamp data in which glutamate receptor-mediated miniature excitatory postsynaptic currents of rostral IOβ neurons showed postnatal increase in amplitude, reaching the adult level by P14. Further, these neurons exhibited subthreshold oscillations in membrane potential as from P14. Taken together, our results support that ionotropic glutamate receptors in the IO enable postnatal coding of gravity-related information and that the rostral IOβ is the only IO subnucleus that encodes spatial orientations in 3-D.

  14. Avaliação de genótipos de feijoeiro comum do grupo comercial carioca cultivados nas épocas das águas e do inverno em Uberlândia, Estado de Minas Gerais = Evaluations of common bean genotypes of the carioca commercial group cultivated in the rainy and winter seasons in Uberlândia, Minas Gerais state

    Directory of Open Access Journals (Sweden)

    Maurício Martins

    2009-01-01

    Full Text Available O feijoeiro é uma das principais culturas do país, e o Estado de Minas Gerais é um dos maiores produtores, representando cerca de 15% da produção nacional. O objetivo deste trabalho foi testar o desempenho de linhagens de feijoeiro comum cultivadas nas épocas daságuas e do inverno, na região do Triângulo Mineiro, Minas Gerais. No cultivo das águas (semeadura em dezembro de 2005 e do inverno (semeadura em maio de 2006, as linhagens/cultivares testadas foram BRS Horizonte, CNFC 8059, CNFC 8065, CNFC 8075, VC-6, VC-7, VC-8, VC-9, VC-10, VC-11, VC-12, CNFC 10443, CNFC 10453, CNFC 10476,MA-I-2.5, MA-I-8.9, MA-I-18.13, RC-I-8, CV-46, CV-55 e Z-22, além das testemunhas BRSMG Majestoso, Pérola e BRSMG Talismã e VC-3. Em cada experimento, o delineamento experimental foi o de blocos casualizados com 25 tratamentos, em três repetições, a parcela útil foi de 4 m2. No cultivo das águas, os rendimentos das linhagens mais produtivas variaram entre 2,69 e 2,78 t ha-1 (VC-9 e VC-10, respectivamente e, no inverno, alcançaram 3 t ha-1 (3,01 e 3,00 t ha-1, CNFC 8065 e Z-22, respectivamente. De maneira geral, as linhagens foram maisprodutivas no cultivo do inverno, embora a interação entre linhagens e época de cultivo tenha indicado desempenho distinto entre elas em relação à época.The common bean is one of the most important crops in Brazil, and Minas Gerais state is one of its largest producers, representing about 15% of the national production. The aim of this studywas to evaluate the performance of common bean lineages cultivated during the rainy and winter seasons in the Triângulo Mineiro region, Minas Gerais state, Brazil. In the rainy growing season (sowing in December, 2005 and in the winter season (sowing in May, 2006, the tested lineages were BRS Horizonte, CNFC 8059, CNFC 8065, CNFC 8075, VC-6, VC-7, VC-8, VC-9, VC- 10, VC-11, VC-12, CNFC 10443, CNFC 10453, CNFC 10476, MA-I-2.5, MA-I-8.9, MA-I- 18.13, RC-I-8, CV-46, CV-55 and Z

  15. International Ventilation Cooling Application Database

    DEFF Research Database (Denmark)

    Holzer, Peter; Psomas, Theofanis Ch.; OSullivan, Paul

    2016-01-01

    The currently running International Energy Agency, Energy and Conservation in Buildings, Annex 62 Ventilative Cooling (VC) project, is coordinating research towards extended use of VC. Within this Annex 62 the joint research activity of International VC Application Database has been carried out...... and locations, using VC as a mean of indoor comfort improvement. The building-spreadsheet highlights distributions of technologies and strategies, such as the following. (Numbers in % refer to the sample of the database’s 91 buildings.) It may be concluded that Ventilative Cooling is applied in temporary......, systematically investigating the distribution of technologies and strategies within VC. The database is structured as both a ticking-list-like building-spreadsheet and a collection of building-datasheets. The content of both closely follows Annex 62 State-Of-The- Art-Report. The database has been filled, based...

  16. A comparison of reactive oxygen species metabolism in the rat aorta and vena cava: focus on xanthine oxidase.

    Science.gov (United States)

    Szasz, Theodora; Thompson, Janice M; Watts, Stephanie W

    2008-09-01

    Reactive oxygen species (ROS) are important mediators in vascular biology. Venous function, although relevant to cardiovascular disease, is still understudied. We compared aspects of ROS metabolism between a major artery (the aorta) and a major vein (the vena cava, VC) of the rat, with the hypothesis that venous ROS metabolism would be overall increased compared with its arterial counterpart. Superoxide and hydrogen peroxide (H2O2) release in basal conditions was higher in VC compared with aorta. The antioxidant capacity for H2O2 was also higher in VC than in aorta. Exogenous superoxide induced a higher contraction in VC compared with aorta. Protein expression of three major ROS metabolizing enzymes, xanthine oxidase (XO), CuZn-SOD, and catalase, was higher in VC compared with aorta. Because XO seemed a likely source of the higher VC ROS levels, we examined it further and found higher mRNA expression and activity of XO in VC compared with aorta. We also investigated the impact of XO inhibition by allopurinol on aorta and VC functional responses to norepinephrine, ANG II, ET-1, and ACh. Maximal ET-1-mediated contraction was decreased by allopurinol in VC but not in the aorta. Our results suggest that there are overall differences in ROS metabolism between aorta and VC, with the latter operating normally at a higher set point, releasing but also being able to handle, higher ROS levels. We propose XO to be an important source for these differences. The result of this particular comparison may be reflective of a general arteriovenous contrast.

  17. Effect of altered arterial perfusion pressure on vascular conductance and muscle blood flow dynamic response during exercise in humans.

    Science.gov (United States)

    Villar, Rodrigo; Hughson, Richard L

    2013-03-01

    Changes in vascular conductance (VC) are required to counter changes in muscle perfusion pressure (MPP) to maintain muscle blood flow (MBF) during exercise. We investigated the recruitment of VC as a function of peak VC measured in three body positions at two different work rates to test the hypothesis that adaptations in VC compensated changes in MPP at low-power output (LPO), but not at high-power output (HPO). Eleven healthy volunteers exercised at LPO and HPO (repeated plantar flexion contractions at 20-30% maximal voluntary contraction, respectively) in horizontal (HOR), 35° head-down tilt (HDT), and 45° head-up tilt (HUT). Muscle blood flow velocity and popliteal diameter were measured by ultrasound to determine MBF, and VC was estimated by dividing MBF flow by MPP. Peak VC was unaffected by body position. The rates of increase in MBF and VC were significantly faster in HUT and slower in HDT than HOR, and rates were faster in LPO than HPO. During LPO exercise, the increase in, and steady-state values of, MBF were less for HUT and HDT than HOR; the increase in VC was less in HUT than HOR and HDT. During HPO exercise, MBF in the HDT was reduced compared with HOR and HUT, even though VC reached 92% VC peak, which was greater than HOR, which was, in turn, greater than HUT. Reduced MBF during HPO HDT exercise had the functional consequence of a significant increase in muscle electromyographic index, revealing the effects of MPP on O2 delivery during exercise.

  18. Selective cephalic upregulation of p-ERK, CamKII and p-CREB in response to glyceryl trinitrate infusion

    DEFF Research Database (Denmark)

    Ramachandran, Roshni; Pedersen, Sara Hougaard; Amrutkar, Dipak Vasantrao

    2018-01-01

    in the trigeminal and spinothalamic system after infusion of the migraine-provoking substance glyceryltrinitrate. Method A catheter was placed in the femoral vein of rats and one week later glyceryltrinitrate 4 µg/kg/min was infused for 20 min. Protein expression in the dura mater, trigeminal ganglion, nucleus...... glycerytrinitrate infusion ( P ... after glycerytrinitrate infusion with long-lasting expression of phosphorylated extracellular signal-regulated kinases observed in the nucleus caudalis. These activations were not observed at the spinal level....

  19. Influence of oculomotor nerve afferents on central endings of primary trigeminal fibers.

    Science.gov (United States)

    Manni, E; Bortolami, R; Pettorossi, V E; Lucchi, M L; Callegari, E; Draicchio, F

    1987-12-01

    Painful fibers running in the third nerve and originating from the ophthalmic trigeminal area send their central projections at level of substantia gelatinosa of nucleus caudalis trigemini. The central endings of these fibers form axoaxonic synapses with trigeminal fibers entering the brain stem through the trigeminal root. The effect of electrical stimulation of the third nerve central stump on the central endings of trigeminal afferent fibers consists in an increased excitability, possibly resulting in a presynaptic inhibition. This inhibitory influence is due to both direct and indirect connections of the third nerve afferent fibers with the trigeminal ones.

  20. Chronic changes in pituitary adenylate cyclase-activating polypeptide and related receptors in response to repeated chemical dural stimulation in rats.

    Science.gov (United States)

    Han, Xun; Ran, Ye; Su, Min; Liu, Yinglu; Tang, Wenjing; Dong, Zhao; Yu, Shengyuan

    2017-01-01

    Background Preclinical experimental studies revealed an acute alteration of pituitary adenylate cyclase-activating polypeptide in response to a single activation of the trigeminovascular system, which suggests a potential role of pituitary adenylate cyclase-activating polypeptide in the pathogenesis of migraine. However, changes in pituitary adenylate cyclase-activating polypeptide after repeated migraine-like attacks in chronic migraine are not clear. Therefore, the present study investigated chronic changes in pituitary adenylate cyclase-activating polypeptide and related receptors in response to repeated chemical dural stimulations in the rat. Methods A rat model of chronic migraine was established by repeated chemical dural stimulations using an inflammatory soup for a different numbers of days. The pituitary adenylate cyclase-activating polypeptide levels were quantified in plasma, the trigeminal ganglia, and the trigeminal nucleus caudalis using radioimmunoassay and Western blotting in trigeminal ganglia and trigeminal nucleus caudalis tissues. Western blot analysis and real-time polymerase chain reaction were used to measure the protein and mRNA expression of pituitary adenylate cyclase-activating polypeptide-related receptors (PAC1, VPAC1, and VPAC2) in the trigeminal ganglia and trigeminal nucleus caudalis to identify changes associated with repetitive applications of chemical dural stimulations. Results All rats exhibited significantly decreased periorbital nociceptive thresholds to repeated inflammatory soup stimulations. Radioimmunoassay and Western blot analysis demonstrated significantly decreased pituitary adenylate cyclase-activating polypeptide levels in plasma and trigeminal ganglia after repetitive chronic inflammatory soup stimulation. Protein and mRNA analyses of pituitary adenylate cyclase-activating polypeptide-related receptors demonstrated significantly increased PAC1 receptor protein and mRNA expression in the trigeminal ganglia, but not

  1. Venture capital and efficiency of portfolio companies

    Directory of Open Access Journals (Sweden)

    A. Thillai Rajan

    2010-12-01

    Full Text Available Venture Capital (VC has emerged as the dominant source of finance for entrepreneurial and early stage businesses, and the Indian VC industry in particular has clocked the fastest growth rate globally. Academic literature reveals that VC funded companies show superior performance to non VC funded companies. However, given that venture capitalists (VCs select and fund only the best companies, how much credit can they take for the performance of the companies they fund? Do the inherent characteristics of the firm result in superior performance or do VCs contribute to the performance of the portfolio company after they have entered the firm? A panel that comprised VCs, an entrepreneur and an academic debated these and other research questions on the inter-relationships between VC funding and portfolio firm performance. Most empirical literature indicates that the value addition effect dominates the selection effect in accounting for the superior performance of VC funded companies. The panel discussion indicates that the context as well as the experience of the General Partners in the VC firms can influence the way VCs contribute to the efficiency of their portfolio companies.

  2. Prospects of Vitamin C as an Additive in Plasma of Stored Blood

    Directory of Open Access Journals (Sweden)

    R. Vani

    2015-01-01

    Full Text Available There is a dire necessity to improve blood storage and prolong shelf-life of blood. Very few studies have focused on oxidative stress (OS in blood and its influence on plasma with storage. This study attempts to (i elucidate the continuous changes occurring in plasma during storage through oxidant levels and antioxidant status and (ii evaluate the influence of vitamin C (VC as an additive during blood storage. Blood was drawn from male Wistar rats and stored for 25 days at 4°C. Blood samples were divided into control and experimental groups. Plasma was isolated every 5 days and the OS markers, antioxidant enzymes, lipid peroxidation, and protein oxidation products, were studied. Catalase activity increased in all groups with storage. Lipid peroxidation decreased in VC (10 but was maintained in VC (30 and VC (60. Although there were variations in all groups, carbonyls were maintained towards the end of storage. Advanced oxidation protein products (AOPP increased in VC (30 and were maintained in VC (10 and VC (60. Sulfhydryls were maintained in all groups. Vitamin C could not sufficiently attenuate OS and hence, this opens the possibilities for further studies on vitamin C in combination with other antioxidants, in storage solutions.

  3. Ascorbyl Tetraisopalmitate Inclusion into Υ-Cyclodextrin and Mesoporous SBA-15: Preparation, Characterization and In Vitro Release Study

    Directory of Open Access Journals (Sweden)

    Maria Bastianini

    2017-07-01

    Full Text Available Ascorbic acid or vitamin C is a strong antioxidant widely used in cosmetic and food fields. This vitamin is very unstable and rapidly undergoes degradation. In order to solve this problem and to obtain a stable ascorbic acid, Nikkol Group has developed ascorbyltetraisopalmitate (VC-IP. This raw material is an oil phase, already well-known and employed in the cosmetic market. The objective of this study is to obtain VC-IP in micro-powder form, in order to produce a new raw material that is easily dispersible in oil and water phases and useful for make-up and color cosmetic applications. Various types of drug carriers were studied and considered in order to support VC-IP and obtain the conversion in powder. Υ-cyclodextrin and mesoporous silica SBA-15 were chosen as the best candidates. A white powder of supported VC-IP was obtained with each carrier (VC-IP@cyclodextrin, VC-IP@SBA-15. The systems underwent physicochemical characterization and in vitro release tests were carried out. Based on the conducted study, it can be concluded that by supporting VC-IP on Υ-cyclodextrin and SBA-15, it is feasible to obtain a new raw material in powder form. The two carriers possess different release profiles, adding the possibility to finely tune the release of the active component in smart formulations.

  4. Magnesium prevents phosphate-induced vascular calcification via TRPM7 and Pit-1 in an aortic tissue culture model.

    Science.gov (United States)

    Sonou, Tomohiro; Ohya, Masaki; Yashiro, Mitsuru; Masumoto, Asuka; Nakashima, Yuri; Ito, Teppei; Mima, Toru; Negi, Shigeo; Kimura-Suda, Hiromi; Shigematsu, Takashi

    2017-06-01

    Previous clinical and experimental studies have indicated that magnesium may prevent vascular calcification (VC), but mechanistic characterization has not been reported. This study investigated the influence of increasing magnesium concentrations on VC in a rat aortic tissue culture model. Aortic segments from male Sprague-Dawley rats were incubated in serum-supplemented high-phosphate medium for 10 days. The magnesium concentration in this medium was increased to demonstrate its role in preventing VC, which was assessed by imaging and spectroscopy. The mineral composition of the calcification was analyzed using Fourier transform infrared (FTIR) spectroscopic imaging, scanning electron microscopy (SEM) and energy dispersive X-ray spectroscopy (EDX) mapping. Magnesium supplementation of high-phosphate medium dose-dependently suppressed VC (quantified as aortic calcium content), and almost ablated it at 2.4 mm magnesium. The FTIR images and SEM-EDX maps indicated that the distribution of phosphate (as hydroxyapatite), phosphorus and Mg corresponded with calcium content in the aortic ring and VC. The inhibitory effect of magnesium supplementation on VC was partially reduced by 2-aminoethoxy-diphenylborate, an inhibitor of TRPM7. Furthermore, phosphate transporter-1 (Pit-1) protein expression was increased in tissues cultured in HP medium and was gradually-and dose dependently-decreased by magnesium. We conclude that a mechanism involving TRPM7 and Pit-1 underpins the magnesium-mediated reversal of high-phosphate-associated VC.

  5. THE CAPITAL STRUCTURE OF VENTURE CAPITAL FIRMS IN INDONESIA

    Directory of Open Access Journals (Sweden)

    Andi Buchari

    2016-10-01

    Full Text Available Venture capital (VC is an important fund source for small and medium enterprises (SMEs and start up, particularly to deliver its main product of equity participation. Therefore, capital structure and factors that affect it are very crucial. This study aims to analyze the capital structure of VC firms in Indonesia using econometric model of panel data regression. This study utilizes secondary data of six years period (2009-2014 monthly financial statements of 27 samples out of 58 VC firms to form 1,944 observations. The study reveals that capital structure of VC firms in Indonesia is dominated by debt/loan rather than capital with DER on average is 136.95%. In addition, the research confirms that VC firms’ capital structure is affected simultaneously by financial aspects which are asset size, profitability, liquidity, asset/investment quality, and earning asset structure. The attentions to financial aspects that affect the VC firms’ capital structure as well as other initiatives related to capital increases are necessary so that the VC firms could carry out its role effectively.

  6. Differential enumeration of subpopulations in concentrated frozen and lyophilized cultures of Lactobacillus delbrueckii ssp. bulgaricus.

    Science.gov (United States)

    Shao, Yuyu; Wang, Zhaoxia; Bao, Qiuhua; Zhang, Heping

    2017-11-01

    Differential enumeration of subpopulations in concentrated frozen and lyophilized cultures of Lactobacillus delbrueckii ssp. bulgaricus ND02 derived from 2 propagation procedures was determined. The subpopulations consisted of 3 categories (physiological states): viable cells capable of forming colonies on agar plates (VC+), viable cells incapable of forming colonies on agar plates (VC-), widely referred to as viable but nonculturable (VBNC) cells, and nonviable or dead cells (NVC). Counts of VC+ were recorded using a conventional plate count procedure. A fluorescent vital staining procedure that discriminates between viable (VC+ and VC-) and NVC cells was used to determine the number of viable and nonviable cells. Both propagation procedures had 2 variables: in procedure (P)1, the propagation medium was rich in yeast extract (4.0%) and the pH was maintained at 5.7; in P2, the medium was devoid of yeast extract and the pH was maintained at 5.1. The results showed that post-propagation operations-concentration of cells by centrifugation and subsequent freezing or lyophilization of cell concentrate-induced different degrees of transience from VC+ to VC- states in cells derived from P1 and P2. Compared with cells derived from P2, cells from P1 were more labile to stress associated with centrifugation, freezing, and lyophilization, as revealed by differential counting. Copyright © 2017 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  7. Desarrollo del cultivo de melón (Cucumis melo con vermicompost bajo condiciones de invernadero / Development of muskmelon (Cucumis melo with vermicompost under greenhouse conditions

    Directory of Open Access Journals (Sweden)

    Alejandro Moreno-Reséndez

    2014-04-01

    Full Text Available Se determinó el efecto del vermicompost (VC sobre el desarrollo del melón en invernadero utilizando como sustratos cuatro tipos de VC mezclados con arena de río (AR, con relaciones 25 : 75, 30 : 70, 35 : 65 y 40 : 60 (% en volumen. Los VC se prepararon a partir de estiércoles de caballo, cabra, conejo y bovino. Los sustratos se colocaron en bolsas de polietileno negro, de 20 kg de capacidad, en donde se sembraron semillas del melón Cantaloupe. Las plantas se condujeron a un solo tallo, tutorando con rafia y la demanda hídrica se cubrió con riego por goteo. Las bolsas, utilizadas como macetas, se colocaron en fila a doble hilera, con arreglo a tresbolillo. Se utilizó un diseño de bloques completos al azar en arreglo factorial 4x4 con cuatro repeticiones. El factor A fueron las mezclas VC : AR y el B los diferentes VC. El análisis de varianza mostró que con 40 % de VC, independientemente del VC usado, se registraron diferencias altamente significativas (P ≤ 0.01 para rendimiento, peso de fruto, diámetros ecuatorial y polar, espesor de pulpa, cavidad de la placenta y días a cosecha, con 96.386 t ha-1, 1.688 kg fruto-1, 14.55 cm, 16.73 cm, 3.77 cm, 5.57 cm y 89 d respectivamente, sin importar el tipo de estiércol utilizado en las mezclas con VC. El contenido promedio de sólidos solubles en los frutos resultó estadísticamente igual en cualquier nivel y tipo de VC empleado.

  8. Vascular calcification in diabetic foot and its association with calcium homeostasis

    Directory of Open Access Journals (Sweden)

    Jayshree Swain

    2012-01-01

    Full Text Available Introduction: Vascular calcification (VC, long thought to result from passive degeneration, involves a complex process of biomineralization resembling osteogenesis, frequently observed in diabetes and is an indicator of diabetic peripheral vascular disease with variable implications. Aim and Objective : To study the association between vascular calcification and calcium homeostasis in diabetic patients with foot ulcers without stage 4, 5 chronic kidney disease. Materials and Methods : A total of 74 patients with diabetic foot ulcer were enrolled, and VC was detected by X-ray and Doppler methods. Serum calcium, phosphate, alkaline phosphatase (ALKP, fasting and post-prandial glucose levels, and glycosylated hemoglobin (HbA1C were recorded. Serum iPTH and 25 (OH vitamin D were estimated by immune radiometric assay and radioimmunoassay, respectively. Data was analyzed by SPSS 16.0. Results: Vascular calcification was present in 42% of patients. Significant difference in the mean (±SD of vitamin D, HbA1C, and eGFR was observed in VC +ve compared to VC -ve. There was no significant association of age, duration, BMI, PTH, Ca, PO4, ALKP with that of VC incidence. Severe vitamin D deficiency was more common in VC +ve (51.6% compared to in VC -ve (18.6%. Sub-group analysis showed that the risk of VC was significantly higher (RR = 2.4, P < 0.05, 95% C.I. = 0.058-2.88 in patients with vitamin D < 10 ng/ml compared to others. Conclusion: Vitamin D deficiency could be a risk for vascular calcification, which possibly act through receptors on vascular smooth muscle cells or modulates osteoprotegerin/RANKL system like other factors responsible for VC in diabetic foot patients.

  9. Financial and Temporal Advantages of Virtual Consultation in Veterans Requiring Specialty Care.

    Science.gov (United States)

    Abbott, Daniel E; Macke, Ryan A; Kurtz, Jodi; Safdar, Nasia; Greenberg, Caprice C; Weber, Sharon M; Voils, Corrine I; Fisher, Deborah A; Maloney, James D

    2018-01-01

    Access to specialty health care in the Veterans Affairs (VA) system continues to be problematic. Given the potential temporal and fiscal benefits of telehealth, the Madison VA developed a virtual consultation (VC) mechanism to expedite diagnostic and therapeutic interventions for Veterans with incidentally discovered pulmonary nodules. Materials and. VC, a remote encounter between referring provider and thoracic surgeon for incidentally discovered pulmonary nodules, was implemented at the Madison VA between 2009 and 2011. Time from request to completion of consultation, hospital cost, and travel costs were determined for 157 veterans. These endpoints were then compared with in-person consultations over a concurrent 6-mo period. For the entire study cohort, the mean time to completion of VC was 3.2 d (SD ± 4.4 d). For the 6-mo period of first VC availability, the mean time to VC completion versus in-person consultation was 2.8 d (SD ± 2.8 d) and 20.5 d (SD ± 15.6 d), respectively (p < 0.05). Following initial VC, 84 (53%) veterans were scheduled for virtual follow-up alone; no veteran required an additional office visit before further diagnostic or therapeutic intervention. VA hospital cost was $228 per in-person consultation versus $120 per episode for VC - a 47.4% decrease. The average distance form veteran home to center was 86 miles, with an average travel reimbursement of $112 per in-person consultation, versus no travel cost associated with VC. VC for incidentally discovered pulmonary nodules significantly decreases time to consultation completion, hospital cost, and veteran travel cost. These data suggest that a significant opportunity exists for expansion of telehealth into additional practice settings within the VA system. © Association of Military Surgeons of the United States 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com

  10. Virtual colonoscopy training and accreditation: a national survey of radiologist experience and attitudes in the UK

    International Nuclear Information System (INIS)

    Burling, D.; Moore, A.; Taylor, S.; La Porte, S.; Marshall, M.

    2007-01-01

    Aim: Expert consensus recommends directed training and possibly in the future, formal accreditation before independent virtual colonoscopy (VC) reporting. We surveyed radiologists' experience of VC training, compared with barium enema, and assessed attitudes towards accreditation. Materials and methods: A questionnaire was sent to 78 consultant radiologists from 72 centres (65 National Health Service hospitals; seven independent primary screening centres) offering a VC service. Results: Fifty-four (69%) eligible radiologists responded. They had interpreted 18,152 examinations (range 3-1500) in total versus 232,350 (13 times more) barium enemas. Twenty-two (41%) deemed their VC training as inadequate [including five (45%) of screening centre radiologists], and only 14 (26%) had attended a training workshop due to lack of availability (54%) or financial/study leave constraints (24%). Eleven (20%) radiologists routinely double-reported VC examinations versus 37 (69%) barium enemas, yet 21 (39%) considered requirements for VC training were greater than barium enema. Thirty-eight (70%) favoured accreditation beyond internal audit for VC versus 15(28%) for barium enema. Of these 38, seven (18%) favoured 'one-off,' and 18 (47%) periodic testing, with 16 (42%) favouring external audit alone or in combination with testing. Overall, 42 (78%) considered specific accreditation for reporting screening examinations appropriate and 45 (83%) respondents preferred a national radiological organization to regulate such a scheme. Conclusion: There is wide variability in reporting experience and recommendations for VC training have not been widely adopted, in part due to limited access to dedicated workshops. UK radiologists are generally in favour of VC accreditation, governed by a national radiology organization

  11. Prevalence of Vibrio cholerae in Coastal Alternative Supplies of Drinking Water and Association with Bacillus-Like Spore Formers

    Directory of Open Access Journals (Sweden)

    Md. Asaduzzaman Shishir

    2018-02-01

    Full Text Available The scarcity of hygienic drinking water is a normal phenomenon in the coastal areas of Bangladesh due to the high salinity of ground water. The inhabitants of this locality, therefore, live on alternative supplies of water including rain-fed pond water, and rainwater with persistent complex microbial interactions therein, often contaminated with life-threatening pathogens. Hence, this study was aimed at analyzing the prevalence of Vibrio cholerae (Vc in the alternative drinking waters of Mathbaria, a coastal subdistrict neighboring the Bay of Bengal, the efficacy of pond sand filter (PSF and the co-association among Bacillus-like spore formers (Sf and Vc. Vc presumably entrapped into the membrane filter was enriched in alkaline peptone water medium and was isolated on selective thiosulfate-citrate-bile salts-sucrose and taurocholate-tellurite-gelatin agar media. They were finally identified by immunochromatographic one step rapid test and serology test. A total of 26% Vc positive samples were obtained out of 100 [ponds—48, household (HH—29, and PSFs—23] where 13% cases were pathogenic (Vc O1 and 13% were non-pathogenic (Vc non-O1/non-O139. The distribution of Vc as observed was 33, 26, and 13.8% in waters derived from pond surface, PSF, and HH reservoirs, respectively, and for pathogenic type, it was 62.5%, 50%, and nil, respectively. Although none of the samples was identified with pathogenic Vc O139, the statistics represents a significant and augmentative risk of cholera outbreak in the focused area. The antibiotic sensitivity pattern in this study resembled the trend observed during last few years for Vc. The PSF demonstrated its inability to remove Vc from any of the samples and in addition, the filter itself was evidenced to be the source of pathogens and spores in further contamination and transmission. The development of biofilm in the PSF could be hypothesized as the reservoir in contaminating pathogen-free water samples. From the

  12. Influence of supplemental vitamin C on postmortem protein degradation and fatty acid profiles of the longissimus thoracis of steers fed varying concentrations of dietary sulfur.

    Science.gov (United States)

    Pogge, Danielle J; Lonergan, Steven M; Hansen, Stephanie L

    2014-02-01

    The objective was to examine the effects of supplemental vitamin C (VC) on postmortem protein degradation and fatty acid profiles of cattle receiving varying concentrations of dietary sulfur (S). A longissimus muscle was collected from 120 Angus-cross steers assigned to a 3 × 2 factorial, evaluating three concentrations of dietary S (0.22, 0.34, and 0.55%) and two concentrations of supplemental VC (0 or 10 g h(-1)d(-1)). Increasing dietary S and VC supplementation (Pdegradation (P = 0.07) and protein carbonylation (Pdegradation. © 2013.

  13. Venture Capital and Industrial ''Innovation''

    OpenAIRE

    Hirukawa, Masayuki; Ueda, Masako

    2008-01-01

    For the sample period of 1965-1992, Kortum and Lerner (2000) find that venture capital (VC) investments have a positive impact on patent count at industry level, and this impact is larger than that of R&D expenditures. We confirm that this positive impact continued to be present and became even stronger in late 90s during which VC industry experienced an unprecedented growth. We then proceed to study if this positive impact of VC is also present on productivity growth, which is a measure of i...

  14. Short-chain grafting of tetrahydrofuran and 1,4-dioxane cycles on vinylchloride-maleic anhydride copolymer

    Directory of Open Access Journals (Sweden)

    2009-01-01

    Full Text Available Mass increase of vinylchloride-maleic anhydride (VC-MA copolymer samples aged in tetrahydrofuran (THF or in 1,4-dioxane results from chemical interaction of VC-MA macromolecules with 1,4-dioxane or THF. Microstructure of the products of such modification was proved by infrared spectroscopy (IR- and nuclear magnetic resonance spectroscopy (13C NMR and 1H NMR. Mechanism of modification has been proposed. The results of microstructure research of VC-MA samples aged in THF and in 1,4-dioxane coincide with already known data on the reactions of opening of these and other oxygen-containing cycles under mild conditions.

  15. Can femoral dialysis catheter insertion cause a life threatening complication?

    Directory of Open Access Journals (Sweden)

    Nurkay Katrancıoğlu

    2014-09-01

    Full Text Available Venous catheter (VC insertion may be necessary for the patients with renal failure facing vascular access problem. Femoral VCs are commonly used for their lower complication rates especially in emergency clinics. The incidence of bleeding associated with VC is reported 0.5-1.6%, however, life threatening hemorrhage and complications requiring surgical intervention are very rare. In this manuscript, we aimed to present a case with hemolytic uremic syndrome complicated with retroperitoneal hematoma after femoral VC insertion. J Clin Exp Invest 2014; 5 (3: 472-474

  16. Prevalence of Vibrio cholerae in Coastal Alternative Supplies of Drinking Water and Association with Bacillus-Like Spore Formers.

    Science.gov (United States)

    Shishir, Md Asaduzzaman; Mamun, Md Al; Mian, Md Mahmuduzzaman; Ferdous, Umme Tamanna; Akter, Noor Jahan; Suravi, Rajia Sultana; Datta, Suvamoy; Kabir, Md Ehsanul

    2018-01-01

    The scarcity of hygienic drinking water is a normal phenomenon in the coastal areas of Bangladesh due to the high salinity of ground water. The inhabitants of this locality, therefore, live on alternative supplies of water including rain-fed pond water, and rainwater with persistent complex microbial interactions therein, often contaminated with life-threatening pathogens. Hence, this study was aimed at analyzing the prevalence of Vibrio cholerae ( Vc ) in the alternative drinking waters of Mathbaria, a coastal subdistrict neighboring the Bay of Bengal, the efficacy of pond sand filter (PSF) and the co-association among Bacillus -like spore formers (Sf) and Vc . Vc presumably entrapped into the membrane filter was enriched in alkaline peptone water medium and was isolated on selective thiosulfate-citrate-bile salts-sucrose and taurocholate-tellurite-gelatin agar media. They were finally identified by immunochromatographic one step rapid test and serology test. A total of 26% Vc positive samples were obtained out of 100 [ponds-48, household (HH)-29, and PSFs-23] where 13% cases were pathogenic ( Vc O1) and 13% were non-pathogenic ( Vc non-O1/non-O139). The distribution of Vc as observed was 33, 26, and 13.8% in waters derived from pond surface, PSF, and HH reservoirs, respectively, and for pathogenic type, it was 62.5%, 50%, and nil, respectively. Although none of the samples was identified with pathogenic Vc O139, the statistics represents a significant and augmentative risk of cholera outbreak in the focused area. The antibiotic sensitivity pattern in this study resembled the trend observed during last few years for Vc . The PSF demonstrated its inability to remove Vc from any of the samples and in addition, the filter itself was evidenced to be the source of pathogens and spores in further contamination and transmission. The development of biofilm in the PSF could be hypothesized as the reservoir in contaminating pathogen-free water samples. From the test of

  17. Prediction of post-operative pulmonary function after lobectomy for primary lung cancer: A comparison among counting method, effective lobar volume, and lobar collapsibility using inspiratory/expiratory CT

    Energy Technology Data Exchange (ETDEWEB)

    Yabuuchi, Hidetake, E-mail: h-yabu@med.kyushu-u.ac.jp [Department of Health Sciences, Kyushu University Graduate School of Medical Sciences, Fukuoka (Japan); Kawanami, Satoshi, E-mail: kawanami_01@mac.com [Department of Clinical Radiology, Kyushu University Graduate School of Medical Sciences, Fukuoka (Japan); Kamitani, Takeshi, E-mail: kamitani@radiol.med.kyushu-u.ac.jp [Department of Clinical Radiology, Kyushu University Graduate School of Medical Sciences, Fukuoka (Japan); Yonezawa, Masato, E-mail: ymasato@radiol.med.kyushu-u.ac.jp [Department of Clinical Radiology, Kyushu University Graduate School of Medical Sciences, Fukuoka (Japan); Yamasaki, Yuzo, E-mail: yyama@radiol.med.kyushu-u.ac.jp [Department of Clinical Radiology, Kyushu University Graduate School of Medical Sciences, Fukuoka (Japan); Yamanouchi, Torahiko, E-mail: tora0228jp@yahoo.co.jp [Department of Clinical Radiology, Kyushu University Graduate School of Medical Sciences, Fukuoka (Japan); Nagao, Michinobu, E-mail: minagao@radiol.med.kyushu-u.ac.jp [Department of Clinical Radiology, Kyushu University Graduate School of Medical Sciences, Fukuoka (Japan); Okamoto, Tatsuro, E-mail: tatsuro@surg2.med.kyushu-u.ac.jp [Department of Surgery and Science, Kyushu University Graduate School of Medical Sciences, Fukuoka (Japan); Honda, Hiroshi, E-mail: honda@radiol.med.kyushu-u.ac.jp [Department of Clinical Radiology, Kyushu University Graduate School of Medical Sciences, Fukuoka (Japan)

    2016-11-15

    Highlights: • ΔFEV{sub 1.0} and ppoΔFEV{sub 1.0} using lobar collapsibility were strongly correlated. • ΔVC and ppoΔVC using effective lobar volume were strongly correlated. • Counting method was inferior to lobar collapsibility for prediction of ppoFEV{sub 1.0}. • Inspiratory/expiratory CT is useful to predict post-operative pulmonary function. - Abstract: Purpose: To compare the predictabilities of postoperative pulmonary function after lobectomy for primary lung cancer among counting method, effective lobar volume, and lobar collapsibility. Methods: Forty-nine patients who underwent lobectomy for primary lung cancer were enrolled. All patients underwent inspiratory/expiratory CT and pulmonary function tests 2 weeks before surgery and postoperative pulmonary function tests 6–7 months after surgery. Pulmonary function losses (ΔFEV{sub 1.0} and ΔVC) were calculated from the pulmonary function tests. Predictive postoperative pulmonary function losses (ppoΔFEV{sub 1.0} and ppoΔVC) were calculated using counting method, effective volume, and lobar collapsibility. Correlations and agreements between ΔFEV{sub 1.0} and ppoFEV{sub 1.0} and those between ΔVC and ppoΔVC were tested among three methods using Spearman’s correlation coefficient and Bland-Altman plots. Results: ΔFEV{sub 1.0} and ppoΔFEV{sub 1.0insp-exp} were strongly correlated (r = 0.72), whereas ΔFEV{sub 1.0} and ppoΔFEV{sub 1.0count} and ΔFEV{sub 1.0} and Pred. ΔFEV{sub 1.0eff.vol.} were moderately correlated (r = 0.50, 0.56). ΔVC and ppoΔVC{sub eff.vol.} (r = 0.71) were strongly correlated, whereas ΔVC and ppoΔVC{sub count}, and ΔVC and ppoΔVC {sub insp-exp} were moderately correlated (r = 0.55, 0.42). Conclusions: Volumetry from inspiratory/expiratory CT data could be useful to predict postoperative pulmonary function after lobectomy for primary lung cancer.

  18. [Comparative anatomical study of the ventral brain arteries of the Pudu pudu (Molina, 1782) with those of the cow].

    Science.gov (United States)

    Schweitzer-Delaunoy, W

    1997-06-01

    Comparative anatomical study of the ventral brain arteries of the Pudú pudu (Molina, 1782) with those of the cow. A comparison using the corrosion method was made between Pudú pudu (Molina, 1782) ventral brain arteries and those of the cow. The Pudú's Rete mirabile epidurale rostrale (Nomina Anatomica Veterinaria, 1994) is ventrally formed by branches of the A. maxillaris, and caudally formed by the A. vertebralis. The Hypophysis is surrounded by the Rete mirabile rostrale. The lateral parts are rostrally joined to that gland by a thin vascular bridge and caudally by thick arteries. The Pudú's Circulus arteriosus cerebri asymmetrical, that is, on the right side the A. cerebri rostralis ends in the A. cerebri media. The left-side A. cerebri rostralis irrigates every rostral portion of the encephalon. In the cow, practically the same arteries come out of the Circulus arteriosus cerebri, which is not asymmetrical. The A. cerebri caudalis comes first out of the A. communicans caudalis and then the branches for the Pons, and finally the A. cerebelli rostralis. In this species, there are arterial blocks that are not present in Pudú.

