WorldWideScience

Sample records for subclass copepoda microcrustaceans

  1. Microcrustaceans (Branchipoda and Copepoda) of Wetland Impoundments on the Savannah River Site, Aiken, South Carolina

    Energy Technology Data Exchange (ETDEWEB)

    DeBiase, Adrienne E; Taylor, Barbara E

    2005-09-21

    The United States Department of Energy’s Savannah River Site (SRS) in Aiken, Allendale, and Barnwell Counties, South Carolina, contains an abundance of freshwater wetlands and impoundments. Four large impoundments, as well as several small, abandoned farm and mill ponds, and about 400 Carolina bays and other small, isolated depression wetland ponds are located within the 893 km2 area of the SRS. Crustaceans of the orders Branchiopoda and Copepoda are nearly ubiquitous in these water bodies. Although small in size, these organisms are often very abundant. They consequently play an important trophic role in freshwater food webs supporting fish, larval salamanders, larval insects, and numerous other animals, aquatic and terrestrial. This report provides an introduction to the free-living microcrustaceans of lentic water bodies on the SRS and a comprehensive list of species known to occur there. Occurrence patterns are summarized from three extensive survey studies, supplemented with other published and unpublished records. In lieu of a key, we provide a guide to taxonomic resources and notes on undescribed species. Taxa covered include the orders Cladocera, Anostraca, Laevicaudata, and Spinicaudata of the Subclass Branchiopoda and the Superorders Calanoida and Cyclopoida of Subclass Copepoda. Microcrustaceans of the Superorder Harpacticoida of the Subclass Copepoda and Subclass Ostracoda are also often present in lentic water bodies. They are excluded from this report because they have not received much study at the species level on the SRS.

  2. Microcrustaceans (Branchiopoda and Copepoda) of Wetland Ponds and Impoundments on the Savannah River Site, Aiken, South Carolina

    Energy Technology Data Exchange (ETDEWEB)

    Adrienne E. DeBiase; Barbara E. Taylor

    2005-09-21

    The United States Department of Energy's Savannah River Site (SRS) in Aiken, Allendale, and Barnwell Counties, South Carolina, contains an abundance of freshwater wetlands and impoundments. Four large impoundments, as well as several small, abandoned farm and mill ponds, and about 400 Carolina bays and other small, isolated depression wetland ponds are located within the 893 km2 area of the SRS. Crustaceans of the orders Branchiopoda and Copepoda are nearly ubiquitous in these water bodies. Although small in size, these organisms are often very abundant. They consequently play an important trophic role in freshwater food webs supporting fish, larval salamanders, larval insects, and numerous other animals, aquatic and terrestrial. This report provides an introduction to the free-living microcrustaceans of lentic water bodies on the SRS and a comprehensive list of species known to occur there. Occurrence patterns are summarized from three extensive survey studies, supplemented with other published and unpublished records. In lieu of a key, we provide a guide to taxonomic resources and notes on undescribed species. Taxa covered include the orders Cladocera, Anostraca, Laevicaudata, and Spinicaudata of the Subclass Branchiopoda and the Superorders Calanoida and Cyclopoida of Subclass Copepoda. Microcrustaceans of the Superorder Harpacticoida of the Subclass Copepoda and Subclass Ostracoda are also often present in lentic water bodies. They are excluded from this report because they have not received much study at the species level on the SRS.

  3. Biodiversity of microcrustaceans (Cladocera, Copepoda in a lowland river ecosystem

    Directory of Open Access Journals (Sweden)

    Maciej Karpowicz

    2016-06-01

    Full Text Available This study presents comprehensive research on microcrustacean diversity in different types of aquatic environments in the Upper Narew Valley over five years. A total of 559 samples were analyzed, and 74 species of crustacean zooplankton were identified. Metacyclops planus (Gurney, 1909 is a new species for the fauna of Poland and was found in oxbow lakes and tributary streams. The results of the study suggest that oxbow lakes, with more than 80% of all recorded species, may significantly contribute to the regional biodiversity of floodplain rivers. The highest crustacean community diversity was observed in the semi-lotic oxbow lakes, which emphasizes the role of intermediate disturbance in enhancing biodiversity of water bodies in river valleys. Generally, more “heterogeneous” habitats, such as small oxbow lakes and tributary streams, had higher crustacean species richness. However, a sampling station that was quite “homogeneous”, the Narew River upstream the Siemianówka Reservoir, had high crustacean species richness. The species accumulation curves revealed that approximately 50 - 100 zooplankton samples taken from different environments of river valley are required to establish crustacean species richness. These data could be important for river catchment management and could act as pilot survey data for monitoring plans.

  4. Spatial distribution and temporal variation of microcrustaceans assembly (Cladocera and Copepoda in different compartments of a reservoir in the brazilian semiarid region

    Directory of Open Access Journals (Sweden)

    Josiane Souza Santos

    2018-04-01

    Full Text Available Abstract Aim: The objective of this study was to investigate the spatial and temporal variation of microcrustacean assemblages of a reservoir in the Brazilian semiarid region. Methods Physical and chemical water variables and samples of microcrustaceans were collected at eight sites of the reservoir between July 2013 and November 2014, in a total of seven campaigns. For this study, the reservoir was categorized in two compartments: lateral and central. Results Limnological variables showed significant temporal variation (PERMANOVA, Pseudo-F = 19.51, p = 0.001. Higher turbidity values and suspended solids were observed in the rainiest months, while during the dry months, we measured higher values of transparency, dissolved oxygen, and chlorophyll-a. It was not found significant spatial variation of limnological variables (PERMANOVA, Pseudo-F = 0.96; p = 0.394. During the study period, ten species were recorded: four Cladocera (Ceriodaphnia cornuta, Daphnia gessneri, Diaphanosoma birgei and Diaphanosoma spinulosum three Copepoda Calanoida (Argyrodiaptomus azevedoi, Notodiaptomus cearensis and Notodiaptomus iheringi and three Copepoda Cyclopoida (Macrocyclops albidus, Thermocyclops minutus and Thermocyclops decipiens. The microcrustacean assemblages showed significant temporal variation (PERMANOVA, Pseudo-F = 4.34; p = 0.001 as well as significant spatial variation (PERMANOVA, Pseudo-F = 9.46; p = 0.001. The highest values of abundance and richness were observed in the lateral compartment, this result is mainly related to the presence of aquatic macrophytes in this region, because the analysis of partial RDA indicated that limnological variables explained only 11% of this variation (Pseudo-F = 2.08, p = 0.001. Conclusions The results suggest that the seasonality of the semiarid is an important factor in the temporal dynamics of the limnological variables, while the aquatic macrophytes play an important role in the spatial distribution of the

  5. Taxonomic resolutions based on 18S rRNA genes: a case study of subclass copepoda.

    Directory of Open Access Journals (Sweden)

    Shu Wu

    Full Text Available Biodiversity studies are commonly conducted using 18S rRNA genes. In this study, we compared the inter-species divergence of variable regions (V1-9 within the copepod 18S rRNA gene, and tested their taxonomic resolutions at different taxonomic levels. Our results indicate that the 18S rRNA gene is a good molecular marker for the study of copepod biodiversity, and our conclusions are as follows: 1 18S rRNA genes are highly conserved intra-species (intra-species similarities are close to 100%; and could aid in species-level analyses, but with some limitations; 2 nearly-whole-length sequences and some partial regions (around V2, V4, and V9 of the 18S rRNA gene can be used to discriminate between samples at both the family and order levels (with a success rate of about 80%; 3 compared with other regions, V9 has a higher resolution at the genus level (with an identification success rate of about 80%; and 4 V7 is most divergent in length, and would be a good candidate marker for the phylogenetic study of Acartia species. This study also evaluated the correlation between similarity thresholds and the accuracy of using nuclear 18S rRNA genes for the classification of organisms in the subclass Copepoda. We suggest that sample identification accuracy should be considered when a molecular sequence divergence threshold is used for taxonomic identification, and that the lowest similarity threshold should be determined based on a pre-designated level of acceptable accuracy.

  6. Spatial distribution and temporal variation of microcrustaceans assembly (Cladocera and Copepoda) in different compartments of a reservoir in the brazilian semiarid region

    OpenAIRE

    Josiane Souza Santos; Nadson Ressyé Simões; Sérgio Luiz Sonoda

    2018-01-01

    Abstract Aim: The objective of this study was to investigate the spatial and temporal variation of microcrustacean assemblages of a reservoir in the Brazilian semiarid region. Methods Physical and chemical water variables and samples of microcrustaceans were collected at eight sites of the reservoir between July 2013 and November 2014, in a total of seven campaigns. For this study, the reservoir was categorized in two compartments: lateral and central. Results Limnological variables showe...

  7. Diversity and structure of microcrustacean assemblages (Cladocera and Copepoda and limnological variability in perennial and intermittent pools in a semi-arid region, Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Nadson R. Simões

    2011-12-01

    Full Text Available Temporary wetlands undergo recurrent drought due to the scarcity of water, which disrupts the hydrological connectivity with adjacent aquatic systems. However, some environments retain water for longer periods, allowing greater persistence of the community. The current study evaluated differences in the microcrustacean assemblages and limnological variability between perennial and intermittent pools in a semi-arid region of Brazil. The abiotic features (water temperature, pH, total alkalinity, electrical conductivity and depth of intermittent pools were affected more than perennial pools due to loss of water volume. This may have contributed to a higher average richness and diversity index in some intermittent pools and differences in the structure of the assemblages. The lowest species richness and diversity were recorded where physical factors, such as a large quantity of suspended solids and variability in the electrical conductivity of the water and pH, make the environment unsuitable for these organisms. These results suggest that community development in intermittent pools is interrupted by the dry season; when the water returns, due to rainfall or rising groundwater, each pond undergoes a different process of colonization. In these circumstances, the biological importance of temporary aquatic environments is clear, since such pools provide shelters and have an important role in the maintenance of the regional diversity of aquatic environments.

  8. Copepoda: Siphonostomatoida

    African Journals Online (AJOL)

    On the fine structure of female CaJigus infeslans Heller, 1865. (Copepoda: Siphonostomatoida). W.H. Oldewage* and J.G. van As. Research Unit for Fish Biology, Rand Afrikaans University, P.O. Box 524, Johannesburg, 2000, Republic of South Africa. Received 13 April 1987; accepted 16 November 1987. Although much ...

  9. COPEPODA, THERODAMASIDAE

    African Journals Online (AJOL)

    COPEPODA) parasitic on New Zealand freshwater fish with a re-examination of. Paeonodes exiguus Wilson. Zool. Pubis Vict. Univ. Wellington, 50: 32-39. TRIPATHI, Y S. 1960. Parasitic copepods from Indian fishes. II: two new families. Therodamasidae and Catlaphillidae. Sobretiro del libro homenage al Doctor Eduardo.

  10. The Essence of Subclassing

    DEFF Research Database (Denmark)

    Madsen, Ole Lehrmann; Møller-Pedersen, Birger

    The essence of subclassing is the ability to represent classification hierarchies reflecting domain concepts. With the right class mechanism there is no need for a separate type/subtype mechanism, and general classes may have behavior specifications so that subclassing also implies code reuse....... Sometimes the application is so well defined (known) that developers may readily start out with classes that represent domain concepts. Singular objects have been around for some time, so a new kind of language with equal support for both objects and classes would simply ask for tool support for objects...

  11. Copepoda endoparasitic of tropical holothurians

    NARCIS (Netherlands)

    Stock, Jan H.

    1968-01-01

    A number of Copepoda of the family Lichomolgidae, all endoparasitic in tropical holothurians, has been described. All belong to the group of genera related to Paranthessius, as borne out by the structure of their appendages, although the body-shape often has undergone modifications due to the

  12. Pass-by-Subclass Parameters

    DEFF Research Database (Denmark)

    Madsen, Anders Bach; Ernst, Erik

    2010-01-01

    where computations involving types are used. Such subclasses are not optimized for being beautiful expositions of application domain concepts, they are much more like function applications or method calls: They occur inline in "client code", they may bind relatively complex expressions, and they rely...

  13. Diversity of micro-crustaceans in temporary habitats of the province ...

    African Journals Online (AJOL)

    ... and Eucypris virens (Ostracoda). Our results highlight the importance of temporary habitats as potential biodiversity hotspots, in spite of a few carried out by freshwater ecologists and taxonomists in undertaking scientific investigations in these environments. Key words: Ostracoda, cladocera, copepoda, biodiversity, Izmir, ...

  14. Variation in Assemblages of Small Fishes and Microcrustaceans After Inundation of Rarely Flooded Wetlands of the Lower Okavango Delta, Botswana

    Science.gov (United States)

    Siziba, Nqobizitha; Chimbari, Moses J.; Masundire, Hillary; Mosepele, Ketlhatlogile; Ramberg, Lars

    2013-12-01

    Water extraction from floodplain river systems may alter patterns of inundation of adjacent wetlands and lead to loss of aquatic biodiversity. Water reaching the Okavango Delta (Delta), Botswana, may decrease due to excessive water extraction and climate change. However, due to poor understanding of the link between inundation of wetlands and biological responses, it is difficult to assess the impacts of these future water developments on aquatic biota. Large floods from 2009 to 2011 inundated both rarely and frequently flooded wetlands in the Delta, creating an opportunity to examine the ecological significance of flooding of wetlands with widely differing hydrological characteristics. We studied the assemblages of small fishes and microcrustaceans, together with their trophic relationships, in temporary wetlands of the lower Delta. Densities of microcrustaceans in temporary wetlands were generally lower than previously recorded in these habitats. Microcrustacean density varied with wetland types and hydrological phase of inundation. High densities of microcrustaceans were recorded in the 2009 to 2010 flooding season after inundation of rarely flooded sites. Large numbers of small fishes were observed during this study. Community structure of small fishes differed significantly across the studied wetlands, with poeciliids predominant in frequently flooded wetlands and juvenile cichlids most abundant in rarely flooded wetlands (analysis of similarity, P < 0.05). Small fishes of <20 mm fed largely on microcrustaceans and may have led to low microcrustacean densities within the wetlands. This result matched our prediction that rarely flooded wetlands would be more productive; hence, they supported greater populations of microcrustaceans and cichlids, which are aggressive feeders. However, the predominance of microcrustaceans in the guts of small fishes (<20 mm) suggests that predation by fishes may also be an important regulatory mechanism of microcrustacean

  15. Does road salting confound the recovery of the microcrustacean community in an acidified lake?

    Science.gov (United States)

    Jensen, Thomas Correll; Meland, Sondre; Schartau, Ann Kristin; Walseng, Bjørn

    2014-04-15

    Numerous boreal lakes across the Northern Hemisphere recovering from acidification are experiencing a simultaneous increase in chloride (Cl) concentrations from road salting. Increasing Cl may have profound effects on the lake ecosystem. We examine if an increase in Cl from road salting has modified the recovery of the microcrustacean community in an acidified boreal lake undergoing chemical recovery (study lake). Results from the study lake were compared with an acidified "reference lake". The community changed during the study period in the study lake mainly driven by the reduction in acidification pressure. Despite the community changes and an increase in species richness, the absence of several acid sensitive species, previously occurring in the lake, indicates a delayed biological recovery relative to the chemical recovery. Moreover, changes in occurrence of acid sensitive and acid tolerant species indicated that the biological recovery was slower in the study lake compared to the "reference". Although recurrent episodes of high aluminum and low pH and decreasing Ca are likely important factors for the delay, these do not explain, for instance, the shift from Cyclops scutifer to Bosmina longispina in the study lake. Although the contribution of Cl was not significant, the correlation between Cl and the variation in microcrustacean community was twice as high in the study lake compared to the "reference". We argue that small, sheltered forest lakes may be especially sensitive to increased Cl levels, through changes in pattern of stratification, thus providing a mechanism for the shift from C. scutifer to B. longispina. The reduction of the acidification pressure seems to override the Cl effects on microcrustaceans at low Cl levels in salt-affected lakes recovering from acidification. However, prognoses for growing traffic and increasing road salting raise concern for many recovering lakes located in proximity to roads and urbanized areas. Copyright © 2014

  16. Can nearby eutrophic reservoirs sustain a differentiated biodiversity of planktonic microcrustaceans in a tropical semiarid basin?

    Science.gov (United States)

    Diniz, Leidiane P; Melo-Júnior, Mauro DE

    2017-01-01

    This paper aims to compare alpha and beta diversities of planktonic microcrustaceans from three reservoirs located nearby in a tropical semiarid basin. Our hypothesis was that alpha and beta diversities of the community are different, although the ecosystems are located close to each other. We carried out two sampling campaigns: dry and rainy seasons. The sampling of microcrustaceans and environmental variables (dissolved oxygen, chlorophyll a and nutrient) was performed at twelve stations and were distributed throughout the three zones (river, transition, and lacustrine), using a plankton net (45 µm). The reservoirs showed different uses and types of nitrogen predominance: Cachoeira (supply/nitrate), Borborema (sewage/ammonia) and Saco (aquaculture/ammonia). Seventeen species were recorded whose richness was assessed as particularly specific to each one of the studied reservoirs. Seasonally, both reservoirs with high anthropogenic alteration showed greater richness in the dry season. The three reservoirs located in a same basin showed different richness and composition, but the diversity did not differ between the zones of the reservoirs. Although communities are close to each other, their composition and richness were found to be distinct for each reservoir. This may be in response to the peculiar particularities, such as nitrogen sources and the different uses.

  17. Can nearby eutrophic reservoirs sustain a differentiated biodiversity of planktonic microcrustaceans in a tropical semiarid basin?

    Directory of Open Access Journals (Sweden)

    LEIDIANE P. DINIZ

    Full Text Available ABSTRACT This paper aims to compare alpha and beta diversities of planktonic microcrustaceans from three reservoirs located nearby in a tropical semiarid basin. Our hypothesis was that alpha and beta diversities of the community are different, although the ecosystems are located close to each other. We carried out two sampling campaigns: dry and rainy seasons. The sampling of microcrustaceans and environmental variables (dissolved oxygen, chlorophyll a and nutrient was performed at twelve stations and were distributed throughout the three zones (river, transition, and lacustrine, using a plankton net (45 µm. The reservoirs showed different uses and types of nitrogen predominance: Cachoeira (supply/nitrate, Borborema (sewage/ammonia and Saco (aquaculture/ammonia. Seventeen species were recorded whose richness was assessed as particularly specific to each one of the studied reservoirs. Seasonally, both reservoirs with high anthropogenic alteration showed greater richness in the dry season. The three reservoirs located in a same basin showed different richness and composition, but the diversity did not differ between the zones of the reservoirs. Although communities are close to each other, their composition and richness were found to be distinct for each reservoir. This may be in response to the peculiar particularities, such as nitrogen sources and the different uses.

  18. The taxonomy and seasonal population dynamics of some Magela Creek flood plain microcrustaceans (Cladocera and copedoda)

    International Nuclear Information System (INIS)

    Julli, M.E.

    1986-01-01

    Six Magela Creek floodplain billabongs were sampled between September 1981 and January 1983 to determine the seasonal population dynamics of littoral and limnetic microcrustaceans. Thirty-seven cladoceran and four copepod species were identified amongst littoral weedbeds and several unidentified harpacticoid copepods and ostracods were also found. By comparison only 6 cladoceran and 4 copepod species were found in limnetic areas. Littoral species generally attained their highest densities during the mid-Wet to Early-dry seasons. The number of open water species present in samples generally increased with the progression of the Dry season. Towards the end of the Dry season, a simplification of the limnetic species assemblage occurred in some billabongs, perhaps in response to adverse changes in water quality

  19. Phylogenetic Information Content of Copepoda Ribosomal DNA Repeat Units: ITS1 and ITS2 Impact

    Science.gov (United States)

    Zagoskin, Maxim V.; Lazareva, Valentina I.; Grishanin, Andrey K.; Mukha, Dmitry V.

    2014-01-01

    The utility of various regions of the ribosomal repeat unit for phylogenetic analysis was examined in 16 species representing four families, nine genera, and two orders of the subclass Copepoda (Crustacea). Fragments approximately 2000 bp in length containing the ribosomal DNA (rDNA) 18S and 28S gene fragments, the 5.8S gene, and the internal transcribed spacer regions I and II (ITS1 and ITS2) were amplified and analyzed. The DAMBE (Data Analysis in Molecular Biology and Evolution) software was used to analyze the saturation of nucleotide substitutions; this test revealed the suitability of both the 28S gene fragment and the ITS1/ITS2 rDNA regions for the reconstruction of phylogenetic trees. Distance (minimum evolution) and probabilistic (maximum likelihood, Bayesian) analyses of the data revealed that the 28S rDNA and the ITS1 and ITS2 regions are informative markers for inferring phylogenetic relationships among families of copepods and within the Cyclopidae family and associated genera. Split-graph analysis of concatenated ITS1/ITS2 rDNA regions of cyclopoid copepods suggested that the Mesocyclops, Thermocyclops, and Macrocyclops genera share complex evolutionary relationships. This study revealed that the ITS1 and ITS2 regions potentially represent different phylogenetic signals. PMID:25215300

  20. Temporal and spatial distribution of microcrustacean zooplankton in relation to turbidity and other environmental factors in a large tropical lake (L. Tana, Ethiopia)

    NARCIS (Netherlands)

    Dejen, E.; Vijverberg, J.; Nagelkerke, L.A.J.; Sibbing, F.A.