  19. Frequent mild head injury promotes trigeminal sensitivity concomitant with microglial proliferation, astrocytosis, and increased neuropeptide levels in the trigeminal pain system.

    Science.gov (United States)

    Tyburski, Ashley L; Cheng, Lan; Assari, Soroush; Darvish, Kurosh; Elliott, Melanie B

    2017-12-01

    Frequent mild head injuries or concussion along with the presence of headache may contribute to the persistence of concussion symptoms. In this study, the acute effects of recovery between mild head injuries and the frequency of injuries on a headache behavior, trigeminal allodynia, was assessed using von Frey testing up to one week after injury, while histopathological changes in the trigeminal pain pathway were evaluated using western blot, ELISA and immunohistochemistry.  RESULTS: A decreased recovery time combined with an increased mild closed head injury (CHI) frequency results in reduced trigeminal allodynia thresholds compared to controls. The repetitive CHI group with the highest injury frequency showed the greatest reduction in trigeminal thresholds along with greatest increased levels of calcitonin gene-related peptide (CGRP) in the trigeminal nucleus caudalis. Repetitive CHI resulted in astrogliosis in the central trigeminal system, increased GFAP protein levels in the sensory barrel cortex, and an increased number of microglia cells in the trigeminal nucleus caudalis. Headache behavior in rats is dependent on the injury frequency and recovery interval between mild head injuries. A worsening of headache behavior after repetitive mild head injuries was concomitant with increases in CGRP levels, the presence of astrocytosis, and microglia proliferation in the central trigeminal pathway. Signaling between neurons and proliferating microglia in the trigeminal pain system may contribute to the initiation of acute headache after concussion or other traumatic brain injuries.

  20. Dichloroethene and Vinyl Chloride Degradation Potential in Wetland Sediments at Twin Lakes and Pen Branch, Savannah River National Laboratory, South Carolina

    National Research Council Canada - National Science Library

    Bradley, Paul M

    2007-01-01

    .... This project investigated the potential for biotic and abiotic DCE and VC degradation in wetland sediments from the Twin Lakes area of the C-BRP investigative unit and from the portion of Pen Branch...

  1. A retrospective analysis of thyroid disease in pregnancy at Chris ...

    African Journals Online (AJOL)

    2017-12-05

    Dec 5, 2017 ... Corresponding author: V Nicolaou (docvic9@gmail.com). Over the past two decades, ... developed nations, with Graves' disease (GD) accounting for the majority of cases (85%). ..... Author contributions. VC: lead researcher ...

  2. Hierarchically porous, ultra-strong reduced graphene oxide-cellulose nanocrystal sponges for exceptional adsorption of water contaminants

    DEFF Research Database (Denmark)

    Yousefi, Nariman; Wong, Kerwin K.W.; Hosseinidoust, Zeinab

    2018-01-01

    Self-assembly of graphene oxide (GO) nanosheets into porous 3D sponges is a promising approach to exploit their capacity to adsorb contaminants while facilitating the recovery of the nanosheets from treated water. Yet, forming mechanically robust sponges with suitable adsorption properties presents...... a significant challenge. Ultra-strong and highly porous 3D sponges are formed using GO, vitamin C (VC), and cellulose nanocrystals (CNCs) - natural nanorods isolated from wood pulp. CNCs provide a robust scaffold for the partially reduced GO (rGO) nanosheets resulting in an exceptionally stiff nanohybrid....... The concentration of VC as a reducing agent plays a critical role in tailoring the pore architecture of the sponges. By using excess amounts of VC, a unique hierarchical pore structure is achieved, where VC grains act as soft templates for forming millimeter-sized pores, the walls of which are also porous...

  3. Characterization of the Aerobic Oxidation of cis-Dichloroethene and Vinyl Chloride in Support of Bioremediation of Chloroethene-Contaminated Sites

    National Research Council Canada - National Science Library

    Gossett, James M; Mattes, Timothy E; Sills, Deborah L; Spain, Jim C; Nishino, Shirley F; Coleman, Nicholas V

    2004-01-01

    ...) and trichloroethene (TCE). Accumulation of VC and cDCE under anaerobic conditions limits the application of natural attenuation and enhanced reductive anaerobic biological in-situ treatment technologies (RABITT...

  4. A Situation Awareness Assistant for Human Deep Space Exploration

    Science.gov (United States)

    Boy, Guy A.; Platt, Donald

    2013-01-01

    This paper presents the development and testing of a Virtual Camera (VC) system to improve astronaut and mission operations situation awareness while exploring other planetary bodies. In this embodiment, the VC is implemented using a tablet-based computer system to navigate through inter active database application. It is claimed that the advanced interaction media capability of the VC can improve situation awareness as the distribution of hu man space exploration roles change in deep space exploration. The VC is being developed and tested for usability and capability to improve situation awareness. Work completed thus far as well as what is needed to complete the project will be described. Planned testing will also be described.

  5. When Rey-Osterrieth’s Complex Figure Becomes a Church: Prevalence and Correlates of Graphic Confabulations in Dementia

    Directory of Open Access Journals (Sweden)

    Oriana Pelati

    2011-11-01

    Full Text Available Verbal confabulation (VC has been described in several pathological conditions characterized by amnesia and has been defined as ‘statements that involve distortion of memories’. Here we describe another kind of confabulation (graphic confabulation, GC, evident at the recall of the Rey-Osterrieth complex figure (ROCF. In a retrospective study of 267 patients with mild-to-moderate dementia, 14 patients (4.9 % recalled the abstract ROCF as drawings with recognizable semantic meaning. VC was evident at the story recall test in 19.8% of the study participants. VC and GC were homogeneously distributed among the different types of dementia. VC has been proposed to originate from complex interactions of amnesia, motivational deficit and dysfunction of monitoring systems. On the contrary, GC seems to be the result of a deficit in visual memory replaced by the semantic translation of isolated parts of the ROCF along with a source monitoring deficit.

  6. Long-term variations in abundance and distribution of sewage pollution indicator and human pathogenic bacteria along the central west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Rodrigues, V.; Ramaiah, N.; Kakti, S.; Samant, D.

    - FC and Escherichia coli - EC) and potential pathogens (Vibrio cholerae - VC, Shigella - SH, and Salmonella spp. - SA). In both Mandovi and Zuari estuaries, where fishing and tourist-related activities are sizable and long-term data collection...

  7. Solitary pulmonary nodule

    Science.gov (United States)

    ... Adenocarcinoma - chest x-ray Pulmonary nodule - front view chest x-ray Pulmonary nodule, solitary - CT scan Respiratory system References Gotway MB, Panse PM, Gruden JF, Elicker BM. Thoracic radiology: noninvasive diagnostic imaging. In: Broaddus VC, Mason RJ, ...

  8. Chest MRI

    Science.gov (United States)

    ... resonance imaging - chest; NMR - chest; MRI of the thorax; Thoracic MRI Patient Instructions ... Gotway MB, Panse PM, Gruden JF, Elicker BM. Thoracic radiology. In: Broaddus VC, Mason RJ, Ernst JD, et ...

  9. Original Research

    African Journals Online (AJOL)

    home

    2014-04-23

    Apr 23, 2014 ... Effect of Integrated Nutrient Management on Yield and Yield Components of. Food Barley .... with inorganic NP fertilizers for improved productivity of the crop. ... (VC) was applied during planting time on treatment basis.

  10. Recent trends in surgical and reconstructive management of vulvar cancer: review of literature.

    Science.gov (United States)

    Vitale, Salvatore Giovanni; Valenti, Gaetano; Biondi, Antonio; Rossetti, Diego; Frigerio, Luigi

    2015-12-01

    Vulvar cancer (VC) is a rare disease. The most common histologic type is squamous-cell carcinoma. VC could be divided into two types: type one, commonly associated with HPV infection, occurs in young women and type two, associated with non-neoplastic lesions that usually occurs in older women. Previously VC was often treated with radical Vulvectomy. Today update in diagnostic and surgery technique, capable to identify early stages of disease and adaptation in surgery procedures, according to the stage of disease, age of patients and possible physical and psychological morbidity consequence, allow using less radical surgery approaches. That has led to decrease therapy-associated morbidity while preserving oncologic safety and improving psychosexual outcomes. Finally, several surgical treatments are available in case of VC and, despite radical surgery is often required, less radical surgery associated with reconstructive plastic surgery decreases some of short- and long-term associated complications.

  11. Introduction to Machine Learning: Class Notes 67577

    OpenAIRE

    Shashua, Amnon

    2009-01-01

    Introduction to Machine learning covering Statistical Inference (Bayes, EM, ML/MaxEnt duality), algebraic and spectral methods (PCA, LDA, CCA, Clustering), and PAC learning (the Formal model, VC dimension, Double Sampling theorem).

  12. Enhancement of Human Cheek Skin Texture by Acacia Nilotica Bark ...

    African Journals Online (AJOL)

    HP

    Keywords: Acacia nilotica, Cream, Visioscan VC 98, Skin texture, Anti-aging. Tropical Journal of .... volunteer (A) before and (B) after application of extract cream for 3 months The .... Antioxidants and vitamins in Cosmetics. Clin. Dermatol. 2001 ...

  13. [Lung dysfunction in patients with severe chronic obstructive bronchitis].

    Science.gov (United States)

    Nefedov, V B; Popova, L A; Shergina, E A

    2005-01-01

    VC, FVC, FEV1, FEV1/VC%, PEF, MEF25, MEF50, MEF75, TCL, TGV, RV, Raw, Rin, Rex, DLCO-SS, PaO2, and PaCO2 were determined in 36 patients with severe chronic obstructive lung disease (FEV1 volumes and capacities; 83.3% of the patients had pulmonary gas exchange dysfunction. Impaired bronchial patency mainly appeared as decreased FEV1, FEV1/VC%, PEF, MEF25, MEF50, MEF75, Raw, Rin, Rex; altered lung volumes and capacities manifested by increased RV, TGV, and TLC, and by decreased VC and FVC; pulmonary gas exchange dysfunction showed up as lowered PaO2 and DLCO-SS, as decreased or increased PaCO2. The observed bronchial patency disorders varied from significant to severe; functional changes in lung volumes and capacities were mild to severe.

  14. Environmental Variability of the Jordan Basin, Gulf of Maine, August 1982, NRL (Naval Research Laboratory) Cruise 712-82.

    Science.gov (United States)

    1983-11-01

    aa oO-N oiO ni-ofl4-0no fln0 4In0nr14-4In -a. ILrn 40... M 4 *10 -4 0 0 N M N n M M flJ ~~~ I-0 . .- I 0 D 0-C N n Nd V M’ 0- M N 0- 0 M 0 a. - Nd 0 V...m N t Cu t d ( Cd C, d Cd md Cd NdCd Cd Cd Cd rd Cd Cd td CV cv cv rd CV Cd cd Od Nd Cd C9 Ld CU d NNNNNN~NNN-r’N" 44444444444444444444444...00000 Cii ---- V U ~fllC iiirnc fftw ----------- ----------------- J a V VVVC VVVr~crt i~~ td C C C C C C . ~ ~ ~ C ~ C C .V .VC VC .VC .V V VC C C

  15. Virtual colonoscopy

    Science.gov (United States)

    Colonoscopy - virtual; CT colonography; Computed tomographic colonography; Colography - virtual ... Differences between virtual and conventional colonoscopy include: VC can view the colon from many different angles. This is not as easy ...

  16. Culturable heterotrophic bacteria from the euphotic zone of the Indian Ocean ocean during the summer monsoon

    Digital Repository Service at National Institute of Oceanography (India)

    Nair, S.; LokaBharathi, P.A.; Chandramohan, D.

    three orders of magnitude higher than VC. @iPseudomonas/Alteromonas@@ group 1 was dominant in both nearshore and offshore regions. Pigmented bacteria were more abundant in offshore stations and showed multiple antibiotic resistence. Statistically...

  17. Separation and determination of reduced vitamin C in polymerized hemoglobin-based oxygen carriers of the human placenta.

    Science.gov (United States)

    Chen, Gang; Mo, Ling; Li, Shen; Zhou, Wentao; Wang, Hong; Liu, Jiaxin; Yang, Chengmin

    2015-06-01

    The molybdenum blue method was used to determine the content of reduced vitamin C (Vc) in a solution of polymerized hemoglobin-based oxygen carriers (HBOCs) of the human placenta. The conditions of absorption wavelength, HCl addition, and reaction time, were investigated. The results of validation experiments showed that under the optimized conditions, a standard curve was confirmed with good linearity of 0.9985, for the Vc amount ranging from 0-200 μg. The values for relative standard deviation (RSD) of the precision and repeatability were both below 5%. Vc recovery was in the range of 97-102%. The conclusion could be made that a reduction in Vc content could be tested effectively by the molybdenum blue method.

  18. HIV-infected viremic long-term non-progressors and controllers display different immunological mechanisms for preserved CD4+cell counts

    DEFF Research Database (Denmark)

    Gaardbo, J; Ronit, A; Hartling, H

    2012-01-01

    of viral replication cannot explain non-progression in LTNP. Therefore we hypothesized that the immunological mechanism responsible for preserved CD4 counts in LTNP is different from that in VC. Methods: 69 treatment naïve HIV-infected patients were included in a cross-sectional study. A total of 14 LTNP...... ratio in LTNP compared to VC were found (3.8 vs. 5.5, P=0.068) while ratios in LTNP and PR were similar (4.0, P>0.05). Conclusion: LTNP displayed high levels of immune activation, apoptotic cells and reduced Th17/Treg ratio compared to VC, while LTNP were similar to PR. Thus, the immunological mechanism...... responsible for preserved CD4 counts in LTNP is still unclear but seems to be different from that in VC....

  19. Bernstein: Prelude, Fugue and Riffs / Edward Greenfield

    Index Scriptorium Estoniae

    Greenfield, Edward

    1998-01-01

    Uuest heliplaadist "Bernstein: Prelude, Fugue and Riffs. Facsimile. West Side Story - Symphonic Dances. Divertimento. City of Birmingham Symphony Orchestra / Paavo Järvi. Virgin Classics VC5 45295-2 (68 minutes:DDD)

  20. Bernstein: Prelude, Fugue and Riffs / Michel Parouty

    Index Scriptorium Estoniae

    Parouty, Michel

    1998-01-01

    Uuest heliplaadist "Bernstein: Prelude, Fugue and Riffs. Facsimile. West Side Story - Symphonic Dances. Divertimento. City of Birmingham Symphony Orchestra / Paavo Järvi" Virgin Classics VC5 45295-2 (68 minutes:DDD)

  1. A FLEXIBLE APPROACH TO THE BENEFICIAL USE OF MACHINING POWER IN MILLING PROCESS

    Directory of Open Access Journals (Sweden)

    Faruk MENDİ

    2000-01-01

    Full Text Available In this study, a computer program has been developed to calculate the cutting speed (Vc and depth of cut (a under certain cutting condition which will be determined by the user for making maximum use of the various milling machines used presently. In the scope of the study, data related to the cutting speed (Vc and depth of cut (a of St 37 Steel and powers of the machine have been obtained. The aim is to make maximum use of the machines by choosing cutting speed (Vc and depth of cut (a with the help data. The effect of changes in cutting speed (Vc and depth of cut (a on productivity has been studied.

  2. A comparison of pulsed and continuous atom transfer between two magneto-optical traps

    International Nuclear Information System (INIS)

    Ram, S. P.; Tiwari, S. K.; Mishra, S. R.

    2010-01-01

    We present the experimental results for a comparison between pulsed and continuous transfer of cold 87 Rb atoms between a vapor chamber magneto-optical trap (VC-MOT) and an ultra-high vacuum magneto-optical trap (UHV-MOT) when using a resonant push beam. We find that employing repetitive cycles of a pulsed and unfocused push beam on an unsaturated VC-MOT cloud results in a significantly higher number of atoms transferred to the UHV-MOT than the number obtained with a continuous push beam focused on a continuous VC-MOT. In pulsed transfer, we find that both the VC-MOT loading duration and the push beam duration play important roles in the transfer process and govern the number of atoms transferred to the UHV-MOT. The parameters and processes affecting the transfer have been investigated and are discussed.

  3. Image size invariant visual cryptography for general access structures subject to display quality constraints.

    Science.gov (United States)

    Lee, Kai-Hui; Chiu, Pei-Ling

    2013-10-01

    Conventional visual cryptography (VC) suffers from a pixel-expansion problem, or an uncontrollable display quality problem for recovered images, and lacks a general approach to construct visual secret sharing schemes for general access structures. We propose a general and systematic approach to address these issues without sophisticated codebook design. This approach can be used for binary secret images in non-computer-aided decryption environments. To avoid pixel expansion, we design a set of column vectors to encrypt secret pixels rather than using the conventional VC-based approach. We begin by formulating a mathematic model for the VC construction problem to find the column vectors for the optimal VC construction, after which we develop a simulated-annealing-based algorithm to solve the problem. The experimental results show that the display quality of the recovered image is superior to that of previous papers.

  4. Beyond financial value capturing? Interactions between value capturing and cooperation at the interface of road infrastructure and land use planning

    NARCIS (Netherlands)

    Heeres, Niels; Lenferink, Sander; Tillema, Taede; Arts, Jos

    2016-01-01

    To deal with tensions between functional interrelatedness and institutional fragmentation, road infrastructure planning is increasingly interested in integrated planning approaches. From a value capture (VC) perspective, integration offers possibilities for financially linking road infrastructure

  5. Growth and FIB-SEM analyses of C60 microtubes vertically synthesized on porous alumina membranes

    Science.gov (United States)

    Miyazawa, Kun'ichi; Kuriyama, Ryota; Shimomura, Shuichi; Wakahara, Takatsugu; Tachibana, Masaru

    2014-02-01

    The vertical growth of C60 microtubes (C60MTs) on anodic aluminum oxide (AAO) membranes was investigated. The C60MT size dependence on isopropyl alcohol (IPA) injection rate, into C60-saturated toluene solutions through AAO membranes, was measured. A longitudinal section of the interface between a vertically grown C60MT (V-C60MT) and a membrane was prepared by focused ion beam processing, and observed with scanning electron microscopy. No cracking was observed along the interface, suggesting good bonding. V-C60MTs exhibited spiral growth. V-C60MT planar density, wall thickness and aspect ratio all decreased with increasing IPA injection rate. The relationships among length, inner and outer diameters of V-C60MTs were also investigated by varying IPA injection rate.

  6. Sexual activity and function after surgical treatment in patients with (pre)invasive vulvar lesions

    NARCIS (Netherlands)

    Grimm, Donata; Eulenburg, Christine; Brummer, Oliver; Schliedermann, Anna-Katharina; Trillsch, Fabian; Prieske, Katharina; Gieseking, Friederike; Selka, Enzia; Mahner, Sven; Woelber, Linn

    Sexual activity (SA) and sexual function (SF) are central outcome measures in women affected by preinvasive (vulvar intraepithelial neoplasia, VIN) and invasive (vulvar cancer, VC) vulvar lesions. Data on sexuality after treatment are scarce. Validated questionnaires including the female sexual

  7. Distribution of the Coenzyme M Pathway of Epoxide Metabolism Among Ethene- and Vinyl Chloride-Degrading Mycobacterium Strains

    National Research Council Canada - National Science Library

    Coleman, Nicholas

    2003-01-01

    ...) and ethene assimilation pathways of Mycobacterium strain JS6O. In the present study, EaCoMT activity and genes were investigated in 10 different mycobacteria isolated on VC or ethene from diverse environmental samples...

  8. Joint Dictionary Learning-Based Non-Negative Matrix Factorization for Voice Conversion to Improve Speech Intelligibility After Oral Surgery.

    Science.gov (United States)

    Fu, Szu-Wei; Li, Pei-Chun; Lai, Ying-Hui; Yang, Cheng-Chien; Hsieh, Li-Chun; Tsao, Yu

    2017-11-01

    Objective: This paper focuses on machine learning based voice conversion (VC) techniques for improving the speech intelligibility of surgical patients who have had parts of their articulators removed. Because of the removal of parts of the articulator, a patient's speech may be distorted and difficult to understand. To overcome this problem, VC methods can be applied to convert the distorted speech such that it is clear and more intelligible. To design an effective VC method, two key points must be considered: 1) the amount of training data may be limited (because speaking for a long time is usually difficult for postoperative patients); 2) rapid conversion is desirable (for better communication). Methods: We propose a novel joint dictionary learning based non-negative matrix factorization (JD-NMF) algorithm. Compared to conventional VC techniques, JD-NMF can perform VC efficiently and effectively with only a small amount of training data. Results: The experimental results demonstrate that the proposed JD-NMF method not only achieves notably higher short-time objective intelligibility (STOI) scores (a standardized objective intelligibility evaluation metric) than those obtained using the original unconverted speech but is also significantly more efficient and effective than a conventional exemplar-based NMF VC method. Conclusion: The proposed JD-NMF method may outperform the state-of-the-art exemplar-based NMF VC method in terms of STOI scores under the desired scenario. Significance: We confirmed the advantages of the proposed joint training criterion for the NMF-based VC. Moreover, we verified that the proposed JD-NMF can effectively improve the speech intelligibility scores of oral surgery patients. Objective: This paper focuses on machine learning based voice conversion (VC) techniques for improving the speech intelligibility of surgical patients who have had parts of their articulators removed. Because of the removal of parts of the articulator, a patient

  9. Energy Information Administration annual report to Congress 1990

    International Nuclear Information System (INIS)

    1991-01-01

    This report to Congress contains energy-related information on the following: petroleum, natural gas and reserves, coal, nuclear and alternate fuels, electric power, energy markets and end us, statistical standards, automated data processing services, information services, and more. (VC)

  10. ICT and Pragmatism: Creating sustainable Employment for ...

    African Journals Online (AJOL)

    OE Osuagwu, VC Agbasonu, C Ndigwe, E Irene, U Sulaiman ... deep challenges in Nigeria's labour market, where the nation's rapid economic growth has not ... Key Words: e-commerce, online transaction, broadband stimulus, unemployment.

  11. Pärt: Fratres / Robert Cowan

    Index Scriptorium Estoniae

    Cowan, Robert

    1995-01-01

    Uuest heliplaadist "Pärt: Fratres (seven versions). Festina Lente. Cantus in Memory of Benjamin Britten. Summa. Peter Manning (vn.), France Springuel (vc.), Mireille Gleizes (pf.), I Fiamminghi. Telare CD CD80387 (79 minutes)

  12. Plan and justification for a Proof-of-Concept oil shale facility. Final report

    Energy Technology Data Exchange (ETDEWEB)

    1990-12-01

    The technology being evaluated is the Modified In-Situ (MIS) retorting process for raw shale oil production, combined with a Circulating Fluidized Bed Combustor (CFBC), for the recovery of energy from the mined shale. (VC)

  13. Plan and justification for a Proof-of-Concept oil shale facility

    Energy Technology Data Exchange (ETDEWEB)

    1990-12-01

    The technology being evaluated is the Modified In-Situ (MIS) retorting process for raw shale oil production, combined with a Circulating Fluidized Bed Combustor (CFBC), for the recovery of energy from the mined shale. (VC)

  14. MRI-Based Evaluation of the Vaginal Cuff in Brachytherapy Planning: Are We Missing the Target?

    Energy Technology Data Exchange (ETDEWEB)

    Chapman, Christina Hunter; Prisciandaro, Joann I. [Department of Radiation Oncology, University of Michigan, Ann Arbor, Michigan (United States); Maturen, Katherine E. [Department of Radiology, University of Michigan, Ann Arbor, Michigan (United States); Cao, Yue [Department of Radiation Oncology, University of Michigan, Ann Arbor, Michigan (United States); Department of Radiology, University of Michigan, Ann Arbor, Michigan (United States); Department of Biomedical Engineering, University of Michigan, Ann Arbor, Michigan (United States); Balter, James M. [Department of Radiation Oncology, University of Michigan, Ann Arbor, Michigan (United States); Department of Biomedical Engineering, University of Michigan, Ann Arbor, Michigan (United States); McLean, Karen [Division of Gynecologic Oncology, Department of Obstetrics and Gynecology, University of Michigan, Ann Arbor, Michigan (United States); Jolly, Shruti, E-mail: shrutij@med.umich.edu [Department of Radiation Oncology, University of Michigan, Ann Arbor, Michigan (United States)

    2016-06-01

    Purpose: Although recurrences and toxicity occur after vaginal cuff (VC) brachytherapy, little is known about dosimetry due to the inability to clearly visualize the VC on computed tomography (CT). T2-weighted (T2W) magnetic resonance imaging (MRI) is superior to CT in this setting, and we hypothesized that it could provide previously unascertainable dosimetric information. Methods and Materials: In a cohort of 32 patients who underwent cylinder-based brachytherapy for endometrial cancer with available MR simulation images, the VC was retrospectively contoured on T2W images, and cases were replanned to treat the upper VC to a dose of 7 Gy/fraction prescribed to 5 mm. Relevant dose-volume parameters for the VC were calculated. Results: T2W MRI identified significant underdosing not observed on CT or T1-weighted imaging. Over two-thirds (69%) of patients had at least 1 cm{sup 3} of VC that received less than 75% of the prescription dose and half (50%) of patients had a least 1 cm{sup 3} of VC that received less than 50% of the prescription dose. The mean minimum point dose to the VC was 2.4 Gy, or 34% of the intended prescription dose (range: 0.53-6.4 Gy). Conclusions: We identified previously unreported VC underdosing in over two-thirds of our patients, with most of these patients having volumes of undistended VC that received less than half of the prescription dose. The maximum dimension was along the craniocaudal axis in some patients or left-right/anterior-posterior axis in others, suggesting that suture material may be restricting access to the vaginal apex and that alternative applicators may be needed when the diameter of the apex is larger than the introitus. Additional follow-up will be needed to determine whether underdosing is associated with isolated VC failure or whether low failure rates across the cohort suggest that some patients are being exposed to excessive dose and unnecessary risk of toxicity.

  15. A randomized comparison of a novel nitinol-frame low-dose-copper intrauterine contraceptive and a copper T380S intrauterine contraceptive.

    Science.gov (United States)

    Reeves, Matthew F; Katz, Bob H; Canela, Juan M; Hathaway, Mark J; Tal, Michael G

    2017-06-01

    We sought to compare VeraCept (VC175), a novel nitinol intrauterine contraceptive (IUC) with 175 square-mm of copper surface area, to a copper T380S IUC. We enrolled parous women into a randomized subject-blinded comparison of VC175 and a copper T380S in a 2:1 fashion at a single clinic. The primary outcomes were total adverse events and continuation at 12 months. We also examined pain on insertion, ease of placement, expulsion, tolerability and pregnancy. Subjective ratings were on a 5-point Likert scale (0, no pain to 5, worst pain). We followed subjects through 24-month follow-up. We enrolled 300 women with 199 randomized to VC175 and 101 to the T380S. Insertion was successful in 198 subjects for VC175 and 100 for the T380S. Mean age was 25 years (range 18, 41), and median parity was 2 (range 1, 8), with 39% having only had Cesarean deliveries. No subjects developed clinical infection or reported serious adverse events. In the VC175 and T380S groups, mean pain at insertion was 1.4 and 2.4, respectively (p<.01). At the 12-month primary endpoint for VC175 and T380S, respectively, continuation was 84% and 68% (p<.002) with expulsions in 5.0% and 12.0% (p<.05) and removal for pain/bleeding in 3.5% and 17.0% (p<.01). At the 24-month visit for VC175 and T380S, respectively, continuation was 77% and 62% (p<.02 by log-rank). One ectopic pregnancy was identified at the 12-month follow-up in a VC175 user. No other pregnancies were diagnosed. With 297.3 and 132.4 woman-years, pregnancy rates were 0.3 and 0.0 per 100 woman-years for VC175 and T380S, respectively. VC175 resulted in less pain at insertion, fewer expulsions and higher total continuation than the T380S, with similar contraceptive efficacy. VC175 is a promising new intrauterine copper contraceptive on a nitinol frame that warrants further clinical trials. Copyright © 2017 Elsevier Inc. All rights reserved.

  16. Automatic extraction of the cingulum bundle in diffusion tensor tract-specific analysis. Feasibility study in Parkinson's disease with and without dementia

    International Nuclear Information System (INIS)

    Ito, Kenji; Masutani, Yoshitaka; Suzuki, Yuichi; Ino, Kenji; Kunimatsu, Akira; Ohtomo, Kuni; Kamagata, Koji; Yasmin, Hasina; Aoki, Shigeki

    2013-01-01

    Tract-specific analysis (TSA) measures diffusion parameters along a specific fiber that has been extracted by fiber tracking using manual regions of interest (ROIs), but TSA is limited by its requirement for manual operation, poor reproducibility, and high time consumption. We aimed to develop a fully automated extraction method for the cingulum bundle (CB) and to apply the method to TSA in neurobehavioral disorders such as Parkinson's disease (PD). We introduce the voxel classification (VC) and auto diffusion tensor fiber-tracking (AFT) methods of extraction. The VC method directly extracts the CB, skipping the fiber-tracking step, whereas the AFT method uses fiber tracking from automatically selected ROIs. We compared the results of VC and AFT to those obtained by manual diffusion tensor fiber tracking (MFT) performed by 3 operators. We quantified the Jaccard similarity index among the 3 methods in data from 20 subjects (10 normal controls [NC] and 10 patients with Parkinson's disease dementia [PDD]). We used all 3 extraction methods (VC, AFT, and MFT) to calculate the fractional anisotropy (FA) values of the anterior and posterior CB for 15 NC subjects, 15 with PD, and 15 with PDD. The Jaccard index between results of AFT and MFT, 0.72, was similar to the inter-operator Jaccard index of MFT. However, the Jaccard indices between VC and MFT and between VC and AFT were lower. Consequently, the VC method classified among 3 different groups (NC, PD, and PDD), whereas the others classified only 2 different groups (NC, PD or PDD). For TSA in Parkinson's disease, the VC method can be more useful than the AFT and MFT methods for extracting the CB. In addition, the results of patient data analysis suggest that a reduction of FA in the posterior CB may represent a useful biological index for monitoring PD and PDD. (author)

  17. Transcriptomic changes reveal gene networks responding to the overexpression of a blueberry DWARF AND DELAYED FLOWERING 1 gene in transgenic blueberry plants.

    Science.gov (United States)

    Song, Guo-Qing; Gao, Xuan

    2017-06-19

    Constitutive expression of the CBF/DREB1 for increasing freezing tolerance in woody plants is often associated with other phenotypic changes including dwarf plant and delayed flowering. These phenotypic changes have been observed when Arabidopsis DWARF AND DELAYED FLOWERING 1 (DDF1) was overexpressed in A. thaliana plants. To date, the DDF1 orthologues have not been studied in woody plants. The aim of this study is to investigate transcriptomic responses to the overexpression of blueberry (Vaccinium corymbosum) DDF1 (herein, VcDDF1-OX). The VcDDF1-OX resulted in enhanced freezing tolerance in tetraploid blueberry plants and did not result in significant changes in plant size, chilling requirement, and flowering time. Comparative transcriptome analysis of transgenic 'Legacy-VcDDF1-OX' plants containing an overexpressed VcDDF1 with non-transgenic highbush blueberry 'Legacy' plants revealed the VcDDF1-OX derived differentially expressed (DE) genes and transcripts in the pathways of cold-response, plant flowering, DELLA proteins, and plant phytohormones. The increase in freezing tolerance was associated to the expression of cold-regulated genes (CORs) and the ethylene pathway genes. The unchanged plant size, dormancy and flowering were due to the minimal effect of the VcDDF1-OX on the expression of DELLA proteins, flowering pathway genes, and the other phytohormone genes related to plant growth and development. The DE genes in auxin and cytokinin pathways suggest that the VcDDF1-OX has also altered plant tolerance to drought and high salinity. A DDF1 orthologue in blueberry functioned differently from the DDF1 reported in Arabidopsis. The overexpression of VcDDF1 or its orthologues is a new approach to increase freezing tolerance of deciduous woody plant species with no obvious effect on plant size and plant flowering time.

  18. Multi-soliton solutions to the modified nonlinear Schrödinger equation with variable coefficients in inhomogeneous fibers

    International Nuclear Information System (INIS)

    Dai, Chao-Qing; Qin, Zhen-Yun; Zheng, Chun-Long

    2012-01-01

    Multi-soliton solutions to the modified nonlinear Schrödinger equation (MNLSE) with variable coefficients (VCs) in inhomogeneous fibers are obtained with the help of mapping transformation, which reduces the VC MNLSE into a constant-coefficient MNLSE. Based on the analytical solutions, one- and two-soliton transmissions in the proper dispersion management systems are discussed. The sustainment of solitons and the disappearance of breathers for the VC MNLSE are first reported here. (paper)

  19. Key factors determining success of primary eye care through vision centres in rural India: Patients′ perspectives

    Directory of Open Access Journals (Sweden)

    Vilas Kovai

    2012-01-01

    Full Text Available Aim : This paper intends to discuss the patients′ perspective on the determinants of primary eye care services from vision centers (VC in rural India. Materials and Methods : A retrospective study design and interview method was used on 127 randomly selected patients who accessed the 4 VCs in 2007. Factor analyses and linear regression models were used to predict the associations with patient satisfaction. Results : The three factors derived from factor analyses were: (1-vision technician (VT, (2-location of VC, and (3-access to VC; explaining 60% of the variance in total patients′ satisfaction with VC. The first model (R2 : 0.61; F 1,124=144.36, P <0.001, indicated that respondents who had ′difficulty to travel to the place of VC′ and those who can afford to pay had less satisfaction with VT services. The second model (R2 =0.18; F 1,124=29.5, P <0.001 explained that respondents′ difficulty to identify the building of VC had decreased patients′ satisfaction and the third model (R2 =0.36; F 1,124=45.6, P <0.001 indicated that those who had to travel<5 km to the VC and had 0.38 units of increased satisfaction level with the services of VC. Conclusion : A good VT can enhance patient satisfaction. However, patient expectations are not only confined to the provider but also other factors such as ability to pay and convenient transportation that helps patients reach the location of the VC with ease.

  20. The influence of large-scale climatic patterns on precipitation, temperature, and discharge in Czech river basins

    Czech Academy of Sciences Publication Activity Database

    Šípek, Václav

    2013-01-01

    Roč. 61, č. 4 (2013), s. 278-285 ISSN 0042-790X R&D Projects: GA AV ČR IAA300600901 Institutional support: RVO:67985874 Keywords : macro-scale climatic patterns * cidlina river * Blanice river * hydrometeorology Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.231, year: 2013 http://147.213.145.2/vc/vc1.asp

  1. Project CHECO Southeast Asia Report. Operation Attleboro

    Science.gov (United States)

    1967-04-14

    By the early morning of the 5th, the 273rd VC Regiment was once again 3 18-.... I A~POALI ~~llajor Enemy Contacts 0 S& , Ir iT~~~g I~c Srok Ca6 s6o...321 machetes, 1 VC flag, 1 chemical agent treatment kit, 1 -ton trail- er, 4 gas masks, 1 farm tractor, 1 pig, 1 set scales, 1 pr binoculars, 2

  2. Pre-diabetes augments neuropeptide Y1- and α1-receptor control of basal hindlimb vascular tone in young ZDF rats.

    Directory of Open Access Journals (Sweden)

    Nicole M Novielli

    Full Text Available Peripheral vascular disease in pre-diabetes may involve altered sympathetically-mediated vascular control. Thus, we investigated if pre-diabetes modifies baseline sympathetic Y(1-receptor (Y(1R and α(1-receptor (α(1R control of hindlimb blood flow (Q(fem and vascular conductance (VC.Q(fem and VC were measured in pre-diabetic ZDF rats (PD and lean controls (CTRL under infusion of BIBP3226 (Y(1R antagonist, prazosin (α(1R antagonist and BIBP3226+prazosin. Neuropeptide Y (NPY concentration and Y(1R and α(1R expression were determined from hindlimb skeletal muscle samples.Baseline Q(fem and VC were similar between groups. Independent infusions of BIBP3226 and prazosin led to increases in Q(fem and VC in CTRL and PD, where responses were greater in PD (p<0.05. The percent change in VC following both drugs was also greater in PD compared to CTRL (p<0.05. As well, Q(fem and VC responses to combined blockade (BIBP3226+prazosin were greater in PD compared to CTRL (p<0.05. Interestingly, an absence of synergistic effects was observed within groups, as the sum of the VC responses to independent drug infusions was similar to responses following combined blockade. Finally, white and red vastus skeletal muscle NPY concentration, Y(1R expression and α(1R expression were greater in PD compared to CTRL.For the first time, we report heightened baseline Y(1R and α(1R sympathetic control of Q(fem and VC in pre-diabetic ZDF rats. In support, our data suggest that augmented sympathetic ligand and receptor expression in pre-diabetes may contribute to vascular dysregulation.

  3. The clinical significance of 5% change in vital capacity in patients with idiopathic pulmonary fibrosis: extended analysis of the pirfenidone trial

    Directory of Open Access Journals (Sweden)

    Nakata Koichiro

    2011-07-01

    Full Text Available Abstract Background Our phase III clinical trial of pirfenidone for patients with idiopathic pulmonary fibrosis (IPF revealed the efficacy in reducing the decline of vital capacity (VC and increasing the progression-free survival (PFS time by pirfenidone. Recently, marginal decline in forced VC (FVC has been reported to be associated with poor outcome in IPF. We sought to evaluate the efficacy of pirfenidone from the aspects of 5% change in VC. Methods Improvement ratings based on 5% change in absolute VC, i.e., "improved (VC ≥ 5% increase", "stable (VC Results In the comparison of the improvement ratings, the statistically significant differences were clearly revealed at months 3, 6, 9, and 12 between pirfenidone and placebo groups. Risk reductions by pirfenidone to placebo were approximately 35% over the study period. In the comparison of the PFS times, statistically significant difference was also observed between pirfenidone and placebo groups. The positive/negative predictive values in placebo and pirfenidone groups were 86.1%/50.8% and 87.1%/71.7%, respectively. Further, the baseline characteristics of patients worsened at month 3 had generally severe impairment, and their clinical outcomes including mortality were also significantly worsened after 1 year. Conclusions The efficacy of pirfenidone in Japanese phase III trial was supported by the rating of 5% decline in VC, and the VC changes at month 3 may be used as a prognostic factor of IPF. Trial Registration This clinical trial was registered with the Japan Pharmaceutical Information Center (JAPIC on September 13th, 2005 (Registration Number: JAPICCTI-050121.