    2004-01-01

    The spatial and seasonal distribution of microcrustacean zooplankton of Lake Tana (Ethiopia) was monthly studied for 2 years. Concurrently, various environmental parameters were measured and related to zooplankton distribution. Canonical Correspondence Analysis (CCA) was used to estimate the

  1. Trophic partitioning among three littoral microcrustaceans: relative importance of periphyton as food resource

    Directory of Open Access Journals (Sweden)

    Alexandre Bec

    2012-07-01

    Full Text Available The high species richness of zooplankton communities in macrophytes littoral zones could result from the diversity of potential trophic niches found in such environment. In macrophytes littoral zones, in addition to phytoplankton, neustonic, benthic and epiphytic biofilms can also be potential components of the microcrustacean diet. Here, we investigated the ability of three large cladocerans: Daphnia longispina, Simocephalus vetulus and Eurycercus lamellatus, to develop on periphyton as their only food source or as a complement to a phytoplankton resource in scarce supply. D. longispina exhibited a very low growth and reproduction rates on the periphytic resource and as S. vetulus seems unable to scrape on periphyton. In contrast, E. lamellatus could not grow on phytoplankton, and appears to be an obligatory periphyton scraper. This latter finding contrasts with previous studies suggesting that E. lamellatus could be able to scrap periphyton as well as filter-feed on suspended matter. These differences in feeding strategy probably reflect the different trophic niches occupied by these three species in macrophytes littoral zones, and may explain at least in part their ability to coexist in the same environment.

  2. KEANEKARAGAMAN DAN MIGRASI VERTIKAL COPEPODA DI TELUK SUMBERKIMA BALI

    Directory of Open Access Journals (Sweden)

    Media Fitri Isma Nugraha

    2008-12-01

    Full Text Available Penelitian keanekaragaman spesies copepoda yang hidup di sekitar keramba jaring apung (KJA di Teluk Sumberkima, Bali Utara dilaksanakan pada bulan Februari 2007 dengan posisi sampling 50L 0237293 UTM 9101738. Penelitian ini bertujuan untuk mengetahui keanekaragaman dan distribusi vertikal populasi zooplankton khususnya copepoda di sekitar KJA Teluk Sumberkima pada beberapa tingkat kedalaman. Sampling copepoda dilakukan dengan memompa air laut sejumlah volume tertentu pada tingkat kedalaman masing-masing 0 m, 3 m, 6 m, 9 m, 12 m, dan 15 m. Air laut tersebut kemudian disaring pada 200 µm secara terpisah. Sampel copepoda diawetkan dengan formalin 4% untuk analisis mikroskopik di laboratorium. Hasil penelitian menunjukkan secara keseluruhan terdapat 3 ordo yang terdiri atas 22 spesies copepoda. Ordo yang mendominasi adalah Calanoida yang ditemukan pada setiap kedalaman, dilanjutkan oleh ordo Cyclopoida yang ditemukan pada kedalaman 0 m, 3 m, 6 m, 12 m, dan 15 m dan ordo Harpacticoida yang ditemukan di semua lapisan kedalaman. Spesies yang mendominasi di setiap kedalaman adalah Calanus sinicus dan Calanus minor. The aim of this experiment was to study biodiversity and vertical distribution of copepods around floating cage culture in Sumberkima Bay, North Bali, in sea water depth levels of 0, 3, 6, 9, 12, and 15 meters at sampling site of 50L 0237293 UTM 9101738. The observation was done in February 2007. Samples were obtained by pumping and then filtering the seawater through 200 µm membrane filter. Samples were preserved in 4% formaldehyde for microscopic observation. Results showed that there were three orders from 22 copepod species dominated by the order of Calanoida found in any depth level followed by the order of Cyclopoida found at 0, 3, 6, 12, and 15 meters depth. Even though the order of Harpacticoida copepods was found in each observed depth level but this order was in little quantity. Dominant species at each depth level was Calanus

  3. Coefficient Estimate Problem for a New Subclass of Biunivalent Functions

    OpenAIRE

    N. Magesh; T. Rosy; S. Varma

    2013-01-01

    We introduce a unified subclass of the function class Σ of biunivalent functions defined in the open unit disc. Furthermore, we find estimates on the coefficients |a2| and |a3| for functions in this subclass. In addition, many relevant connections with known or new results are pointed out.

  4. North-south diversity of Scolecithricidae species (Copepoda: Calanoida) in the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Gopalakrishnan, T.C.; Balachandran, T.

    The effectiveness of north-south hydrographical barriers in restricting the distributions of Scolecithricidae species (Copepoda:Calanoida) in the euphotic zone of the Indian Ocean was studied. Twenty seven species belonging to 7 genera were...

  5. A note on chromosomes of Pontellopsis herdmani and Pontella princeps (Copepoda) from the Laccadive sea

    Digital Repository Service at National Institute of Oceanography (India)

    Goswami, U.; Goswami, S.C.

    Pontellopsis herdmani and Pontella princeps (Pontellidae, Calanoida, Copepoda) showed a diploid number of 20 and a haploid number of 10 chromosomes during the spermatogonial metaphase and metaphase II stages. The chromosomes were in the size range...

  6. KELIMPAHAN COPEPODA (ORDO: CALANOIDA DI TELUK PEGAMETAN, BALI UTARA

    Directory of Open Access Journals (Sweden)

    Gede S. Sumiarsa

    2009-04-01

    Full Text Available Pengamatan kelimpahan spesies copepoda, ordo Calanoida di Teluk Pegametan, Bali telah dilaksanakan pada bulan April 2007. Teluk Pegametan adalah salah satu wilayah yang potensial untuk budidaya laut yang terletak di bagian barat Laut Bali. Penelitian ini bertujuan untuk menginventarisasi spesies-spesies copepoda dari ordo Calanoida yang hidup di perairan Teluk Pegametan. Penelitian ini dilakukan pada 10 stasiun sampling dengan metode sampling secara horizontal pada permukaan laut. Plankton net berdiameter 31 cm dengan ukuran mesh 40 mm ditarik sepanjang 10 meter dengan menggunakan speed boat di sekitar stasiun pengamatan. Sampel diawetkan dengan formalin 4% untuk diidentifikasi. Dari hasil pengamatan di sepuluh stasiun terdapat 14 spesies copepoda ordo Calanoida yaitu: Acrocalanus gracilis, Calanus minor, C. sinicus, C. tenuicornis, Centropoges abdominalis, Eucalanus attenuatus, Haloptilus longicornis, Lucicutia curta, L. flavicornis, Parvocalanus crassirostris, Pseudocalanus gracilis, Rinchalanus cornutus, Scolecithricella minor, dan Temora turbinata. Spesies dominan adalah Calanus sinicus dengan proporsi 65,6% dari jumlah individu yang dijumpai. Observation on the abundance of copepod species (order: Calanoida in Pegametan Bay has been conducted in April 2007. Pegametan Bay is located on the North West of Bali and is one of several potential areas for mariculture. The purpose of this study was to find out the abundance of copepod (Order: Calanoida in the bay. Research sampling was conducted in 10 sampling points where planktons were collected using plankton net of 40 µm mesh size with diameter of 31 cm dragged horizontally on the sea water surface as far as 10 m each. Samples were preserved in 4% formalin for identification.  There were 14 species of Calanoida copepod species found during the research: Acrocalanus gracilis, Calanus minor, C. sinicus, C. tenuicornis, Centropoges abdominalis, Eucalanus attenuatus, Haloptilus longicornis

  7. Molecular Phylogeny and Revision of Copepod Orders (Crustacea: Copepoda).

    Science.gov (United States)

    Khodami, Sahar; McArthur, J Vaun; Blanco-Bercial, Leocadio; Martinez Arbizu, Pedro

    2017-08-22

    For the first time, the phylogenetic relationships between representatives of all 10 copepod orders have been investigated using 28S and 18S rRNA, Histone H3 protein and COI mtDNA. The monophyly of Copepoda (including Platycopioida Fosshagen, 1985) is demonstrated for the first time using molecular data. Maxillopoda is rejected, as it is a polyphyletic group. The monophyly of the major subgroups of Copepoda, including Progymnoplea Lang, 1948 (=Platycopioida); Neocopepoda Huys and Boxshall, 1991; Gymnoplea Giesbrecht, 1892 (=Calanoida Sars, 1903); and Podoplea Giesbrecht, 1892, are supported in this study. Seven copepod orders are monophyletic, including Platycopioida, Calanoida, Misophrioida Gurney, 1933; Monstrilloida Sars, 1901; Siphonostomatoida Burmeister, 1834; Gelyelloida Huys, 1988; and Mormonilloida Boxshall, 1979. Misophrioida (=Propodoplea Lang, 1948) is the most basal Podoplean order. The order Cyclopoida Burmeister, 1835, is paraphyletic and now encompasses Poecilostomatoida Thorell, 1859, as a sister to the family Schminkepinellidae Martinez Arbizu, 2006. Within Harpacticoida Sars, 1903, both sections, Polyarthra Lang, 1948, and Oligoarthra Lang, 1948, are monophyletic, but not sister groups. The order Canuelloida is proposed while maintaining the order Harpacticoida s. str. (Oligoarthra). Cyclopoida, Harpacticoida and Cyclopinidae are redefined, while Canuelloida ordo. nov., Smirnovipinidae fam. nov. and Cyclopicinidae fam. nov are proposed as new taxa.

  8. Immunoglobulin subclass in experimental murine Toxocara cati infection

    Directory of Open Access Journals (Sweden)

    Kusnoto

    2017-11-01

    Full Text Available Aim: The aim of this study was to detect specific immunoglobulin (Ig that could be used to determine monoclonal antibody in conjugate-making an effort for the indirect enzyme-linked immunosorbent assay (ELISA diagnostic kit of toxocariasis in human. Materials and Methods: The study was conducted to assess the Ig profile, based on ELISA-isotyping, in mice infected with second stage larvae eggs of Toxocara cati. The optical density values of anti-T. cati mice serum IgG subclasses were analyzed by applying ANOVA factorial. Results: The specific IgG subclass in mice infected with T. cati mice was found to be IgG2β. Conclusion: Subclass of IgG, especially IgG2β, can provide leads about the use of the monoclonal antibody in conjugate making an effort for the indirect ELISA diagnostic kit.

  9. Coefficient inequality for certain subclass of analytic functions

    Directory of Open Access Journals (Sweden)

    D. Vamshee Krishna

    2013-03-01

    Full Text Available The objective of this paper is to an obtain an upper bound to the second Hankel determinant $|a_{2}a_{4}-a_{3}^{2}|$ for the function $f$, belonging to a certain subclass of analytic functions, using Toeplitz determinants.

  10. Some subclasses of multivalent functions involving a certain linear operator

    Science.gov (United States)

    Srivastava, H. M.; Patel, J.

    2005-10-01

    The authors investigate various inclusion and other properties of several subclasses of the class of normalized p-valent analytic functions in the open unit disk, which are defined here by means of a certain linear operator. Problems involving generalized neighborhoods of analytic functions in the class are investigated. Finally, some applications of fractional calculus operators are considered.

  11. Estudos ecotoxicológicos com as espécies Argyrodiaptomus furcatus e Notodiaptomus iheringi (Copepoda, Calanoida)

    OpenAIRE

    Denise Tieme Okumura

    2011-01-01

    Os Copepoda constituem a maior classe de pequenos crustáceos, com mais de 8.500 espécies descritas. Dentre as cinco ordens de Copepoda de vida livre, as espécies pertencentes à ordem Calanoida apresentam um forte endemismo, com uma restrita distribuição geográfica. Além disso, os Copepoda Calanoida são particularmente sensíveis a contaminantes contidos na coluna de água devido ao seu hábito planctônico. No presente trabalho foram realizados estudos ecotoxicológicos com duas espécies de Copepo...

  12. On the ecological role of Copepoda in the Suez Canal marine ...

    African Journals Online (AJOL)

    Moreover, the importance of copepods in the marine food web and secondary productivity in the canal water, as well as their response to environmental variations in the Suez Canal ecosystem were discussed. KEY WORDS: Zooplankton, Copepoda, food web, marine ecosystem, Suez Canal Egyptian Journal of Biology ...

  13. A three-layer immunoradiometric assay for determination of IgG subclass antibodies in Human Sera (''IgG subclass RAST'')

    International Nuclear Information System (INIS)

    Djurup, R.; Soendergaard, I.; Weeke, B.; University of Copenhagen, Denmark); Magnusson, C.G.M.

    1984-01-01

    We report the development of a three-layer immunoradiometric assay (TIRA) for measurement of IgG antibodies of all four subclasses in human sera. The first layer consists of diluted human serum, the second layer is monoclonal mouse antibodies to human IgG subclasses, and the third layer is 125 I-labelled rabbit anti-mouse IgG. Monoclonal anti-IgGI, anti-IgG3 and anti-IgG4 reacted only with their complementary IgG subclass, whereas the anti-IgG2 showed slight cross-reactivity to immunoglobins of other subclasses and classes and to light chain proteins. The observed cross-reactivity was found to be without importance, when the TIRA was applied to measurement of IgG subclass antibodies. Equipotency was established by use of appropriate dilutions of the monoclonal antibodies, and the assay was calibrated by use of human reference serum. The TIRA therefore permits reliable inter-individual and intra-individual comparisons of the IgG antibody response in all four subclasses. Non-specific binding obtained with pooled normal human serum was below 0.33%. Inter-assay coefficient of variation was between 18 and 27%. The TIRA was applied to measurement of IgG subclass antibodies to timothy grass pollen in sera from grass pollen allergies undergoing immunotherapy. (author)

  14. Morphometric variability of Arctodiaptomus salinus (Copepoda) in the Mediterranean-Black Sea region

    OpenAIRE

    ANUFRIIEVA, Elena V.; SHADRIN, Nickolai V.

    2015-01-01

    Inter-species variability in morphological traits creates a need to know the range of variability of characteristics in the species for taxonomic and ecological tasks. Copepoda Arctodiaptomus salinus, which inhabits water bodies across Eurasia and North Africa, plays a dominant role in plankton of different water bodies-from fresh to hypersaline. This work assesses the intra- and inter-population morphometric variability of A. salinus in the Mediterranean-Black Sea region and discusses some o...

  15. Spatial distribution and secondary production of Copepoda in a tropical reservoir: Barra Bonita, SP, Brazil

    Directory of Open Access Journals (Sweden)

    MJ. Santos-Wisniewski

    Full Text Available The present paper aims to describe the spatial distribution of zooplankton copepods, their biomass and instantaneous secondary production, in Barra Bonita, a large eutrophic, polymitic reservoir (22° 29' S and 48° 34' W on the Tietê River, of the Paraná basin. Sampling was carried out during two seasons: dry winter and rainy summer. Species composition, age structure and numerical density of each copepod species population were analyzed at 25 sampling stations. Secondary production was calculated for Copepoda, the dominant group in zooplankton communities, taking Calanoida and Cyclopoida separately. Copepoda represented the largest portion of the total zooplankton biomass, the dominant species being Notodiaptomus iheringi among the Calanoida and Mesocyclops ogunnus and Thermocyclops decipiens among the Cyclopoida. The production of Copepoda was higher during the rainy summer (23.61 mgDW.m-3.d-1 in January 1995 than during the dry winter season (14 mgDW.m-3.d-1 in August 1995, following the general pattern of abundance for the whole zooplankton community. Among the copepods, Cyclopoida production was higher than that of Calanoida, a pattern commonly observed for tropical lakes and reservoirs. Barra Bonita copepods are very productive, but there was a great degree of spatial heterogeneity, related to the physical and chemical conditions, particularly the level of nutrients and also to phytoplankton biomass.

  16. KERAGAAN COPEPODA CYCLOPOIDA: Apocyclops sp. PADA KONDISI KULTUR

    Directory of Open Access Journals (Sweden)

    Philip Teguh Imanto

    2016-11-01

    Full Text Available Copepoda pada dasarnya adalah udang berukuran mikroskopik yang menjadi rantai pakan alami yang penting di perairan bebas. Investigasi jenis-jenis copepod lokal akan membantu menyiapkan informasi untuk pengembangan budidayanya sebagai jasad pakan alami. Penelitian dilakukan dengan mengkoleksi jenis Cyclopoida lokal perairan pantai Gerokgak, Buleleng, Bali, diisolasi dan dikembangbiakkan dengan pakan kombinasi antara alga Nannochloropsis oculatta, tepung terigu, ragi roti, dan hati ayam dalam tangki beton 5 m3. Tiga ratus individu Cyclopoida yang membawa telur ditempatkan pada tiga wadah kultur bervolume satu liter. Pengamatan pada pertumbuhan individu dilakukan dengan sampling setiap hari dan setiap dua hari untuk melihat perkembangan telurnya. Jenis Cyclopoida lokal termasuk famili Cyclopidae dan genus Apocyclops spp. Kecepatan pertumbuhan mencapai 20 µm setiap harinya, dan dari fase copepodit mencapai ukuran dewasa membawa telur dianalisis selama 12 hari, perkembangan telur memerlukan waktu maksimal 10 hari, sehingga estimasi siklus umur minimal adalah 22 hari. Produktivitas rata-rata telur Apocyclops spp. pada penelitian ini diestimasi sebanyak 36 (minimum16-maksimum 65 butir per individu betina. Penelitian kultur lebih lanjut difokuskan pada optimalisasi suhu, salinitas, oksigen terlarut pada media hingga optimalisasi pada jenis pakan. Copepod, a microscopic shrimp, is an important member in natural food chain in waters. Investigating the types of local copepod will provide valuable information for the development of other natural live feed culture. The research was carried out by collecting local Cyclopoida species from Gerokgak coastal waters, Buleleng Regency-Bali, isolated and cultured with combination feed of algae Nannochloropsis oculatta, wheat flour, yeast bread and chicken liver in 5 m3 concrete tank. Three hundred individuals of Cyclopoida carrying eggs were placed in three beaker glasses of one-liter culture volume. An observation

  17. Apical versus Basal Neurogenesis Directs Cortical Interneuron Subclass Fate

    Directory of Open Access Journals (Sweden)

    Timothy J. Petros

    2015-11-01

    Full Text Available Fate determination in the mammalian telencephalon, with its diversity of neuronal subtypes and relevance to neuropsychiatric disease, remains a critical area of study in neuroscience. Most studies investigating this topic focus on the diversity of neural progenitors within spatial and temporal domains along the lateral ventricles. Often overlooked is whether the location of neurogenesis within a fate-restricted domain is associated with, or instructive for, distinct neuronal fates. Here, we use in vivo fate mapping and the manipulation of neurogenic location to demonstrate that apical versus basal neurogenesis influences the fate determination of major subgroups of cortical interneurons derived from the subcortical telencephalon. Somatostatin-expressing interneurons arise mainly from apical divisions along the ventricular surface, whereas parvalbumin-expressing interneurons originate predominantly from basal divisions in the subventricular zone. As manipulations that shift neurogenic location alter interneuron subclass fate, these results add an additional dimension to the spatial-temporal determinants of neuronal fate determination.

  18. Using constellation pharmacology to define comprehensively a somatosensory neuronal subclass

    Science.gov (United States)

    Teichert, Russell W.; Memon, Tosifa; Aman, Joseph W.; Olivera, Baldomero M.

    2014-01-01

    Change is intrinsic to nervous systems; change is required for learning and conditioning and occurs with disease progression, normal development, and aging. To better understand mammalian nervous systems and effectively treat nervous-system disorders, it is essential to track changes in relevant individual neurons. A critical challenge is to identify and characterize the specific cell types involved and the molecular-level changes that occur in each. Using an experimental strategy called constellation pharmacology, we demonstrate that we can define a specific somatosensory neuronal subclass, cold thermosensors, across different species and track changes in these neurons as a function of development. Cold thermosensors are uniformly responsive to menthol and innocuous cool temperature (17 °C), indicating that they express TRPM8 channels. A subset of cold thermosensors expressed α7 nicotinic acetylcholine receptors (nAChRs) but not other nAChR subtypes. Differences in temperature threshold of cold thermosensors correlated with functional expression of voltage-gated K channels Kv1.1/1.2: Relatively higher expression of KV1.1/1.2 channels resulted in a higher threshold response to cold temperature. Other signaling components varied during development and between species. In cold thermosensors of neonatal mice and rats, ATP receptors were functionally expressed, but the expression disappeared with development. This developmental change occurred earlier in low-threshold than high-threshold cold thermosensors. Most rat cold thermosensors expressed TRPA1 channels, whereas mouse cold thermosensors did not. The broad implications of this study are that it is now feasible to track changes in receptor and ion-channel expression in individual neuronal subclasses as a function of development, learning, disease, or aging. PMID:24469798

  19. Certain Subclasses of Analytic and Bi-Univalent Functions Involving Double Zeta Functions

    OpenAIRE

    Siregar, Saibah; Raman, Sintuja

    2012-01-01

    In the present paper, we introduce two new subclasses of the functions class Σ of bi-univalent functions involving double zeta functions in the open unit disc U={z:zEC, |z|<1}. The estimates on the coefficients |a2| and |a3| for functions in these new subclasses of the function class Σ are obtained in our investigation.