  4. Marginal bone-level alterations of loaded zirconia and titanium dental implants: an experimental study in the dog mandible.

    Science.gov (United States)

    Thoma, Daniel S; Benic, Goran I; Muñoz, Fernando; Kohal, Ralf; Sanz Martin, Ignacio; Cantalapiedra, Antonio G; Hämmerle, Christoph H F; Jung, Ronald E

    2016-04-01

    The aim was to test whether or not the marginal bone-level alterations of loaded zirconia implants are similar to the bone-level alterations of a grade 4 titanium one-piece dental implant. In six dogs, all premolars and the first molars were extracted in the mandible. Four months later, three zirconia implants (BPI, VC, ZD) and a control titanium one-piece (STM) implant were randomly placed in each hemimandible and left for transmucosal healing (baseline). Six months later, CAD/CAM crowns were cemented. Sacrifice was scheduled at 6-month postloading. Digital X-rays were taken at implant placement, crowns insertion, and sacrifice. Marginal bone-level alterations were calculated, and intra- and intergroup comparisons performed adjusted by confounding factors. Implants were successfully placed. Until crown insertion, two implants were fractured (one VC, one ZD). At sacrifice, 5 more implants were (partly) fractured (one BPI, four ZD), and one lost osseointegration (VC). No decementation of crowns occurred. All implant systems demonstrated a statistically significant (except VC) loss of marginal bone between baseline and crown insertion ranging from 0.29 mm (VC; P = 0.116) to 0.80 mm (ZD; P = 0.013). The estimated marginal bone loss between baseline and 6 months of loading ranged between 0.19 mm (BPI) and 1.11 mm (VC), being statistically significant for STM and VC only (P implants and control implants (STM vs. BPI P = 0.007; vs. VC P = 0.001; vs. ZD P = 0.011). Zirconia implants were more prone to fracture prior to and after loading with implant-supported crowns compared to titanium implants. Individual differences and variability in the extent of the bone-level changes during the 12-month study period were found between the different implant types and materials. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  5. TR-ESR Investigation on Reaction of Vitamin C with Excited Triplet of 9,10-phenanthrenequinone in Reversed Micelle Solutions

    Science.gov (United States)

    Xu, Xin-sheng; Shi, Lei; Liu, Yi; Ji, Xue-han; Cui, Zhi-feng

    2011-04-01

    Time-resolved electron spin resonance has been used to study quenching reactions between the antioxidant Vitamin C (VC) and the triplet excited states of 9,10-phenanthrenequinone (PAQ) in ethylene glycol-water (EG-H2O) homogeneous and inhomogeneous reversed micelle solutions. Reversed micelle solutions were used to be the models of physiological environment of biological cell and tissue. In PAQ/EG-H2O homogeneous solution, the excited triplet of PAQ (3PAQ*) abstracts hydrogen atom from solvent EG. In PAQ/VC/EG-H2O solution, 3PAQ* abstracts hydrogen atom not only from solvent EG but also from VC. The quenching rate constant of 3PAQ* by VC is close to the diffusion-controlled value of 1.41 × 108 L/(mol ·s). In hexadecyltrimethylammonium bromide (CTAB)/EG-H2O and aerosol OT (AOT)/EG-H2O reversed micelle solutions, 3PAQ* and VC react around the water-oil interface of the reversed micelle. Exit of 3PAQ* from the lipid phase slows down the quenching reaction. For Triton X-100 (TX-100)/EG-H2O reversed micelle solution, PAQ and VC coexist inside the hydrophilic polyethylene glycol core, and the quenching rate constant of 3PAQ* by VC is larger than those in AOT/EG-H2O and CTAB/EG-H2O reversed micelle solutions, even a little larger than that in EG-H2O homogeneous solution. The strong emissive chemically induced dynamic electron polarization of As.- resulted from the effective TM spin polarization transfer in hydrogen abstraction of 3PAQ* from VC.

  6. Massachusetts Institute of Technology Lincoln Laboratory Facilities Replacement on Hanscom Air Force Base Phase 1 Final Environmental Assessment

    Science.gov (United States)

    2014-07-24

    Service UST Underground Storage Tank VC Vitrified Clay VOCs Volatile Organic Compounds W Watts 1 1.0 PURPOSE AND NEED FOR ACTION 1.1 INTRODUCTION The...discharged to sanitary drain and the solids slurry is hauled off site for disposal Fluoride drain: welded stainless steel drain piping from wet...diameter vitrified clay (VC) gravity sewer collection pipe, flowing north/northeast to the upper pumping station at Building 1306, is located within the

  7. A venture capital view of challenges, opportunities, and innovation in biomedical research.

    Science.gov (United States)

    Ratcliffe, L T

    2011-02-01

    Small biotech companies have been an important source of innovation, pipelines, and new products for the pharmaceutical industry, and are primarily financed by venture capital (VC). The significant changes happening within the VC industry have broad implications for these small companies. This includes a shift to financing later-stage programs with increasing interest in orphan or specialty indications. Nontraditional sources of capital and innovative risk-sharing structures can enable early-stage companies.

  8. Private equity and venture capital: investment fund structures in the Czech Republic

    Directory of Open Access Journals (Sweden)

    Marek Zinecker

    2011-01-01

    Full Text Available A working private equity and venture capital market (PE/VC market stimulates the business environment in a positive manner and impacts the level of economic growth of national economies. A study of the Austrian Private Equity and Venture Capital Organisation/AVCO (2004, p. 6 defines prerequisites for a correct operation of the PE/VC market. It views the legislative provision for suitable legal fund structures for PE/VC investments and their tax treatment as a key factor. In its publication, Private Equity & Venture Capital in the Czech Republic (2010, p. 14, the Czech Venture Capital Association/CVCA stresses that legal barriers are an important reason behind the limited scope of resources available to domestic PE/VC funds. Legal barriers prevent the establishment of a standard PE/VC fund in the territory of the Czech Republic, which fact in turn has a negative impact on the level of development of the domestic PE/VC market (fundraising, investment volumes, establishment of the infrastructure required for the operation of PE/VC funds. The purpose of this article is, based on an analysis of the relevant information sources, to assess how the current Czech legislation regulates the legal fund structures for PE/VC investments and their tax treatment. Proposals for a potential improvement of the situation are based on a comparison of the legislative framework applicable in the Czech Republic and the requirements defined by the European Venture Capital Association/EVCA, as well as the AVCO study (2004, 2006.

  9. Calcium Overload Accelerates Phosphate-Induced Vascular Calcification Via Pit-1, but not the Calcium-Sensing Receptor.

    Science.gov (United States)

    Masumoto, Asuka; Sonou, Tomohiro; Ohya, Masaki; Yashiro, Mitsuru; Nakashima, Yuri; Okuda, Kouji; Iwashita, Yuko; Mima, Toru; Negi, Shigeo; Shigematsu, Takashi

    2017-07-01

    Vascular calcification (VC) is a risk factor of cardiovascular and all-cause mortality in patients with chronic kidney disease (CKD). CKD-mineral and bone metabolism disorder is an important problem in patients with renal failure. Abnormal levels of serum phosphate and calcium affect CKD-mineral and bone metabolism disorder and contribute to bone disease, VC, and cardiovascular disease. Hypercalcemia is a contributing factor in progression of VC in patients with CKD. However, the mechanisms of how calcium promotes intracellular calcification are still unclear. This study aimed to examine the mechanisms underlying calcium-induced calcification in a rat aortic tissue culture model. Aortic segments from 7-week-old male Sprague-Dawley rats were cultured in serum-supplemented medium for 10 days. We added high calcium (HiCa; calcium 3.0 mM) to high phosphate (HPi; phosphate 3.8 mM) medium to accelerate phosphate and calcium-induced VC. We used phosphonoformic acid and the calcimimetic R-568 to determine whether the mechanism of calcification involves Pit-1 or the calcium-sensing receptor. Medial VC was significantly augmented by HPi+HiCa medium compared with HPi alone (300%, p<0.05), and was associated with upregulation of Pit-1 protein. Pit-1 protein concentrations in HPi+HiCa medium were greater than those in HPi medium. Phosphonoformic acid completely negated the augmentation of medial VC induced by HPi+HiCa. R-568 had no additive direct effect on medial VC. These results indicated that exposure to HPi+HiCa accelerates medial VC, and this is mediated through Pit-1, not the calcium-sensing receptor.

  10. Formation of vanadium carbide precipitations at the surface of alloys: Thermodynamics and kinetics aspects; Bildung von Vanadiumcarbid-Ausscheidungen auf Legierungsoberflaechen: Thermodynamische und kinetische Aspekte

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, A.; Uebing, C. [Max-Planck-Institut fuer Eisenforschung GmbH, Duesseldorf (Germany)

    1998-12-31

    The paper describes the formation of vanadium carbides on the surface layers of Fe-3%V-C(100) alloys. The phase diagram calculated for this alloyed material using the ThermoCalc program package reveals a co-existence of ferritic matrix and V{sub 3}C{sub 2} at temperatures of T{<=}650 C. This carbide is instable at elevated temperatures, leading to co-existence of ferrite and the cubic VC{sub 1-x}. Experimental analyses revealed the formation of a 2D VC compound in the top layers of the surface of Fe-3%V-C(100) alloys, induced by equilibrium segregation. The paper explains the usefulness of thermodynamic and kinetic calculations for interpretation of precipitation phenomena in steels. Mathematically derived and experimental results of analyses for the case of non-equilibrium segregation showed excellent agreement in the determination of carbide thickness (nanometer scale) and time dependence of segregation under fast cooling conditions. (orig./CB) [Deutsch] In der vorliegenden Arbeit wurde die Bildung von Vanadiumcarbiden auf Fe-3%V-C(100)-Legierungsoberflaechen beschrieben. Das anhand des ThermoCalc-Programmpakets fuer diese Legierungszusammensetzung berechnete Phasendiagramm zeigt bei niedrigen Temperaturen T{<=}650 C die Koexistenz von ferritischer Matrix und V{sub 3}C{sub 2}. Bei hoeheren Temperaturen ist dieses Carbid instabil und es liegt Koexistenz von Ferrit und dem kubischen VC{sub 1-x} vor. Die experimentellen Untersuchungen zeigen die Ausbildung einer zweidimensionalen VC-Oberflaechenverbindung auf Fe-3%V-C(100)-Legierungsoberflaechen durch Gleichgewichtssegregation. Diese Arbeit zeigt, dass thermodynamische und kinetische Rechnungen bei der Deutung von Ausscheidungsphaenomenen in Staehlen sinnvoll eingesetzt werden koennen. Bei der Nichtgleichgewichtssegregation wurde bezueglich Carbiddicke (im Nanometerbereich) und Zeitabhaengigkeit der Ausscheidung bei schneller Abkuehlung eine hervorragende Uebereinstimmung zwischen Simulation und Experiment gefunden

  11. Anticuerpos anti LKM-1 y crioglobulinemia en hepatitis crónica autoinmune y por virus C de la hepatitis

    OpenAIRE

    Jirón V,M. Isabel; Ardiles S,Adriana; Parra B,M Adriana; Orellana V,Juana

    2000-01-01

    Background: Anti liver kidney microsome antibodies (LKM-1) have been recently incorporated to the study and classification of chronic autoimmune hepatitis (HC-A1). The presence of anti LKM-1 antibodies and essential cryoglobulinemia is frequent in virus C associated chronic hepatitis (HC-VC). Aim: To study the frequency of anti LKM-1 antibodies and cryoglobulin levels in patients with HC-AI, HC-VC and cryptogenic cirrhosis. Patients and methods: Forty two patients were studied. Nineteen adult...

  12. Elimination of carbon vacancies in 4H-SiC epi-layers by near-surface ion implantation: Influence of the ion species

    Science.gov (United States)

    Ayedh, H. M.; Hallén, A.; Svensson, B. G.

    2015-11-01

    The carbon vacancy (VC) is a prevailing point defect in high-purity 4H-SiC epitaxial layers, and it plays a decisive role in controlling the charge carrier lifetime. One concept of reducing the VC-concentration is based on carbon self-ion implantation in a near surface layer followed by thermal annealing. This leads to injection of carbon interstitials (Ci's) and annihilation of VC's in the epi-layer "bulk". Here, we show that the excess of C atoms introduced by the self-ion implantation plays a negligible role in the VC annihilation. Actually, employing normalized implantation conditions with respect to displaced C atoms, other heavier ions like Al and Si are found to be more efficient in annihilating VC's. Concentrations of VC below ˜2 × 1011 cm-3 can be reached already after annealing at 1400 °C, as monitored by deep-level transient spectroscopy. This corresponds to a reduction in the VC-concentration by about a factor of 40 relative to the as-grown state of the epi-layers studied. The negligible role of the implanted species itself can be understood from simulation results showing that the concentration of displaced C atoms exceeds the concentration of implanted species by two to three orders of magnitude. The higher efficiency for Al and Si ions is attributed to the generation of collision cascades with a sufficiently high energy density to promote Ci-clustering and reduce dynamic defect annealing. These Ci-related clusters will subsequently dissolve during the post-implant annealing giving rise to enhanced Ci injection. However, at annealing temperatures above 1500 °C, thermodynamic equilibrium conditions start to apply for the VC-concentration, which limit the net effect of the Ci injection, and a competition between the two processes occurs.

  13. Effect of swift heavy ion irradiation on surface resistance of ...

    Indian Academy of Sciences (India)

    ... Larkin–Ovchinnikov scenario [5] where the effective pinning force on the FLL is given by BJc(H)=(np〈 f 2〉/Vc)1/2 where np is the density of pinning centers, f the ele- mentary pinning force parameter and Vc the Larkin volume over which the FLL maintains its spatial order. We have shown in an earlier communication [6] ...

  14. Multifactor analysis and simulation of the surface runoff and soil infiltration at different slope gradients

    Science.gov (United States)

    Huang, J.; Kang, Q.; Yang, J. X.; Jin, P. W.

    2017-08-01

    The surface runoff and soil infiltration exert significant influence on soil erosion. The effects of slope gradient/length (SG/SL), individual rainfall amount/intensity (IRA/IRI), vegetation cover (VC) and antecedent soil moisture (ASM) on the runoff depth (RD) and soil infiltration (INF) were evaluated in a series of natural rainfall experiments in the South of China. RD is found to correlate positively with IRA, IRI, and ASM factors and negatively with SG and VC. RD decreased followed by its increase with SG and ASM, it increased with a further decrease with SL, exhibited a linear growth with IRA and IRI, and exponential drop with VC. Meanwhile, INF exhibits a positive correlation with SL, IRA and IRI and VC, and a negative one with SG and ASM. INF was going up and then down with SG, linearly rising with SL, IRA and IRI, increasing by a logit function with VC, and linearly falling with ASM. The VC level above 60% can effectively lower the surface runoff and significantly enhance soil infiltration. Two RD and INF prediction models, accounting for the above six factors, were constructed using the multiple nonlinear regression method. The verification of those models disclosed a high Nash-Sutcliffe coefficient and low root-mean-square error, demonstrating good predictability of both models.

  15. The Vibrio cholerae Mrp system: cation/proton antiport properties and enhancement of bile salt resistance in a heterologous host.

    Science.gov (United States)

    Dzioba-Winogrodzki, Judith; Winogrodzki, Olga; Krulwich, Terry A; Boin, Markus A; Häse, Claudia C; Dibrov, Pavel

    2009-01-01

    The mrp operon from Vibrio cholerae encoding a putative multisubunit Na(+)/H(+) antiporter was cloned and functionally expressed in the antiporter-deficient strain of Escherichia coli EP432. Cells of EP432 expressing Vc-Mrp exhibited resistance to Na(+) and Li(+) as well as to natural bile salts such as sodium cholate and taurocholate. When assayed in everted membrane vesicles of the E. coli EP432 host, Vc-Mrp had sufficiently high antiport activity to facilitate the first extensive analysis of Mrp system from a Gram-negative bacterium encoded by a group 2 mrp operon. Vc-Mrp was found to exchange protons for Li(+), Na(+), and K(+) ions in pH-dependent manner with maximal activity at pH 9.0-9.5. Exchange was electrogenic (more than one H(+) translocated per cation moved in opposite direction). The apparent K(m) at pH 9.0 was 1.08, 1.30, and 68.5 mM for Li(+), Na(+), and K(+), respectively. Kinetic analyses suggested that Vc-Mrp operates in a binding exchange mode with all cations and protons competing for binding to the antiporter. The robust ion antiport activity of Vc-Mrp in sub-bacterial vesicles and its effect on bile resistance of the heterologous host make Vc-Mrp an attractive experimental model for the further studies of biochemistry and physiology of Mrp systems. Copyright 2008 S. Karger AG, Basel.

  16. Myo-Inositol content determined by myo-inositol biosynthesis and oxidation in blueberry fruit.

    Science.gov (United States)

    Song, Fangyuan; Su, Hongyan; Yang, Nan; Zhu, Luying; Cheng, Jieshan; Wang, Lei; Cheng, Xianhao

    2016-11-01

    Myo-inositol metabolism in plant edible organs has become the focus of many recent studies because of its benefits to human health and unique functions in plant development. In this study, myo-inositol contents were analyzed during the development of two blueberry cultivars, cv 'Berkeley' and cv 'Bluecrop'. Furthermore, two VcMIPS 1/2 (Vaccinium corymbosum MIPS) genes, one VcIMP (Vaccinium corymbosum IMP) gene and one VcMIOX (Vaccinium corymbosum MIOX) gene were isolated for the first time from blueberry. The expression patterns of VcMIPS2, VcIMP and VcMIOX genes showed a relationship with the change profiles of myo-inositol content during fruit ripening. The results were further confirmed by the analyses of the enzyme activity. Results indicated that both myo-inositol biosynthesis and oxidation played important roles in determining of myo-inositol levels during the development of blueberry. To our knowledge, this report is the first to discuss myo-inositol levels in fruits in terms of biosynthesis and catabolism. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Microscopic Aspects of Autoschizic Cell Death in Human Ovarian Carcinoma (2774) Cells Following Vitamin C, Vitamin K3 or Vitamin C:K3 Treatment

    Science.gov (United States)

    Gilloteaux, Jacques; Jamison, James M.; Arnold, David; Taper, Henryk S.; von Gruenigen, Vivian E.; Summers, Jack L.

    2003-08-01

    Human ovarian carcinoma cells (MDAH 2774) were treated with sodium ascorbate (VC), menadione (VK3), or with a VC:VK3 combination for 1 h and then studied using light microscopy (LM) and scanning (SEM) and transmission electron (TEM) microscopy. Plasma membrane damage (blisters and blebs, hairy aspect) results from vitamin C (VC) treatment, while cytoskeletal damage and self-morsellation are caused by vitamin K3 (VK3) treatment. VC:VK3-treated cells exhibit exacerbated injuries characteristic of both VC and VK3 treatment as well as a significant decrease in cell diameters from 20 35 [mu]m for control cells to 7 12 [mu]m for VC:VK3 treatment. Moreover, after a 1-h exposure to the vitamin combination, autoschizis (43%), apoptosis (3%), and oncosis (1.9%) are observed at the percentages indicated. All cellular changes associated with autoschizis observed with SEM were confirmed by LM and TEM observations and are consistent with cell death by autoschizis: decrease in cell size, cytoplasmic self-excisions, degradation of the nucleus and nucleolus without formation of apoptotic bodies and, ultimately, karyorrhexis and karyolysis. These results also suggest that the vitamin combination may find clinical use in the treatment of ovarian cancer.

  18. The vitamin C:vitamin K3 system - enhancers and inhibitors of the anticancer effect.

    Science.gov (United States)

    Lamson, Davis W; Gu, Yu-Huan; Plaza, Steven M; Brignall, Matthew S; Brinton, Cathy A; Sadlon, Angela E

    2010-12-01

    The oxidizing anticancer system of vitamin C and vitamin K₃ (VC:VK₃, producing hydrogen peroxide via superoxide) was combined individually with melatonin, curcumin, quercetin, or cholecalciferol (VD₃) to determine interactions. Substrates were LNCaP and PC-3 prostate cancer cell lines. Three of the tested antioxidants displayed differences in cell line cytotoxicity. Melatonin combined with VC:VK₃ quenched the oxidizing effect, while VC:VK₃ applied 24 hours after melatonin showed no quenching. With increasing curcumin concentrations, an apparent combined effect of VC:VK₃ and curcumin occurred in LNCaP cells, but not PC-3 cells. Quercetin alone was cytotoxic on both cell lines, but demonstrated an additional 50-percent cytotoxicity on PC-3 cells when combined with VC:VK₃. VD₃ was effective against both cell lines, with more effect on PC-3. This effect was negated on LNCaP cells with the addition of VC:VK₃. In conclusion, a natural antioxidant can enhance or decrease the cytotoxicity of an oxidizing anticancer system in vitro, but generalizations about antioxidants cannot be made.

  19. Vorticity confinement technique for drag prediction

    Science.gov (United States)

    Povitsky, Alex; Snyder, Troy

    2011-11-01

    This work couples wake-integral drag prediction and vorticity confinement technique (VC) for the improved prediction of drag from CFD simulations. Induced drag computations of a thin wing are shown to be more accurate than the more widespread method of surface pressure integration when compared to theoretical lifting-line value. Furthermore, the VC method improves trailing vortex preservation and counteracts the shift from induced drag to numerical entropy drag with increasing distance of Trefftz plane downstream of the wing. Accurate induced drag prediction via the surface integration of pressure barring a sufficiently refined surface grid and increased computation time. Furthermore, the alternative wake-integral technique for drag prediction suffers from numerical dissipation. VC is shown to control the numerical dissipation with very modest computational overhead. The 2-D research code is used to test specific formulations of the VC body force terms and illustrate the computational efficiency of the method compared to a ``brute force'' reduction in spatial step size. For the 3-D wing simulation, ANSYS FLUENT is employed with the VC body force terms added to the solver with user-defined functions (UDFs). VC is successfully implemented to highly unsteady flows typical for Micro Air Vehicles (MAV) producing oscillative drag force either by natural vortex shedding at high angles of attack or by flapping wing motion.

  20. Quantification of vicine and convicine in faba bean seeds using hydrophilic interaction liquid chromatography.

    Science.gov (United States)

    Purves, Randy W; Khazaei, Hamid; Vandenberg, Albert

    2018-02-01

    Faba bean (Vicia faba L.) provides environmental and health benefits; however, the presence of the pyrimidine glycosides vicine and convicine (v-c) in its seeds limits consumption. Low v-c genotypes have been introduced, but the convicine levels in these genotypes have not been quantified. To improve detection, the polar nature of v-c was exploited by implementing hydrophilic interaction liquid chromatography (HILIC). A sample preparation method using a two-step extraction was developed for use with UV and/or tandem mass spectrometry (SRM) detection. The HILIC-UV method was suitable for over three orders of magnitude, covering the range of v-c concentrations in faba bean seeds across all genotypes tested. The linear range of HILIC-SRM was slightly less (∼3 orders of magnitude), but improved sensitivity and selectivity make it more suitable for quantifying low v-c samples. The analysis of 13 genotypes suggests that v-c concentrations in faba bean seeds may be independent quantitative traits. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Effects of temperature sum on vitamin C concentration and yield of sea buckthorn (Hippophae rhamnoides fruit: optimal time of fruit harvest

    Directory of Open Access Journals (Sweden)

    Yingmou Yao

    1993-12-01

    Full Text Available To investigate the effects of temperature sum on vitamin C concentration (Vc, yield and maturity of sea buckthorn fruit (Hippophae rhamnoides L. and to predict the optimal harvest time, berries were collected from eight genotypes at an interval of about one week from August 16 to December 2. Maturity was visually observed, berry weight measured and Vc determined. Berries matured at 1165-1316 degree-days (d.d.. Vc reached maximum at about 1229 d.d., while fruit size and yield reached maximum at 1380 d.d.. Mathematical models of polynomial equations were highly significant for predicting the effects of temperature sum on Vc, maturity and fruit yield. Optimal harvest time for maximizing Vc, yield or economic income could be determined according to differential equations. Great variations in Vc, fruit maturity and fruit size suggested good opportunities for selection and breeding. Low rank correlations in vitamin C concentration during fruit maturity, however, call for special attention in selection and breeding.

  2. [Lung dysfunction in patients with mild chronic obstructive bronchitis].

    Science.gov (United States)

    Nefedov, V B; Popova, L A; Shergina, E A

    2004-01-01

    VC, FVC, FEV1, FEV1/VC%, PEF, MEF25, MEF50, MEF75, TCL, TGV, RV, Ravt, Riin, Rex, DLCO-SS, PaO2, and PaO2 were determined in 33 patients with mild chronic obstructive lung disease (FEV1 > 70% of the normal value). All the patients were found to have impaired bronchial patency; most (63.6%) patients had lung volume and capacity changes, almost half (45.5%) the patients had pulmonary gas exchange dysfunction. Impaired bronchial patency mainly appeared as decreased MEF50, MEF15, and FEV1/VC%; altered lung volumes and capacities manifested chiefly by increased RV and decreased VC; pulmonary gas exchange dysfunction showed up primarily as lowered PaO2. The magnitude of the observed functional changes was generally slight. MEF50, MEF75, FEV1/VC%, and VC dropped to 59-20 and 79-70% of the normal value, respectively. RV increased up to 142-196% of the normal value; PaO2 reduced up to 79-60% mm Hg.

  3. Immunohistochemical expression of basement membrane proteins of verrucous carcinoma of the oral mucosa.

    Science.gov (United States)

    Arduino, Paolo G; Carrozzo, Marco; Pagano, Marco; Broccoletti, Roberto; Scully, Crispian; Gandolfo, Sergio

    2010-06-01

    Squamous cell carcinoma (SCC) of the oral cavity is an extremely invasive tumour of stratified squamous epithelium that spreads throughout degradation of the basement membrane (BM) and extra-cellular matrix. Oral verrucous carcinoma (VC) is a rare low-grade variant of oral SCC that penetrates into the subepithelial connective tissue. It also has a different clinical behaviour from classical oral SCC. We investigated the immunohistochemical expression of laminin, laminin-5, collagen IV and fibronectin in VC, severe epithelial dysplasia (SED) and SCC in order to analyse if the pattern of these molecules expression contributes to the differences in the biological behaviour of these diseases. The staining pattern of laminin was less intensive in SCC compared with SED and VC, and collagen IV expression was increased in VC compared with SED. Discontinuities of laminin, collagen IV and fibronectin were more evident in SED than in VC. This study indicates that VC has a biological behaviour different from SED or SCC, observable by immunohistochemistry in the BM zone.

  4. Predictive models and spatial variations of vital capacity in healthy people from 6 to 84 years old in China based on geographical factors.

    Science.gov (United States)

    He, Jinwei; Ge, Miao; Wang, Congxia; Jiang, Naigui; Zhang, Mingxin; Yun, Pujun

    2014-07-01

    The aim of this study was to provide a scientific basic for a unified standard of the reference value of vital capacity (VC) of healthy subjects from 6 and 84 years old in China. The normal reference value of VC was correlated to seven geographical factors, including altitude (X1), annual duration of sunshine (X2), annual mean air temperature (X3), annual mean relative humidity (X4), annual precipitation amount (X5), annual air temperature range (X6) and annual mean wind speed (X7). Predictive models were established by five different linear and nonlinear methods. The best models were selected by t-test. The geographical distribution map of VC in different age groups can be interpolated by Kriging's method using ArcGIS software. It was found that the correlation of VC and geographical factors in China was quite significant, especially for both males and females aged from 6 to 45. The best models were built for different age groups. The geographical distribution map shows the spatial variations of VC in China precisely. The VC of healthy subjects can be simulated by the best model or acquired from the geographical distribution map provided the geographical factors for that city or county of China are known.

  5. The Value Chain Approach in One Health: Conceptual Framing and Focus on Present Applications and Challenges.

    Science.gov (United States)

    Antoine-Moussiaux, Nicolas; Peyre, Marisa; Bonnet, Pascal; Bebay, Charles; Bengoumi, Mohammed; Tripodi, Astrid

    2017-01-01

    The value chain (VC) is a major operational concept for socioeconomic analysis at meso level. Widely mobilized in development practice, it is still undergoing conceptual and practical refining, e.g., to take account of environmental and social sustainability. Briefly, VC refers to a system of value creation through the full set of actors, links, technical and commercial activities and flows involved in the provision of a good or service on a market. In the past decade, this concept has been promoted in the management of animal health. In particular, the emergence of highly pathogenic avian influenza (HPAI) has triggered an interdisciplinary dynamic including VC analysis as a central tool. These efforts promoted participatory investigation methods in the analysis of health systems. Using qualitative and quantitative data, these methods acknowledge the usefulness of actors' involvement and knowledge, hence facilitating the transdisciplinarity needed for effective action. They fit into adaptive and action-oriented strategies, fostering stakeholders' participation. Recent research on HPAI surveillance in South-East Asia merged VC and participatory approaches to develop innovative tools for analyzing constraints to information flow. On-going interventions for HPAI prevention and control as well as the prevention of other emerging zoonotic risks in Africa are presently building on this VC framework to develop strategies for its application at national and regional scales. Based on the latter experiences, this article proposes a field-based perspective on VC applications to animal and public health systems, within a One Health approach responding to the overall challenge of complexity.

  6. Listening to Schneiderian Voices: A Novel Phenomenological Analysis.

    Science.gov (United States)

    Rosen, Cherise; Chase, Kayla A; Jones, Nev; Grossman, Linda S; Gin, Hannah; Sharma, Rajiv P

    This paper reports on analyses designed to elucidate phenomenological characteristics, content and experience specifically targeting participants with Schneiderian voices conversing/commenting (VC) while exploring differences in clinical presentation and quality of life compared to those with voices not conversing (VNC). This mixed-method investigation of Schneiderian voices included standardized clinical metrics and exploratory phenomenological interviews designed to elicit in-depth information about the characteristics, content, meaning, and personification of auditory verbal hallucinations. The subjective experience shows a striking pattern of VC, as they are experienced as internal at initial onset and during the longer-term course of illness when compared to VNC. Participants in the VC group were more likely to attribute the origin of their voices to an external source such as God, telepathic communication, or mediumistic sources. VC and VNC were described as characterological entities that were distinct from self (I/we vs. you). We also found an association between VC and the positive, cognitive, and depression symptom profile. However, we did not find a significant group difference in overall quality of life. The clinical portrait of VC is complex, multisensory, and distinct, and suggests a need for further research into the biopsychosocial interface between subjective experience, socioenvironmental constraints, individual psychology, and the biological architecture of intersecting symptoms. © 2016 S. Karger AG, Basel.

  7. Effects of Soil Quality Enhancement on Pollinator-Plant Interactions

    Directory of Open Access Journals (Sweden)

    Yasmin J. Cardoza

    2012-01-01

    Full Text Available Both biotic and abiotic factors can affect soil quality, which can significantly impact plant growth, productivity, and resistance to pests. However, the effects of soil quality on the interactions of plants with beneficial arthropods, such as pollinators, have not been extensively examined. We studied the effects of vermicompost (earthworm compost, VC soil amendment on behavioral and physiological responses of pollinators to flowers and floral resources, using cucumbers, Cucumis sativus, as our model system. Results from experiments conducted over three field seasons demonstrated that, in at least two out of three years, VC amendment significantly increased visit length, while reducing the time to first discovery. Bumblebee (Bombus impatiens workers that fed on flowers from VC-amended plants had significantly larger and more active ovaries, a measure of nutritional quality. Pollen fractions of flowers from VC-grown plants had higher protein compared to those of plants grown in chemically fertilized potting soil. Nectar sugar content also tended to be higher in flowers from VC-grown plants, but differences were not statistically significant. In conclusion, soil quality enhancement, as achieved with VC amendment in this study, can significantly affect plant-pollinator interactions and directly influences pollinator nutrition and overall performance.

  8. Strategies for Increasing the Market Share of Recycled Products—A Games Theory Approach

    Science.gov (United States)

    Batzias, Dimitris F.; Pollalis, Yannis A.

    2009-08-01

    A methodological framework (including 28 activity stages and 10 decision nodes) has been designed under the form of an algorithmic procedure for the development of strategies for increasing the market share of recycled products within a games theory context. A case example is presented referring to a paper market, where a recycling company (RC) is in competition with a virgin-raw-material-using company (VC). The strategies of the VC, for increasing its market share, are the strengthening of (and advertisement based on) the high quality (VC1), the high reliability (VC2), the combination quality and reliability, putting emphasis on the first component (VC3), the combination quality and reliability, putting emphasis on the second component (VC4). The strategies of the RC, for increasing its market share, are proper advertisement based on the low price of produced recycled paper satisfying minimum quality requirements (RC1), the combination of low price with sensitization of the public as regards environmental and materials-saving issues, putting emphasis on the first component (RC2), the same combination, putting emphasis on the second component (RC3). Analysis of all possible situations for the case example under examination is also presented.

  9. Brain perfusion ratios by 99mTc HMPAO SPECT utilizing a mean value of the visual cortex to the cerebellum ratio derived from normal subjects

    International Nuclear Information System (INIS)

    Sanchez Catasus, C.; Rodriguez, R.; Cisnero, M.; Palmero, R.; Diaz, O.; Aguila, A.

    2002-01-01

    Aim: Previous results shows that the cerebellum (CER) is the best reference to calculate relative indexes of perfusion (IP) by brain SPECT. However, it can not be used on patients with bilateral cerebellar hypoperfusion. In such cases visual cortex (VC) or an average of the whole brain activity is recommended (WB). VC and WB are less reliable than CER, making it difficult to compare SPECT scans that have been normalized with different values. Materials and Methods: To overcome this difficulty, we developed a method to calculate IP utilizing a reference value defined as (VC / ), where is the mean value of the VC/CER ratio derived from a normal database which was assumed to be constant. We called the value VC/ the 'Pseudocerebellum' (PCER). For clinical validation, we first tested statistically the VC/CER ratio on a group of 60 [ 99m Tc]-HMPAO SPECT scans of 20 normal subjects and 40 neurological patients with positive SPECT but without involvement of VC and CER. To demonstrate that IP PCER approx. IP CER , we calculated the mean value of the absolute differences CER - IP PCER vertical bar> on two groups of scans from subjects without involvement of VC and CER: 10 normal subjects (GI); and 40 patients (GII). Finally, using an indirect procedure the method was tested on a third group of SPECT scans of 30 patients with bilateral cerebellar hypoperfusion (G III). Results: The VC/CER ratio was approximately constant with gender and age at a 95% confidence level; CER - IP PCER vertical bar> was 1.22%±0.35 and 1.20%±0.42 for GI and GII, respectively. This is less than the within-subject replicability of the HMPAO SPECT studies; and thus demonstrated by an indirect approach that IP PCER is a valid procedure by which to evaluate relative perfusion on patients with bilateral cerebellar hypoperfusion and quantitatively comparable to using CER as reference region. Conclusion: The VC/CER ratio has very little inter-subject variability in individuals where these regions are not

  10. Recovery of function, peripheral sensitization and sensory neurone activation by novel pathways following axonal injury in Aplysia californica.

    Science.gov (United States)

    Dulin, M F; Steffensen, I; Morris, C E; Walters, E T

    1995-10-01

    Recovery of behavioural and sensory function was examined following unilateral pedal nerve crush in Aplysia californica. Nerve crush that transected all axons connecting the tail to the central nervous system (CNS) eliminated the ipsilateral tail-evoked siphon reflex, whose sensory input travels in the crushed tail nerve (p9). The first reliable signs of recovery of this reflex were observed within 1 week, and most animals displayed tail-evoked siphon responses within 2 weeks. Wide-dynamic-range mechanosensory neurons with somata in the ventrocaudal (VC) cluster of the ipsilateral pleural ganglion exhibited a few receptive fields (RFs) on the tail 3 weeks after unilateral pedal nerve crush, indicating that the RFs had either regenerated or been reconnected to the central somata. These RFs were smaller and sensitized compared with corresponding RFs on the contralateral, uncrushed side. Centrally conducted axon responses of VC sensory neurones to electrical stimulation distal to the nerve crush site did not reappear until at least 10 days after the crush. Because the crush site was much closer to the CNS than to the tail, the failure of axon responses to be restored earlier than the behavioural responses indicates that early stages of reflex recovery are not due to regeneration of VC sensory neurone axons into the tail. Following nerve crush, VC sensory neurones often could be activated by stimulating central connectives or peripheral nerves that do not normally contain the sensory neurone's axons. These results suggest that recovery of behavioral function after nerve injury involves complex mechanisms, including regenerative growth of axotomized VC sensory neurones, sensitization of regenerating RFs and sprouting of VC sensory neurone fibres within the CNS. Furthermore, the rapidity of behavioural recovery indicates that its initial phases are mediated by additional mechanisms, perhaps centripetal regeneration of unidentified sensory neurones having peripheral

  11. Assessment of vegetation establishment on tailings dam at an iron ore mining site of suburban Beijing, China, 7 years after reclamation with contrasting site treatment methods.

    Science.gov (United States)

    Yan, Demin; Zhao, Fangying; Sun, Osbert Jianxin

    2013-09-01

    Strip-mining operations greatly disturb soil, vegetation and landscape elements, causing many ecological and environmental problems. Establishment of vegetation is a critical step in achieving the goal of ecosystem restoration in mining areas. At the Shouyun Iron Ore Mine in suburban Beijing, China, we investigated selective vegetation and soil traits on a tailings dam 7 years after site treatments with three contrasting approaches: (1) soil covering (designated as SC), (2) application of a straw mat, known as "vegetation carpet", which contains prescribed plant seed mix and water retaining agent (designated as VC), on top of sand piles, and (3) combination of soil covering and application of vegetation carpet (designated as SC+VC). We found that after 7 years of reclamation, the SC+VC site had twice the number of plant species and greater biomass than the SC and VC sites, and that the VC site had a comparable plant abundance with the SC+VC site but much less biodiversity and plant coverage. The VC site did not differ with the SC site in the vegetation traits, albeit low soil fertility. It is suggested that application of vegetation carpet can be an alternative to introduction of topsoil for treatment of tailings dam with fine-structured substrate of ore sands. However, combination of topsoil treatment and application of vegetation carpet greatly increases vegetation coverage and plant biodiversity, and is therefore a much better approach for assisting vegetation establishment on the tailings dam of strip-mining operations. While application of vegetation carpet helps to stabilize the loose surface of fine-structured mine wastes and to introduce seed bank, introduction of fertile soil is necessary for supplying nutrients to plant growth in the efforts of ecosystem restoration of mining areas.

  12. A mechanistic nitrogen limitation model for CLM(ED)

    Science.gov (United States)

    Ali, A. A.; Xu, C.; McDowell, N. G.; Rogers, A.; Wullschleger, S. D.; Fisher, R.; Vrugt, J. A.

    2014-12-01

    Photosynthetic capacity is a key plant trait that determines the rate of photosynthesis; however, in Earth System Models it is either a fixed value or derived from a linear function of leaf nitrogen content. A mechanistic leaf nitrogen allocation model have been developed for a DOE-sponsored Community Land Model coupled to the Ecosystem Demography model (CLM-ED) to predict the photosynthetic capacity [Vc,max25 (μmol CO2 m-2 s-1)] under different environmental conditions at the global scale. We collected more than 800 data points of photosynthetic capacity (Vc,max25) for 124 species from 57 studies with the corresponding leaf nitrogen content and environmental conditions (temperature, radiation, humidity and day length) from literature and the NGEE arctic site (Barrow). Based on the data, we found that environmental control of Vc,max25 is about 4 times stronger than the leaf nitrogen content. Using the Markov-Chain Monte Carlo simulation approach, we fitted the collected data to our newly developed nitrogen allocation model, which predict the leaf nitrogen investment in different components including structure, storage, respiration, light capture, carboxylation and electron transport at different environmental conditions. Our results showed that our nitrogen allocation model explained 52% of variance in observed Vc,max25 and 65% variance in observed Jmax25 using a single set of fitted model parameters for all species. Across the growing season, we found that the modeled Vc,max25 explained 49% of the variability in measured Vc,max25. In the context of future global warming, our model predicts that a temperature increase by 5oC and the doubling of atmospheric carbon dioxide reduced the Vc,max25 by 5%, 11%, respectively.

  13. Theoretical studies of a hybrid ejector CO2 compression cooling system for vehicles and preliminary experimental investigations of an ejector cycle

    International Nuclear Information System (INIS)

    Chen, Xiangjie; Worall, Mark; Omer, Siddig; Su, Yuehong; Riffat, Saffa

    2013-01-01

    Highlights: ► Waste heat from vehicle exhausted gas was used as heat source for ejector. ► Ejector acts as the main interface between ejector and CO 2 VC sub-system. ► The effect of sub-cooling was analyzed. ► COP of ejector cooling system was measured between 0.2 and 0.5 during experiments. ► Enhanced ejector and vapour compression system. -- Abstract: This paper presents theoretical investigations into a hybrid ejector and CO 2 vapour compression (VC) system for road transport cooling. The purpose is to utilise the waste heat from exhaust gas and the VC sub-system to drive the ejector system, whose cooling effect will be employed to subcool the VC sub-system. Exploitation of the energy consumption ratio between ejector sub-system and CO 2 VC sub-system indicated that the more energy obtained from exhausted gas, the better system performance could be achieved for CO 2 VC sub-system, and hence higher cooling capacity of the VC sub-system at the same compression power. Thermodynamic simulations of two sub-systems and the hybrid system were presented. The results indicated that, at boiler temperature of 120 °C, evaporator temperature of 10 °C, a COP of 0.584 was achieved for hybrid system, with 22% improvement over a single ejector cycle. Preliminary experimental studies were carried out on a single ejector cycle, with boiler temperatures between 115 °C and 130 °C, and evaporator temperatures between 5 °C and 10 °C. The effects of various operation conditions on the overall ejector operation were coherently analysed. The COP of the ejector sub-system from experimental results was approximately 85% compared with simulation results, which showed a good agreement between theoretical analysis and experimental results.

  14. NEW REGULATION OF PRIVATE EQUITY AND VENTURE CAPITAL FUNDS AND OPEN QUESTIONS

    Directory of Open Access Journals (Sweden)

    Suzana Audić Vuletić

    2017-01-01

    Full Text Available This article provides an analysis of the new regulation of private equity and venture capital funds which are in Croatian law regulated by Alternative Investment Funds Act and ordinances. These funds can offer their units only via private offering to primarily professional, i.e. qualifying investors. They invest mostly in shares and units of companies, including both companies in early (start-ups and in later stage of business. For the companies in which they invest, these funds are very signifi cant as they can provide capital for even small entrepreneurs which could not obtain fi nancing from traditional sources (e. g. banks. This article analyzes investment transactions between private equity (further in text: PE and venture capital (further in text: VC funds and the company in which they invest (portfolio company. PE and VC funds represent a new segment in the Croatian capital market which is still developing and whose potential is yet to be fully recognized. PE and VC funds are not regulated on the EU level. However, managers of AIFs, including PE and VC funds are under certain conditions. Authors shall analyze these legal sources, both on the EU and on the domestic level, with emphasis on the regulation of managers of AIFs when they acquire controlling stake in non-listed companies and issuers, which is of special interest to PE and VC funds due to their investment techniques. In that light, authors question if there is a mechanism which ensures that PE and VC funds act as a socially responsible shareholders/unitholders in portfolio companies (public accountability of the managers of AIFs. If so, authors argue the existence of possible confl ict of interest, as it is not clear in whose interest should managers of PE and VC funds act: in the interest of their investors or in the interest of the portfolio company.

  15. Population calcium imaging of spontaneous respiratory and novel motor activity in the facial nucleus and ventral brainstem in newborn mice

    DEFF Research Database (Denmark)

    Persson, Karin; Rekling, Jens C

    2011-01-01

    The brainstem contains rhythm and pattern forming circuits, which drive cranial and spinal motor pools to produce respiratory and other motor patterns. Here we used calcium imaging combined with nerve recordings in newborn mice to reveal spontaneous population activity in the ventral brainstem...... and in the facial nucleus. In Fluo-8AM loaded brainstem-spinal cord preparations, respiratory activity on cervical nerves was synchronized with calcium signals at the ventrolateral brainstem surface. Individual ventrolateral neurons at the level of the parafacial respiratory group showed perfect or partial...... synchrony with respiratory nerve bursts. In brainstem-spinal cord preparations, cut at the level of the mid-facial nucleus, calcium signals were recorded in the dorsal, lateral and medial facial subnuclei during respiratory activity. Strong activity initiated in the dorsal subnucleus, followed by activity...

  16. [Pathophysiology and treatment of orofacial pain.

    Science.gov (United States)

    Shinoda, Masamichi; Noma, Noboru

    "Pain" is one of body defense mechanisms and crucial for the life support. However, orofacial pain such as myofascial pain syndrome, burning mouth syndrome and trigeminal neuralgia plays no part in body defense mechanisms and requires therapeutic intervention. Recent studies have indicated that plastic changes in the activities of trigeminal neurons, satellite glial cells in trigeminal ganglion, secondary neurons, microglia and astrocytes in trigeminal spinal subnucleus following orofacial inflammation and trigeminal nerve injury are responsible for orofacial pain mechanisms. Clinically, it is well known that the etiologic differential diagnosis which consists of careful history-taking and physical examination is essential for therapeutic decision in patients with orofacial pain. This report outlines the current knowledge on the pathophysiology, diagnosis, treatment of orofacial pain.

  17. Cocaine- and amphetamine-regulated transcript is present in hypothalamic neuroendocrine neurones and is released to the hypothalamic-pituitary portal circuit

    DEFF Research Database (Denmark)

    Larsen, P J; Seier, V; Fink-Jensen, A

    2003-01-01

    Cocaine- and amphetamine-regulated transcript (CART) is present in a number of hypothalamic nuclei. Besides actions in circuits regulating feeding behaviour and stress responses, the hypothalamic functions of CART are largely unknown. We report that CART immunoreactivity is present in hypothalami......, supraoptic, paraventricular (PVN) and periventricular nuclei of the hypothalamus. In the PVN, CART-positive neuroendocrine neurones were found in all of cytoarchitectonically identified nuclei. In the periventricular nucleus, approximately one-third of somatostatin cells were also CART......-immunoreactive. In the medial parvicellular subnucleus of the PVN, CART and FG coexisted with thyrotrophin-releasing hormone, whereas very few of the corticotrophin-releasing hormone containing cells were CART-immunoreactive. In the arcuate nucleus, CART was extensively colocalized with pro...

  18. Differential Activation of Medullary Vagal Nuclei Caused by Stimulation of Different Esophageal Mechanoreceptors

    Science.gov (United States)

    Lang, Ivan M.; Medda, Bidyut K.; Shaker, Reza

    2010-01-01

    Esophageal mechanorecptors, i.e. muscular slowly adapting tension receptors and mucosal rapidly adapting touch receptors, mediate different sets of reflexes. The aim of this study was to determine the medullary vagal nuclei involved in the reflex responses to activation of these receptors. Thirty-three cats were anesthetized with alpha-chloralose and the esophagus was stimulated by slow balloon or rapid air distension. The physiological effects of the stimuli (N=4) were identified by recording responses from the pharyngeal, laryngeal, and hyoid muscles, esophagus, and the lower esophageal sphincter (LES). The effects on the medullary vagal nuclei of the stimuli: slow distension (N=10), rapid distension (N=9), and in control animals (N=10) were identified using the immunohistochemical analysis of c-fos. The experimental groups were stimulated 3 times per minute for 3 hours. After the experiment, the brains were removed and processed for c-fos immunoreactivity or thioinin. We found that slow balloon distension activated the esophago-UES contractile reflex and esophago LES relaxation response, and rapid air injection activated the belch and its component reflexes. Slow balloon distension activated the NTSce, NTSdl, NTSvl, DMNc, DMNr and NAr; and rapid air injection primarily activated AP, NTScd, NTSim, NTSis, NTSdm, NTSvl, NAc and NAr. We concluded that different sets of medullary vagal nuclei mediate different reflexes of the esophagus activated from different sets of mechanoreceptors. The NTScd is the primary NTS subnucleus mediating reflexes from the mucosal rapidly adapting touch receptors, and the NTSce is the primary NTS subnucleus mediating reflexes from the muscular slowly adapting tension receptors. The AP may be involved in mediation of belching. PMID:20971087

  19. Tritiated-nicotine- and 125I-alpha-bungarotoxin-labeled nicotinic receptors in the interpeduncular nucleus of rats. II. Effects of habenular destruction

    International Nuclear Information System (INIS)

    Clarke, P.B.; Hamill, G.S.; Nadi, N.S.; Jacobowitz, D.M.; Pert, A.

    1986-01-01

    The cholinergic innervation of the interpeduncular nucleus (IPN) is wholly extrinsic and is greatly attenuated by bilateral habenular destruction. We describe changes in the labeling of putative nicotinic receptors within this nucleus at 3, 5, or 11 days after bilateral habenular lesions. Adjacent tissue sections of the rat IPN were utilized for 3 H-nicotine and 125 I-alpha-bungarotoxin ( 125 I-BTX) receptor autoradiography. Compared to sham-operated controls, habenular destruction significantly reduced autoradiographic 3 H-nicotine labeling in rostral (-25%), intermediate (-13%), and lateral subnuclei (-36%). Labeling in the central subnucleus was unchanged. Loss of labeling was maximal at the shortest survival time (3 days) and did not change thereafter. In order to establish whether this loss was due to a reduction in the number or the affinity of 3 H-nicotine-binding sites, a membrane assay was performed on microdissected IPN tissue from rats that had received surgery 3 days previously. Bilateral habenular lesions produced a 35% reduction of high-affinity 3 H-nicotine-binding sites, with no change in binding affinity. Bilateral habenular lesions reduced 125 I-BTX labeling in the intermediate subnuclei, and a slight increase occurred in the rostral subnucleus. In the lateral subnuclei, 125 I-BTX labeling was significantly reduced (27%) at 3 days but not at later survival times. In view of the known synaptic morphology of the habenulointerpeduncular tract, it is concluded that a subpopulation of 3 H-nicotine binding sites within the IPN is located on afferent axons and/or terminals. This subpopulation, located within rostral, intermediate, and lateral subnuclei, may correspond to presynaptic nicotinic cholinergic receptors. Sites that bind 125 I-BTX may include a presynaptic subpopulation located in the lateral and possibly the intermediate subnuclei

  20. Nucleus of the solitary tract in the C57BL/6J mouse: Subnuclear parcellation, chorda tympani nerve projections, and brainstem connections.

    Science.gov (United States)

    Ganchrow, Donald; Ganchrow, Judith R; Cicchini, Vanessa; Bartel, Dianna L; Kaufman, Daniel; Girard, David; Whitehead, Mark C

    2014-05-01

    The nucleus of the solitary tract (NST) processes gustatory and related somatosensory information rostrally and general viscerosensory information caudally. To compare its connections with those of other rodents, this study in the C57BL/6J mouse provides a subnuclear cytoarchitectonic parcellation (Nissl stain) of the NST into rostral, intermediate, and caudal divisions. Subnuclei are further characterized by NADPH staining and P2X2 immunoreactivity (IR). Cholera toxin subunit B (CTb) labeling revealed those NST subnuclei receiving chorda tympani nerve (CT) afferents, those connecting with the parabrachial nucleus (PBN) and reticular formation (RF), and those interconnecting NST subnuclei. CT terminals are densest in the rostral central (RC) and medial (M) subnuclei; less dense in the rostral lateral (RL) subnucleus; and sparse in the ventral (V), ventral lateral (VL), and central lateral (CL) subnuclei. CTb injection into the PBN retrogradely labels cells in the aforementioned subnuclei; RC and M providing the largest source of PBN projection neurons. Pontine efferent axons terminate mainly in V and rostral medial (RM) subnuclei. CTb injection into the medullary RF labels cells and axonal endings predominantly in V at rostral and intermediate NST levels. Small CTb injections within the NST label extensive projections from the rostral division to caudal subnuclei. Projections from the caudal division primarily interconnect subnuclei confined to the caudal division of the NST; they also connect with the area postrema. P2X2 -IR identifies probable vagal nerve terminals in the central (Ce) subnucleus in the intermediate/caudal NST. Ce also shows intense NADPH staining and does not project to the PBN. Copyright © 2013 Wiley Periodicals, Inc.

  1. Migraine Pathophysiology - Evolution Of Our Knowledge

    Directory of Open Access Journals (Sweden)

    Sinha K.K

    2002-01-01

    Full Text Available The biologic basis of migraine had remained unclear until about 15 years, but current migraine research has made some major advances to explain its mechanism. Migraine is currently conceived to originate in the brain. The trigger of an attack starts a depolarising event very similar to "spreading depression" of Leao in a brain that is already hyperexcitable. Hyperexcitability of cell membrane is perhaps genetically determined. Cortical depolarising events drive the trigeminovascular system through mechanisms that are largely hypothetical but might include a migraine generating centre in the brainstem to produce changes in the vessels of the cranium and meninges. Pain sensations carrying impulses are relayed back, first reaching the trigeminal ganglion caudalis and the trigeminal cervical complex in upper cervical cord from where they are relayed further up through various transmitting pathways to the brainstem, thalamus and the cortex where pain is finally perceived and registered.

  2. mRNA expression of 5-hydroxytryptamine 1B, 1D, and 1F receptors and their role in controlling the release of calcitonin gene-related peptide in the rat trigeminovascular system

    DEFF Research Database (Denmark)

    Amrutkar, Dipak V; Ploug, Kenneth B; Hay-Schmidt, Anders

    2012-01-01

    Triptans, a family of 5-hydroxytryptamine (5-HT) 1B, 1D, and 1F receptor agonists, are used in the acute treatment of migraine attacks. The site of action and subtypes of the 5-HT(1) receptor that mediate the antimigraine effect have still to be identified. This study investigated the mRNA expres......Triptans, a family of 5-hydroxytryptamine (5-HT) 1B, 1D, and 1F receptor agonists, are used in the acute treatment of migraine attacks. The site of action and subtypes of the 5-HT(1) receptor that mediate the antimigraine effect have still to be identified. This study investigated the m......RNA expression of these receptors and the role of 5-HT(1) receptor subtypes in controlling the release of calcitonin gene-related peptide (CGRP) in rat dura mater, trigeminal ganglion (TG), and trigeminal nucleus caudalis (TNC). The mRNA for each receptor subtype was quantified by quantitative real...

  3. Degradation of 1,1,2,2-tetrachloroethane and accumulation of vinyl chloride in wetland sediment microcosms and in situ porewater: biogeochemical controls and associations with microbial communities

    Science.gov (United States)

    Lorah, Michelle M.; Voytek, Mary A.

    2004-05-01

    The biodegradation pathways of 1,1,2,2-tetrachloroethane (TeCA) and 1,1,2-trichloroethane (112TCA) and the associated microbial communities in anaerobic wetland sediments were evaluated using concurrent geochemical and genetic analyses over time in laboratory microcosm experiments. Experimental results were compared to in situ porewater data in the wetland to better understand the factors controlling daughter product distributions in a chlorinated solvent plume discharging to a freshwater tidal wetland at Aberdeen Proving Ground, Maryland. Microcosms constructed with wetland sediment from two sites showed little difference in the initial degradation steps of TeCA, which included simultaneous hydrogenolysis to 112TCA and dichloroelimination to 1,2-dichloroethene (12DCE). The microcosms from the two sites showed a substantial difference, however, in the relative dominance of subsequent dichloroelimination of 112TCA. A greater dominance of 112TCA dichloroelimination in microcosms constructed with sediment that was initially iron-reducing and subsequently simultaneously iron-reducing and methanogenic caused approximately twice as much vinyl chloride (VC) production as microcosms constructed with sediment that was methanogenic only throughout the incubation. The microcosms with higher VC production also showed substantially more rapid VC degradation. Field measurements of redox-sensitive constituents, TeCA, and its anaerobic degradation products along flowpaths in the wetland porewater also showed greater production and degradation of VC with concurrent methanogenesis and iron reduction. Molecular fingerprinting indicated that bacterial species [represented by a peak at a fragment size of 198 base pairs (bp) by MnlI digest] are associated with VC production from 112TCA dichloroelimination, whereas methanogens (190 and 307 bp) from the Methanococcales or Methanobacteriales family are associated with VC production from 12DCE hydrogenolysis. Acetate-utilizing methanogens

  4. Effects of vasoactive intestinal peptide on vascular conductance are unaffected by anesthesia

    International Nuclear Information System (INIS)

    Bouder, T.G.; Huffman, L.J.; Hedge, G.A.

    1988-01-01

    In rats anesthetized with ketamine and pentobarbital (KET/PB), vasoactive intestinal peptide (VIP) increases vascular conductance (VC) in the salivary gland, pancreas, and thyroid gland, whereas no changes in VC are observed in a number of other organs. Because anesthesia may alter the responsiveness of physiological systems, we compared the effects of VIP on organ VC in conscious or anesthetized rats. Chronically catheterized rats were studied in the conscious state or 30 min after induction of anesthesia with KET/PB, isoflurane, or Inactin. Blood flows were measured by the reference sample version of the radioactive microsphere (MS) technique using two MS injections ( 141 Ce-MS/ 85 Sr-MS). Mean arterial blood pressure was monitored and used in the calculation of VC. Organ VCs were similar under basal conditions in conscious and anesthetized rats. VIP infusion caused systemic hypotension and increased VCs in the salivary gland, pancreas, and thyroid gland, and these responses were largely unaffected by anesthesia. These results indicate that the anesthetics used do not alter basal VC or the responsiveness of the vasculature to exogenous VIP

  5. Video conferencing versus telephone calls for team work across hospitals: a qualitative study on simulated emergencies

    Directory of Open Access Journals (Sweden)

    Hagen Oddvar

    2009-11-01

    Full Text Available Abstract Background Teamwork is important for patient care and outcome in emergencies. In rural areas, efficient communication between rural hospitals and regional trauma centers optimise decisions and treatment of trauma patients. Little is known on potentials and effects of virtual team to team cooperation between rural and regional trauma teams. Methods We adapted a video conferencing (VC system to the work process between multidisciplinary teams responsible for trauma as well as medical emergencies between one rural and one regional (university hospital. We studied how the teams cooperated during simulated critical scenarios, and compared VC with standard telephone communication. We used qualitative observations and interviews to evaluate results. Results The team members found VC to be a useful tool during emergencies and for building "virtual emergency teams" across distant hospitals. Visual communication combined with visual patient information is superior to information gained during ordinary telephone calls, but VC may also cause interruptions in the local teamwork. Conclusion VC can improve clinical cooperation and decision processes in virtual teams during critical patient care. Such team interaction requires thoughtful organisation, training, and new rules for communication.

  6. Virtual colonoscopy: clinical application

    International Nuclear Information System (INIS)

    Laghi, A.

    2005-01-01

    Virtual colonoscopy (VC), also known as computed tomography Colonography (CTC), is a non-invasive test for the examination of the colon based on volumetric, thin-collimation CT acquisition of a cleansed and air-distended colon. The technique is easy, less labour-intensive than barium enema and conventional colonoscopy, and is inherently safer. Several studies demonstrate the ability of VC in the detection of colonic neoplastic lesions, not only large carcinomas, but also polyps. Currently, the most widely accepted clinical indication is incomplete or unsuccessful colonoscopy, which may be the result of redundant colon, patient intolerance to the procedure, spasm not resolving even with the use of spasmolytics, obstructing colo-rectal cancer. VC is also used to detect cancer in frail and immobile patients to avoid sedation during colonoscopy or the turning required during barium enema. The use of VC in patients under surveillance following colo-rectal cancer surgery is under investigation. Further studies are necessary in order to assess the cost-effectiveness of this approach. For colo-rectal cancer screening, a practical approach is to consider VC as a currently credible alternative screening method and as a reasonable alternative to the other colo-rectal cancer screening tests when a patient is unable or unwilling to undergo conventional colonoscopy. (orig.)

  7. Effect of dietary vanadium and vitamin C on egg quality and antioxidant status in laying hens.

    Science.gov (United States)

    Wang, J P; He, K R; Ding, X M; Luo, Y H; Bai, S P; Zeng, Q F; Su, Z W; Xuan, Y; Zhang, K Y

    2016-06-01

    This study assessed the effect of dietary vanadium (V) and vitamin C (VC) on production performance, egg quality and antioxidant status in laying hens. A total of 360 laying hens (31-week-old) were randomly allotted into a 3 × 3 factorial arrangement treatments (four replicates and 10 chicks per replicate) with three levels of dietary V (0, 5 and 10 mg/kg) and three levels of vitamin C (0, 50 and 100 mg/kg) for 12 weeks. The effect of V and VC did not alter egg production, egg weight, average daily feed intake and feed conversion ratio during 1-12 week. Albumen height and Haugh unit value were linearly decreased (p effect of 100 mg/kg VC was observed to counteract (p effect in V-containing treatments during 1-12 week. Hens fed V-containing diet laid lighter (linear effect, p effect of V during 4, 8 and 12 week. The effect of VC alone and the interactive effect between VC and V were shown to increase serum (p effect and can mitigate the oxidative stress to some extent. Journal of Animal Physiology and Animal Nutrition © 2015 Blackwell Verlag GmbH.

  8. A comparison of volume control and pressure-regulated volume control ventilation in acute respiratory failure

    Science.gov (United States)

    Guldager, Henrik; Nielsen, Soeren L; Carl, Peder; Soerensen, Mogens B

    1997-01-01

    Background: The aim of this study was to test the hypothesis that a new mode of ventilation (pressure-regulated volume control; PRVC) is associated with improvements in respiratory mechanics and outcome when compared with conventional volume control (VC) ventilation in patients with acute respiratory failure. We conducted a randomised, prospective, open, cross over trial on 44 patients with acute respiratory failure in the general intensive care unit of a university hospital. After a stabilization period of 8 h, a cross over trial of 2 × 2 h was conducted. Apart from the PRVC/VC mode, ventilator settings were comparable. The following parameters were recorded for each patient: days on ventilator, failure in the assigned mode of ventilation (peak inspiratory pressure > 50 cmH2O) and survival. Results: In the crossover trial, peak inspiratory pressure was significantly lower using PRVC than with VC (20 cmH2O vs 24 cmH2O, P < 0.0001). No other statistically significant differences were found. Conclusions: Peak inspiratory pressure was significantly lower during PRVC ventilation than during VC ventilation, and thus PRVC may be superior to VC in certain patients. However, in this small group of patients, we could not demonstrate that PRVC improved outcome. PMID:11056699

  9. Lung function in idiopathic pulmonary fibrosis - extended analyses of the IFIGENIA trial

    Directory of Open Access Journals (Sweden)

    Verschakelen Johny

    2009-10-01

    Full Text Available Abstract Background The randomized placebo-controlled IFIGENIA-trial demonstrated that therapy with high-dose N-acetylcysteine (NAC given for one year, added to prednisone and azathioprine, significantly ameliorates (i.e. slows down disease progression in terms of vital capacity (VC (+9% and diffusing capacity (DLco (+24% in idiopathic pulmonary fibrosis (IPF. To better understand the clinical implications of these findings we performed additional, explorative analyses of the IFGENIA data set. Methods We analysed effects of NAC on VC, DLco, a composite physiologic index (CPI, and mortality in the 155 study-patients. Results In trial completers the functional indices did not change significantly with NAC, whereas most indices deteriorated with placebo; in non-completers the majority of indices worsened but decline was generally less pronounced in most indices with NAC than with placebo. Most categorical analyses of VC, DLco and CPI also showed favourable changes with NAC. The effects of NAC on VC, DLco and CPI were significantly better if the baseline CPI was 50 points or lower. Conclusion This descriptive analysis confirms and extends the favourable effects of NAC on lung function in IPF and emphasizes the usefulness of VC, DLco, and the CPI for the evaluation of a therapeutic effect. Most importantly, less progressed disease as indicated by a CPI of 50 points or lower at baseline was more responsive to therapy in this study. Trial Registration Registered at http://www.ClinicalTrials.gov; number NCT00639496.

  10. Molecular dynamics coupled with a virtual system for effective conformational sampling.

    Science.gov (United States)

    Hayami, Tomonori; Kasahara, Kota; Nakamura, Haruki; Higo, Junichi

    2018-07-15

    An enhanced conformational sampling method is proposed: virtual-system coupled canonical molecular dynamics (VcMD). Although VcMD enhances sampling along a reaction coordinate, this method is free from estimation of a canonical distribution function along the reaction coordinate. This method introduces a virtual system that does not necessarily obey a physical law. To enhance sampling the virtual system couples with a molecular system to be studied. Resultant snapshots produce a canonical ensemble. This method was applied to a system consisting of two short peptides in an explicit solvent. Conventional molecular dynamics simulation, which is ten times longer than VcMD, was performed along with adaptive umbrella sampling. Free-energy landscapes computed from the three simulations mutually converged well. The VcMD provided quicker association/dissociation motions of peptides than the conventional molecular dynamics did. The VcMD method is applicable to various complicated systems because of its methodological simplicity. © 2018 Wiley Periodicals, Inc. © 2018 Wiley Periodicals, Inc.

  11. Vitamin D in Vascular Calcification: A Double-Edged Sword?

    Directory of Open Access Journals (Sweden)

    Jeffrey Wang

    2018-05-01

    Full Text Available Vascular calcification (VC as a manifestation of perturbed mineral balance, is associated with aging, diabetes and kidney dysfunction, as well as poorer patient outcomes. Due to the current limited understanding of the pathophysiology of vascular calcification, the development of effective preventative and therapeutic strategies remains a significant clinical challenge. Recent evidence suggests that traditional risk factors for cardiovascular disease, such as left ventricular hypertrophy and dyslipidaemia, fail to account for clinical observations of vascular calcification. Therefore, more complex underlying processes involving physiochemical changes to mineral balance, vascular remodelling and perturbed hormonal responses such as parathyroid hormone (PTH and fibroblast growth factor 23 (FGF-23 are likely to contribute to VC. In particular, VC resulting from modifications to calcium, phosphate and vitamin D homeostasis has been recently elucidated. Notably, deregulation of vitamin D metabolism, dietary calcium intake and renal mineral handling are associated with imbalances in systemic calcium and phosphate levels and endothelial cell dysfunction, which can modulate both bone and soft tissue calcification. This review addresses the current understanding of VC pathophysiology, with a focus on the pathogenic role of vitamin D that has provided new insights into the mechanisms of VC.

  12. Vacuum chamber eddy current correction coil for the AGS Booster

    International Nuclear Information System (INIS)

    Danby, G.; Jackson, J.

    1988-01-01

    The AGS Booster injector will perform a variety of functions. Heavy ion acceleration requires a bakeable, ultra-high vacuum system (VC). Acceleration for intense proton beams requires rapid cycling (B /preceq/ 10T/sec). If straight forward heavy walled VC are used, the field perturbations due to eddy currents are large. The state of the art lattice has highly distributed lumped sextupoles capable of substantially correcting the induced field nonlinearity. Nevertheless, for the very highest space charge-intensity limits, it is desirable to have the capability to remove eddy current fields at the source. Correction coils attached to the outside of the VC cancel its current aberrations over the required good field aperture. These can be passively powered by transformer action, using two turn windings around the magnet yoke. Programmed power supplies can also be used. This inexpensive additional correction option uses a three turn per quadrant coil which follows the local contour of the VC. Transverse movements of several mms of the VC will have no beam optical effect since the large field aberrations and their corrections have the same displaced coordinates. Experimental and computer studies will be presented, as well as mechanical and electrical design of a simple method of construction. 6 figs

  13. 4-D Micro-CT of the Mouse Heart

    Directory of Open Access Journals (Sweden)

    Cristian T. Badea

    2005-04-01

    Full Text Available Purpose: Demonstrate noninvasive imaging methods for in vivo characterization of cardiac structure and function in mice using a micro-CT system that provides high photon fluence rate and integrated motion control. Materials and Methods: Simultaneous cardiac- and respiratory-gated micro-CT was performed in C57BL/6 mice during constant intravenous infusion of a conventional iodinated contrast agent (Isovue-370, and after a single intravenous injection of a blood pool contrast agent (Fenestra VC. Multiple phases of the cardiac cycle were reconstructed with contrast to noise and spatial resolution sufficient for quantitative assessment of cardiac function. Results: Contrast enhancement with Isovue-370 increased over time with a maximum of ~500 HU (aorta and 900 HU (kidney cortex. Fenestra VC provided more constant enhancement over 3 hr, with maximum enhancement of ~620 HU (aorta and ~90 HU (kidney cortex. The maximum enhancement difference between blood and myocardium in the heart was ~250 HU for Isovue-370 and ~500 HU for Fenestra VC. In mice with Fenestra VC, volumetric measurements of the left ventricle were performed and cardiac function was estimated by ejection fraction, stroke volume, and cardiac output. Conclusion: Image quality with Fenestra VC was sufficient for morphological and functional studies required for a standardized method of cardiac phenotyping of the mouse.

  14. Estimation of gas and tissue lung volumes by MRI: functional approach of lung imaging.

    Science.gov (United States)

    Qanadli, S D; Orvoen-Frija, E; Lacombe, P; Di Paola, R; Bittoun, J; Frija, G

    1999-01-01

    The purpose of this work was to assess the accuracy of MRI for the determination of lung gas and tissue volumes. Fifteen healthy subjects underwent MRI of the thorax and pulmonary function tests [vital capacity (VC) and total lung capacity (TLC)] in the supine position. MR examinations were performed at inspiration and expiration. Lung volumes were measured by a previously validated technique on phantoms. Both individual and total lung volumes and capacities were calculated. MRI total vital capacity (VC(MRI)) was compared with spirometric vital capacity (VC(SP)). Capacities were correlated to lung volumes. Tissue volume (V(T)) was estimated as the difference between the total lung volume at full inspiration and the TLC. No significant difference was seen between VC(MRI) and VC(SP). Individual capacities were well correlated (r = 0.9) to static volume at full inspiration. The V(T) was estimated to be 836+/-393 ml. This preliminary study demonstrates that MRI can accurately estimate lung gas and tissue volumes. The proposed approach appears well suited for functional imaging of the lung.

  15. Accelerated postirradiation recovery of hematopoietic marrow following priming with low doses of vincristine

    International Nuclear Information System (INIS)

    Johnke, R.M.; Abernathy, R.S.

    1990-01-01

    The present investigation is a continuation of efforts to characterize the radioprotective potential of priming with vincristine (VcR). In this study, the postirradiation recovery kinetics of the marrow's hematopoietic stem cell, progenitor cell, and stromal cell compartments were monitored following exposure to a range of sublethal radiation doses to determine (a) the optimal VcR/radiation intertreatment interval for achieving maximal hematopoietic protection, (b) whether this optimal interval is influenced by the dose of radiation administered, and (c) whether the radioprotection observed involves the hematopoietic stroma. The results demonstrate that the degree of radioprotection observed was significantly influenced by the scheduling of the VcR priming dose with respect to the radiation exposure. An intertreatment interval of 24 h provided maximal radioprotective benefit irrespective of the radiation dose administered. Additionally, the radioprotection following VcR priming appeared to be more the result of an accelerated recovery in the hematopoietic stem cell and progenitor cell compartments than a change in their intrinsic radiosensitivity. The data also suggest that this accelerated recovery was not a consequence of greater radioprotection of marrow stroma. Finally, the radioprotection observed following VcR priming did not appear to involve a selective lineage response by either the erythroid or the granulomonocytic progenitor compartments

  16. Advanced topical drug delivery system for the management of vaginal candidiasis.

    Science.gov (United States)

    Johal, Himmat Singh; Garg, Tarun; Rath, Goutam; Goyal, Amit Kumar

    2016-01-01

    Vaginal candidiasis or vulvovaginal candidiasis (VC) is a common mucosal infection of vagina, mainly caused by Candida species. The major symptoms of VC are dyspareunia, pruritis, itching, soreness, vagina as well as vulvar erythema and edema. Most common risk factors that lead to the imbalance in the vaginal micro biota are the use of antibiotics, pregnancy, diabetes mellitus, immuno suppression as in AIDS or HIV patients, frequent sexual intercourse, spermicide and intra-uterine devices and vaginal douching. Various anti-fungal drugs are available for effective treatment of VC. Different conventional vaginal formulations (creams, gels, suppositories, powder, ointment, etc.) for VC are available today but have limited efficacy because of lesser residence time on vaginal epithelium due to self-cleansing action of vagina. So to overcome this problem, an extended and intimate contact with vaginal mucosa is desired; which can be accomplished by utilizing mucoadhesive polymers. Mucoadhesive polymers have an excellent binding capacity to mucosal tissues for considerable period of time. This unique property of these polymers significantly enhances retention time of different formulations on mucosal tissues. Currently, various novel formulations such as liposomes, nano- and microparticles, micro-emulsions, bio-adhesive gel and tablets are used to control and treat VC. In this review, we focused on current status of vaginal candidiasis, conventional and nanotechnology inspired formulation approaches.

  17. Evaluation of ViroCyt® Virus Counter for Rapid Filovirus Quantitation

    Directory of Open Access Journals (Sweden)

    Cynthia A. Rossi

    2015-03-01

    Full Text Available Development and evaluation of medical countermeasures for diagnostics, vaccines, and therapeutics requires production of standardized, reproducible, and well characterized virus preparations. For filoviruses this includes plaque assay for quantitation of infectious virus, transmission electron microscopy (TEM for morphology and quantitation of virus particles, and real-time reverse transcription PCR for quantitation of viral RNA (qRT-PCR. The ViroCyt® Virus Counter (VC 2100 (ViroCyt, Boulder, CO, USA is a flow-based instrument capable of quantifying virus particles in solution. Using a proprietary combination of fluorescent dyes that stain both nucleic acid and protein in a single 30 min step, rapid, reproducible, and cost-effective quantification of filovirus particles was demonstrated. Using a seed stock of Ebola virus variant Kikwit, the linear range of the instrument was determined to be 2.8E+06 to 1.0E+09 virus particles per mL with coefficient of variation ranging from 9.4% to 31.5% for samples tested in triplicate. VC particle counts for various filovirus stocks were within one log of TEM particle counts. A linear relationship was established between the plaque assay, qRT-PCR, and the VC. VC results significantly correlated with both plaque assay and qRT-PCR. These results demonstrated that the VC is an easy, fast, and consistent method to quantify filoviruses in stock preparations.