  20. Acute effects of interleukin-6 infusion on apo-B-containing lipoprotein subclasses in humans

    DEFF Research Database (Denmark)

    Bagdade, John; Pedersen, Bente K; Schwenke, Dawn

    2011-01-01

    B:E) apoB-containing subclasses present in VLDL. Therefore, we have directly measured these subclasses following their isolation by sequential immunoprecipitation in seven healthy male subjects during a 3-h infusion with recombinant human (rh) IL-6. Though plasma TG and apoB-containing particle number were...... unchanged by IL-6, the distribution of TG-rich subclasses was significantly altered. Compared to baseline values, LpB:E + LpB:C:E increased significantly at 0.5 h (p infused controls at 0.5 and 1 h (p

  1. Feeding spectra of Arctodiaptomus salinus (Calanoida, Copepoda) using fatty acid trophic markers in seston food in two salt lakes in South Siberia (Khakasia, Russia)

    NARCIS (Netherlands)

    Tolomeev, A.; Sushchik, N.N.; Gulati, R.D.; Makhutova, O.N.; Kalacheva, G.S.; Zotina, T.A.

    2010-01-01

    During two vegetation seasons (2004–2005), we compared feeding spectra of Arctodiaptomus salinus (Calanoida, Copepoda) populations inhabiting two neighboring salt lakes, Shira and Shunet, Khakasia, Russia, using fatty acid (FA) trophic markers. Sestonic FA composition in two lakes moderately

  2. The Sea of Marmara: New Locality for Lepeophtheirus europaensis Zedam, Berrebi, Renaud, Raibaut and Gabrion, 1988 (Copepoda, Siphonostomatoida, Caligidae from Turkey

    Directory of Open Access Journals (Sweden)

    Alaş Ali

    2017-07-01

    Full Text Available Lepeophtheirus europaensis Zeddam, Berrebi, Renaud, Raibaut and Gabrion, 1988 (Copepoda, Siphonostomatoida, Caligidae an ectoparasite of flatfishes, was reported for the first time in the Sea of Marmara Coasts.

  3. ABUNDANCE AND ISOTOPIC COMPOSITION OF PLANKTONIC MICROCRUSTACEANS IN A CENTRAL AMAZON FLOODPLAIN LAKE: IMPLICATIONS FOR THE TROPHIC DYNAMICS OF THE PLANKTON COMMUNITY

    Directory of Open Access Journals (Sweden)

    Pedro Caraballo

    2016-01-01

    Full Text Available During the hydrological year from December 2007 to November 2008, monthly samplings in the pelagic, littoral and macrophytes zones were conducted in the Lago Catalão, a floodplain lake receiving a mixture of water from Negro and Solimões Rivers, in front of Manaus city. Taxonomic composition and their relative abundance of the planktonic microcrustaceans community was studied. Natural abundances of carbon (C and nitrogen (N stable isotopes were measured to indicate energy sources. Cladocerans were the most abundant, with a relative abundance of 60%, followed by the calanoid and cyclopoid copepods with relative abundances of 29% and 11%, respectively. Diaphanosoma spp. was the dominant cladoceran group during all the sampling periods. Cladocerans were also represented by Moina spp., Ceriodaphnia spp. and Daphnia gessneri. Three genera of calanoid copepods were found: Notodiaptomus spp, Rhacodiaptomus spp., and Argyrodiaptomus spp. The genus Mesocyclops spp. was identified among the cyclopoid copepods. Zooplankton δ13C values indicated that the aquatic macrophyte zone was distinct, with a mean of -27.31‰, which was more enriched than zooplankton in the pelagic and littoral zones, where they had mean δ13C values of -33.11 and -34.66‰, respectively. Overall, analysis of stable isotopes showed that regardless of the pathways, the initial source of carbon for the zooplankton was phytoplankton, with a minimal participation of heterotrophic bacteria.

  4. An intersectional gene regulatory strategy defines subclass diversity of C. elegans motor neurons.

    Science.gov (United States)

    Kratsios, Paschalis; Kerk, Sze Yen; Catela, Catarina; Liang, Joseph; Vidal, Berta; Bayer, Emily A; Feng, Weidong; De La Cruz, Estanisla Daniel; Croci, Laura; Consalez, G Giacomo; Mizumoto, Kota; Hobert, Oliver

    2017-07-05

    A core principle of nervous system organization is the diversification of neuron classes into subclasses that share large sets of features but differ in select traits. We describe here a molecular mechanism necessary for motor neurons to acquire subclass-specific traits in the nematode Caenorhabditis elegans . Cholinergic motor neuron classes of the ventral nerve cord can be subdivided into subclasses along the anterior-posterior (A-P) axis based on synaptic connectivity patterns and molecular features. The conserved COE-type terminal selector UNC-3 not only controls the expression of traits shared by all members of a neuron class, but is also required for subclass-specific traits expressed along the A-P axis. UNC-3, which is not regionally restricted, requires region-specific cofactors in the form of Hox proteins to co-activate subclass-specific effector genes in post-mitotic motor neurons. This intersectional gene regulatory principle for neuronal subclass diversification may be conserved from nematodes to mice.

  5. Association between habitual dietary intake and lipoprotein subclass profile in healthy young adults.

    Science.gov (United States)

    Bogl, L H; Pietiläinen, K H; Rissanen, A; Kangas, A J; Soininen, P; Rose, R J; Ala-Korpela, M; Kaprio, J

    2013-11-01

    Nutritional epidemiology is increasingly shifting its focus from studying single nutrients to the exploration of the whole diet utilizing dietary pattern analysis. We analyzed associations between habitual diet (including macronutrients, dietary patterns, biomarker of fish intake) and lipoprotein particle subclass profile in young adults. Complete dietary data (food-frequency questionnaire) and lipoprotein subclass profile (via nuclear magnetic resonance spectroscopy) were available for 663 subjects from the population-based FinnTwin12 study (57% women, age: 21-25 y). The serum docosahexaenoic to total fatty acid ratio was used as a biomarker of habitual fish consumption. Factor analysis identified 5 dietary patterns: "Fruit and vegetables", "Meat", "Sweets and desserts", "Junk food" and "Fish". After adjustment for sex, age, body mass index, waist circumference, physical activity, smoking status and alcohol intake, the "Junk food" pattern was positively related to serum triglycerides (r = 0.12, P = 0.002), a shift in the subclass distribution of VLDL toward larger particles (r = 0.12 for VLDL size, P consumption is related to favorable subclass distributions of VLDL and HDL, while junk food intake is associated with unfavorable alterations in the distribution of all lipoprotein subclasses independent of adiposity and other lifestyle factors. Copyright © 2012 Elsevier B.V. All rights reserved.

  6. Recurrent meningitis in a child with IgG3 subclass deficiency.

    Science.gov (United States)

    Vehapoglu, Aysel; Ozgurhan, Gamze; Demir, Aysegul Dogan; Uzuner, Selcuk; Nursoy, Mustafa Atilla; Turkmen, Serdar

    2014-08-01

    Recurrent meningitis is an uncommon life-threatening condition. Here, the case of a 6-year-old boy is reported who had two episodes of meningitis with an IgG3 subclass deficiency. The boy had aseptic meningitis at the age of 3 years, followed by bacterial meningitis at the age of 4 years. Primary immunoglobulin deficiencies are a group of disorders associated with an increased incidence and/or severity of infection. Recurrent infections, sinusitis, bronchitis, and pneumonia are the most frequently observed illnesses in patients with IgG subclass deficiencies, of which an IgG3 subclass deficiency is the most common, especially in adults. Although cases of recurrent viral or bacterial meningitis have been reported, herein a patient is presented with recurrence of aseptic and bacterial meningitis 1 year after the initial episode. Some researchers recommend that all children with episodes of recurrent meningitis should be screened for primary immunoglobulin or complement deficiencies.

  7. Dietary fatty acids were not independently associated with lipoprotein subclasses in elderly women.

    Science.gov (United States)

    Alaghehband, Fatemeh Ramezan; Lankinen, Maria; Värri, Miika; Sirola, Joonas; Kröger, Heikki; Erkkilä, Arja T

    2017-07-01

    Dietary fatty acids are known to affect serum lipoproteins; however, little is known about the associations between consumption of dietary fatty acids and lipoprotein subclasses. In this study, we hypothesized that there is an association between dietary fatty acids and lipoprotein subclasses and investigated the cross-sectional association of dietary fat intake with subclasses of lipoproteins in elderly women. Altogether, 547 women (aged ≥65 years) who were part of OSTPRE cohort participated. Dietary intake was assessed by 3-day food records, lifestyle, and health information obtained through self-administrated questionnaires, and lipoprotein subclasses were determined by nuclear magnetic resonance spectroscopy. To analyze the associations between fatty acids and lipoprotein subclasses, we used Pearson and Spearman correlation coefficients and the analysis of covariance (ANCOVA) test with, adjustment for physical activity, body mass index, age, smoking status, and intake of lipid-lowering drugs. There were significant correlations between saturated fatty acids (SFA; % of energy) and concentrations of large, medium, and small low-density lipoproteins (LDL); total cholesterol in large, medium, and small LDL; and phospholipids in large, medium, and small LDL, after correction for multiple testing. After adjustment for covariates, the higher intake of SFA was associated with smaller size of LDL particles (P = .04, ANCOVA) and lower amount of triglycerides in small very low-density lipoproteins (P = .046, ANCOVA). However, these associations did not remain significant after correction for multiple testing. In conclusion, high intake of SFA may be associated with the size of LDL particles, but the results do not support significant, independent associations between dietary fatty acids and lipoprotein subclasses. Copyright © 2017 Elsevier Inc. All rights reserved.