  18. Evaluation of ViroCyt® Virus Counter for Rapid Filovirus Quantitation

    Directory of Open Access Journals (Sweden)

    Cynthia A. Rossi

    2015-02-01

    Full Text Available Development and evaluation of medical countermeasures for diagnostics, vaccines, and therapeutics requires production of standardized, reproducible, and well characterized virus preparations. For filoviruses this includes plaque assay for quantitation of infectious virus, transmission electron microscopy (TEM for morphology and quantitation of virus particles, and real-time reverse transcription PCR for quantitation of viral RNA (qRT-PCR. The ViroCyt® Virus Counter (VC 2100 (ViroCyt, Boulder, CO, USA is a flow-based instrument capable of quantifying virus particles in solution. Using a proprietary combination of fluorescent dyes that stain both nucleic acid and protein in a single 30 min step, rapid, reproducible, and cost-effective quantification of filovirus particles was demonstrated. Using a seed stock of Ebola virus variant Kikwit, the linear range of the instrument was determined to be 2.8E+06 to 1.0E+09 virus particles per mL with coefficient of variation ranging from 9.4% to 31.5% for samples tested in triplicate. VC particle counts for various filovirus stocks were within one log of TEM particle counts. A linear relationship was established between the plaque assay, qRT-PCR, and the VC. VC results significantly correlated with both plaque assay and qRT-PCR. These results demonstrated that the VC is an easy, fast, and consistent method to quantify filoviruses in stock preparations.

  19. Tolerance of Volume Control Noninvasive Ventilation in Subjects With Amyotrophic Lateral Sclerosis.

    Science.gov (United States)

    Martínez, Daniel; Sancho, Jesús; Servera, Emilio; Marín, Julio

    2015-12-01

    Noninvasive ventilation (NIV) tolerance has been identified as an independent predictor of survival in amyotrophic lateral sclerosis (ALS). Volume control continuous mandatory ventilation (VC-CMV) NIV has been associated with poor tolerance. The aim of this study was to determine the tolerance of subjects with ALS to VC-CMV NIV. This was a prospective study involving subjects with ALS who were treated with VC-CMV NIV. Respiratory and functional parameters were recorded when the subjects began ventilatory support. NIV tolerance was evaluated after 3 months. Eighty-seven subjects with ALS were included. After 3 months, 80 subjects (92%) remained tolerant of NIV. Tolerant subjects presented greater survival (median 22.0 months, 95% CI 14.78-29.21) than intolerant subjects (median 6.0 months, 95% CI 0.86-11.13) (P = .03). The variables that best predicted NIV tolerance were mechanically assisted cough peak flow (P = .01) and percentage of time spent with SpO2 NIV (P = .03) CONCLUSIONS: VC-CMV NIV provides high rates of NIV tolerance in subjects with ALS. Mechanically assisted cough peak flow and percentage of time spent with SpO2 NIV are the 2 factors associated with tolerance of VC-CMV NIV in subjects with ALS. Copyright © 2015 by Daedalus Enterprises.

  20. Application of visual cryptography for learning in optics and photonics

    Science.gov (United States)

    Mandal, Avikarsha; Wozniak, Peter; Vauderwange, Oliver; Curticapean, Dan

    2016-09-01

    In the age data digitalization, important applications of optics and photonics based sensors and technology lie in the field of biometrics and image processing. Protecting user data in a safe and secure way is an essential task in this area. However, traditional cryptographic protocols rely heavily on computer aided computation. Secure protocols which rely only on human interactions are usually simpler to understand. In many scenarios development of such protocols are also important for ease of implementation and deployment. Visual cryptography (VC) is an encryption technique on images (or text) in which decryption is done by human visual system. In this technique, an image is encrypted into number of pieces (known as shares). When the printed shares are physically superimposed together, the image can be decrypted with human vision. Modern digital watermarking technologies can be combined with VC for image copyright protection where the shares can be watermarks (small identification) embedded in the image. Similarly, VC can be used for improving security of biometric authentication. This paper presents about design and implementation of a practical laboratory experiment based on the concept of VC for a course in media engineering. Specifically, our contribution deals with integration of VC in different schemes for applications like digital watermarking and biometric authentication in the field of optics and photonics. We describe theoretical concepts and propose our infrastructure for the experiment. Finally, we will evaluate the learning outcome of the experiment, performed by the students.

  1. Modified cellulose nanocrystal for vitamin C delivery.

    Science.gov (United States)

    Akhlaghi, Seyedeh Parinaz; Berry, Richard M; Tam, Kam Chiu

    2015-04-01

    Cellulose nanocrystal grafted with chitosan oligosaccharide (CNC-CSOS) was used to encapsulate vitamin C and prepare CNCS/VC complexes using tripolyphosphte via ionic complexation. The stability of vitamin C and the antioxidant activity of the CNCS/VC complexes were elucidated. The formation of the complex was confirmed using DSC and UV-vis spectrophotometry, and TEM was used to study the morphology of the complexes. The encapsulation efficiency of vitamin C at pH 3 and 5 was 71.6% ± 6.8 and 91.0 ± 1.0, respectively. Strong exothermic peaks observed in isothermal titration calorimetric (ITC) studies at pH 5 could be attributed to additional electrostatic interactions between CNC-CSOS and vitamin C at pH 5. The in vitro release of vitamin C from CNCS/VC complexes showed a sustained release of up to 20 days. The vitamin C released from CNCS/VC complex displayed higher stability compared with the control vitamin C solution, and this was also confirmed from the ITC thermograms. CNC-CSOS possessed a higher scavenging activity and faster antioxidant activity compared with its precursors, i.e., oxidized CNC and CSOS and their physical mixtures. Complexing vitamin C into CNC-CSOS particles yielded a dynamic antioxidant agent, where the vitamin C is released over time and displayed sustained antioxidant properties. Therefore, CNCS/VC can potentially be used in cosmeceutical applications as topical formulations.

  2. Association between vascular calcification scores on plain radiographs and fatty acid contents of erythrocyte membrane in hemodialysis patients.

    Science.gov (United States)

    Son, Young K; Lee, Su M; Kim, Seong E; Kim, Ki H; Lee, Seon Y; Bae, Hae R; Han, Jin Y; Park, Yongsoon; An, Won S

    2012-01-01

    Vascular calcification (VC) scores determined by using simple plain radiographic films are known to be associated with coronary artery disease and mortality in patients undergoing hemodialysis (HD). Omega-3 fatty acid (FA) has been shown to reduce ectopic calcifications in an animal model, and it has also been shown that erythrocyte membrane omega-3 FA content is an independent discriminator of coronary artery disease. The present study was designed to demonstrate relations between VC scores and erythrocyte membrane FA contents in patients undergoing HD. A cross-sectional study was carried out. The study was carried out at an outpatient hemodialysis unit at Dong-A University Hospital, Busan, Republic of Korea. A total of 31 patients undergoing HD were recruited. Patients with significant malnutrition, a short duration of dialysis (acid and docosahexaenoic acid were not found to be related with VC on simple plain radiographic films. However, erythrocyte membrane contents of oleic acid and total monounsaturated FA (MUFA) were significantly higher in patients with significant VC scores. Furthermore, erythrocyte membrane contents of MUFA and oleic acid were found to be negatively associated with high-density lipoprotein cholesterol level and positively associated with triglyceride level. Erythrocyte membrane contents of MUFA and oleic acid were found to be associated with VC scores determined using plain radiographs and with dyslipidemia in patients undergoing HD. Copyright © 2012 National Kidney Foundation, Inc. Published by Elsevier Inc. All rights reserved.

  3. Vacuum chamber eddy current correction coil for the AGS booster

    International Nuclear Information System (INIS)

    Danby, G.; Jackson, J.

    1988-01-01

    This paper reports on the AGS Booster injector that performs a variety of functions. Heavy ion acceleration requires a bakeable, ultra-high vacuum system (VC). Acceleration for intense proton beams requires rapid cycling (B ≤10T/sec). If straight forward heavy walled VC are used, the field perturbations due to eddy currents are large. The state of the art lattice has highly distributed lumped sextupoles capable of substantially correcting the induced field nonlinearity. Nevertheless, for the very highest space charge-intensity limits, it is desirable to have the capability to remove eddy current fields at the source. Correction coils attached to the outside of the VC cancel its current aberrations over the required good field aperture. These can be passively powered by transformer action, using two turn windings around the magnet yoke. Programmed power supplies can also be used. This inexpensive additional correction option uses a three turn per quadrant coil which follows the local contour of the VC. Transverse movements of several mms of the VC will have no beam optical effect since the large field aberrations and their corrections have the same displace coordinates. Experimental and computer studies will be presented, as well as mechanical and electrical design of a simple method of construction

  4. Natural antioxidants exhibit chemopreventive characteristics through the regulation of CNC b-Zip transcription factors in estrogen-induced breast carcinogenesis.

    Science.gov (United States)

    Chatterjee, Anwesha; Ronghe, Amruta; Singh, Bhupendra; Bhat, Nimee K; Chen, Jie; Bhat, Hari K

    2014-12-01

    The objective of the present study was to characterize the role of resveratrol (Res) and vitamin C (VC) in prevention of estrogen-induced breast cancer through regulation of cap "n"collar (CNC) b-zip transcription factors. Human breast epithelial cell line MCF-10A was treated with 17β-estradiol (E2) and VC or Res with or without E2. mRNA and protein expression levels of CNC b-zip transcription factors nuclear factor erythroid 2-related factor 1 (Nrf1), nuclear factor erythroid 2 related factor 2 (Nrf2), nuclear factor erythroid 2 related factor 3 (Nrf3), and Nrf2-regulated antioxidant enzymes superoxide dismutase 3 (SOD3) and quinone oxidoreductase 1 (NQO1) were quantified. The treatment with E2 suppressed, whereas VC and Res prevented E2-mediated decrease in the expression levels of SOD3, NQO1, Nrf2 mRNA, and protein in MCF-10A cells. The treatment with E2, Res, or VC significantly increased mRNA and protein expression levels of Nrf1. 17β-Estradiol treatment significantly increased but VC or Res decreased Nrf3 mRNA and protein expression levels. Our studies demonstrate that estrogen-induced breast cancer might be prevented through upregulation of antioxidant enzymes via Nrf-dependent pathways. © 2014 Wiley Periodicals, Inc.

  5. Virtual colonoscopy: clinical application

    Energy Technology Data Exchange (ETDEWEB)

    Laghi, A. [Univ. of Rome La Sapienza, Polo Didattico Pontino, Latina (Italy)

    2005-11-15

    Virtual colonoscopy (VC), also known as computed tomography Colonography (CTC), is a non-invasive test for the examination of the colon based on volumetric, thin-collimation CT acquisition of a cleansed and air-distended colon. The technique is easy, less labour-intensive than barium enema and conventional colonoscopy, and is inherently safer. Several studies demonstrate the ability of VC in the detection of colonic neoplastic lesions, not only large carcinomas, but also polyps. Currently, the most widely accepted clinical indication is incomplete or unsuccessful colonoscopy, which may be the result of redundant colon, patient intolerance to the procedure, spasm not resolving even with the use of spasmolytics, obstructing colo-rectal cancer. VC is also used to detect cancer in frail and immobile patients to avoid sedation during colonoscopy or the turning required during barium enema. The use of VC in patients under surveillance following colo-rectal cancer surgery is under investigation. Further studies are necessary in order to assess the cost-effectiveness of this approach. For colo-rectal cancer screening, a practical approach is to consider VC as a currently credible alternative screening method and as a reasonable alternative to the other colo-rectal cancer screening tests when a patient is unable or unwilling to undergo conventional colonoscopy. (orig.)

  6. Barriers and Opportunities to Advancing Women in Leadership Roles in Vector Control: Perspectives from a Stakeholder Survey.

    Science.gov (United States)

    Hayden, Mary H; Barrett, Erika; Bernard, Guyah; Toko, Eunice N; Agawo, Maurice; Okello, Amanda M; Gunn, Jayleen K L; Ernst, Kacey C

    2018-05-01

    Increasing the active participation of professional women in vector control (VC) activities may help promote greater gender equity in the workplace and reduce the burden of vector-borne diseases. This stakeholder survey examined the current roles and perspective of professionals employed in the VC sector in Kenya, Indonesia, India, and other countries. The largest barriers that women face in pursuing leadership roles in the VC sector include lack of awareness of career opportunities, limitations based on cultural norms, and the belief that VC is men's work. These barriers could be addressed through improving education and recruitment campaigns, as well as supporting higher education and mentoring programs. Females were almost six times more likely to be encouraged to pursue leadership positions in their organization compared with male respondents (odds ratio = 5.9, P > 0.03, 95% confidence interval: 1.19, 29.42). These findings suggest that once women are recruited into the VC workforce, they face minimal discrimination and have increased leadership opportunities.

  7. Wechsler Intelligence Scale for Children-fourth edition (WISC-IV) short-form validity: a comparison study in pediatric epilepsy.

    Science.gov (United States)

    Hrabok, Marianne; Brooks, Brian L; Fay-McClymont, Taryn B; Sherman, Elisabeth M S

    2014-01-01

    The purpose of this article was to investigate the accuracy of the WISC-IV short forms in estimating Full Scale Intelligence Quotient (FSIQ) and General Ability Index (GAI) in pediatric epilepsy. One hundred and four children with epilepsy completed the WISC-IV as part of a neuropsychological assessment at a tertiary-level children's hospital. The clinical accuracy of eight short forms was assessed in two ways: (a) accuracy within +/- 5 index points of FSIQ and (b) the clinical classification rate according to Wechsler conventions. The sample was further subdivided into low FSIQ (≤ 80) and high FSIQ (> 80). All short forms were significantly correlated with FSIQ. Seven-subtest (Crawford et al. [2010] FSIQ) and 5-subtest (BdSiCdVcLn) short forms yielded the highest clinical accuracy rates (77%-89%). Overall, a 2-subtest (VcMr) short form yielded the lowest clinical classification rates for FSIQ (35%-63%). The short form yielding the most accurate estimate of GAI was VcSiMrBd (73%-84%). Short forms show promise as useful estimates. The 7-subtest (Crawford et al., 2010) and 5-subtest (BdSiVcLnCd) short forms yielded the most accurate estimates of FSIQ. VcSiMrBd yielded the most accurate estimate of GAI. Clinical recommendations are provided for use of short forms in pediatric epilepsy.

  8. A comparison of intellectual assessments over video conferencing and in-person for individuals with ID: preliminary data.

    Science.gov (United States)

    Temple, V; Drummond, C; Valiquette, S; Jozsvai, E

    2010-06-01

    Video conferencing (VC) technology has great potential to increase accessibility to healthcare services for those living in rural or underserved communities. Previous studies have had some success in validating a small number of psychological tests for VC administration; however, VC has not been investigated for use with persons with intellectual disabilities (ID). A comparison of test results for two well known and widely used assessment instruments was undertaken to establish if scores for VC administration would differ significantly from in-person assessments. Nineteen individuals with ID aged 23-63 were assessed once in-person and once over VC using the Wechsler Abbreviated Scale of Intelligence (WASI) and the Beery-Buktenica Test of Visual-Motor Integration (VMI). Highly similar results were found for test scores. Full-scale IQ on the WASI and standard scores for the VMI were found to be very stable across the two administration conditions, with a mean difference of less than one IQ point/standard score. Video conferencing administration does not appear to alter test results significantly for overall score on a brief intelligence test or a test of visual-motor integration.

  9. The pathogenic microorganisms in papanicolaou vaginal smears and correlation with inflammation.

    Directory of Open Access Journals (Sweden)

    Esmat Barouti

    2013-03-01

    Full Text Available Non-specific cervicitis or inflammatory changes in a smear report are common which are usually unclear for clinical approaches. To investigate the frequency of inflammation and pathogenic vaginal microorganisms in cervical smears among an Iranian population sample.This cross-sectional study was carried out on Pap smear samples of women referred to gynecological clinic of Taleghani Hospital in Tehran, Iran, between October 2008 and March 2009. This study was conducted on 528 conventional Papanicolaou cervical smears. The frequency and severity of inflammation and prevalence of bacterial vaginosis (BV, Trichomonas vaginalis (TV, and vaginal candidiasis (VC was determined in the samples. Also co-infection of the microorganisms in Pap samples was evaluated. percentage, mean±standard deviation of the outcome parameters were calculated. The comparison between data was performed with the Pearson's chi square or Fisher's exact test.The prevalence of BV, VC, and TV in Pap samples was 17%, 11%, and 0.4% respectively. Overall, the prevalence of these microorganisms in women of reproductive age was higher than menopausal women. There was a significant association between VC and the presence of inflammation in our samples.Based on our results, inflammation in the Pap smears can suggest an infection of VC and the patients should be considered for proper VC treatment.

  10. Electron-beam-induced-current and active secondary-electron voltage-contrast with aberration-corrected electron probes

    Energy Technology Data Exchange (ETDEWEB)

    Han, Myung-Geun, E-mail: mghan@bnl.gov [Condensed Matter Physics & Materials Science, Brookhaven National Laboratory, Upton, NY 11973 (United States); Garlow, Joseph A. [Condensed Matter Physics & Materials Science, Brookhaven National Laboratory, Upton, NY 11973 (United States); Materials Science and Engineering Department, Stony Brook University, Stony Brook, NY 11794 (United States); Marshall, Matthew S.J.; Tiano, Amanda L. [Department of Chemistry, Stony Brook University, Stony Brook, NY 11974 (United States); Wong, Stanislaus S. [Condensed Matter Physics & Materials Science, Brookhaven National Laboratory, Upton, NY 11973 (United States); Department of Chemistry, Stony Brook University, Stony Brook, NY 11974 (United States); Cheong, Sang-Wook [Department of Physics and Astronomy, Rutgers Center for Emergent Materials, Rutgers University, Piscataway, NJ 08854 (United States); Walker, Frederick J.; Ahn, Charles H. [Department of Applied Physics and Center for Research on Interface Structures and Phenomena, Yale University, New Haven, CT 06520 (United States); Department of Mechanical Engineering and Materials Science, Yale University, New Haven, CT 06520 (United States); Zhu, Yimei [Condensed Matter Physics & Materials Science, Brookhaven National Laboratory, Upton, NY 11973 (United States)

    2017-05-15

    Highlights: • Electron-beam-induced-current (EBIC) and active secondary-electron voltage-contrast (SE-VC) are demonstrated in STEM mode combined with in situ electrical biasing in a TEM. • Electrostatic potential maps in ferroelectric thin films, multiferroic nanowires, and single crystals obtained by off-axis electron holography were compared with EBIC and SE-VC data. • Simultaneous EBIC and active SE-VC performed with atomic resolution STEM are demonstrated. - Abstract: The ability to map out electrostatic potentials in materials is critical for the development and the design of nanoscale electronic and spintronic devices in modern industry. Electron holography has been an important tool for revealing electric and magnetic field distributions in microelectronics and magnetic-based memory devices, however, its utility is hindered by several practical constraints, such as charging artifacts and limitations in sensitivity and in field of view. In this article, we report electron-beam-induced-current (EBIC) and secondary-electron voltage-contrast (SE-VC) with an aberration-corrected electron probe in a transmission electron microscope (TEM), as complementary techniques to electron holography, to measure electric fields and surface potentials, respectively. These two techniques were applied to ferroelectric thin films, multiferroic nanowires, and single crystals. Electrostatic potential maps obtained by off-axis electron holography were compared with EBIC and SE-VC to show that these techniques can be used as a complementary approach to validate quantitative results obtained from electron holography analysis.

  11. Neuronal responses to tactile stimuli and tactile sensations evoked by microstimulation in the human thalamic principal somatic sensory nucleus (ventral caudal).

    Science.gov (United States)

    Schmid, Anne-Christine; Chien, Jui-Hong; Greenspan, Joel D; Garonzik, Ira; Weiss, Nirit; Ohara, Shinji; Lenz, Frederick Arthur

    2016-06-01

    The normal organization and plasticity of the cutaneous core of the thalamic principal somatosensory nucleus (ventral caudal, Vc) have been studied by single-neuron recordings and microstimulation in patients undergoing awake stereotactic operations for essential tremor (ET) without apparent somatic sensory abnormality and in patients with dystonia or chronic pain secondary to major nervous system injury. In patients with ET, most Vc neurons responded to one of the four stimuli, each of which optimally activates one mechanoreceptor type. Sensations evoked by microstimulation were similar to those evoked by the optimal stimulus only among rapidly adapting neurons. In patients with ET, Vc was highly segmented somatotopically, and vibration, movement, pressure, and sharp sensations were usually evoked by microstimulation at separate sites in Vc. In patients with conditions including spinal cord transection, amputation, or dystonia, RFs were mismatched with projected fields more commonly than in patients with ET. The representation of the border of the anesthetic area (e.g., stump) or of the dystonic limb was much larger than that of the same part of the body in patients with ET. This review describes the organization and reorganization of human Vc neuronal activity in nervous system injury and dystonia and then proposes basic mechanisms. Copyright © 2016 the American Physiological Society.

  12. Neutron irradiation damage in transition metal carbides

    International Nuclear Information System (INIS)

    Matsui, Hisayuki; Nesaki, Kouji; Kiritani, Michio

    1991-01-01

    Effects of neutron irradiation on the physical properties of light transition metal carbides, TiC x , VC x and NbC x , were examined, emphasizing the characterization of irradiation induced defects in the nonstoichiometric composition. TiC x irradiated with 14 MeV (fusion) neutrons showed higher damage rates with increasing C/Ti (x) ratio. A brief discussion is made on 'cascade damage' in TiC x irradiated with fusion neutrons. Two other carbides (VC x and NbC x ) were irradiated with fission reactor neutrons. The irradiation effects on VC x were not so simple, because of the complex irradiation behavior of 'ordered' phases. For instance, complete disordering was revealed in an ordered phase, 'V 8 C 7 ', after an irradiation dose of 10 25 n/m 2 . (orig.)

  13. Characteristics of Venture Capital Network and Its Correlation with Regional Economy: Evidence from China.

    Science.gov (United States)

    Jin, Yonghong; Zhang, Qi; Shan, Lifei; Li, Sai-Ping

    2015-01-01

    Financial networks have been extensively studied as examples of real world complex networks. In this paper, we establish and study the network of venture capital (VC) firms in China. We compute and analyze the statistical properties of the network, including parameters such as degrees, mean lengths of the shortest paths, clustering coefficient and robustness. We further study the topology of the network and find that it has small-world behavior. A multiple linear regression model is introduced to study the relation between network parameters and major regional economic indices in China. From the result of regression, we find that, economic aggregate (including the total GDP, investment, consumption and net export), upgrade of industrial structure, employment and remuneration of a region are all positively correlated with the degree and the clustering coefficient of the VC sub-network of the region, which suggests that the development of the VC industry has substantial effects on regional economy in China.

  14. High toughness in the intercritically reheated coarse-grained (ICRCG) heat-affected zone (HAZ) of low carbon microalloyed steel

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Jun, E-mail: hujunral@163.com [The State Key Laboratory of Rolling and Automation, Northeastern University, Shenyang 110819 (China); Du, Lin-Xiu [The State Key Laboratory of Rolling and Automation, Northeastern University, Shenyang 110819 (China); Wang, Jian-Jun [Institute of Materials Research, School of Material and Metallurgy, Northeastern University, Shenyang 110819 (China); Xie, Hui; Gao, Cai-Ru [The State Key Laboratory of Rolling and Automation, Northeastern University, Shenyang 110819 (China); Misra, R.D.K. [Laboratory for Excellence in Advanced Steel Research, Center for Structural and Functional Materials, University of Louisiana at Lafayette, Lafayette, LA 70504-4130 (United States)

    2014-01-10

    Motivated by the small lattice mismatch between ferrite and vanadium nitride (VN), we describe here the welding thermal cycle simulation that provides high toughness in the ICRCG HAZ of low carbon V–N steel. This unique behavior is attributed to the formation of ultra-fine grained ferrite along prior austenite grain boundaries generated by the first pass welding thermal cycle with high misorientation boundaries, where V(C, N) precipitates provide potential nucleation sites for ferrite, leading to extraordinary refinement of martensite/austenite (M/A) constituent. Nitrogen stimulates the precipitation behavior of V(C, N). The nucleation of high density of V(C, N) precipitates consumes carbon-content in the austenite, leading to decrease in the carbon-content in the M/A constituent, with consequent decrease in hardness. The increase in toughness is explained in terms of Griffith's crack propagation theory.

  15. Profound hypoglycemia-ınduced by vaccinium corymbosum juice and laurocerasus fruit.

    Science.gov (United States)

    Aktan, Ahmet Hamdi; Ozcelik, Abdullah; Cure, Erkan; Cure, Medine Cumhur; Yuce, Suleyman

    2014-01-01

    An emergency intervention was performed in a 75-year-old male patient with hypoglycemic attack and blackout. Although he was diagnosed with prediabetes before 2 years, he did not take any anti-diabetic drug or follow dietary advice. He drank Vaccinium corymbosum L (VC) juice daily with a belief that it increases sexual potency. Before the development of hypoglycemia, the patient had consumed about 500 ml VC juice in addition to eating 200-300 gram of Laurocerasus officinalis (LO) fruit. The measured plasma glucose (PG) level during loss of consciousness was 30 mg/dl. The profound hypoglycemia may be an unexpected side effect of an interaction between the chemical compositions of the two plants, occurred as a result of LO fruit intake that may have a strong PG-lowering effect or related to excessive intake of VC juice. Both plants may be considered in the alternative treatment of diabetes.

  16. Chemical, mechanical, and tribological properties of pulsed-laser-deposited titanium carbide and vanadium carbide

    International Nuclear Information System (INIS)

    Krzanowski, J.E.; Leuchtner, R.E.

    1997-01-01

    The chemical, mechanical, and tribological properties of pulsed-laser-deposited TiC and VC films are reported in this paper. Films were deposited by ablating carbide targets using a KrF (λ = 248 nm) laser. Chemical analysis of the films by XPS revealed oxygen was the major impurity; the lowest oxygen concentration obtained in a film was 5 atom%. Oxygen was located primarily on the carbon sublattice of the TiC structure. The films were always substoichiometric, as expected, and the carbon in the films was identified primarily as carbidic carbon. Nanoindentation hardness tests gave values of 39 GPa for TiC and 26 GPa for VC. The friction coefficient for the TiC films was 0.22, while the VC film exhibited rapid material transfer from the steel ball to the substrate resulting in steel-on-steel tribological behavior

  17. Volatility-constrained multifractal detrended cross-correlation analysis: Cross-correlation among Mainland China, US, and Hong Kong stock markets

    Science.gov (United States)

    Cao, Guangxi; Zhang, Minjia; Li, Qingchen

    2017-04-01

    This study focuses on multifractal detrended cross-correlation analysis of the different volatility intervals of Mainland China, US, and Hong Kong stock markets. A volatility-constrained multifractal detrended cross-correlation analysis (VC-MF-DCCA) method is proposed to study the volatility conductivity of Mainland China, US, and Hong Kong stock markets. Empirical results indicate that fluctuation may be related to important activities in real markets. The Hang Seng Index (HSI) stock market is more influential than the Shanghai Composite Index (SCI) stock market. Furthermore, the SCI stock market is more influential than the Dow Jones Industrial Average stock market. The conductivity between the HSI and SCI stock markets is the strongest. HSI was the most influential market in the large fluctuation interval of 1991 to 2014. The autoregressive fractionally integrated moving average method is used to verify the validity of VC-MF-DCCA. Results show that VC-MF-DCCA is effective.

  18. Effects of duration of vitamin C supplementation during the finishing period on postmortem protein degradation, tenderness, and meat color of the longissimus muscle of calf-fed steers consuming a 0.31 or 0.59% sulfur diet.

    Science.gov (United States)

    Pogge, D J; Lonergan, S M; Hansen, S L

    2015-05-01

    High-S (HS) diets have been identified as a causative agent in the development of oxidative stress in cattle, which in postmortem muscle can negatively alter meat quality. Vitamin C (VC) is a potent antioxidant produced endogenously by cattle; however, exogenous supplementation of VC may be useful when HS diets are fed to cattle. The objective of this study was to examine the impact of duration of VC supplementation, for the first 56, 90, or 127 d, during the finishing period on meat color and tenderness of the longissimus thoracis (LT) collected from calf-fed steers consuming a 0.31 or 0.59% S diet. Angus steers ( n= 42) were stratified to pens by initial BW (304 ± 13 kg) and GeneMax marbling score (4.3 ± 0.12), and each pen was randomly assigned to 1 of 7 treatments (6 steers/pen, 1 pen/treatment), including HS (0.59% S, a combination of dried distillers grains plus solubles and sodium sulfate) control (HS CON), HS CON + 10 g VC·steer·(-1)d(-1) for the first 56 d (HS VC56), 90 d (HS VC90), or 127 d (HS VC127), low S (LS; 0.31% S) + 10 g VC·steer·(-1)d(-1) for the first 56 d (LS VC56), 90 d (LS VC90), or 127 d (LS VC127). Steers were harvested (n = 40) and, after a 24-h chill, rib sections (LT) were collected. pH was determined on each rib section before division into 3 sections for determination of 1) 7-d retail display and color and Warner-Bratzler shear force (WBSF), 2) 14-d WBSF determination, and 3) protein degradation and collagen content (2 d postmortem). Data were analyzed by ANOVA as a completely randomized design, with the fixed effect of treatment. Individual feed intake was recorded, and steer was the experimental unit. The HS steers had a greater and lesser percent of the 80- and 76-kDa subunits of calpain-1 (P ≤ 0.05), respectively, and tended to have less (P = 0.08) troponin T degradation (d2), and more (P = 0.02) collagen than LS steers. Increasing days of VC supplementation decreased (P = 0.05) the percentage of the 80 kDa subunit of

  19. Scintigraphy of liver and spleen in vinyl chloride workers

    Energy Technology Data Exchange (ETDEWEB)

    Biersack, H J; San Luis, T Jr; Lange, C E; Thelen, M; Veltman, G; Winkler, C [Bonn Univ. (Germany, F.R.). Inst. fuer Klinische und Experimentelle Nuklearmedizin; Bonn Univ. (Germany, F.R.). Klinik und Poliklinik der Haut- und Geschlechtskrankheiten; Bonn Univ. (Germany, F.R.). Radiologische Klinik)

    1977-10-01

    In 152 VC-exposed workers of whom 124 were employed in the PVC-production and 28 in VC-processing plants, liver and spleen imaging was performed using sup(99m)Tc-sulphur colloid and /sup 197/Hg-BMHP. In 101 (= 81%) of the 124 workers of the PVC-production plant and in 18 (= 64%) workers of PVC-processing factories pathological liver and spleen scintigrams were found. The most frequent pathological change in the scintigraphic image was an increase in splenic colloid accumulation, when compared with the liver uptake. Three angiosarcomas of the liver were detected through circumscribed defects of colloid accumulation. Sequential liver scintigraphy was done in 15 cases. In 7 patients with esophageal varices, considerable decrease in portal venous blood flow was demonstrated. - As a result of our investigations it can be stated that scintigraphically detectable changes are sensitive indicators of VC-induced lesions of the liver including liver fibrosis, portal hypertension and angiosarcoma.

  20. The development of a virtual camera system for astronaut-rover planetary exploration.

    Science.gov (United States)

    Platt, Donald W; Boy, Guy A

    2012-01-01

    A virtual assistant is being developed for use by astronauts as they use rovers to explore the surface of other planets. This interactive database, called the Virtual Camera (VC), is an interactive database that allows the user to have better situational awareness for exploration. It can be used for training, data analysis and augmentation of actual surface exploration. This paper describes the development efforts and Human-Computer Interaction considerations for implementing a first-generation VC on a tablet mobile computer device. Scenarios for use will be presented. Evaluation and success criteria such as efficiency in terms of processing time and precision situational awareness, learnability, usability, and robustness will also be presented. Initial testing and the impact of HCI design considerations of manipulation and improvement in situational awareness using a prototype VC will be discussed.

  1. Boundary layers and scaling relations in natural thermal convection

    Science.gov (United States)

    Shishkina, Olga; Lohse, Detlef; Grossmann, Siegfried

    2017-11-01

    We analyse the boundary layer (BL) equations in natural thermal convection, which includes vertical convection (VC), where the fluid is confined between two differently heated vertical walls, horizontal convection (HC), where the fluid is heated at one part of the bottom plate and cooled at some other part, and Rayleigh-Benard convection (RBC). For BL dominated regimes we derive the scaling relations of the Nusselt and Reynolds numbers (Nu, Re) with the Rayleigh and Prandtl numbers (Ra, Pr). For VC the scaling relations are obtained directly from the BL equations, while for HC they are derived by applying the Grossmann-Lohse theory to the case of VC. In particular, for RBC with large Pr we derive Nu Pr0Ra1/3 and Re Pr-1Ra2/3. The work is supported by the Deutsche Forschungsgemeinschaft (DFG) under the Grant Sh 405/4 - Heisenberg fellowship.

  2. Fetal cocaine exposure: analysis of vernix caseosa.

    Science.gov (United States)

    Moore, C; Dempsey, D; Deitermann, D; Lewis, D; Leikin, J

    1996-10-01

    Preliminary data regarding the use of vernix caseosa (VC) as an alternative to other biological specimens for the determination of fetal cocaine exposure are presented. Advantages of VC analysis include its presence on all newborn babies, historical record of drug exposure, and ease of collection and storage. Fifteen samples of vernix caseosa-five from babies known to be cocaine-exposed because of a positive benzoylecgonine result from the urine and umbilical cord blood and ten from nonexposed neonates-were analyzed for the presence of cocaine and metabolites. VC samples from three of the five neonates known to be cocaine-exposed were positive for cocaine or its metabolites, the other two had little or no remaining specimen. The remaining ten were negative.

  3. Assessing chlorinated ethene degradation in a large scale contaminant plume by dual carbon–chlorine isotope analysis and quantitative PCR

    DEFF Research Database (Denmark)

    Hunkeler, D.; Abe, Y.; Broholm, Mette Martina

    2011-01-01

    The fate of chlorinated ethenes in a large contaminant plume originating from a tetrachloroethene (PCE) source in a sandy aquifer in Denmark was investigated using novel methods including compound-specific carbon and chlorine isotope analysis and quantitative real-time polymerase chain reaction (q...... reduction by pyrite as indicated by the formation of cDCE and stable carbon isotope data. TCE and cDCE showed carbon isotope trends typical for reductive dechlorination with an initial depletion of 13C in the daughter products followed by an enrichment of 13C as degradation proceeded. At 1000 m downgradient......DCE. The significant enrichment of 13C in VC indicates that VC was transformed further, although the mechanismcould not be determined. The transformation of cDCEwas the rate limiting step as no accumulation of VC occurred. In summary, the study demonstrates that carbon–chlorine isotope analysis and qPCR combinedwith...

  4. Virtual cathode regime in nonstationary electric high-current discharge in hydrogen

    International Nuclear Information System (INIS)

    Baksht, F.G.; Borodin, V.S.; Zhuravlev, V.N.

    1988-01-01

    Virtual cathode (VC) regime in a non-stationary high-current hydrogen arch is constructed. Basic calculational characteristics of the near-the-cathode layer are presented. The calculation was conducted for a 1 cm long cathode under 2x10 4 A/cm 2 current density in pulse and 10 atm. pressure. A rectangular current pulse was considered. It is shown that VC formation is caused by electron temperature reduction in the near-the-cathode area. This results in the reduction of ion flux from plasma to the cathode surface and finally in the change of a sign of space charge and field intensity near the surface. Under the transition to VC regime only the cathode temperature and its effective work function are practically changed, while the rest of parameters remain approximately constant

  5. Telepresence as Educational Practice in the Third Teaching-Room

    DEFF Research Database (Denmark)

    Levinsen, Karin; Ørngreen, Rikke; Buhl, Mie

    2013-01-01

    in useful and meaningful ways. During 2011 and 2012 we have conducted a research and development project: Telepresence as educational practice in the Royal Danish Music Academy (RDAM) educations in collaboration with RDAM and their international partners within VC-based teaching and learning in the domain...... of higher music education. The presented study draws on specially designed teaching scenarios with experienced teachers who are novices to VC-based learning. The instruments involved are piano, cello and vocalist singers. The scenarios include iteration of a series of designed activities, which allows...... experiments with interventions in order to develop VC-based designs for learning in collaboration with teachers and technicians at the RDAM-end. We used various data collecting methods such as: written reports from students, MindTape sessions, and Skype interviews, focus group interviews via video conference...

  6. Pulmonary tolerance in man to continuous oxygen exposure at 3.0, 2.5, 2.0, and 1.5 ATA in Predictive Studies V

    Science.gov (United States)

    Clark, J. M.; Gelfand, R.; Flores, N. D.; Lambertsen, C. J.; Pisarello, J. B.

    1987-01-01

    Oxygen effects on pulmonary function were measured in normal, resting men who breathed oxygen continuously at 3.0, 2.5, 2.0, and 1.5 ATA to predefined limits of CNS, cardiac, or pulmonary tolerance. Rates of pulmonary symptom intensification and decrease in vital capacity (VC) increased progressively with elevation of inspired oxygen pressure. Although VC decrements occurred concurrently with symptoms, the lung volume changes became prominent when symptoms were still mild. The observed effects were consistent with the interpretation that small airway function is impaired more selectively by oxygen exposure at 3.0 and 2.5 ATA than by exposure at 2.0 and 1.5 ATA. Despite similar VC changes after oxygen exposure at 2.0 ATA for nearly 10 hr and exposure at 1.5 ATA for almost 18 hr, the 2.0 ATA exposure caused greater impairment of pulmonary function and required a longer recovery period.