  8. Heritability of antibody isotype and subclass responses to Plasmodium falciparum antigens.

    Directory of Open Access Journals (Sweden)

    Nancy O Duah

    2009-10-01

    Full Text Available It is important to understand the extent to which genetic factors regulate acquired immunity to common infections. A classical twin study design is useful to estimate the heritable component of variation in measurable immune parameters.This study assessed the relative heritability of different plasma antibody isotypes and subclasses (IgG1, IgG2, IgG3, IgG4, IgM, IgA and IgE naturally acquired to P. falciparum blood stage antigens AMA1, MSP1-19, MSP2 (two allelic types and MSP3 (two allelic types. Separate analyses were performed on plasma from 213 pairs of Gambian adult twins, 199 child twin pairs sampled in a dry season when there was little malaria transmission, and another set of 107 child twin pairs sampled at the end of the annual wet season when malaria was common. There were significantly positive heritability (h(2 estimates for 48% (20/42 of the specific antibody assays (for the seven isotypes and subclasses to the six antigens tested among the adults, 48% (20/42 among the children in the dry season and 31% (13/42 among the children in the wet season. In children, there were significant heritability estimates for IgG4 reactivity against each of the antigens, and this subclass had higher heritability than the other subclasses and isotypes. In adults, 75% (15/20 of the significantly heritable antigen-specific isotype responses were attributable to non-HLA class II genetic variation, whereas none showed a significant HLA contribution.Genome-wide approaches are now warranted to map the major genetic determinants of variable antibody isotype and subclass responses to malaria, alongside evaluation of their impact on infection and disease. Although plasma levels of IgG4 to malaria antigens are generally low, the exceptionally high heritability of levels of this subclass in children deserves particular investigation.

  9. Breeding biology of the freshwater copepoda, heliodiaptomus viduus (gurney) and its prospects as live food organism

    International Nuclear Information System (INIS)

    Altaff, K.

    2003-01-01

    The tropical freshwater copepoda, Heliodiaptomus viduus occur commonly in the peninsular India. This species is comparatively bigger (total mean length of female and male is 2.05 plus minus 0.09 mm and 1.7 plus minus 0.04 mm respectively) than other freshwater diaptomids. Aspects of reproductive biology such as sexual dimorphism, organization of female and male reproductive system, oogenesis, spermatogenesis and spermatophore formation are described for the first time. Details pertaining to fertilization, embryonic and post embryonic development of this specie is reported. Studies on live span and reproductive potential of this specie indicate continuous breeding with short interclutch period. Importance of the live food in aquahatcheries and prospects of H. viduus as alternate live food to Artemia nauplii is discussed. (author)

  10. Leaf litter copepods from a cloud forest mountain top in Honduras (Copepoda: Cyclopidae, Canthocamptidae).

    Science.gov (United States)

    Fiers, Frank; Jocque, Merlijn

    2013-01-01

    Five different species of Copepoda were extracted from a leaf litter sample collected on the top (at 2000 m a.s.l.) of a cloud forested mountain in El Cusuco National Park, Honduras. Three of them, one Cyclopidae and two Canthocamptidae are new to science, and are described herein. Olmeccyclops hondo sp. nov. is the second representative thus far known of this New World genus. Moraria catracha sp. nov. and Moraria cusuca sp. nov. are the first formally described members of the genus occurring in Central America. The concept of a "Moraria-group" is considered to be an artificial grouping and is limited here to the genera Moraria and Morariopsis only. The distributional range of this group is essentially Holarctic, with the mountainous regions in Honduras, and probably in west Nicaragua, as the southernmost limits in the New World.

  11. A microfluorometric assay for immunoglobulin class and subclass levels in murine serum

    NARCIS (Netherlands)

    Haaijman, J.J.; Brinkhof, J.

    1977-01-01

    The IgG fractions of rabbit antisera specific for the Fc part of mouse IgA, IgM, and the four subclasses of IgG (1, 2a, 2b, and 3) were coupled covalently to Sepharose beads by the cyanogen bromide method. The beads were then incubated with different dilutions of mouse serum. The mouse

  12. Large scale aggregate microarray analysis reveals three distinct molecular subclasses of human preeclampsia.

    Science.gov (United States)

    Leavey, Katherine; Bainbridge, Shannon A; Cox, Brian J

    2015-01-01

    Preeclampsia (PE) is a life-threatening hypertensive pathology of pregnancy affecting 3-5% of all pregnancies. To date, PE has no cure, early detection markers, or effective treatments short of the removal of what is thought to be the causative organ, the placenta, which may necessitate a preterm delivery. Additionally, numerous small placental microarray studies attempting to identify "PE-specific" genes have yielded inconsistent results. We therefore hypothesize that preeclampsia is a multifactorial disease encompassing several pathology subclasses, and that large cohort placental gene expression analysis will reveal these groups. To address our hypothesis, we utilized known bioinformatic methods to aggregate 7 microarray data sets across multiple platforms in order to generate a large data set of 173 patient samples, including 77 with preeclampsia. Unsupervised clustering of these patient samples revealed three distinct molecular subclasses of PE. This included a "canonical" PE subclass demonstrating elevated expression of known PE markers and genes associated with poor oxygenation and increased secretion, as well as two other subclasses potentially representing a poor maternal response to pregnancy and an immunological presentation of preeclampsia. Our analysis sheds new light on the heterogeneity of PE patients, and offers up additional avenues for future investigation. Hopefully, our subclassification of preeclampsia based on molecular diversity will finally lead to the development of robust diagnostics and patient-based treatments for this disorder.

  13. Colony-stimulating factor (CSF) radioimmunoassay: detection of a CSF subclass stimulating macrophage production

    International Nuclear Information System (INIS)

    Stanley, E.R.

    1979-01-01

    Colony-stimulating factors (CSFs) stimulate the differentiation of immature precursor cells to mature granulocytes and macrophages. Purified 125 I-labeled murine L cell CSF has been used to develop a radioimmunoassay (RIA) that detects a subclass of CSFs that stimulates macrophage production. Murine CSF preparations that contain this subclass of CSF compete for all of the CSF binding sites on anti-L cell CSF antibody. With the exception of mouse serum, which can contain inhibitors of the bioassay, there is complete correspondence between activities determined by RIA and those determined by bioassay. The RIA is slightly more sensitive than the bioassay, detecting approximately 0.3 fmol of purified L cell CSF. It can also detect this subclass of CSF in chickens, rats, and humans. In the mouse, the subclass is distinguished from other CSFs by a murine cell bioassay dose-response curve in which 90% of the response occurs over a 10-fold (rather than a 100-fold) increase in concentration, by stimulating the formations of colonies contaning a high proportion of mononuclear (rather than granulocytic) cells, and by certain physical characteristics

  14. Fekete-Szegö Inequalities of a Subclass of Multivalent Analytic Functions

    Directory of Open Access Journals (Sweden)

    Selvaraj C.

    2016-07-01

    Full Text Available The main object of this paper is to study Fekete-Szegö problem for a certain subclass of p - valent analytic functions. Fekete-Szegö inequality of several classes are obtained as special cases from our results. Applications of the result are also obtained on the class defined by convolution.

  15. Antibody isotypes, including IgG subclasses, in Ecuadorian patients with pulmonary Paragonimiasis

    Directory of Open Access Journals (Sweden)

    Angel Guevara E.

    1995-08-01

    Full Text Available An ELISA test was developed to detect Paragonimus-specific antibodies, including IgG subclasses, using P. mexicanus crude water-soluble antigens. The test was standardized to detect antibodies in sera of Ecuadorian patients with pulmonary paragonimiasis and negative controls from the endemic area. The detected mean levels of IgG (0.753, SEM: 0.074 and IgM (0.303, SEM: 0.033 were significantly elevated (P<0.05. Within the IgG subclasses, IgG4 showed the highest detected mean level (0.365, SEM: 0.116 and the other three subclasses showed considerably lower mean levels (IgG1, 0.186 SEM: 0.06; IgG2, 0.046 SEM: 0.01; IgG3, 0.123 SEM: 0.047. The number of P. mexicanus eggs found in sputum of infected individuals showed a positive correlation with the level of antibodies detected for IgM, IgG and its subclasses (P<0.001. The relevance of these findings in Ecuadorian patients suffering from pulmonary paragonimiasis is discussed.

  16. On certain subclasses of multivalent functions associated with an extended fractional differintegral operator

    Science.gov (United States)

    Patel, J.; Mishra, A. K.

    2007-08-01

    In the present paper an extended fractional differintegral operator , suitable for the study of multivalent functions is introduced. Various mapping properties and inclusion relationships between certain subclasses of multivalent functions are investigated by applying the techniques of differential subordination. Relevant connections of the definitions and results presented in this paper with those obtained in several earlier works on the subject are also pointed out.

  17. Perfil de isotipos de imunoglobulinas e subclasses de IgG na leishmaniose tegumentar americana Immunoglobulin isotype and IgG subclass profiles in american tegumentary leishmaniasis

    Directory of Open Access Journals (Sweden)

    Maria Aparecida de Souza

    2005-04-01

    Full Text Available O presente trabalho avaliou o perfil de anticorpos em amostras de soro de 37 pacientes com diagnóstico clínico confirmado ou compatível com leishmaniose tegumentar americana atendidos no Hospital de Clínicas da Universidade Federal de Uberlândia, MG. Os perfis das classes de imunoglobulinas e subclasses de IgG foram analisados pelo teste ELISA indireto, utilizando-se antígeno solúvel de Leishmania (Leishmania amazonensis. A avidez dos anticorpos foi determinada pelo tratamento com uréia a 6 M, após incubação dos soros com o antígeno. Observou-se que 97%, 94,6%, 57,5 e 21,5% das amostras testadas apresentaram anticorpos anti-Leishmania das classes IgE, IgG, IgA e IgM, respectivamente e, os perfis das subclasses de IgG demonstraram, IgG1>IgG3>IgG2>IgG4. Os anticorpos IgE anti-Leishmania de alta avidez corresponderam a 44,4%. Por outro lado, IgG e IgA anti-Leishmania foram em sua maioria (62,8 e 47,8%, respectivamente, de média avidez. A variação do perfil de isotipos, bem como a avidez das imunoglobulinas refletiu a complexidade da resposta imune humoral contra a leishmaniose tegumentar americana.The present work investigated the serum antibody profiles in 37 patients with American tegumentary leishmaniasis, who were attended at Hospital de Clinicas - Universidade Federal de Uberlandia, MG, Brazil. The immunoglobulin class and IgG subclass profiles were analyzed by indirect ELISA using Leishmania (Leishmania amazonensis soluble antigen. The antibody avidity was determined by 6 M urea treatment after incubation with immunoenzymatic conjugate. It was observed that 97% of the serum samples presented anti-Leishmania antibodies for IgE class, 94.6% IgG, 57.5% IgA and 21.5% IgM class. For IgG subclasses the profiles were in the following order of frequency: IgG1>IgG3>IgG2>IgG4. High avidity of anti-Leishmania IgE antibodies was found in 44.4% of the samples. On the other hand, moderate avidity of specific IgG and IgA was observed in 62