  7. Painleve Analysis and Determinant Solutions of a (3+1)-Dimensional Variable-Coefficient Kadomtsev-Petviashvili Equation in Wronskian and Grammian Form

    International Nuclear Information System (INIS)

    Meng Xianghua; Tian Bo; Yao Zhenzhi; Feng Qian; Gao Yitian

    2009-01-01

    In this paper, the investigation is focused on a (3+1)-dimensional variable-coefficient Kadomtsev-Petviashvili (vcKP) equation, which can describe the realistic nonlinear phenomena in the fluid dynamics and plasma in three spatial dimensions. In order to study the integrability property of such an equation, the Painleve analysis is performed on it. And then, based on the truncated Painleve expansion, the bilinear form of the (3+1)-dimensional vcKP equation is obtained under certain coefficients constraint, and its solution in the Wronskian determinant form is constructed and verified by virtue of the Wronskian technique. Besides the Wronskian determinant solution, it is shown that the (3+1)-dimensional vcKP equation also possesses a solution in the form of the Grammian determinant. (general)

  8. Fiscal 2000 report on result of project for promoting exchange of international environmental technology information; 2000 nendo kankyo gijutsu kokusai joho koryu sokushin jigyo seika hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-03-01

    With the purpose of sharing environmental technology information of the APEC countries, the homepage structuring was commenced linking and systematizing the home pages owned by governments, institutions, enterprises, etc., as the APEC Virtual Center (APEC-VC) project, with the fiscal 2000 results reported. In creating the homepage contents, in order to disseminate more useful information for the developing countries, 'Environmental Technology Cooperation for Developing Countries' as the original contents was prepared. In building a search engine, for the purpose of improving convenience for website users of the Virtual Center, APEC VC Japan created a retrieval system on the site. In overseas investigation, the researchers visited local plants to grasp problems and the needs by enterprises and organizations on water-pollution, waste treatment and the like, with the purpose of reflecting the investigation result in the website. In addition, the researchers visited APEC VC coordinators and/or contact points to exchange opinions with the view of expanding the network. (NEDO)

  9. High toughness in the intercritically reheated coarse-grained (ICRCG) heat-affected zone (HAZ) of low carbon microalloyed steel

    International Nuclear Information System (INIS)

    Hu, Jun; Du, Lin-Xiu; Wang, Jian-Jun; Xie, Hui; Gao, Cai-Ru; Misra, R.D.K.

    2014-01-01

    Motivated by the small lattice mismatch between ferrite and vanadium nitride (VN), we describe here the welding thermal cycle simulation that provides high toughness in the ICRCG HAZ of low carbon V–N steel. This unique behavior is attributed to the formation of ultra-fine grained ferrite along prior austenite grain boundaries generated by the first pass welding thermal cycle with high misorientation boundaries, where V(C, N) precipitates provide potential nucleation sites for ferrite, leading to extraordinary refinement of martensite/austenite (M/A) constituent. Nitrogen stimulates the precipitation behavior of V(C, N). The nucleation of high density of V(C, N) precipitates consumes carbon-content in the austenite, leading to decrease in the carbon-content in the M/A constituent, with consequent decrease in hardness. The increase in toughness is explained in terms of Griffith's crack propagation theory

  10. Separation of three water-soluble vitamins by poly(dimethylsiloxane) microchannel electrophoresis with electrochemical detection.

    Science.gov (United States)

    Li, Xiang-Yun; Zhang, Qian-Li; Lian, Hong-Zhen; Xu, Jing-Juan; Chen, Hong-Yuan

    2007-09-01

    A method for rapid separation and sensitive determination of three water-soluble vitamins, pyridoxine, ascorbic acid (VC), and p-aminobenzoic acid (PABA) has been developed by PDMS microchannel electrophoresis integrated with amperometric detection. After treatment of the microchip with oxygen plasma, the peak shapes of the three analytes were essentially improved. Pyridoxine, VC, and PABA were well separated within only 80 s in a running buffer of 20 mM borate solution (pH 8.5). Good linearity was obtained within the concentration range of 2-200 microM for the three water-soluble vitamins. The detection limits were 1.0 microM for pyridoxine and VC, and 1.5 microM for PABA. The proposed method has been successfully applied to real human urine sample, without solid phase extraction, with recoveries of 80-122% for the three water-soluble vitamins.

  11. Government Sponsored Venture Capital: Blessing Or Curse?

    Directory of Open Access Journals (Sweden)

    Erika Jáki

    2017-12-01

    Full Text Available Young companies with growth opportunities face serious problems when it comes to financing. The private venture capital (VC market fails to provide sufficient funding for this segment. First, we present the main characteristics of start-up companies and market failures that can lead to government intervention. These failures include asymmetric information embodied in the business plan; high transaction costs of the investment process from the investment decision to the exit; and positive externalities in the economy, as the government prefers other goals than profit realization. Government participation is categorized as direct or indirect intervention. We present international studies showing that indirect government intervention can have both beneficial and negative effects on the vc market. Finally, the Hungarian government’s participation and intervention are evaluated on the domestic VC market.

  12. Estimation of groin recurrence risk in patients with squamous cell vulvar carcinoma by the assessment of marker gene expression in the lymph nodes

    Directory of Open Access Journals (Sweden)

    Kowalewska Magdalena

    2012-06-01

    Full Text Available Abstract Background Regional lymph node (LN status is a well-known prognostic factor for vulvar carcinoma (VC patients. Although the reliable LN assessment in VC is crucial, it presents significant diagnostic problems. We aimed to identify specific mRNA markers of VC dissemination in the LN and to address the feasibility of predicting the risk of nodal recurrence by the patterns of gene expression. Methods Sentinel and inguinal LN samples from 20 patients who had undergone surgery for stage T1-3, N0-2, M0 primary vulvar squamous cell carcinoma were analyzed. Gene expression profiles were assessed in four metastatic [LN(+] and four histologically negative [LN(−] lymph node samples obtained from four VC patients, by the Affymetrix U133 Plus 2.0 gene expression microarrays. Of the set of genes of the highest expression in the metastatic LNs compared to LN(−, seven candidate marker genes were selected: PERP, S100A8, FABP5, SFN, CA12, JUP and CSTA, and the expression levels of these genes were further analyzed by the real-time reverse transcription polymerase chain reaction (qRT-PCR in 71 LN samples. Results All of the seven genes in question were significantly increased in LN(+ compared to LN(− samples. In the initial validation of the seven putative markers of metastatic LN, the Cox proportional hazard model pointed to SFN, CA12 and JUP expression to significantly relate to the time to groin recurrence in VC patients. Conclusions Our findings first provided evidence that SFN, CA12 and JUP have a potential of marker genes for the prediction of the groin recurrence LN in VC patients.

  13. The Value Chain Approach in One Health: Conceptual Framing and Focus on Present Applications and Challenges

    Directory of Open Access Journals (Sweden)

    Nicolas Antoine-Moussiaux

    2017-12-01

    Full Text Available The value chain (VC is a major operational concept for socioeconomic analysis at meso level. Widely mobilized in development practice, it is still undergoing conceptual and practical refining, e.g., to take account of environmental and social sustainability. Briefly, VC refers to a system of value creation through the full set of actors, links, technical and commercial activities and flows involved in the provision of a good or service on a market. In the past decade, this concept has been promoted in the management of animal health. In particular, the emergence of highly pathogenic avian influenza (HPAI has triggered an interdisciplinary dynamic including VC analysis as a central tool. These efforts promoted participatory investigation methods in the analysis of health systems. Using qualitative and quantitative data, these methods acknowledge the usefulness of actors’ involvement and knowledge, hence facilitating the transdisciplinarity needed for effective action. They fit into adaptive and action-oriented strategies, fostering stakeholders’ participation. Recent research on HPAI surveillance in South-East Asia merged VC and participatory approaches to develop innovative tools for analyzing constraints to information flow. On-going interventions for HPAI prevention and control as well as the prevention of other emerging zoonotic risks in Africa are presently building on this VC framework to develop strategies for its application at national and regional scales. Based on the latter experiences, this article proposes a field-based perspective on VC applications to animal and public health systems, within a One Health approach responding to the overall challenge of complexity.

  14. Is preoperative spirometry a predictive marker for postoperative complications after colorectal cancer surgery?

    Science.gov (United States)

    Tajima, Yuki; Tsuruta, Masashi; Yahagi, Masashi; Hasegawa, Hirotoshi; Okabayashi, Koji; Shigeta, Kohei; Ishida, Takashi; Kitagawa, Yuko

    2017-09-01

    Spirometry is a basic test that provides much information about pulmonary function; it is performed preoperatively in almost all patients undergoing colorectal cancer (CRC) surgery in our hospital. However, the value of spirometry as a preoperative test for CRC surgery remains unknown. The aim of this study was to determine whether spirometry is useful to predict postoperative complications (PCs) after CRC surgery. The medical records of 1236 patients who had preoperative spirometry tests and underwent CRC surgery between 2005 and 2014 were reviewed. Preoperative spirometry results, such as forced vital capacity (FVC), one-second forced expiratory volume (FEV1), %VC (FVC/predicted VC) and FEV1/FVC (%FEV1), were analyzed with regard to PCs, including pneumonia. PCs were found in 383 (30.9%) patients, including 218 (56%) with surgical site infections, 67 (17%) with bowel obstruction, 62 (16%) with leakage and 20 (5.2%) with pneumonia. Of the spirometry results, %VC was correlated with PC according to logistic regression analysis (odds ratio, OR = 0.99, 95% confidence interval, CI = 0.98-0.99; P = 0.034). Multivariate analysis after adjusting for male sex, age, laparoscopic surgery, tumor location, operation time and blood loss showed that a lower %VC tends to be a risk factor for PC (OR = 0.99, 95% CI = 0.98-1.002; P = 0.159) and %VC was an independent risk factor for postoperative pneumonia in PCs (OR = 0.97, 95% CI = 0.94-0.99; P = 0.049). In CRC surgery, %VC may be a predictor of postoperative complications, especially pneumonia. © The Author 2017. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com

  15. Emergence of Viral hemorrhagic septicemia virus in the North American Great Lakes region is associated with low viral genetic diversity.

    Science.gov (United States)

    Thompson, Tarin M; Batts, William N; Faisal, Mohamed; Bowser, Paul; Casey, James W; Phillips, Kenneth; Garver, Kyle A; Winton, James; Kurath, Gael

    2011-08-29

    Viral hemorrhagic septicemia virus (VHSV) is a fish rhabdovirus that causes disease in a broad range of marine and freshwater hosts. The known geographic range includes the Northern Atlantic and Pacific Oceans, and recently it has invaded the Great Lakes region of North America. The goal of this work was to characterize genetic diversity of Great Lakes VHSV isolates at the early stage of this viral emergence by comparing a partial glycoprotein (G) gene sequence (669 nt) of 108 isolates collected from 2003 to 2009 from 31 species and at 37 sites. Phylogenetic analysis showed that all isolates fell into sub-lineage IVb within the major VHSV genetic group IV. Among these 108 isolates, genetic diversity was low, with a maximum of 1.05% within the 669 nt region. There were 11 unique sequences, designated vcG001 to vcG011. Two dominant sequence types, vcG001 and vcG002, accounted for 90% (97 of 108) of the isolates. The vcG001 isolates were most widespread. We saw no apparent association of sequence type with host or year of isolation, but we did note a spatial pattern, in which vcG002 isolates were more prevalent in the easternmost sub-regions, including inland New York state and the St. Lawrence Seaway. Different sequence types were found among isolates from single disease outbreaks, and mixtures of types were evident within 2 isolates from individual fish. Overall, the genetic diversity of VHSV in the Great Lakes region was found to be extremely low, consistent with an introduction of a new virus into a geographic region with previously naive host populations.

  16. Velocidade crítica como um método não invasivo para estimar a velocidade de lactato mínimo no ciclismo La velocidad crítica como un método no invasivo para estimar la velocidad de lactato mínimo en el ciclismo Critical velocity as a noninvasive method to estimate the lactate minimum velocity on cycling

    Directory of Open Access Journals (Sweden)

    Wolysson Carvalho Hiyane

    2006-12-01

    Full Text Available A velocidade de lactato mínimo (VLM representa o ponto de equilíbrio entre produção e remoção do lactato sanguíneo (lac. Com objetivo de analisar a validade da velocidade crítica (VC como método não invasivo de estimar a VLM no ciclismo outdoor, 15 ciclistas (67,9 ± 5,7kg; 1,70 ± 0,1m; 26,7 ± 4,2 anos percorreram as distâncias de 2, 4 e 6km em velódromo no menor tempo possível. A VC foi identificada pelo modelo distância-tempo a partir das combinações de séries preditivas de 2 e 4km (VC2/4, 2 e 6km (VC2/6, 4 e 6km (VC4/6 e 2, 4 e 6km (VC2/4/6. Para identificação da VLM foi realizada uma série de 2km à máxima velocidade, seguida de seis séries incrementais de 2km com 1 minuto de pausa para dosagem de lac. A VLM foi identificada visualmente (VLMv e aplicando-se função polinomial (VLMp. Não foram observadas diferenças entre VLMv (33,3 ± 2,5km.h¹ e VLMp (33,1 ± 2,6km.h¹. Com exceção da VC4/6 (34,6 ± 3,5km.h¹, os valores de VC2/4 (38,0 ± 2,2km.h¹, VC2/6 (36,1 ± 2,4km.h¹ e VC2/4/6 (36,1 ± 2,5km.h¹ diferiram da VLMp e VLMv. Os autores concluem que, apesar de ser ~1km/h acima da VLM, a VC identificada a partir de séries preditivas de maior duração (4 e 6km - aproximadamente 6 e 10 min não diferem estatisticamente e apresentam alta correlação e concordância com a VLM. No entanto, é necessário investigar se a VC representa um equilíbrio entre remoção e produção de lac durante exercícios de longa duração no ciclismo outdoor.La velocidad de lactato mínimo (VLM representa el punto de equilibrio entre la producción y la remoción de lactato sanguíneo (lac. Con el objetivo de analizar la validez de la velocidad crítica (VC como método no invasivo de estimar la VLM en el ciclismo "outdoor", 15 ciclistas (67,9 ± 5,7 kg; 1,70 ± 0,1 m; 26,7 ± 4,2 años percorrieron distancias de 2, 4 y 6 km en velódromo en el menor tiempo posible. La VC fue identificada por el modelo distancia-tiempo a partir de

  17. Critical Velocity for Shear Localization in A Mature Mylonitic Rock Analogue

    Science.gov (United States)

    Takahashi, M.; van den Ende, M.; Niemeijer, A. R.; Spiers, C. J.

    2016-12-01

    Highly localized slip zones, seen within ductile shear zones developed in nature, such as pseudotachylite bands occurring within mylonites, are widely recognized as evidence for earthquake nucleation and/or propagation within and overprinting the ductile regime. To understand brittle/frictional localization processes in ductile shear zones and to connect these to earthquake nucleation and propagation processes, we performed large velocity step-change tests on a brine-saturated, 80:20 (wt. %) halite and muscovite gouge mixture, after forming a mature mylonitic structure through pressure solution creep at low-velocity. The sharp increase in sliding strength that occurs in response to an instantaneous upward velocity-step (direct effect) is an important parameter in determining the potential for and nature of seismic rupture nucleation. We obtained reproducible results regarding low velocity mechanical behavior compared with previous work of Niemeijer and Spiers, [2006], but also obtained new insights into the effects of sudden increases in slip velocity on localization and strength evolution, at velocities above a specific critical velocity Vc ( 20 μm/sec). We found that once a ductile, mylonitic structure has developed in a shear zone, subsequent cataclastic deformation at high velocity (> Vc) is consistently localized in a narrow zone characterized by fine grains of halite aligned in arrays between foliated muscovite Due to this intense localization, structures presumably developed under low velocity conditions were still preserved in large parts of the gouge body. This switch to localized deformation is controlled by the imposed velocity, and becomes most apparent at velocities over Vc. In addition, the direct effect a decreases rapidly when the velocity exceeds Vc. This implies that slip can localize and accelerate towards seismic velocities more or less instantly once Vc is exceeded. Obtaining a measure for Vc in natural faults is therefore of key importance

  18. Perceived Health-Related Quality of Life in Women With Vulvar Neoplasia: A Cross Sectional Study.

    Science.gov (United States)

    Kobleder, Andrea; Nikolic, Nataša; Hechinger, Mareike; Denhaerynck, Kris; Hampl, Monika; Mueller, Michael D; Senn, Beate

    2016-09-01

    The aim of the study was to determine health-related quality of life (HRQoL) of women with surgically treated vulvar intraepithelial neoplasia (VIN) and vulvar cancer (VC) during the first week after hospital discharge. Further objectives were to investigate differences between women with VIN and VC as well as to examine whether correlations exist between women's symptom experience and HRQoL. This cross-sectional study was conducted in 8 hospitals in Germany and Switzerland. Women with VIN and VC rated HRQoL with the validated German Short-Form 36. Differences between HRQoL in women with VIN and VC were tested with Wilcoxon rank-sum score. The WOMen with vulvAr Neoplasia (WOMAN) - Patient reported Outcome (PRO) self-report instrument was used to measure women's symptom experience. Correlations between symptoms and HRQoL were calculated using Spearman correlation coefficient. Women with VIN and VC (n = 65) reported lower HRQoL in physical aspects (Physical Component Summary [PCS], 34.9) than that in mental aspects (Mental Component Summary, 40.5). Women with VC had lower HRQoL than women with VIN, as manifested by significant differences concerning the dimensions of "physical functioning" and "role-physical." "Difficulties in daily life" as a distressing symptom correlated with MCS and PCS. Wound-related symptoms correlated with PCS and psychosocial symptoms/issues with MCS. Analysis showed that women with vulvar neoplasia reported lower HRQoL in the physical and mental dimensions 1 week after discharge than comparable studies referring to months or years after surgery. Health-related quality of life is influenced by physical impairment because physical symptoms are prevalent 1 week after discharge. Patient education should focus on symptom management in an early postsurgical phase to enhance women's HRQoL.

  19. The induction of apoptosis and autophagy in human hepatoma SMMC-7721 cells by combined treatment with vitamin C and polysaccharides extracted from Grifola frondosa.

    Science.gov (United States)

    Zhao, Fei; Zhao, Jin; Song, Lei; Zhang, Ya-Qing; Guo, Zhong; Yang, Ke-Hu

    2017-11-01

    Polysaccharides extracted from the mushroom Grifola frondosa (GFP) are a potential anticancer agent. The objective of this study was to investigate the effect of GFP and vitamin C (VC) alone and in combination on the viability of human hepatocarcinoma SMMC-7721 and HepG2 cells. Studies designed to detect cell apoptosis and autophagy were also conducted to investigate the mechanism. Results from the cell viability assay indicated that a combination of GFP (0.2 or 0.25 mg/mL) and VC (0.3 mmol/L) (GFP/VC) led to 52.73 and 53.93% reduction in cell viability of SMMC-7721 and HepG2 cells separately after 24 h. Flow cytometric analysis indicated that GFP/VC treatment induced cell cycle arrest at the G2/M phase, and apoptosis occurred in approximately 43.62 and 42.46% of the SMMC-7721 and HepG2 cells separately. Moreover, results of Hoechst33258 and monodansylcadaverine staining, and transmission electron microscopy, showed that GFP/VC induced apoptosis and autophagy in SMMC-7721 and HepG2 cells. Western blot analysis showed changes in the expression of apoptosis-related proteins [upregulation of BAX and caspase-3, downregulation of Bcl-2, and activation of poly-(ADP-ribose)-polymerase] and autophagy protein markers (upregulation of beclin-1 and microtubule-associated protein 1A/1B light chain-3). We also demonstrated that the expression of both Akt and p-Akt was enhanced, suggesting the PI3K/Akt/mTOR pathway might not be involved in this process. Our study shows that the combined application of GFP and VC induced cell apoptosis and autophagy in vitro, and might have antitumor activity in vivo.

  20. A combined toxicity study of zinc oxide nanoparticles and vitamin C in food additives.

    Science.gov (United States)

    Wang, Yanli; Yuan, Lulu; Yao, Chenjie; Ding, Lin; Li, Chenchen; Fang, Jie; Sui, Keke; Liu, Yuanfang; Wu, Minghong

    2014-12-21

    At present, safety evaluation standards for nanofood additives are made based on the toxic effects of a single additive. Since the size, surface properties and chemical nature influence the toxicity of nanomaterials, the toxicity may have dramatically changed when nanomaterials are used as food additives in a complex system. Herein, we investigated the combined toxicity of zinc oxide nanoparticles (ZnO NPs) and vitamin C (Vc, ascorbic acid). The results showed that Vc increased the cytotoxicity significantly compared with that of the ZnO only NPs. When the cells were exposed to ZnO NPs at a concentration less than 15 mg L(-1), or to Vc at a concentration less than 300 mg L(-1), there was no significant cytotoxicity, both in the case of gastric epithelial cell line (GES-1) and neural stem cells (NSCs). However, when 15 mg L(-1) of ZnO NPs and 300 mg L(-1) of Vc were introduced to cells together, the cell viability decreased sharply indicating significant cytotoxicity. Moreover, the significant increase in toxicity was also shown in the in vivo experiments. The dose of the ZnO NPs and Vc used in the in vivo study was calculated according to the state of food and nutrition enhancer standard. After repeated oral exposure to ZnO NPs plus Vc, the injury of the liver and kidneys in mice has been indicated by the change of these indices. These findings demonstrate that the synergistic toxicity presented in a complex system is essential for the toxicological evaluation and safety assessment of nanofood.

  1. Techniques of preoxygenation in patients with ineffective face mask seal

    Directory of Open Access Journals (Sweden)

    Pankaj Kundra

    2013-01-01

    Full Text Available Background: Ineffective face mask seal is the most common cause for suboptimal pre-oxygenation. Room air entrainment can be more with vital capacity (VC breaths when the mask is not a tight fit. Aims: This study was designed to compare 5 min tidal volume (TV breathing and eight VC breaths in patients with ineffective face mask seal. Methods: Twenty eight ASA I adults with ineffective face mask seal were randomized to breathe 100% oxygen at normal TV for 5 min (Group TV and eight VC breaths (Group VC in a cross over manner through circle system at 10 L/min. End tidal oxygen concentration (EtO 2 and arterial blood gas analysis was performed to evaluate oxygenation with each technique. Statistical Analysis: Data were analysed using SPSS statistical software, version 16. Friedman′s two-way analysis of variance by ranks was used for non-parametric data. Results: Significant increase in EtO 2 (median 90 and PaO 2 (228.85 was seen in group TV when compared to group VC (EtO 2 median 85, PaO 2 147.65, P<0.05. Mean total ventilation volume in 1 min in group VC was 9.4±3.3 L/min and more than fresh gas flow (10 L/min in seven patients. In group TV, the fresh gas flow (50 L/5 min was sufficient at normal TV (mean total ventilation in 5 min 36.7±6.3 L/min. Conclusions: TV breathing for 5 min provides better pre-oxygenation in patients with ineffective mask seal with fresh gas flow of 10 L/min delivered through a circle system.

  2. The Use of Synchronous Videoconferencing Teaching to Increase Access to Specialist Nurse Education in Rural KwaZulu-Natal, South Africa

    Directory of Open Access Journals (Sweden)

    Jennifer Chipps

    2010-06-01

    Full Text Available In KwaZulu-Natal more than 50% of the population lives in the rural area but most of the health workers are based in urban centres where teaching hospitals and high incomes are common. Nursing provides the backbone of health care in the public sector. Specialist nurses such as advanced midwives or specialist HIV nurses are in short supply. Teaching via live synchronous videoconference (VC provides an opportunity to extend specialist education to nurses at rural hospitals. Aim: The aim of the study was to review and evaluate the current use of videoconference education for nurses in KwaZulu-Natal. Methodology: A review the literature on VC education in nursing using bibliometric review strategies was conducted and two nurses’ education courses conducted via videoconferencing was evaluated against a set of criteria developed and validated by the Department of TeleHealth at the University. Results: 81 publications addressing videoconference nurse education were found, most being published after 2000. Over half were descriptive studies, but were still valuable for informing this study. Based on the evaluation of the two courses against the set of criteria, the two courses were aligned sufficiently well with the measurement criteria. Additionally, the delivery of the courses via videoconferencing allowed for the identification of potential cost savings. Discussion: This evaluation indicates that these two courses have been successfully implemented using VC. In the light of the potential savings of time and money, VC can be used to teach specialist nursing courses to rural nurses. Recommendations to improve the VC courses included orientation training for presenters and encouraging more research regarding the effectiveness of VC as a teaching modality for clinical nurses in rural areas. Conclusion: More attention should be given to developing the infrastructure and skills to make this technology available and commonly used in health services in

  3. Contrasting growth properties of Nocardioides JS614 on threedifferent vinyl halides.

    Science.gov (United States)

    Taylor, Anne E; Bottomley, Peter J; Semprini, Lewis

    2018-02-01

    Ethene (ETH)-grown inocula of Nocardioides JS614 grow on vinyl chloride (VC), vinyl fluoride (VF), or vinyl bromide (VB) as the sole carbon and energy source, with faster growth rates and higher cell yields on VC and VF than on VB. However, whereas acetate-grown inocula of JS614 grow on VC and VF after a lag period, growth on VB did not occur unless supplemental ethene oxide (EtO) was present in the medium. Despite inferior growth on VB, the maximum rate of VB consumption by ETH-grown cells was ~ 50% greater than the rates of VC and VF consumption, but Br - release during VB consumption was non-stoichiometric with VB consumption (~ 66%) compared to 100% release of Cl - and F - during VC and VF consumption. Evidence was obtained for VB turnover-dependent toxicity of cell metabolism in JS614 with both acetate-dependent respiration and growth being significantly reduced by VB turnover, but no VC or VF turnover-dependent toxicity of growth was detected. Reduced growth rate and cell yield of JS614 on VB probably resulted from a combination of inefficient metabolic processing of the highly unstable VB epoxide (t 0.5  = 45 s), accompanied by growth inhibitory effects of VB metabolites on acetate-dependent metabolism. The exact role(s) of EtO in promoting growth of alkene repressed JS614 on VB remains unresolved, with evidence of EtO inducing epoxide consuming activity prior to an increase in alkene oxidizing activity and supplementing reductant supply when VB is the growth substrate.

  4. Variance-covariance measurements of anti y/sub D/ for 5.7-MeV neutrons using wall-less spherical detectors

    International Nuclear Information System (INIS)

    Marino, S.A.; Kliauga, P.; Goldhagen, P.

    1988-01-01

    Initial results of measurements of anti y/sub D/ for 5.7-MeV neutrons in wall-less spherical detectors, obtained using the variance-covariance (VC) technique, were presented in last year's Annual Report. During the past year, the electrometers have been calibrated and found to be within less than 1% of their nominal value. The VC data have been corrected for electrometer offsets and calibrations. In addition, some measurements were recalculated, excluding runs in which the relative covariance was more than 2.6 times greater than the relative variance (due to large changes in beam intensity from tuning the accelerator during a run). Pulse-height measurements of y were made in the usual manner using the same detectors, and the angle and distance from the target were the same as were used for the VC measurements. Propane-based, tissue-equivalent (TE) gas was used instead of the methane-based TE gas used when the detectors functioned as ionization chambers for the VC method. Calibrations were made using 1.5 keV Al K/sub α/ X rays. Results of the VC and pulse-height measurements are given. The new anti y/sub D/ values for the VC technique are about 7% lower than the previous values, while the pulse-height measurement values are about 25% lower than the corresponding previous values. Lower values of anti y/sub D/ are expected, due to the use of a wall-less chamber, the change from a long, thin cylinder to a sphere, and the change in irradiation angle causing the γ-ray dose fraction to more than double

  5. Emergence of viral hemorrhagic septicemia virus in the North American Great Lakes region is associated with low viral genetic diversity

    Science.gov (United States)

    Thompson, T.M.; Batts, W.N.; Faisal, M.; Bowser, P.; Casey, J.W.; Phillips, K.; Garver, K.A.; Winton, J.; Kurath, G.

    2011-01-01

    Viral hemorrhagic septicemia virus (VHSV) is a fish rhabdovirus that causes disease in a broad range of marine and freshwater hosts. The known geographic range includes the Northern Atlantic and Pacific Oceans, and recently it has invaded the Great Lakes region of North Ame­rica. The goal of this work was to characterize genetic diversity of Great Lakes VHSV isolates at the early stage of this viral emergence by comparing a partial glycoprotein (G) gene sequence (669 nt) of 108 isolates collected from 2003 to 2009 from 31 species and at 37 sites. Phylogenetic analysis showed that all isolates fell into sub-lineage IVb within the major VHSV genetic group IV. Among these 108 isolates, genetic diversity was low, with a maximum of 1.05% within the 669 nt region. There were 11 unique sequences, designated vcG001 to vcG011. Two dominant sequence types, vcG001 and vcG002, accounted for 90% (97 of 108) of the isolates. The vcG001 isolates were most widespread. We saw no apparent association of sequence type with host or year of isolation, but we did note a spatial pattern, in which vcG002 isolates were more prevalent in the easternmost sub-regions, including inland New York state and the St. Lawrence Seaway. Different sequence types were found among isolates from single disease outbreaks, and mixtures of types were evident within 2 isolates from ­individual fish. Overall, the genetic diversity of VHSV in the Great Lakes region was found to be extremely low, consistent with an introduction of a new virus into a geographic region with ­previously naïve host populations.

  6. Magnesium Attenuates Phosphate-Induced Deregulation of a MicroRNA Signature and Prevents Modulation of Smad1 and Osterix during the Course of Vascular Calcification

    Directory of Open Access Journals (Sweden)

    Loïc Louvet

    2016-01-01

    Full Text Available Vascular calcification (VC is prevalent in patients suffering from chronic kidney disease (CKD. High phosphate levels promote VC by inducing abnormalities in mineral and bone metabolism. Previously, we demonstrated that magnesium (Mg2+ prevents inorganic phosphate- (Pi- induced VC in human aortic vascular smooth muscle cells (HAVSMC. As microRNAs (miR modulate gene expression, we investigated the role of miR-29b, -30b, -125b, -133a, -143, and -204 in the protective effect of Mg2+ on VC. HAVSMC were cultured in the presence of 3 mM Pi with or without 2 mM Mg2+ chloride. Total RNA was extracted after 4 h, 24 h, day 3, day 7, and day 10. miR-30b, -133a, and -143 were downregulated during the time course of Pi-induced VC, whereas the addition of Mg2+ restored (miR-30b or improved (miR-133a, miR-143 their expression. The expression of specific targets Smad1 and Osterix was significantly increased in the presence of Pi and restored by coincubation with Mg2+. As miR-30b, miR-133a, and miR-143 are negatively regulated by Pi and restored by Mg2+ with a congruent modulation of their known targets Runx2, Smad1, and Osterix, our results provide a potential mechanistic explanation of the observed upregulation of these master switches of osteogenesis during the course of VC.

  7. Comparative analysis of niobium and vanadium carbide efficiency in the high energy mechanical milling of aluminum bronze alloy

    Directory of Open Access Journals (Sweden)

    Alexandre Nogueira Ottoboni Dias

    Full Text Available Abstract This study aims to analyze the efficiency of niobium and vanadium carbides in the high energy mechanical milling of aluminum bronze alloy. Two series of experiments were made following the same steps for both niobium carbide (NbC and vanadium carbide (VC additions: 30 g of chips were weighed and placed in a stainless steel jar with 3 % of carbide and 1 % of stearic acid for a mass/sphere relationship of 1:10. The milling was realized using a planetary ball mill for 10, 30 and 50 hours in an inert argon atmosphere at 300 rpm. Results shown in laser diffraction indicate a great reduction in the particle sizes of powders when VC is used. For 30 hours milling, D50 values ranged from 1580 µm with NbC to 182.3 µm with VC addition. The D50 values ranged from 251.5 µm with NbC to 52.26 µm with VC addition, for 50 hours milling. The scanning electron microscopy showed that in 10 hours of milling, the energy was not sufficient to achieve the shear of chips in both cases. For 30 hours, it's possible to observe particles with sizes between 100 µm and 800 µm with NbC addition while for the same milling time, with VC it's possible to see particles with different sizes, but with many shapes of fine particulates. For 50 hours milling, particles achieved the smaller sizes between 50 and 200 µm with NbC and ranging from 5 until 50 µm with VC addition.

  8. Visual cortex plasticity evokes excitatory alterations in the hippocampus

    Directory of Open Access Journals (Sweden)

    Marian Tsanov

    2009-11-01

    Full Text Available The integration of episodic sequences in the hippocampus is believed to occur during theta rhythm episodes, when cortico-hippocampal dialog results in reconfiguration of neuronal assemblies. As the visual cortex (VC is a major source of sensory information to the hippocampus, information processing in the cortex may affect hippocampal network oscillations, facilitating the induction of synaptic modifications. We investigated to what degree the field activity in the primary VC, elicited by sensory or electrical stimulation, correlates with hippocampal oscillatory and synaptic responsiveness, in freely behaving adult rats. We found that the spectral power of theta rhythm (4-10Hz in the dentate gyrus (DG, increases in parallel with high-frequency oscillations in layer 2/3 of the VC and that this correlation depends on the degree of exploratory activity. When we mimic robust thalamocortical activity by theta-burst application to dorsal lateral geniculate nucleus, a hippocampal theta increase occurs, followed by a persistent potentiation of the DG granule field population spike. Furthermore, the potentiation of DG neuronal excitability tightly correlates with the concurrently occurring VC plasticity. The concurrent enhancement of VC and DG activity is also combined with a highly negative synchronization between hippocampal and cortical low frequency oscillations. Exploration of familiar environment decreases the degree of this synchrony. Our data propose that novel visual information can induce high-power fluctuations in intrinsic excitability for both VC and hippocampus, potent enough to induce experience-dependent modulation of cortico-hippocampal connections. This interaction may comprise one of the endogenous triggers for long-term synaptic plasticity in the hippocampus.

  9. Microstructure Characteristics of Fe-Matrix Composites Reinforced by In-Situ Carbide Particulates

    Science.gov (United States)

    Huang, Xiaodong; Song, Yanpei

    2017-10-01

    Carbide particulates reinforced iron-matrix composites were prepared by in-situ synthesis reaction between Ti, V and C on liquid alloys surface. The microstructure of the composite was characterized by SEM, TEM and OM. The results showed that the main phases were α-Fe, carbide particulate; besides, there were small amounts of γ-Fe and graphite (G) in the composite. The carbides were TiVC2 and VC in the shape of short bar and graininess. The matrix consisted of martensite and small amounts of retained austenite.

  10. The effects of patterned electrical stimulation combined with voluntary contraction on spinal reciprocal inhibition in healthy individuals

    DEFF Research Database (Denmark)

    Takahashi, Yoko; Fujiwara, Toshiyuki; Yamaguchi, Tomofumi

    2017-01-01

    The aim of this study was to examine the effects of voluntary contraction (VC) on the modulation of reciprocal inhibition induced by patterned electrical stimulation (PES) in healthy individuals. Twelve healthy volunteers participated in this study. PES was applied to the common peroneal nerve...... a soleus H-reflex conditioning-test paradigm at the time points of before, immediately after, 10 min after, 20 min after, and 30 min after the tasks. PES+VC increased the amount of reciprocal inhibition, with after-effects lasting up to 20 min. PES alone increased reciprocal inhibition and maintained...

  11. Results from the search for dark matter in the Milky Way with 9 years of data of the ANTARES neutrino telescope

    Directory of Open Access Journals (Sweden)

    A. Albert

    2017-06-01

    Full Text Available Using data recorded with the ANTARES telescope from 2007 to 2015, a new search for dark matter annihilation in the Milky Way has been performed. Three halo models and five annihilation channels, WIMP+WIMP→bb¯,W+W−,τ+τ−,μ+μ− and νν¯, with WIMP masses ranging from 50 GeVc2 to 100 TeVc2, were considered. No excess over the expected background was found, and limits on the thermally averaged annihilation cross-section were set.

  12. Copine-I: Modulator of NF-kappa B Transcription and Prostate Cancer Survival

    Science.gov (United States)

    2008-01-01

    that are evolutionally conserved from Arabidopsis to Homo sapiens . Nine human copine family members have been identified (Tomsig and Creutz, 2002...Although p65:p65 homodimers are not believed to display the same high affinity for DNA as the p65:p50 heterodimer, both homo - and heterodimers...Stables VC Co pi ne M yr -C op in e Copine-I TNF Treatment (hr) R el at iv e C o p y 0 400 800 1200 1600 2000 0 0.5 1 2 4 IL-8 :VC :Copine-I

  13. Age-related vessel calcification at distal extremities is a risk factor of osteoporosis

    Directory of Open Access Journals (Sweden)

    Ling Qin

    2014-01-01

    Full Text Available We conducted a cohort study to investigate if the vessel calcifications (VCs found in the distal extremities are an index of low bone mass at multiskeletal sites. A total of 332 healthy women aged 41–80 years were recruited for bone mineral content (BMC and bone mineral density measurement using peripheral quantitative computed tomography (pQCT and dual-energy X-ray absorptiometry (DXA. Seven percent of the women showed VC at both upper and lower distal extremities based on pQCT images. Women who had VC were then compared with their age-matched non-VC counterparts. Results showed that peripheral VC was mainly formed at distal lower extremities, and the prevalence of VC increased with advancing age, with 0%, 5.6%, 9.3%, and up to 34.5% in the age groups of 41–50 years, 51–60 years, 61–70 years, and 71–80 years, respectively. Compared with the control group, the VC group showed a significantly higher body mass index (25.2 vs. 23.2, p < 0.01, lower BMC at the spine (27.4 g vs. 31.3 g, p < 0.05, and lower BMC (1.8 g vs. 2.0 g, p < 0.05 and bone mineral density (0.57 g/cm2 vs. 0.66 g/cm2, p < 0.05 at the hip as measured by DXA. The diagnosis of VC in the distal extremities by pQCT increased the diagnosis sensitivity of osteoporosis by 50%. The significance of our findings imply that in clinical settings using pQCT for bone assessment and identification of patients with VC in the distal extremities, patients should also be referred for central DXA measurement at the femoral neck for diagnosis of osteoporosis as well as further assessment of vascular disorders.

  14. Evaluation of Verticilum Chlamydosporium and Arrthrobotrys for Biological Control of Meloidogyne Incognita in Celery and Tomato

    International Nuclear Information System (INIS)

    Nyongesa, W.M.

    2002-01-01

    The ability of nematode trapping fungi and egg-parasitic fungi to colonize and persist in the rhizosphere of crop plants is thought to be an important factor influencing the success of bi logical control of root infecting nematodes. In this study, two strains of an egg parasite fungus Verticillium chlamydosporium (Vc-10 and Vc-2M) and an isolate of the nematode-trapping fungus Arthrobotrys oligospora and persistence in the rhizosphere and tomato plants in a green house pot experiment. The isolates tested differed in their pathogenicity to M. incognita and survival in the rhizosphere. An isolate of Verticillum chlamydosporium (Vc-10) was the most virulent pathogen of the nematode. Root galling was slowest in tomato plants treated with V-10 (2.2); pots treated with this isolate had the lowest final soil population of infective juveniles; there was a 62.2% and 98.5% infections of eggs and egg masses respectively by Vc-10 on tomato plants. The two isolates of Verticillium chlamydosporium (Vc-10 and Vc2M) persisted in the soil and could be re-isolated from the rhizosphere and roots of tomato plants at least 16 weeks after soil application. The final inoculum density was, however higher for Vc-10 (1.35x10 5 cfu/g soil) than Vc-2M (9.25x10 4 cfu/g soil). Arthrobotrys oligospora on the other hand did not give any significant control of the nematode on both crops, there was severe galling on the roots of plants treated with this agent. It could not be re-isolated from the plant rhizosphere sixteen weeks after soil infestation. Lack of nematode control on both crops by A.oligo spora was attributed to it's poor on establishment in the plant rhizosphere; low density and roots penetration by infective juveniles before they were ensnared in the trapping devices of this fungal biocontrol agent. The fact that it could not be re-isolated from the rhizosphere may imply that the fungus did not survive in the rhizosphere in quantities enough to enhance nematode control

  15. Outcome and prognostic factors in a French cohort of patients with myositis-associated interstitial lung disease.

    Science.gov (United States)

    Obert, Julie; Freynet, Olivia; Nunes, Hilario; Brillet, Pierre-Yves; Miyara, Makoto; Dhote, Robin; Valeyre, Dominique; Naccache, Jean-Marc

    2016-12-01

    Interstitial lung disease (ILD) is a common form of extramuscular involvement in patients with polymyositis/dermatomyositis and is associated with poor prognosis. This study was designed to describe the long-term outcome of myositis-associated ILD. This retrospective observational study was conducted in 48 consecutive patients. Two groups defined according to outcome were compared to determine prognostic factors: a "severe" group (vital capacity [VC] myositis-associated ILD had severe initial PFT results but a low mortality rate. Independent prognostic factors at presentation were initial VC and myopathic changes on electromyography. This study highlights the need for studies focusing on the correlation between muscle and lung pathogenic mechanisms.

  16. The effect of magnesium supplementation on vascular calcification in chronic kidney disease-a randomised clinical trial (MAGiCAL-CKD)

    DEFF Research Database (Denmark)

    Bressendorff, Iain; Hansen, Ditte; Schou, Morten

    2017-01-01

    INTRODUCTION: Chronic kidney disease (CKD) is associated with an increased risk of cardiovascular disease and mortality, which is thought to be caused by increased propensity towards vascular calcification (VC). Magnesium (Mg) inhibits phosphate-induced VC in vitro and in animal models and serum Mg...... the progression of coronary artery calcification (CAC) in subjects with predialysis CKD. METHODS AND ANALYSIS: We will randomise 250 subjects with estimated glomerular filtration rate of 15 to 45 mL/min/1.73 m2 to 12 months treatment with either slow-release Mg hydroxide 30 mmol/day or matching placebo in a 1...

  17. Culture Propels the Intersection of Ethos, Pathos, and Logos with Innovation and Entrepreneurship

    Directory of Open Access Journals (Sweden)

    Marta Szabo White

    2016-06-01

    Full Text Available The model from the conference website: Academic Globalization and Inter-Cultural Communication: AGIC 2016 http://www.iiis2016.org/wmsci/website/about.asp?vc=22, is depicted in Appendix 1, and serves as the inspiration for this paper.In this model, cybernetic loops, modified through: negative and positive feedback loops, and their relationships with "Academic Globalization" and "Inter-Cultural Communication" are supported by Systemics, Cybernetics and Informatics, 2016 [1]. http://www.iiis2016.org/wmsci/website/about.asp?vc=22

  18. A Virtual Class Calculus

    DEFF Research Database (Denmark)

    Ernst, Erik; Ostermann, Klaus; Cook, William Randall

    2006-01-01

    Virtual classes are class-valued attributes of objects. Like virtual methods, virtual classes are defined in an object's class and may be redefined within subclasses. They resemble inner classes, which are also defined within a class, but virtual classes are accessed through object instances...... model for virtual classes has been a long-standing open question. This paper presents a virtual class calculus, vc, that captures the essence of virtual classes in these full-fledged programming languages. The key contributions of the paper are a formalization of the dynamic and static semantics of vc...

  19. Comment on "Cheating prevention in visual cryptography".

    Science.gov (United States)

    Chen, Yu-Chi; Horng, Gwoboa; Tsai, Du-Shiau

    2012-07-01

    Visual cryptography (VC), proposed by Naor and Shamir, has numerous applications, including visual authentication and identification, steganography, and image encryption. In 2006, Horng showed that cheating is possible in VC, where some participants can deceive the remaining participants by forged transparencies. Since then, designing cheating-prevention visual secret-sharing (CPVSS) schemes has been studied by many researchers. In this paper, we cryptanalyze the Hu-Tzeng CPVSS scheme and show that it is not cheating immune. We also outline an improvement that helps to overcome the problem.

  20. Intravenous urography and voiding cystoureterography in northern Norway: A retrospective study

    International Nuclear Information System (INIS)

    Pedersen, H.K.; Pape, J.F.; Gudmundsen, T.E.; Ostensen, H.; Tromsoe Univ.

    1986-01-01

    Intravenous urography (IU) was performed in 489 patients aged 0-9 years during 1980-1983. A total of 35 (7.2%), 19 (13.1%) boys and 16 (4.7%) girls had pathological changes at IU. Of these, 11 boys and 5 girls had findings with therapeutic consequences. We have analysed the results of IU and voiding cystoureterography (VC) in 62 patients and show that a normal IU does not exclude vesicoureteral reflux into the renal pelvis. By performing only VC hydronephrosis, pyelonephritic scarring and anomalies may be missed. (orig.)

  1. Companies investments on Private Equity/Venture Capital market

    Directory of Open Access Journals (Sweden)

    Zbigniew Drewniak

    2009-12-01

    Full Text Available One of the investors on Private Equity/Venture Capital market are corporations. The share of companies in total funds raised by PE/VC funds is still on the very low level. Beside indirect investments, companies invest directly, creating special entities in one corporate structure. Capital gains are one of the advantages of these investments for companies. However, the companies have also other purposes like the acquirement and the development of new technologies, as well as the transfer of knowledge. The participation of PE/VC fund in the investment process results in the support for company expansion and the creation of company value.

  2. Is there need for both intravenous urography and voiding cystography in the evaluation of children with recurrent urinary tract infections?

    DEFF Research Database (Denmark)

    Nielsen, K K; Qvist, N; Jensen, K M

    1986-01-01

    In a prospective study 33 children (aged 6-14 years) consecutively referred for recurrent urinary tract infections (RUTI), underwent intravenous urography (IVU) as well as voiding cystography (VC). Seven children had unilateral and two children had bilateral renal scarring, while ten children had...... and the current theories on the significance of patient age and grade of VUR, we conclude that in case of a normal IVU in children with RUTI and age of at least 6 years, there is no reason to supplement the pre-treatment evaluation with VC....

  3. VIRTUAL COMMISSIONING OF A ROBOTIC CELL USING TECNOMATIX PROCESS SIMULATE

    Directory of Open Access Journals (Sweden)

    Nicolae-Adrian DUMITRASCU

    2017-06-01

    Full Text Available The concept of Virtual Commissioning (VC has become one of the most essential phases in the development and simulation of automated manufacturing processes. By creating a digital copy of the real system installment, companies have the ability to test out more complex scenarios with robots and complicated mechatronics design, greatly decreasing the startup time of the plant and shortening the product’s time to the market, while increasing the overall quality at the same time. This paper presents the core concepts of VC and all the required resources and technologies that are involved in the development of a state-of-the-art manufacturing process.

  4. Analysis on the resistive force in penetration of a rigid projectile

    Directory of Open Access Journals (Sweden)

    Xiao-wei Chen

    2014-09-01

    Full Text Available According to the dimensionless formulae of DOP (depth of penetration of a rigid projectile into different targets, the resistive force which a target exerts on the projectile during the penetration of rigid projectile is theoretically analyzed. In particular, the threshold Vc of impact velocity applicable for the assumption of constant resistive force is formulated through impulse analysis. The various values of Vc corresponding to different pairs of projectile-target are calculated, and the consistency of the relative test data and numerical results is observed.

  5. Respiratory function in iron deficiency anaemia before and after treatment.

    Science.gov (United States)

    Osmanliev, P; Tzanev, B; Prokopov, V; Gigova, D

    1975-01-01

    The present studies concern the basic ventilatory indices, the arterial blood gases, the indices of the acid-base balance and the indices of the alveolar-capillary diffusion (DLCO, SS, Dm, theta Vc) in anemia before and after treatment. Substantial changes are recorded after treatment mainly in DLCO, SS and theta Vc. These changes are predominantly due to changes in the concentration of Hb. An evaluation of both methods for the standardization of DLCO at 14,6 g Hb/100 ml blood is also presented.

  6. Searching for Roots. Pärt: Symphony No. 1, "Polyphonic" / Guy S. Rickards

    Index Scriptorium Estoniae

    Rickards, Guy S.

    1997-01-01

    Uuest heliplaadist "Searching for Roots. Pärt: Symphony No. 1, "Polyphonic". Nekrolog, Op. 3; Tubin: Symphony No. 11; Tüür: Searching for Roots. Insula deserta. Zeitraum. Royal Stockholm Philharmonic Orchestra / Paavo Järvi. Virgin Classics VC5 45212-2 (72 min.:DDD)

  7. :CHOES OF W4.R (()4.RT 3)

    African Journals Online (AJOL)

    of men to fill the gaps caused by our heavy losses. I eventually ... sics and thinking apparently of anything bar the .... afterwards that it was General Maxwell, VC, the .... to John Buchan's history, casualties were 261 ..... cussions of the past successful engagement and of ..... London Gazette, 17 July 1946, p 3718; C. Buckley:.

  8. Determination of Arsenic in Soil Alkali by Graphite Furnace Atomic Absorption Spectrophotometery Using Modified Corn Silk Fiber as Adsorbent

    International Nuclear Information System (INIS)

    Zhou, X.; Ju, S.; Liu, M.; Zhao, Y.

    2015-01-01

    A safe, rapid, simple and environmentally friendly method based modified corn silk fiber (MC), chemical modified with succinic anhydride (C/sub 4/H/sub 4/O/sub 3/), was developed for the extraction and preconcentration of As(III) in food additives soil alkali sample prior to graphite furnace atomic absorption spectrometry (GFAAS) analysis. The structure and properties of VC (unmodified corn silk fiber) and MC were analyzed and discussed by means of FTIR, SEM and TG, and the effect of adsorbent amount, pH, soil alkali solution concentration, adsorption time and adsorption temperature were carefully optimized. Under the optimum conditions, the relative standard deviations (RSD, n=6) were 1.27-3.05%, the calibration graph was linear in the range of 0-100 meu g/ L and the limits of detection (LOD) was 0.13 meu g/L. The surface of MC became loose and porous which increased the adsorption area. Comparing with VC, carboxy groups were measured in MC and the increase of negative electron group in fiber molecular made its coordination combining ability with As(III) enhanced; In comparison with the removal arsenic rate of VC, MC's significantly increased by 2.86 fold. The recovery rate of soil alkali, treated by VC and MC, reached to 96.85% and 94.32%, and it did not affected the function of soil alkali. (author)

  9. Stemcell Information: SKIP000766 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available lacement, 1% non-essential amino acid, 1 mM L-glutamine,...VC. ... 不整脈源性右室心筋症患者由来iPS細胞 human ES-like Research Grade Retrovirus SOX2, OCT3/4, KLF4, and C-MYC ... Yes ... 80% Knockout DMEM, 20% serum rep

  10. Determination of IgE antibodies to Polistes dominulus, Vespula germanica and Vespa crabro in sera of patients allergic to vespids.

    Science.gov (United States)

    Blanca, M; Garcia, F; Miranda, A; Carmona, M J; Garcia, J; Fernandez, J; Terrados, S; Vega, J M; Juarez, C

    1991-02-01

    The study was undertaken to investigate the presence of IgE antibodies to Polistes dominulus (PD), Vespula germanica (VG) and Vespa crabro (VC) in a large group of sera belonging to patients sensitized to Vespids in Spain. RAST values showed that although the majority of patients had IgE antibodies to PD, VG and VC, there was a marked predominance of PD. These results were related to the distribution of the insect in the areas where the sera were obtained. Due to geographical and insect distribution differences, the whole area was divided into three zones: Central, East and South. Comparison of the positive RAST values obtained indicated that, although the positivity to PD predominated over VG and this over VC, there were significant differences in percentage positivities to each vespid in the different regions studied. The results of the RAST absorption studies indicated that in most instances patients were originally sensitized to one vespid and were RAST positive to the other venoms due to cross-reactivity. Only in a minority of cases were coexisting antibodies to two insects present. These results show that PD and VG are the important vespids followed to a lesser extent by VC. This study provides relevant information concerning insect distribution sensitivity in a European country.

  11. Grover, Dr Arun Kumar

    Indian Academy of Sciences (India)

    Specialization: Magnetism & Superconductivity, Vortex State Studies in Superconductors, Strongly Correlated Systems Address: Vice Chancellor, Panjab University, Chandigarh 160 014, U.T.. Contact: Office: (0172) 254 1945. Residence: (0172) 254 1428. Fax: (0172) 254 1022. Email: vc@pu.ac.in, arunkgrover@gmail.com.

  12. Study on shrimp waste water and vermicompost as a nutrient source for bell peppers

    Science.gov (United States)

    The aquaculture industry generates significant nutrient-rich wastewater that is released into streams and rivers causing environmental concern. The objective of this controlled environment study was to evaluate the effect of waste shrimp water (SW), vermicompost (VC), at rates of 10%, 20%, 40%, and ...

  13. Asthma - children

    Science.gov (United States)

    ... BS, Burks AW, et al, eds. Middleton's Allergy Principles and Practice . 8th ed. Philadelphia, PA: Elsevier Saunders; 2014:chap 53. Lugogo N, Que LG, Gilstrap DL, Kraft M. Asthma: clinical diagnosis and management. In: Broaddus VC, Mason RJ, Ernst JD, et ...

  14. Asthma

    Science.gov (United States)

    ... BS, Burks AW, et al, eds. Middleton's Allergy Principles and Practice . 8th ed. Philadelphia, PA: Elsevier Saunders; 2014:chap 55. Lugogo N, Que LG, Gilstrap DL, Kraft M. Asthma: clinical diagnosis and management. In: Broaddus VC, Mason RJ, Ernst JD, et ...

  15. Supplementation with Vitamin E and Vitamin C inversely alters mitochondrial copy number and mitochondrial protein in obese, exercising rats

    Science.gov (United States)

    Controversy exists as to whether supplementation with the antioxidants vitamin E (VE) and vitamin C (VC) blocks adaptation to exercise. Exercise is a first-line means to treat obesity and its complications. While obesity alters mitochondrial (MT) function and induces insulin resistance (IR), no data...

  16. Vitamin E and vitamin C do not reduce insulin sensitivity but inhibit mitochondrial protein expression in exercising obese rats

    Science.gov (United States)

    Controversy exists as to whether supplementation with the antioxidants vitamin E (VE) and vitamin C (VC) blocks adaptation to exercise. Exercise is a first-line means to treat obesity and its complications. While diet-induced obesity alters mitochondrial (MT) function and induces insulin resistance ...

  17. Defense Horizons. Number 78, March 2015

    Science.gov (United States)

    2015-03-01

    and antelope Valley College (aVC) results in increases in number of scientists, engi- neers, and technicians from which to draw employees for the...should address best prac- tices for project valuation , what types of formalized arrangements are acceptable, and legal precedents that allow such

  18. Defense Partnerships: Documenting Trends and Emerging Topics for Action

    Science.gov (United States)

    2015-03-01

    between the air force research lab and antelope Valley College (aVC) results in increases in number of scientists, engi- neers, and technicians from...guiding document, tool, or resource should address best prac- tices for project valuation , what types of formalized arrangements are acceptable, and

  19. Framework for Evaluating Loop Invariant Detection Games in Relation to Automated Dynamic Invariant Detectors

    Science.gov (United States)

    2015-09-01

    National Vulnerability Database OS Operating System SQL Structured Query Language VC Verification Condition VBA Visual Basic for Applications...Detectability ...............................................................................................37 Figure 20. Excel VBA Codes for Checker...checks each of these assertions for detectability by Daikon. The checker is an Excel Visual Basic for Applications ( VBA ) script that checks the

  20. HIV-infected viremic long-term non-progressors and controllers display different immunological mechanisms for preserved CD4+cell counts

    DEFF Research Database (Denmark)

    Gaardbo, J; Ronit, A; Hartling, H

    2012-01-01

    161+), and regulatory T cells (Tregs, CD4+CD25+CD127lowFoxP3+) were evaluated using flow cytometry. For statistics Kruskal-Wallis test followed by Mann-Whitney U test were used. Data are given as medians. Summary of results: LTNP had higher frequency of activated CD4+ and CD8+cells compared to VC (3...

  1. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... vanadium carbide encapsulated into carbon nanotube (VC@C) with large specific surface area .... Oxidation of ZnO thin films during pulsed laser deposition process ... properties of PLBZT ferroelectric thin films synthesized by sol–gel processing ..... Synthesis, characterization and oxide ionic conductivity of -type solid ...

  2. Research on Kinematic Trajectory Simulation System of KUKA Arc Welding Robot System

    Science.gov (United States)

    Hu, Min

    2017-10-01

    In this paper, the simulation trajectory simulation of KUKA arc welding robot system is realized by means of VC platform. It is used to realize the teaching of professional training of welding robot in middle school. It provides teaching resources for the combination of work and study and integration teaching, which enriches the content of course teaching.

  3. Contribution of Polyphenol Oxidation, Chlorophyll and Vitamin C Degradation to the Blackening of Piper nigrum L.

    Science.gov (United States)

    Gu, Fenglin; Huang, Feifei; Wu, Guiping; Zhu, Hongying

    2018-02-09

    Black pepper ( Piper nigrum L.) is the most widely used spice in the world. Blackening is considered to be beneficial and important in the processing of black pepper because it contributes to its color and flavor. The purpose of this paper is to investigate polyphenol oxidation as well as the chlorophyll and vitamin C (VC) degradation in the blackening of Piper nigrum L. Black pepper was produced by four methods, and changes in polyphenols, chlorophyll and VC were studied by high performance liquid chromatography (HPLC) and ultraviolet-visible and visible (UV-Vis) spectrophotometry. The results show that polyphenol oxidase activity significantly decreased during the preparation of black pepper, and the concentrations of phenolic compounds, VC, and chlorophyll a and b also significantly decreased. Polyphenol oxidation and chlorophyll and VC degradation contribute to the blackening. A crude extract of phenolic compounds from black pepper was prepared by the system solvent method. The greater the polarity of the extraction solvent, the higher the extraction rates of the phenolic compounds and the total phenol content. Pepper phenolic compounds were analyzed by HPLC analysis.

  4. Impact of different drying trajectories on degradation of nutritional compounds in broccoli (Brassica oleracea var. italica)

    NARCIS (Netherlands)

    Jin, X.; Oliviero, T.; Sman, van der R.G.M.; Verkerk, R.; Dekker, M.; Boxtel, van A.J.B.

    2014-01-01

    This work concerns the degradation of the nutritional compounds glucoraphanin (GR) and vitamin C (Vc), and the inactivation of the enzyme myrosinase (MYR) in broccoli (Brassica oleracea var. italica) during drying with air temperatures in the range of 30e60 C. Dynamic optimization is applied to find

  5. Contribution of Polyphenol Oxidation, Chlorophyll and Vitamin C Degradation to the Blackening of Piper nigrum L.

    Directory of Open Access Journals (Sweden)

    Fenglin Gu

    2018-02-01

    Full Text Available Black pepper (Piper nigrum L. is the most widely used spice in the world. Blackening is considered to be beneficial and important in the processing of black pepper because it contributes to its color and flavor. The purpose of this paper is to investigate polyphenol oxidation as well as the chlorophyll and vitamin C (VC degradation in the blackening of Piper nigrum L. Black pepper was produced by four methods, and changes in polyphenols, chlorophyll and VC were studied by high performance liquid chromatography (HPLC and ultraviolet-visible and visible (UV-Vis spectrophotometry. The results show that polyphenol oxidase activity significantly decreased during the preparation of black pepper, and the concentrations of phenolic compounds, VC, and chlorophyll a and b also significantly decreased. Polyphenol oxidation and chlorophyll and VC degradation contribute to the blackening. A crude extract of phenolic compounds from black pepper was prepared by the system solvent method. The greater the polarity of the extraction solvent, the higher the extraction rates of the phenolic compounds and the total phenol content. Pepper phenolic compounds were analyzed by HPLC analysis.

  6. Tree Coring as an initial screening tool for typical pollutants in the subsurface

    DEFF Research Database (Denmark)

    Nielsen, Mette Algreen; Trapp, Stefan

    2014-01-01

    Previous guidelines report that tree coring is more or less useful for a variety of VOCs, such as BTEX, MTBE, trimethyl benzene, and chlorinated solvents (PCE, TCE, DCE, VC). This new guideline goes beyond the previous guidelines by including the use of a technique to screen for heavy metals, plus...

  7. Application of a new point measurement to estimate goundwater-surface water exchange

    DEFF Research Database (Denmark)

    Cremeans, Mackenzie; Devlin, J.F.; McKnight, Ursula S.

    heterogeneous. Calculated discharges were combined with geochemical data to determine the mass discharge of specific solutes (PCE, TCE, cis-DCE, and VC). Total mass discharge of the contaminants was found to be concentrated in several “hot spots” that occurred in locations determined by both magnitudes...

  8. Viral conductance : Quantifying the robustness of networks with respect to spread of epidemics

    NARCIS (Netherlands)

    Youssef, M.; Kooij, R.E.; Scoglio, C.

    2011-01-01

    In this paper, we propose a novel measure, viral conductance (VC), to assess the robustness of complex networks with respect to the spread of SIS epidemics. In contrast to classical measures that assess the robustness of networks based on the epidemic threshold above which an epidemic takes place,

  9. Association of serum fetuin-A and fetuin-A gene polymorphism in ...

    African Journals Online (AJOL)

    Dalia A. Maharem

    2013-09-12

    Sep 12, 2013 ... might affect serum fetuin-A levels. The aim of this work was to study the association between ... VC was associated with older age, male gender, longer HD duration, lower .... life [40]. Patients with severe VCs were associated with a higher ...... parameters of calcium-phosphate balance, but they noticed.

  10. Investigating the Limitations of Advanced Design Methods through Real World Application

    Science.gov (United States)

    2016-03-31

    36 War Room Laptop Display ( MySQL , JMP 9 Pro, 64-bit Windows) Georgia Tech Secure Collaborative Visualization Environment ( MySQL , JMP 9 Pro...investigate expanding the EA for VC3ATS • Would like to consider both an expansion of the use of current Java -based BPM approach and other potential EA

  11. Differences in spirometry and diffusing capacity after a 3-h wet or dry oxygen dive with a PO(2) of 150 kPa

    NARCIS (Netherlands)

    van Ooij, P. J. A. M.; van Hulst, R. A.; Houtkooper, A.; Sterk, P. J.

    2011-01-01

    Breathing oxygen with a partial pressure of >50 kPa causes pulmonary oxygen toxicity (POT), resulting in a decrease in vital capacity (VC) and in diffusing capacity for carbon monoxide (DLco). As submersion is thought to potentiate POT, we hypothesized that submerged oxygen divers are at increased

  12. Anaerobic Transformation of Chlorinated Aliphatic Hydrocarbons in a Sand Aquifer Based on Spatial Chemical Distributions

    Science.gov (United States)

    Semprini, Lewis; Kitanidis, Peter K.; Kampbell, Don H.; Wilson, John T.

    1995-04-01

    We estimated the distribution of chlorinated aliphatic hydrocarbons (CAHs) from groundwater samples collected along three transects in a sand aquifer. Trichloroethylene (TCE) leaked and contaminated the aquifer probably more than a decade before we collected the measurements. The data show significant concentrations of TCE, cis-l,2-dichloroethylene (c-DCE), vinyl chloride (VC), and ethene. We attributed DCE, VC, and ethene to the reductive dehalogenation of TCE. The CAH concentrations varied significantly with depth and correlate with sulfate and methane concentrations. Anoxic aquifer conditions exist with methane present at relatively high concentrations at depth. High concentrations of TCE correspond with the absence of methane or low methane concentrations, whereas products of TCE dehalogenation are associated with higher methane concentrations and low sulfate concentrations. Indications are that the dechlorination of TCE and DCE to VC and ethene is associated with sulfate reduction and active methanogenesis. TCE dechlorination to DCE is likely occurring under the less reducing conditions of sulfate reduction, with further reductions to VC and ethene occurring under methanogenic conditions. We estimated that about 20% of TCE has dechlorinated to ethene. The analysis of the data enhanced our knowledge of natural in situ transformation and transport processes of CAHs.

  13. Augmentation of the acute phase response in vitamin C ...

    African Journals Online (AJOL)

    Objective. To investigate the effects of vitamin C (VC) supplementation on the alterations in systemic markers of inflammation as a result of participation in a 90 km down run from Pietermaritzburg to Durban in 29 subjects who completed the 1999 Comrades Marathon. Interventions. Runners were divided into groups ...

  14. T55-L-714 Engine Development and Qualification. Engine M11 Low Cycle Fatigue Test Report. (0213-005-87),

    Science.gov (United States)

    1987-12-01

    Adjust nozzle/cylinder to obtain best runouts at cylinder, also check 2nd nozzle pVc’ first nozzle. Notify engineering of results before safety wiring and...installation of ir " GP wheel . 2.6 Complete GP assembly using reworked nozzle 2-121-100-R72 SN 37. 2.7 Measure and record all firs and , assembly

  15. Curbing the Growth of Wax Bean (Vigna unguiculata L. via a Novel Complex of Nano Zinc Oxide/Vermicompost

    Directory of Open Access Journals (Sweden)

    Farideh BEHBOUDI

    2016-12-01

    Full Text Available Vermicompost (VC samples were prepared from manure and spent mushroom compost (SMC and were impregnated with zinc oxide nanoparticles (ZnO NPs, giving ZnO NPs/VC complexes that were added into the soil in which wax beans (Vigna unguiculata L. were then planted. The study was carried out through a factorial experiment in a randomized complete block design with three factors. The experimental factors included: ZnO NPs (0, 0.4, 0.8 and 1.2 mg kg-1, two substrate types (cow manure and SMC and VC (2.5, 5 and 7.5 weight percentages. To the substrate types, adult earthworms (Eisenia fetida were added. Specifically, after three months, the prepared VC was soaked in ZnO NPs solutions, mixed with soil (according to cultivation substrate weight, then employed in wet plantation of wax beans. The obtained results showed that with increasing ZnO NPs, leaves’ chlorophyll, grains number per pod, stem length, hundred grains weight, grain yield, and the grain protein content significantly decreased. In general, the usage of these NPs in the applied amounts could curb the undesired growth of this species.

  16. The role of institutions as actors influencing Uganda’s cassava sector

    Directory of Open Access Journals (Sweden)

    Cedric Mutyaba

    2016-04-01

    Full Text Available We aim at mapping out a detailed framework that reveals the proportionate flow of cassava and its products along the value chain (VC. Furthermore, we aim at establishing the role of institutions and the linkages between institutions and other VC actors that influence the cassava VC in Uganda. We use both primary and secondary data obtained from four regions in Uganda. Results show that farmers, processors, transporters, traders, consumers and institutions are the major actors. There are four categories of institutions, viz, government, non-government, community based organisations and international agencies. Roles performed by institutions include: development and enforcement of policies, Research and Development (R&D, capacity building, and creation of market access linkages for cassava and its products. Findings reveal that there is no clear nexus and no coordination among farmers/producers, processors, traders, transporters and consumers. However, institutions are well coordinated and play various roles along the VC to influence the dynamics of actors. Policy-wise it is important to establish strong private-public partnerships to bridge the impaired linkages between the actors (farmers/producers, processors, traders, transporters, and consumers and institutions. Strong partnerships are envisaged to reduce the associated transaction costs amongst the actors.

  17. GenBank blastx search result: AK242401 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242401 J080068F24 AF179596.1 AF179596 Vibrio cholerae 569b mega-integron MInVc Vco27A, Vco27B, Vco28 (vco2...8), Vco29 (vco29), ORF23 genes, complete cds; insertion sequence IS1359 putative tr

  18. Effects of vacuum compression therapy on skin microcirculation in patients suffering from lower limb ischaemia

    NARCIS (Netherlands)

    Ubbink, D. T.; van der Oord, B. M.; Sobotka, M. R.; Jacobs, M. J.

    2000-01-01

    We investigated the short-term effect of vacuum compression (VC) treatment on skin microcirculatory perfusion in the foot of patients with lower limb ischaemia and healthy controls. Ten patients with intermittent claudication or rest pain and 5 healthy controls underwent vacuum-compression treatment

  19. Fossil Energy Program semiannual progress report, April 1990-- September 1990

    Energy Technology Data Exchange (ETDEWEB)

    Judkins, R.R.

    1991-09-01

    This report covers progress made during the period April 1, 1990, through September 30, 1990, for research and development projects that contribute to the advancement of various fossil energy technologies. Topics discussed include: ceramics and composite materials R&D, new alloys, corrosion and erosion research, coal conversion development, mild gasification. (VC)

  20. Fossil Energy Program semiannual progress report, April 1990-- September 1990

    Energy Technology Data Exchange (ETDEWEB)

    Judkins, R.R.

    1991-09-01

    This report covers progress made during the period April 1, 1990, through September 30, 1990, for research and development projects that contribute to the advancement of various fossil energy technologies. Topics discussed include: ceramics and composite materials R D, new alloys, corrosion and erosion research, coal conversion development, mild gasification. (VC)

  1. Effect of Integrated Nutrient Management on Yield and Yield ...

    African Journals Online (AJOL)

    Declining soil fertility is one of the major problems causing yield reduction of barley ... (VC) with inorganic NP on growth, yield and yield components of food barley. ... The experiments were laid out in a randomized complete block design with ...

  2. Oral verrucous carcinoma complicating a repetitive injury by the ...

    African Journals Online (AJOL)

    Here we reported a case of VC of oral cavity a particularly very aggressive, arising from prosthesis injury. Regardless of the treatment modality, given new insights into the possible aggressivity of this tumor, radiotherapy associated to chemotherapy may be a more appropriate primary treatment compared with the significant ...

  3. A Neural Circuit for Auditory Dominance over Visual Perception.

    Science.gov (United States)

    Song, You-Hyang; Kim, Jae-Hyun; Jeong, Hye-Won; Choi, Ilsong; Jeong, Daun; Kim, Kwansoo; Lee, Seung-Hee

    2017-02-22

    When conflicts occur during integration of visual and auditory information, one modality often dominates the other, but the underlying neural circuit mechanism remains unclear. Using auditory-visual discrimination tasks for head-fixed mice, we found that audition dominates vision in a process mediated by interaction between inputs from the primary visual (VC) and auditory (AC) cortices in the posterior parietal cortex (PTLp). Co-activation of the VC and AC suppresses VC-induced PTLp responses, leaving AC-induced responses. Furthermore, parvalbumin-positive (PV+) interneurons in the PTLp mainly receive AC inputs, and muscimol inactivation of the PTLp or optogenetic inhibition of its PV+ neurons abolishes auditory dominance in the resolution of cross-modal sensory conflicts without affecting either sensory perception. Conversely, optogenetic activation of PV+ neurons in the PTLp enhances the auditory dominance. Thus, our results demonstrate that AC input-specific feedforward inhibition of VC inputs in the PTLp is responsible for the auditory dominance during cross-modal integration. Copyright © 2017 Elsevier Inc. All rights reserved.

  4. vitamin c - jf-f

    African Journals Online (AJOL)

    impo

    delayed-onset muscle soreness (DOMS) which peaks after. 24 - 48 hours and subsides after ... As the evidence regarding the effect of vitamin C (VC) supple- mentation on systemic ..... Pederson EW, Ostowski K, Ibfedt T, et al. Effect of vitamin ...

  5. Event-related Potentials Reflecting the Processing of Phonological Constraint Violations

    NARCIS (Netherlands)

    Domahs, Ulrike; Kehrein, Wolfgang; Knaus, Johannes; Wiese, Richard; Schlesewsky, Matthias

    2009-01-01

    Flow are violations of phonological constraints processed in word comprehension? The present article reports the results of ail event-related potentials (ERP) Study oil a phonological constraint of German that disallows identical segments within it syllable or word (CC(i)VC(i)). We examined three

  6. Fulltext PDF

    Indian Academy of Sciences (India)

    IAS Admin

    that v. This particular speed v is chosen with an intention to help the analysis given below. If one knows the electromagnetic fields in one inertial frame, the Lorentz transformation gives the fields in any other inertial frame. In this case, the transformation equations are (see chapter 12 of [1]):. Ex. = γ(Ex + vBz) = γ(0 + 0) = 0,.

  7. Ventilation coefficient trends in the recent decades over four major ...

    Indian Academy of Sciences (India)

    viz., Mumbai, Delhi, Kolkata and Chennai is analysed to study the trends and long term ... terized by their economic development and large ... in ventilation coefficient over different regions in. India as ... VC trends in recent decades over major Indian Metropolitan cities ..... M 2009 A case study of atmospheric boundary layer.

  8. Verbal Skills in Children with ADHD. Short Report

    Science.gov (United States)

    Andreou, G.; Agapitou, P.; Karapetsas, A.

    2005-01-01

    The present study examined whether ADHD children exhibit low verbal IQ (VIQ) and distinguishable test profile on the Verbal comprehension (VC) and Freedom from distractibility (FFD) factors, and whether gender influences their verbal abilities. At the Laboratory of Neuropsychology of the Department of Special Education, University of Thessaly,…

  9. ''Localized'' tachyonic wavelet-solutions of the wave equation

    International Nuclear Information System (INIS)

    Barut, A.O.; Chandola, H.C.

    1993-05-01

    Localized-nonspreading, wavelet-solutions of the wave equation □φ=0 with group velocity v>c and phase velocity u=c 2 /v< c are constructed explicitly by two different methods. Some recent experiments seem to find evidence for superluminal group velocities. (author). 7 refs, 2 figs

  10. Synergistic antitumor cytotoxic actions of ascorbate and menadione on human prostate (DU145) cancer cells in vitro: nucleus and other injuries preceding cell death by autoschizis.

    Science.gov (United States)

    Gilloteaux, Jacques; Jamison, James M; Neal, Deborah; Summers, Jack L

    2014-04-01

    Scanning (SEM) and transmission electron microscopy (TEM) were used to characterize the cytotoxic effects of ascorbate (VC), menadione (VK3), or a VC:VK3 combination on a human prostate carcinoma cell line (DU145) following a 1-h vitamin treatment and a subsequent 24-h incubation in culture medium. Cell alterations examined by light and electron microscopy were treatment-dependent with VC + VK3 >VK3 > VC > Sham. Oxidative stress-induced damage was found in most organelles. This report describes injuries in the tumor cell nucleus (chromatin and nucleolus), mitochondria, endomembranes, lysosomal bodies (autophagocytoses) and inclusions. Morphologic alterations suggest that cytoskeleton damage is likely responsible for the superficial cytoplasmic changes, including major changes in cell shape and size and the self-excising phenomena. Unlike apoptotic bodies, the excised pieces contain ribonucleoproteins, but not organelles. These deleterious events cause a progressive, significant reduction in the tumor cell size. During nuclear alterations, the nuclei maintain their envelope during chromatolysis and karyolysis until cell death, while nucleoli undergo a characteristic segregation of their components. In addition, changes in fat and glycogen storage are consistent the cytotoxic and metabolic alterations caused by the respective treatments. All cellular ultrastructural changes are consistent with cell death by autoschizis and not apoptosis or other kinds of cell death.

  11. Intraosseous verrucous carcinoma arising from an orthokeratinized odontogenic keratocyst: A report of a rarest entity

    Directory of Open Access Journals (Sweden)

    Nagaraju Kamarthi

    2016-01-01

    Full Text Available Intraosseous verrucous carcinomas (VCs arising from odontogenic cysts are a rare entity. An unusual case of a VC arising from the orthokeratinized odontogenic cyst is described for the first time. The microscopic features of the lesion are presented.

  12. Reprogramming towards totipotency is greatly facilitated by synergistic effects of small molecules

    Directory of Open Access Journals (Sweden)

    Kei Miyamoto

    2017-04-01

    Full Text Available Animal cloning has been achieved in many species by transplanting differentiated cell nuclei to unfertilized oocytes. However, the low efficiencies of cloning have remained an unresolved issue. Here we find that the combination of two small molecules, trichostatin A (TSA and vitamin C (VC, under culture condition with bovine serum albumin deionized by ion-exchange resins, dramatically improves the cloning efficiency in mice and 15% of cloned embryos develop to term by means of somatic cell nuclear transfer (SCNT. The improvement was not observed by adding the non-treated, rather than deionized, bovine serum. RNA-seq analyses of SCNT embryos at the two-cell stage revealed that the treatment with TSA and VC resulted in the upregulated expression of previously identified reprogramming-resistant genes. Moreover, the expression of early-embryo-specific retroelements was upregulated by the TSA and VC treatment. The enhanced gene expression was relevant to the VC-mediated reduction of histone H3 lysine 9 methylation in SCNT embryos. Our study thus shows a simply applicable method to greatly improve mouse cloning efficiency, and furthers our understanding of how somatic nuclei acquire totipotency.