  18. First report on Copepoda and Ostracoda (Crustacea from northern Apenninic springs (N. Italy: a faunal and biogeographical account

    Directory of Open Access Journals (Sweden)

    Giampaolo ROSSETTI

    2008-02-01

    Full Text Available The microcrustacean fauna of rheocrene and rheo-limnocrene springs in a protected area of the northern Apennines (Italy was investigated for the first time. All springs are located in the catchments of the rivers Parma and Enza at altitudes between 800 and 1609 m a.s.l. Several of these springs are still in pristine condition while others are artificially modified or impacted to some degree. Surveys were carried out from April to June 2007. The sampling methods used for invertebrate fauna were: moss washing, artificial traps, and inserting drift tubes at the discharge point. A total of 14 harpacticoid, five cyclopoid, and 13 ostracod taxa were identified. Ostracods were mainly represented by crenophilic taxa; of particular interest was the collection of a specimen belonging to Pseudolimnocythere, a stygobiont genus with only two living species and a reduced distribution. Faunal affinities between northern Apenninic springs and those in other Italian mountain systems are discussed. The investigated ecosystems support a high microcrustacean diversity that must be adequately preserved due to the increasing direct and indirect impacts on mountain springs and groundwater resources.

  19. Quantitative analysis of rat Ig (sub)classes binding to cell surface antigens

    International Nuclear Information System (INIS)

    Nilsson, R.; Brodin, T.; Sjoegren, H.-O.

    1982-01-01

    An indirect 125 I-labeled protein A assay for detection of cell surface-bound rat immunoglobulins is presented. The assay is quantitative and rapid and detects as little as 1 ng of cell surface-bound Ig. It discriminates between antibodies belonging to different IgG subclasses, IgM and IgA. The authors describe the production and specificity control of the reagents used and show that the test can be used for quantitative analysis. A large number of sera from untreated rats are tested to evaluate the frequency of falsely positive responses and variation due to age, sex and strain of rat. With this test it is relatively easy to quantitate the binding of classes and subclasses of rat immunoglobulins in a small volume (6 μl) of untreated serum. (Auth.)

  20. [EFFICACY OF IVIG TREATMENT IN BRONCHIECTASIS ASSOCIATED WITH IGG SUBCLASS DEFICIENCY].

    Science.gov (United States)

    Shostak, Yael; Kramer, Mordechai R

    2017-11-01

    Bronchiectasis is characterized by an abnormal dilatation of the bronchi leading to a chronic inflammatory process, airway blockage and impaired clearance of secretions. The damage to the airways is usually progressive and is the result of several pathogenic processes. In the past, healing of infections (especially pulmonary tuberculosis) was the main cause of airway dilatation and progression of chronic inflammation. Today, congenital illnesses, anatomical defects and immune deficiency play an important role in the pathogenesis of bronchiectasis formation. The immunoglobulin repertoire is vital for effective host protection against a wide variety of pathogens. Primary antibody deficiency diseases are defects of the humoral arm of the immune system and involve an absence/reduced levels of one or more immunoglobulin classes/subclasses or defects of specific antibody formation. Immunoglobulin G (IGG) subclass deficiency can occur in a healthy person and could be without clinical significance. However, in recent years there is emerging evidence that in patients with recurrent infections, early diagnosis of antibody deficiency affects the prognosis and prevention of ongoing lung damage. The use of IVIG has contributed significantly to the survival rate in primary antibody deficiencies. There is limited literature on the treatment of IVIG for patients with IGG subclass deficiency. However, all studies presented so far demonstrated that immunoglobulin therapy reduced the rate of bacterial infections, days of antibiotic usage, hospital admissions and significantly increased patients' quality of life. Therefore, in the appropriate clinical setting, ie: a patient with bronchiectasis and recurrent infections, it is justified to test whether there are humoral immune defects such as IGG subclass deficiency. In a patient with proven deficiency, we should recommend to start IVIG treatment until clinical benefit is achieved.

  1. IgG subclasses in previously healthy adult patients with acute ...

    African Journals Online (AJOL)

    t Ccmparing mean values of 19G1, 19G2, JgG3 and IgG4 between the critically ill and. rlOfl-sevet1! groups of patiems. Combined cases. Pooling of data on all cases allowed comparison of the various parameters indicating severity of pneumonia and the. IgG subclass levels between survivors and non-survivors. The results ...

  2. An annotated list of parasites (Isopoda, Copepoda, Monogenea, Digenea, Cestoda and Nematoda) collected in groupers (Serranidae, Epinephelinae) in New Caledonia emphasizes parasite biodiversity in coral reef fish

    Czech Academy of Sciences Publication Activity Database

    Justine, J.-L.; Beveridge, I.; Boxshall, G.A.; Bray, R. A.; Moravec, František; Trilles, J.-P.; Whittington, I.D.

    2010-01-01

    Roč. 57, č. 4 (2010), s. 237-262 ISSN 0015-5683 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Isopoda * Copepoda * Monogenea * Digenea * Cestoda * Nematoda * Serranidae * Epinephelinae * parasite biodiversity * coral reef * New Caledonia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.533, year: 2010

  3. Specific IgG and its subclass antibodies after immunotherapy with gynandropsis gynandra

    Directory of Open Access Journals (Sweden)

    Latha G

    2005-01-01

    Full Text Available Background : About 10 to 15 % of the Indian population is known to suffer from major allergic disorders such as Asthma, Rhinitis, Atopic Dermatitis and Urticaria. Aeroallergens play a major role in the pathogenesis of respiratory allergic diseases. Among the aeroallergens, pollens are major causative agents. The predominance of pollen allergens necessitate the need to assess the specific immunotherapy (SIT in allergic patients. Objective : To evaluate the effect of immunotherapy based on the presence of IgG and its subclass antibodies towards whole pollen antigen of Gynandropsis gynandra (G.gynandra and its fractions. Material and Methods : A study was conducted in 30 bronchial asthma patients on immunotherapy, by assessing the levels of IgG and its subclasses specific to G. gynandra pollen. Results : There was a significant increase in IgG and its subclass antibodies to whole pollen antigen and its fractions i.e.> 90kD, 46-37kD and 36-32kD after the course of IT. Conclusion : The use of peptide fractions may be more appropriate instead of the whole pollen antigen to test the effect of immunotherapy.

  4. Establishment of two invasive crustaceans (Copepoda: Harpacticoida) on the nearshore sands of Lake Michigan

    Science.gov (United States)

    Horvath, Thomas G.; Whitman, Richard L.; Last, Laurel L.

    2001-01-01

    Benthic copepods (Copepoda: Harpacticoida) in the nearshore sediments of southern Lake Michigan appear to be dominated by two new invasive species. We report the first occurrence in North America of Schizopera borutzkyi Montschenko, a native to the Danube River delta, and Heteropsyllus nr. nunni, likely a new species that is morphologically similar to the marine species Heteropsyllus nunni and represents the first occurrence of this genus in freshwater. Schizopera borutzkyi is a euryhaline species occurring in shallow sands in its native habitat and in deeper sands (6-15 m) in southern Lake Michigan. Based on the absence of these species from previous studies, we suggest that they are recent introductions. Heteropsyllus nr. nunni dominated (55-100%) the harpacticoid abundance to depths of 9 m, but S. borutzkyi comprised 75% of the harpacticoid abundance at 15 m. Native harpacticoids were always greatly outnumbered by invasive harpacticoids in our samples, which suggests that the natives are being replaced rapidly or that the invasive species are finding unused resources. The ecological implications of these introductions are not known, but these invasions may represent continued 'invasional meltdown' in Lake Michigan.

  5. Copepoda: Kroyeriidae

    African Journals Online (AJOL)

    1998-10-28

    Oct 28, 1998 ... Introduction. Kroyeria, with 18 nominal species, is the largest of the three genera of the family Kroyeriidae (Deets 1994). The major host taxon for Kroyeria is the Carcharhiniformes, which con- stitutes an estimated 200 species of sharks. Kroyeria dispar was first described by Wilson (1935) from an ...

  6. Copepoda: Pandaridae

    African Journals Online (AJOL)

    1991-03-04

    ,27(1) finely striated marginal membrane is present along the anterior and lateral margins of the cephalothorax of D. latifolia (Figure 1 & 4c), which no doubt fonns an effective seal against the host tissue. Posteriorly, however ...

  7. Different Somatic Hypermutation Levels among Antibody Subclasses Disclosed by a New Next-Generation Sequencing-Based Antibody Repertoire Analysis

    Directory of Open Access Journals (Sweden)

    Kazutaka Kitaura

    2017-05-01

    Full Text Available A diverse antibody repertoire is primarily generated by the rearrangement of V, D, and J genes and subsequent somatic hypermutation (SHM. Class-switch recombination (CSR produces various isotypes and subclasses with different functional properties. Although antibody isotypes and subclasses are considered to be produced by both direct and sequential CSR, it is still not fully understood how SHMs accumulate during the process in which antibody subclasses are generated. Here, we developed a new next-generation sequencing (NGS-based antibody repertoire analysis capable of identifying all antibody isotype and subclass genes and used it to examine the peripheral blood mononuclear cells of 12 healthy individuals. Using a total of 5,480,040 sequences, we compared percentage frequency of variable (V, junctional (J sequence, and a combination of V and J, diversity, length, and amino acid compositions of CDR3, SHM, and shared clones in the IgM, IgD, IgG3, IgG1, IgG2, IgG4, IgA1, IgE, and IgA2 genes. The usage and diversity were similar among the immunoglobulin (Ig subclasses. Clonally related sequences sharing identical V, D, J, and CDR3 amino acid sequences were frequently found within multiple Ig subclasses, especially between IgG1 and IgG2 or IgA1 and IgA2. SHM occurred most frequently in IgG4, while IgG3 genes were the least mutated among all IgG subclasses. The shared clones had almost the same SHM levels among Ig subclasses, while subclass-specific clones had different levels of SHM dependent on the genomic location. Given the sequential CSR, these results suggest that CSR occurs sequentially over multiple subclasses in the order corresponding to the genomic location of IGHCs, but CSR is likely to occur more quickly than SHMs accumulate within Ig genes under physiological conditions. NGS-based antibody repertoire analysis should provide critical information on how various antibodies are generated in the immune system.