  13. Vitelline coat of Unio elongatulus: III. Glycan chain analysis of the 220- and 180-kD components by means of lectins.

    Science.gov (United States)

    Focarelli, R; Leotta, F; Lampariello, R; Rosati, F

    1995-02-01

    Lectins of different binding specificity were used to analyze the oligosaccharide chains of the 220- and 180-kD proteins of the Unio elongatulus egg vitelline coat (vc). The lectins ConA and RCA1 reacted with both glycoproteins, and four other lectins reacted with one or other vc components. The lectin from Galanthus nivalis, which recognizes terminal mannose residues of N-linked high mannose type oligosaccharide chains, bound specifically to the 180-kD protein. Binding sites for this lectin were found throughout the vc of the differentiating oocyte and the mature egg. Lectins specific for the O-linked oligosaccharide chains, such as AIA and PNA, reacted only with the 220-kD protein species. Binding sites for these lectins were found only in the crater region. The presence of fucosyl residues on the glycan chains was investigated with lectins from Lotus tetragonolobus and Aleuria aurantia. The latter was positive on both glycoproteins, whereas LTA was only positive to the 220-kD species. The binding sites of both these lectins were in the same areas as those of PNA and AIA. These results suggest that while the 180-kD protein is part of the entire vc structure, the 220-kD protein is prevalently accumulated in the crater region. Since this is where sperm recognition and interaction take place, it has been suggested the 220-kD protein acts as a ligand molecule in the sperm-egg interaction.

  14. Planck 2013 results. XXVII. Doppler boosting of the CMB: Eppur si muove

    DEFF Research Database (Denmark)

    Planck Collaboration,; Aghanim, N.; Armitage-Caplan, C.

    2013-01-01

    Our velocity relative to the rest frame of the cosmic microwave background (CMB) generates a dipole temperature anisotropy on the sky whichhas been well measured for more than 30 years, and has an accepted amplitude of v/c = 1.23 x 10-3, or v = 369 km-1. In addition to thissignal generated by Dop...

  15. INFLUENCE OF HYDRAULIC RETENTION TIME ON EXTENT OF PCE DECHLORINATION AND PRELIMINARY CHARACTERIZATION OF THE ENRICHMENT CULTURE. (R826694C703)

    Science.gov (United States)

    The extent of tetrachloroethene (PCE) dechlorination in two chemostats was evaluated as a function of hydraulic retention time (HRT). The inoculum of these chemostats was from an upflow anaerobic sludge blanket (UASB) reactor that rapidly converts PCE to vinyl chloride (VC) an...

  16. Vascular channels in metacarpophalangeal joints : a comparative histologic and high-resolution imaging study

    NARCIS (Netherlands)

    Scharmga, A.; Keller, K.K.; Peters, M.; van Tubergen, A.; van den Bergh, J.P.W.; van Rietbergen, B.; Weijers, R.; Loeffen, D.; Hauge, E.M.; Geusens, P.P.M.M.

    2017-01-01

    We evaluated whether cortical interruptions classified as vascular channel (VC) on high-resolution peripheral quantitative computed tomography (HR-pQCT) could be confirmed by histology. We subsequently evaluated the image characteristics of histologically identified VCs on matched single and

  17. 75 FR 66057 - Waybill Data Released in Three-Benchmark Rail Rate Proceedings

    Science.gov (United States)

    2010-10-27

    ... (CSX Transp. II), 584 F.3d 1076 (DC Cir. 2009), the Board modified its simplified rail rate guidelines...- Benchmark approach for smaller rail rate disputes. The Three-Benchmark method compares a challenged rate of...: The RSAM and R/VC >180 benchmarks. See Rate Guidelines--Non-Coal Proceedings, (Rate Guidelines) 1 S.T...

  18. [Function in patients with chronic fibrocavernous tuberculosis].

    Science.gov (United States)

    Nefedov, V B; Popova, L A; Shergina, E A

    2008-01-01

    Vital capacity (VC), forced vital capacity (FVC), forced expiratory volume in 1 second (FEV1), FEV1/VC%, PEF, MEF25, MEF50, MEF75, TLC, TGV, residual volume (RV), R(aw), R(in), R(ex), DLCO-SB, DLCO-SS, PaO2, and PaCO2 were determined in 62 patients with chronic fibrocavernous tuberculosis. Lung dysfunctions were detected in 96.8% of the patients. Changes in lung volumes and capacities were found in 90.3%, impaired bronchial patency was in 90.3%, and pulmonary gas exchange dysfunction was in 79.0%. The lung volume and capacity changes appeared as decreased VC and FVC, decreased and increased TLC, TGV, RV; impaired bronchial patency presented as decreased PEF, MEF25, MEF50, MEF75, and FEV1/VC%; and increased R(aw), R(in), R(ex); pulmonary gas exchange dysfunction manifested itself as reduced DLCO-SB, DLCO-SS, PaO2, and decreased and increased PaCO2. The magnitude of the observed functional changes ranges from slight to significant and drastic with a predominance of considerable and drastic changes in lung volumes and capacities and mild impairments of bronchial patency and pulmonary gas exchange function.

  19. [Impaired lung function in patients with moderate chronic obstructive bronchitis].

    Science.gov (United States)

    Nefedov, V B; Popova, L A; Shergina, E A

    2004-01-01

    VC, FVC, FEV1, FEV1/VC%, PEF, MEF25, MEF50, MEF75, TLC, TGV, RV, Raw, Rin, Rex, DLCO-SS, paO2 and paCO2 were determined in 22 patients with moderate chronic obstructive bronchitis (FEV1, 79-50% of the normal value). All the patients were found to have impaired bronchial patency, 90.9% of the patients had lung volume and capacity changes; pulmonary gas exchange dysfunction was present in 72.7%. Bronchial patency impairments were manifested by a decrease in FEV1, FEV1/VC%, PEF, MEF25, MEF50, MEF75, and an increase in Raw, Rin, Rex. Changes in the lung volumes and capacities appeared as higher RV, TGV, TLC, lower VC and FVC. Pulmonary gas exchange dysfunction showed up as a reduction in pO2 and DLCO-SS a reduction and an increase in paCO2. The magnitude of the functional changes observed in most patients was low. Significant and pronounced disorders were seen in one third of the patients.

  20. [Pulmonary function in patients with infiltrative pulmonary tuberculosis].

    Science.gov (United States)

    Nefedov, V B; Popova, L A; Shergina, E A

    2007-01-01

    Vital capacity (VC), forced vital capacity (FVC), forced expiratory volume in 1 second (FEV1), FEV1/VC%, PEF, MEF25, MEF50, MEF75, TLC, TGV, pulmonary residual volume (PRV), R(aw), R(in),, R(ex), DLCO-SB, DLCO-SS, PaO2, and PaCO2 were determined in 103 patients with infiltrative pulmonary tuberculosis. Pulmonary dysfunction was detected in 83.5% of the patients. Changes were found in lung volumes and capacities in 63.1%, impaired bronchial patency and pulmonary gas exchange dysfunction were in 60.2 and 41.7%, respectively. The changes in pulmonary volumes and capacities appeared as increased PRV, decreased VC and FVC, and decreased and increased TGV and TLC; impaired bronchial patency presented as decreased PEF, MEF25, MEF50, MEF75, FEV1/VC% and increased R(aw) R(in), and R(ex); pulmonary gas exchange dysfunction manifested itself as reduced DLCO-SB, DLCO-SS, and PaO2 and decreased and increased PaCO2. The magnitude of the observed functional changes was generally slight. Significant disorders were observed rarely and very pronounced ones were exceptional.

  1. [Pulmonary function in patients with disseminated pulmonary tuberculosis].

    Science.gov (United States)

    Nefedov, V B; Shergina, E A; Popova, L A

    2007-01-01

    Vital capacity (VC), forced vital capacity (FVC), forced expiratory volume in 1 second (FEV1), FEV1/VC%, PEF, MEF25%, MEF50%, MEF75%, TLS, TGV, pulmonary residual volume (PRV), Raw, Rin, Rex, DLCO-SB, DLCO-SS, PaO2, and PaCO2 were determined in 29 patients with disseminated pulmonary tuberculosis. Pulmonary dysfunction was detected in 93.1% of the patients. Changes were found in lung volumes and capacities in 65.5%, impaired bronchial patency and pulmonary gas exchange dysfunction were in 79.3 and 37.9%, respectively. The changes in pulmonary volumes and capacities appeared as increased PRV, decreased VC, FVC, and TLS, decreased and increased TGV; impaired bronchial patency presented as decreased PEF, MEF25%, MEF50%, MEF75%, and FEV1/VC% and increased Raw, Rin, and Rex; pulmonary gas exchange dysfunction manifested itself as reduced DLCO-SS and PaO2 and decreased and increased PaCO2. The observed functional changes varied from slight to significant and pronounced with a preponderance of small disorders, a lower detection rate of significant disorders, and rare detection of very pronounced ones.

  2. [Pulmonary function in patients with focal pulmonary tuberculosis].

    Science.gov (United States)

    Nefedov, V B; Popova, L A; Shergina, E A

    2008-01-01

    Vital capacity (VC), forced vital capacity (FVC), forced expiratory volume in 1 second (FEV1), FEV1/VC%, PEF, MEF25, MEF50, MEF75, TLC, TGV, pulmonary residual volume (PRV), Raw, Rin, Rcx, DLCO-SB, DLCO-SS/VA, PaO2, and PaCO2 were determined in 40 patients with focal pulmonary tuberculosis. Changes were found in lung volumes and capacities in 75%, impaired bronchial patency and pulmonary gas exchange dysfunction were in 57.5 and 25%, respectively. The lung volume and capacity changes appeared mainly as increased TGV and PRV; impaired bronchial patency presented as decreased MEF50, MEF75, and FEV1/VC%; pulmonary gas exchange dysfunction manifested itself as reduced DLCO-SB, PaO2, and PaCO2. The magnitude of the observed functional changes was generally slight. TGV and PRL increased up to 148-187 and 142-223% of the normal values, respectively; MEF50, MEF75, FEV1/VC%, and DLCO decreased to 59-24, 58-26, 78-57, and 78-67% of the normal values and PaO2 and PaCO2 did to 79-69 and 34-30 cm Hg.

  3. The Windows serial port programming handbook

    CERN Document Server

    Bai, Ying

    2004-01-01

    The fundamentals of serial port communications. Serial port programming in ANSI C and Assembly languages for MS-DOS. Serial ports interface developed in VC++ 6.0. Serial port programming in Visual Basic. Serial port programming in LabVIEW. Serial port programming in MATLAB. Serial port programming in Smalltalk. Serial port programming in Java.

  4. Design of LabVIEW based test system software for MDC electronics

    International Nuclear Information System (INIS)

    Xue Lin; Huazhong Normal Univ., Wuhan; Huang Guangming; Zhang Hongyu; Jiang Xiaoshan; Sheng Huayi; Zhuang Baoan

    2006-01-01

    This paper presents the design of Test System Software for MDC Electronics. The highly modular software, developed in LabVIEW and VC ++ 6.0, has been applied in hardware debugging and performance test. LabVIEW and its DLL calling mechanism are introduced briefly. Testing functions of the software, as well as its user interfaces, are described in detail. (authors)

  5. Hyperolius argus (Anura) in Natal: taxonomy, biogeography and ...

    African Journals Online (AJOL)

    South African frogs of the genus. Hyperolius in the Museum of Comparative Zoology,. Cambridge, Massachusetts. Ann. Transv. Mus. 20: 283 - 291. PARKER, H.W. 1930. A collection of frogs from Portuguese East. Africa. Proc. zool. Soc. Lond. 1930: 897 - 905. PASSMORE, N.I. & CARRUTHERS, V.C. 1979. South African.

  6. Singlet fermionic dark matter with Veltman conditions

    Science.gov (United States)

    Kim, Yeong Gyun; Lee, Kang Young; Nam, Soo-hyeon

    2018-07-01

    We reexamine a renormalizable model of a fermionic dark matter with a gauge singlet Dirac fermion and a real singlet scalar which can ameliorate the scalar mass hierarchy problem of the Standard Model (SM). Our model setup is the minimal extension of the SM for which a realistic dark matter (DM) candidate is provided and the cancellation of one-loop quadratic divergence to the scalar masses can be achieved by the Veltman condition (VC) simultaneously. This model extension, although renormalizable, can be considered as an effective low-energy theory valid up to cut-off energies about 10 TeV. We calculate the one-loop quadratic divergence contributions of the new scalar and fermionic DM singlets, and constrain the model parameters using the VC and the perturbative unitarity conditions. Taking into account the invisible Higgs decay measurement, we show the allowed region of new physics parameters satisfying the recent measurement of relic abundance. With the obtained parameter set, we predict the elastic scattering cross section of the new singlet fermion into target nuclei for a direct detection of the dark matter. We also perform the full analysis with arbitrary set of parameters without the VC as a comparison, and discuss the implication of the constraints by the VC in detail.

  7. Generalized modeling of multi-component vaporization/condensation phenomena for multi-phase-flow analysis

    International Nuclear Information System (INIS)

    Morita, K.; Fukuda, K.; Tobita, Y.; Kondo, Sa.; Suzuki, T.; Maschek, W.

    2003-01-01

    A new multi-component vaporization/condensation (V/C) model was developed to provide a generalized model for safety analysis codes of liquid metal cooled reactors (LMRs). These codes simulate thermal-hydraulic phenomena of multi-phase, multi-component flows, which is essential to investigate core disruptive accidents of LMRs such as fast breeder reactors and accelerator driven systems. The developed model characterizes the V/C processes associated with phase transition by employing heat transfer and mass-diffusion limited models for analyses of relatively short-time-scale multi-phase, multi-component hydraulic problems, among which vaporization and condensation, or simultaneous heat and mass transfer, play an important role. The heat transfer limited model describes the non-equilibrium phase transition processes occurring at interfaces, while the mass-diffusion limited model is employed to represent effects of non-condensable gases and multi-component mixture on V/C processes. Verification of the model and method employed in the multi-component V/C model of a multi-phase flow code was performed successfully by analyzing a series of multi-bubble condensation experiments. The applicability of the model to the accident analysis of LMRs is also discussed by comparison between steam and metallic vapor systems. (orig.)

  8. Biotransformation of tetrachloroethylene to trichloroethylene, dichloroethylene, vinyl chloride, and carbon dioxide under methanogenic conditions

    International Nuclear Information System (INIS)

    Vogel, T.M.; McCarty, P.L.

    1985-01-01

    Tetrachloroethylene (PCE) and trichloroethylene (TCE), common industrial solvents, are among the most frequent contaminants found in groundwater supplies. Due to the potential toxicity and carcinogenicity of chlorinated ethylenes, knowledge about their transformation potential is important in evaluating their environmental fate. The results of this study confirm that PCE can be transformed by reductive dehalogenation to TCE, dichloroethylene, and vinyl chloride (VC) under anaerobic conditions. In addition, [ 14 C]PCE was at least partially mineralized to CO 2 . Mineralization of 24% of the PCE occurred in a continuous-flow fixed-film methanogenic column with a liquid detention time of 4 days. TCE was the major intermediate formed, but traces of dichloroethylene isomers and VC were also found. In other column studies under a different set of methanogenic conditions, nearly quantitative conversion of PCE to VC was found. These studies clearly demonstrate that TCE and VC are major intermediates in PCE biotransformation under anaerobic conditions and suggest that the potential exists for the complete mineralization of PCE to CO 2 in soil and aquifer systems and in biological treatment processes

  9. Degradation of chlorinated compounds in an anaerobic-aerobic process

    Energy Technology Data Exchange (ETDEWEB)

    Alfan-Guzman, R.; Guerrero-Barajas, C.; Garcia-Pena, I.

    2009-07-01

    Remediation technologies that involves gas transport (e.g., soil vapor extraction and air sparging of groundwater) cause the emission of gases contaminated with chlorinated solvents. Under anaerobic conditions, reductive dechlorination of trichloroethylene (TCE) proceeds via the formation of cis and trans dichloroethene (DCEs) and vinyl chloride (VC) as intermediates. (Author)

  10. The acutely ACL injured knee assessed by MRI: changes in joint fluid, bone marrow lesions, and cartilage during the first year

    DEFF Research Database (Denmark)

    Frobell, R B; Le Graverand, M-P; Buck, R

    2008-01-01

    OBJECTIVES: To investigate changes in the knee during the first year after acute rupture of the anterior cruciate ligament (ACL) of volumes of joint fluid (JF), bone marrow lesions (BMLs), and cartilage volume (VC), and cartilage thickness (ThCcAB) and cartilage surface area (AC). To identify fac...

  11. Research Article Special Issue

    African Journals Online (AJOL)

    2016-06-15

    Jun 15, 2016 ... [9] Verma SP, Tripathi VC, Das P. Asparagus racemosus leaf extract inhibits growth of. UOK 146 renal cell carcinoma cell line: Simultaneous Oncogenic PRCCTFE3 Fusion. Transcript Inhibition and Apoptosis independent cell death. Asian Pac J Cancer Prev. 2014; 15: 1937-1941. [10] Kim BY, Cui ZG, Lee ...

  12. Aqueous root extract of Asparagus cochinchinensis (Lour.) Merr. Has antioxidant activity in D-galactose-induced aging mice.

    Science.gov (United States)

    Lei, Linghua; Chen, Yanhua; Ou, Lijun; Xu, Yinglong; Yu, Xiaoying

    2017-09-25

    Extracts of plants have been considered as sources of natural antioxidant agents. In this study, we aimed to explore the antioxidant capacity of the aqueous root extract of Asparagus cochinchinensis (Lour.) Merr. Using vitamin C (Vc) as a positive control, we analyzed the aqueous root extract of A. cochinchinensis free radical scavenging ability in vitro. We also established a mouse aging model using D-galactose and then treated it with aqueous root extract or Vc. The blood cell count and superoxide dismutase (SOD), catalase (CAT), and nitric oxide synthase (NOS) activities as well as malondialdehyde (MDA) and nitric oxide (NO) contents were measured; pathological examination of tissues was performed; and SOD, glutathione peroxidase (GPX), and NOS expression levels in the serum, liver, and brain tissues were investigated. In vitro, compared with the antioxidant Vc, the aqueous root extract showed similar 1,1-Diphenyl-2-picrylhydrazyl radical and 3-ethylbenzothiazoline-6-sulfonic·scavenging activities and even significantly increased superoxide anion (p < 0.05) and hydroxyl radical (OH) (p < 0.01) scavenging activities. The aqueous extract significantly increased the white blood cell count as well as enhanced SOD, CAT, and NOS activities (p < 0.01) in aging mice. In addition, the aqueous extract increased the NO content (p < 0.05) and reduced the MDA content (p < 0.05). The aqueous root extract of A. cochinchinensis showed as strong antioxidant ability as Vc and might prevent aging by reducing radicals.

  13. Loss of PEDF: A Novel Mechanism of Antihormone Resistance in Breast Cancer

    Science.gov (United States)

    2015-10-01

    Lewis-Wambi JS, Slifker MJ, Willis AL, Ramos P, Tapia C, Kim HR, Yerrum S, Sharma CG, Nicolas E, Balagurunathan Y, Ross EA, Jordan VC: Estrogen...J, Tan LP, Platteel I, Sluis T, Huitema S, et al. Expression of miR-21 and its targets (PTEN, PDCD4, TM1) in flat epithelial atypia of the breast in

  14. Vernonia cinerea Less. supplementation and strenuous exercise reduce smoking rate: relation to oxidative stress status and beta-endorphin release in active smokers

    Directory of Open Access Journals (Sweden)

    Yankai Araya

    2010-05-01

    Full Text Available Abstract Purpose The aim of this study was to evaluate the effects of Vernonia cinerea Less. (VC supplementation and exercise on oxidative stress biomarkers, beta-endorphin release, and the rate of cigarette smoking. Methods Volunteer smokers were randomly divided into four groups: group 1: VC supplement; group 2: exercise with VC supplement; group 3: exercise; and group 4: control. VC was prepared by wash and dry techniques and taken orally before smoking, matching the frequency of strenuous exercise (three times weekly. Before and after a two month period, exhaled carbon monoxide (CO, blood oxidative stress (malondialdehyde [MDA], nitric oxide [NOx], protein hydroperoxide [PrOOH] and total antioxidant capacity [TAC], beta-endorphin and smoking rate were measured, and statistically analyzed. Results In Group 1, MDA, PrOOH, and NOx significantly decreased, whereas TAC increased (p 0.05. In Group 3, MDA, PrOOH, NOx, TAC, and beta-endorphin levels increased significantly (p 0.05. All groups had lower levels of CO after the intervention. The smoking rate for light cigarette decreased in group 2(62.7%, 1(59.52%, 3 (53.57% and 4(14.04%, whereas in self-rolled cigarettes it decreased in group 1 (54.47%, 3 (42.30%, 2 (40% and 4 (9.2%. Conclusion Supplementation with Vernonia cinerea Less and exercise provided benefit related to reduced smoking rate, which may be related to oxidaive stress and beta-endorphine levels.

  15. Measurement of lung volumes : usefulness of spiral CT

    International Nuclear Information System (INIS)

    Kang, Ho Yeong; Kwak, Byung Kook; Lee, Sang Yoon; Kim, Soo Ran; Lee, Shin Hyung; Lee, Chang Joon; Park, In Won

    1996-01-01

    To evaluate the usefulness of spiral CT in the measurement of lung volumes. Fifteen healthy volunteers were studied by both spirometer and spiral CT at full inspiration and expiration in order to correlated their results, including total lung capacity (TLC), vital capacity (VC) and residual volume (RV). 3-D images were reconstructed from spiral CT, and we measured lung volumes at a corresponding CT window range ; their volumes were compared with the pulmonary function test (paired t-test). The window range corresponding to TLC was from -1000HU to -150HU (p=0.279, r=0.986), and for VC from -910HU to -800HU (p=0.366, r=0.954) in full-inspiratory CT. The optimal window range for RV in full-expiratory CT was from -1000HU to -450HU (p=0.757, r=0.777), and TLC-VC in full-inspiratory CT was also calculated (p=0.843, r=0.847). Spiral CT at full inspiration can used to lung volumes such as TLC, VC and RV

  16. Eot;kbt;sp•.t;klngs,, Eook Rt

    African Journals Online (AJOL)

    van die "Titanic". (1912) geopenbaar is en sowel oorlewendes as tydgenote diep getref het. In sy voorwoord tot Drums of the Birkenhead het brig. G.R.P. Roupel!, V.C., C.B., O.L., in dieselfde verband opgemerk: It is interesting to realise that those qualities which are so essential for a soldier to possess on the battlefield,.

  17. Untitled

    African Journals Online (AJOL)

    1992. Epidemiologic observations on porcine cysticercosis in a rural community of Michoacan State, Mexico. Veterinary Parasi- tology, 41 : 195-201. TSANG, V.C. & WILSON, M., 1995. Taenia solium cysticercosis : An under recognized but serious public health problem. Parasitoſ. ogy today, 1 : 124-126. VANKERCKHOVEN ...

  18. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... reanalysis winds over Kharagpur to estimate the convergence of wind, moisture and vorticity to understand the observed variations in wind speed and relative humidity, and also the increased aerosol concentrations. The variation of ventilation coefficient (VC), a factor determining the air pollution potential over a region, ...

  19. Why Do European Venture Capital Companies Syndicate?

    NARCIS (Netherlands)

    S. Manigart (Sophie); J. Bruining (Hans); A. Lockett (Andy); M. Meuleman (Miguel)

    2002-01-01

    textabstractFinancial theory, resource-based theory and access to deal flow are used to explain syndication practices among European venture capital (VC) firms. The desire to share risk and increase portfolio diversification is a more important motive for syndication than the desire to access

  20. Effect of vermicast generated from an allelopathic weed lantana (Lantana camara) on seed germination, plant growth, and yield of cluster bean (Cyamopsis tetragonoloba).

    Science.gov (United States)

    Karthikeyan, M; Hussain, N; Gajalakshmi, S; Abbasi, S A

    2014-11-01

    In perhaps the first-ever study of its kind, the effect of vermicompost, derived solely from an allelopathic weed, on the germination, growth, and yield of a botanical species, has been carried out. In test plots, the soil was treated with the vermicompost of lantana (Lantana camara) at the rates of 5, 7.5, and 10 t ha(-1), and cluster bean (Cyamopsis tetragonoloba) was grown on it. The performance of these systems was compared with the systems in which the soil was fortified with inorganic fertilizers (IFs) in concentrations equivalent to those present in the respective vermicompost (VC) treatments. Additionally, a set of control was studied in which the soil was used without fortification by either VC or IF. It was seen that up to 51.5 % greater germination success occurred in the VC treatments compared to controls. VC also supported better plant growth in terms of stem diameter, shoot length, shoot mass, number of leaves, and leaf pigments. The positive impact extended up to fruit yield. In addition, vermicast application enhanced root nodule formation, reduced disease incidence, and allowed for a smaller number of stunted plants. The results indicate that allelopathic ingredients of lantana seem to have been totally eliminated during the course of its vermicomposting and that lantana vermicompost has the potential to support germination, growth, and fruit yield better than equivalent quantities of IFs.

  1. A relativistic radiation transfer benchmark

    International Nuclear Information System (INIS)

    Munier, A.

    1988-01-01

    We use the integral form of the radiation transfer equation in an one dimensional slab to determine the time-dependent propagation of the radiation energy, flux and pressure in a collisionless homogeneous medium. First order v/c relativistic terms are included and the solution is given in the fluid frame and the laboratory frame

  2. 76 FR 52718 - Complaint About Postal Services

    Science.gov (United States)

    2011-08-23

    ... Pleadings III. Statutory Alternatives for Commission Action IV. Analysis and Written Determination V....C. 403(c). Id. at 12. II. Postal Service Pleadings On June 7, 2011, the Postal Service filed a...)(1)(B). \\8\\ The statute does not specify the precise nature of the proceedings. IV. Analysis and...

  3. Bond of Reinforcemen Under Controlled Confinement.

    Science.gov (United States)

    1991-06-01

    motivated the design of a new testing device and specimen that allow for the control and measurement of the four variables identified. STEEL-CONCRETE... Ps4 At r = r, the internal radius of the concrete cylinder increases by: Arc = rs(a t - ic Or)/Ec (5) r r(1 - Vc) + r2(1 -[) -2 rc P/pp] (6) --2

  4. Study on hydropyrolysis of maceral from Shenmu coal

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Q.; Li, W.; Chen, H.; Li, B. [Chinese Academy of Sciences, Taiyuan (China). State Key Lab of Coal Conversion

    2002-02-01

    Hydropyrolysis of maceral concentrates from Shenmu coal was systematically investigated using TGA at final temperature of 900{degree}C with heating rate of 20{degree}C/min under pressure of 0.1Mpa to 3Mpa. The effect of pressure on TG/DTG curve, distribution of elements in semi-cokes and removal of sulfur and nitrogen was investigated. The results indicated that the remarkable weight loss was observed in range from 378{degree}C to 718{degree}C, the peak temperature of the maximum reaction rate was 496{degree}C and 522{degree}C for V-C and F-C respectively, and V-C has larger weight loss rate. With increasing pressure the diffusion of hydrogen increased markedly, which led to increase of weight loss. For the element distribution in the semi-coke, the C content increased, H and O content decreased, while the S content changed little. The desulfurization and denitrogenation also increased with increase in pressure. At pressure of 3 MPa, V-C had higher desulfurization than F-C. With increased pyrolysis pressure, the combustion reactivity of semi-coke first decreased and then increased. V-C semi-coke had higher combustion reactivity than F-C semi-coke under the same conditions. 8 refs., 6 figs., 3 tabs.

  5. Impact of a wastewater treatment plant on microbial community composition and function in a hyporheic zone of a eutrophic river

    NARCIS (Netherlands)

    Atashgahi, S.; Aydin, R.; Rocha Dimitrov, M.; Sipkema, D.; Hamonts, K.; Lahti, Leo; Maphosa, F.; Kruse, T.; Saccenti, E.; Springael, D.; Dejonghe, W.; Smidt, H.

    2015-01-01

    The impact of the installation of a technologically advanced wastewater treatment plant (WWTP) on the benthic microbial community of a vinyl chloride (VC) impacted eutrophic river was examined two years before, and three and four years after installation of the WWTP. Reduced dissolved organic carbon

  6. Climate Change and Aedes Vectors: 21st Century Projections for Dengue Transmission in Europe

    Directory of Open Access Journals (Sweden)

    Jing Liu-Helmersson

    2016-05-01

    Full Text Available Warming temperatures may increase the geographic spread of vector-borne diseases into temperate areas. Although a tropical mosquito-borne viral disease, a dengue outbreak occurred in Madeira, Portugal, in 2012; the first in Europe since 1920s. This outbreak emphasizes the potential for dengue re-emergence in Europe given changing climates. We present estimates of dengue epidemic potential using vectorial capacity (VC based on historic and projected temperature (1901–2099. VC indicates the vectors' ability to spread disease among humans. We calculated temperature-dependent VC for Europe, highlighting 10 European cities and three non-European reference cities. Compared with the tropics, Europe shows pronounced seasonality and geographical heterogeneity. Although low, VC during summer is currently sufficient for dengue outbreaks in Southern Europe to commence–if sufficient vector populations (either Ae. aegypti and Ae. albopictus were active and virus were introduced. Under various climate change scenarios, the seasonal peak and time window for dengue epidemic potential increases during the 21st century. Our study maps dengue epidemic potential in Europe and identifies seasonal time windows when major cities are most conducive for dengue transmission from 1901 to 2099. Our findings illustrate, that besides vector control, mitigating greenhouse gas emissions crucially reduces the future epidemic potential of dengue in Europe.

  7. The Lipid Lowering and Cardioprotective Effects of Vernonia calvoana Ethanol Extract in Acetaminophen-Treated Rats

    Directory of Open Access Journals (Sweden)

    Godwin Eneji Egbung

    2017-12-01

    Full Text Available Background: Paracetamol overdose/abuse as a result of self-medication is a common occurrence amongst people living in low/middle income countries. The present study was designed to investigate the hypolipidemic and cardioprotective potentials of Vernonia calvoana (VC ethanol extract in acetaminophen (paracetamol-treated rats. Methods: Thirty-five Wistar rats weighing 100–150 g were randomly assigned into five groups of seven rats each. Groups 2–5 received high doses of paracetamol to induce liver damage, while group 1 was used as normal control. Afterwards, they were allowed to receive varying doses of VC (group 3 and 4 or vitamin E (group 5, whilst groups 1 and 2 were left untreated. The treatment period lasted for twenty one days after which sera were harvested and assayed for serum lipid indices using standard methods. Results: Groups 3 to 5 treated animals indicated significant decrease (p < 0.001 in low density lipoprotein cholesterol (LDL-c, total cholesterol (TC and triacylglycerol (TG levels relative to the normal and acetaminophen-treated controls, the atherogenic index showed a significant decrease (p < 0.001 in all treated groups compared with normal and acetaminophen-treated controls. However, the VC- and vitamin E-treated groups showed significant (p < 0.001 increase in high density lipoprotein cholesterol (HDL-C relative to the controls. Conclusions: Data from our study suggest that ethanol leaf extract of VC possesses probable hypolipidemic and cardioprotective effects.

  8. Original Article

    African Journals Online (AJOL)

    Abstract. Introduction: Fetuin-A, a systemic calcification inhibitor, has been negatively related to vascular calcification. (VC) and cardiovascular mortality. In this study we investigated the association between fetuin-A levels and atherosclerotic vascular complications in systemic lupus erythematosus (SLE) patients with and ...

  9. Venture Capitalist Enabled Entrepreneurial Mentoring

    DEFF Research Database (Denmark)

    Agrawal, Anirudh

    2018-01-01

    Traditionally the success of a venture capital model has been anchored around two dimensions‚ namely equity as a trade for investment and start-up valuation and profitable exits. Scholars have focused less on the inter-organizational interaction between the venture capital (VC) and start-up entre...

  10. (JASR) VOL. 10, No. 2, 2010 69 CITRUS FARMERS PRODUCTION

    African Journals Online (AJOL)

    oma

    models of citrus, production of bottled citrus juice, jams and marmalades. Although a lot of work has been done in development of improved technologies for ..... Acta. Horticulturae 123:23-27. Owoeye, T (2010) Nigeria: Training farmers will boost agricultural production. www.freshplaza.com/news_detail. Umeh, V.C, Garcia ...

  11. Corporate relocation in venture capital finance

    NARCIS (Netherlands)

    Cumming, D.; Flemming, G.; Schwienbacher, A.

    2009-01-01

    This paper introduces an analysis of international relocation decisions of venture capital (VC)-backed companies. Relocations to the United States are motivated by economic conditions as well as an improvement in the laws of the country in which the entrepreneurial firm is based. Relocations to the

  12. Investor perception towards small medium enterprises investment in Africa

    NARCIS (Netherlands)

    Aboah, J.; White, B.; Meuwissen, M.P.M.

    2015-01-01

    This study seeks to examine investor perceptions towards investing in SMEs in Africa. Data was collected via an online survey sent to investors on the Venture Capital for Africa (VC4Africa) platform. The Kendall’s coefficient of concordance was used to determine the degree of agreement among

  13. Dicty_cDB: FC-IC1431 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KHRILQN DNMMYRVC--- ---RPRYLNRHWLIDRIY*sve*milkelgkitp*lrekeslcckk*rsq*rrggdclik tqdsak*qhdv*gl Translated A...VC--- ---RPRYLNRHWLIDRIY*sve*milkelgkitp*lrekeslcckk*rsq*rrggdclik tqdsak*qhdv*gl...*rnsak*lrncgrrrafvvkneghskegvatv**k hrilqndnmmyrvc Frame C: lnrhwlidriy*sve*milkelgkitp*lrekeslcckk*rsq*rrgg

  14. How effective is a virtual consultation process in facilitating multidisciplinary decision-making for malignant epidural spinal cord compression?

    Science.gov (United States)

    Fitzpatrick, David; Grabarz, Daniel; Wang, Lisa; Bezjak, Andrea; Fehlings, Michael G; Fosker, Christopher; Rampersaud, Raja; Wong, Rebecca K S

    2012-10-01

    The purpose of this study was to assess the accuracy of a virtual consultation (VC) process in determining treatment strategy for patients with malignant epidural spinal cord compression (MESCC). A prospective clinical database was maintained for patients with MESCC. A virtual consultation process (involving exchange of key predetermined clinical information and diagnostic imaging) facilitated rapid decision-making between oncologists and spinal surgeons. Diagnostic imaging was reviewed retrospectively (by R.R.) for surgical opinions in all patients. The primary outcome was the accuracy of virtual consultation opinion in predicting the final treatment recommendation. After excluding 20 patients who were referred directly to the spinal surgeon, 125 patients were eligible for virtual consultation. Of the 46 patients who had a VC, surgery was recommended in 28 patients and actually given to 23. A retrospective review revealed that 5/79 patients who did not have a VC would have been considered surgical candidates. The overall accuracy of the virtual consultation process was estimated at 92%. The VC process for MESCC patients provides a reliable means of arriving at a multidisciplinary opinion while minimizing patient transfer. This can potentially shorten treatment decision time and enhance clinical outcomes. Copyright © 2012 Elsevier Inc. All rights reserved.

  15. A Selection of Experimental Test Cases for the Validation of CFD Codes. Volume 2. (Recueil de cas d’essai Experimentaux Pour la Validation des Codes de L’Aerodynamique Numerique. Volume 2)

    Science.gov (United States)

    1994-08-01

    Ums les cas d’essai. Ces disquettes sont disponibles ä la demande aupres des Centres de distribution nalionaux de I’AGARD. Le groupe de travail a... Tesi Matrix for Configuralion (21 q, (kPa) a (degrees) NPR From Nozzle NPR Rear Nozzle Vc Front Nozzle Ve Rear Nozzle Remarks 0.00 0 1.3 to

  16. Impact Of Landfill Closure Designs On Long-Term Natural Attenuation Of Chlorinated Hydrocarbons

    Science.gov (United States)

    2002-03-01

    petroleum hydrocarbons and VC) and to stimulate the precipitation of arsenic (Turpie et al., 2000). Such an engineered remedy provides for continued...precipitation of arsenic . This treatment system provides many advantages over remedial measures currently proposed for this and other similar sites with...1999a. Summary of the Remediation Technologies Development Forum. Phytoremediation Action Team Alternative Cover Assessment Program (ACAP

  17. INDAG newsletter, No. 7, September 2007

    International Nuclear Information System (INIS)

    2007-09-01

    The current issue presents information about the following: recent activities in Nuclear desalination in Member State; development of a joint MED/VC Simulator; DEEP Update with New Water Transport Cost Model; highlights of ongoing and future activities of the IAEA (2006-2007)

  18. ORF Alignment: NC_002128 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ing protein SopA [Large-insert cloning vector ... pSMART VC] gb|AAR05665.1| stabilization of plasmid ... ... protein A [Salmonella typhimurium] gb|AAO61293.1| ParA ... [BAC cloning vector pEBAC190G

  19. Conversion of highly active waste to solids

    International Nuclear Information System (INIS)

    Scheffler, K.

    Borosilicate glasses were selected as matrix material for solidification of highly radioactive wastes. Current laboratory work on the VERA process is described. Goals were met by a five-component glass VG-38 and a glass-ceramic VC-15. The VERA process is described: flowsheet, denitration, calcinator, fusion facility

  20. Venture Capital Throws Dough That Could Fix Health Care Woe.

    Science.gov (United States)

    Kelley, Timothy

    2017-11-01

    Some experts say that investors funding innovative startup companies can disrupt American health care, making it smarter and more efficient. Others warn that incentives must change if VC money is to make a real difference. It's a trend no one in health care can ignore.