  8. Association among Dietary Flavonoids, Flavonoid Subclasses and Ovarian Cancer Risk: A Meta-Analysis

    Science.gov (United States)

    You, Ruxu; Yang, Yu; Liao, Jing; Chen, Dongsheng; Yu, Lixiu

    2016-01-01

    Background Previous studies have indicated that intake of dietary flavonoids or flavonoid subclasses is associated with the ovarian cancer risk, but presented controversial results. Therefore, we conducted a meta-analysis to derive a more precise estimation of these associations. Methods We performed a search in PubMed, Google Scholar and ISI Web of Science from their inception to April 25, 2015 to select studies on the association among dietary flavonoids, flavonoid subclasses and ovarian cancer risk. The information was extracted by two independent authors. We assessed the heterogeneity, sensitivity, publication bias and quality of the articles. A random-effects model was used to calculate the pooled risk estimates. Results Five cohort studies and seven case-control studies were included in the final meta-analysis. We observed that intake of dietary flavonoids can decrease ovarian cancer risk, which was demonstrated by pooled RR (RR = 0.82, 95% CI = 0.68–0.98). In a subgroup analysis by flavonoid subtypes, the ovarian cancer risk was also decreased for isoflavones (RR = 0.67, 95% CI = 0.50–0.92) and flavonols (RR = 0.68, 95% CI = 0.58–0.80). While there was no compelling evidence that consumption of flavones (RR = 0.86, 95% CI = 0.71–1.03) could decrease ovarian cancer risk, which revealed part sources of heterogeneity. The sensitivity analysis indicated stable results, and no publication bias was observed based on the results of Funnel plot analysis and Egger’s test (p = 0.26). Conclusions This meta-analysis suggested that consumption of dietary flavonoids and subtypes (isoflavones, flavonols) has a protective effect against ovarian cancer with a reduced risk of ovarian cancer except for flavones consumption. Nevertheless, further investigations on a larger population covering more flavonoid subclasses are warranted. PMID:26960146

  9. Effect of pistachio consumption on plasma lipoprotein subclasses in pre-diabetic subjects.

    Science.gov (United States)

    Hernández-Alonso, P; Salas-Salvadó, J; Baldrich-Mora, M; Mallol, R; Correig, X; Bulló, M

    2015-04-01

    Nuts have been demonstrated to improve several cardiovascular risk factors and the lipid profile in diabetic and pre-diabetic subjects. However, analysis of conventional serum lipid profiles does not completely explain the atherogenic risk associated with pre-diabetes. We therefore investigated whether chronic consumption of pistachio modifies the lipoprotein subclasses to a healthier profile in pre-diabetic subjects. Randomized cross-over clinical trial in 54 subjects with pre-diabetes. Subjects consumed a pistachio-supplemented diet (PD, 50% carbohydrates, 33% fat, including 57 g/d of pistachios daily) and a control diet (CD, 55% carbohydrates, 30% fat) for 4 months each, separated by a 2-week wash-out. Diets were isocaloric and matched for protein, fiber and saturated fatty acids. Nuclear magnetic resonance (NMR) was performed to determine changes in plasma lipoprotein subclasses. Small low-density lipoprotein particles (sLDL-P) significantly decreased after pistachio consumption compared to the nut-free diet (P = 0.023). The non-high-density lipoprotein particles (non-HDL-P i.e. VLDL-P plus LDL-P) significantly decreased under the PD compared to CD (P = 0.041). The percentage of sHDL-P increased by 2.23% after the PD compared with a reduction of 0.08% after the CD (P = 0.014). Consequently, the overall size of HDL-P significantly decreased in the PD (P = 0.007). Chronic pistachio consumption could modify the lipoprotein particle size and subclass concentrations independently of changes in total plasma lipid profile, which may help to explain the decreased risk of cardiovascular disease and mortality associated with those individuals who frequently consumed nuts. This study is registered at www.clinicaltrials.gov as NCT01441921. Copyright © 2015 Elsevier B.V. All rights reserved.

  10. Family analysis of immunoglobulin classes and subclasses in children with autistic disorder.

    Science.gov (United States)

    Spiroski, Mirko; Trajkovski, Vladimir; Trajkov, Dejan; Petlichkovski, Aleksandar; Efinska-Mladenovska, Olivija; Hristomanova, Slavica; Djulejic, Eli; Paneva, Meri; Bozhikov, Jadranka

    2009-11-01

    Autistic disorder is a severe neurodevelopment disorder characterized by a triad of impairments in reciprocal social interaction, verbal and nonverbal communication, and a pattern of repetitive stereotyped activities, behaviours and interests. There are strong lines of evidence to suggest that the immune system plays an important role in the pathogenesis of autistic disorder. The aim of this study was to analyze quantitative plasma concentration of immunoglobulin classes, and subclasses in autistic patients and their families. The investigation was performed retrospectively in 50 persons with autistic disorder in the Republic of Macedonia. Infantile autistic disorder was diagnosed by DSM-IV and ICD-10 criteria. Plasma immunoglobulin classes (IgM, IgA, and IgG) and subclasses (IgG1, IgG2, IgG3, and IgG4) were determined using Nephelometer Analyzer BN-100. Multiple comparisons for the IgA variable have shown statistically significant differences between three pairs: male autistic from the fathers (p = 0,001), female autistic from the mothers (p = 0,008), as well as healthy sisters from the fathers (p = 0,011). Statistically significant differences found between three groups regarding autistic disorder (person with autistic disorder, father/mother of a person with autistic disorder, and brother/sister) independent of sex belongs to IgA, IgG2, and IgG3 variables. Multiple comparisons for the IgA variable have shown statistically significant differences between children with autistic disorder from the fathers and mothers (p autistic disorder from the same family should be tested for immunoglobulin classes and subclasses in order to avoid differences between generations.

  11. IgG subclass reactivity to Trypanosoma cruzi in chronic chagasic patients.

    Science.gov (United States)

    Hernández-Becerril, N; Nava, A; Reyes, P A; Monteón, V M

    2001-01-01

    The anti-Trypanosoma cruzi antibodies isotype profile in Chagas' disease has been studied in relation to different clinical manifestations. A high titer of IgG anti-T. cruzi antibodies is found in patients with cardiac involvement, while a high titer of IgA anti-T. cruzi antibodies is associated with digestive forms. The aim of this work was to analyze the IgG subclass reactivity of anti-T. cruzi antibodies in patients with chronic Chagasic cardiomyopathy. Twelve consecutive chagasic patients were analyzed for IgG subclass reactivity to a T. cruzi antigenic extract. They had a complete clinical evaluation, peripheral EKG, echocardiography, left ventriculogram, and coronariography. All patients came from rural areas of Mexico and had lived in endemic zones for over seven years. They presented left ventricular endsystolic dimension above 42 mm in 58% (7/12) and ejection fraction below 50% in 58% (7/12). We found that IgG1 and IgG2 anti-T. cruzi antibodies showed higher titer than IgG3 antibodies, with consistently low titer of IgG4 antibodies. Expression of the four IgG subclasses of anti-T. cruzi antibodies suggest a mixed Th1/Th2-like immune response under a probably continuous chronic antigenic stimulation. On the other hand, high levels of IgG2 anti-T. cruzi antibodies showed a tendency to be associated with severe cardiomegaly. Our results suggest that a mixed Th1/Th2-like immune response may take place in chronic chagasic patients under a chronic antigenic stimulation.

  12. Family Analysis of Immunoglobulin Classes and Subclasses in Children with Autistic Disorder

    Directory of Open Access Journals (Sweden)

    Mirko Spiroski

    2009-11-01

    Full Text Available Autistic disorder is a severe neurodevelopment disorder characterized by a triad of impairments in reciprocal social interaction, verbal and nonverbal communication, and a pattern of repetitive stereotyped activities, behaviours and interests. There are strong lines of evidence to suggest that the immune system plays an important role in the pathogenesis of autistic disorder. The aim of this study was to analyze quantitative plasma concentration of immunoglobulin classes, and subclasses in autistic patients and their families. The investigation was performed retrospectively in 50 persons with autistic disorder in the Republic of Macedonia. Infantile autistic disorder was diagnosed by DSM-IV and ICD-10 criteria. Plasma immunoglobulin classes (IgM, IgA, and IgG and subclasses (IgG1, IgG2, IgG3, and IgG4 were determined using Nephelometer Analyzer BN-100. Multiple comparisons for the IgA variable have shown statistically significant differences between three pairs: male autistic from the fathers (p = 0,001, female autistic from the mothers (p = 0,008, as well as healthy sisters from the fathers (p = 0,011. Statistically significant differences found between three groups regarding autistic disorder (person with autistic disorder, father/mother of a person with autistic disorder, and brother/sister independent of sex belongs to IgA, IgG2, and IgG3 variables. Multiple comparisons for the IgA variable have shown statistically significant differences between children with autistic disorder from the fathers and mothers (p < 0,001, and healthy brothers and sisters from the fathers and mothers (p < 0,001. Comparison between healthy children and children with autistic disorder from the same family should be tested for immunoglobulin classes and subclasses in order to avoid differences between generations.

  13. Morphometric variability of Arctodiaptomus salinus (Copepoda) in the Mediterranean-Black Sea region.

    Science.gov (United States)

    Anufriieva, Elena V; Shadrin, Nickolai V

    2015-11-18

    Inter-species variability in morphological traits creates a need to know the range of variability of characteristics in the species for taxonomic and ecological tasks. Copepoda Arctodiaptomus salinus, which inhabits water bodies across Eurasia and North Africa, plays a dominant role in plankton of different water bodies-from fresh to hypersaline. This work assesses the intra- and inter-population morphometric variability of A. salinus in the Mediterranean-Black Sea region and discusses some observed regularities. The variability of linear body parameters and proportions was studied. The impacts of salinity, temperature, and population density on morphological characteristics and their variability can manifest themselves in different ways at the intra- and inter-population levels. A significant effect of salinity, pH and temperature on the body proportions was not found. Their intra-population variability is dependent on temperature and salinity. Sexual dimorphism of A. salinus manifests in different linear parameters, proportions, and their variability. There were no effects of temperature, pH and salinity on the female/male parameter ratio. There were significant differences in the body proportions of males and females in different populations. The influence of temperature, salinity, and population density can be attributed to 80%-90% of intra-population variability of A. salinus. However, these factors can explain less than 40% of inter-population differences. Significant differences in the body proportions of males and females from different populations may suggest that some local populations of A. salinus in the Mediterranean-Black Sea region are in the initial stages of differentiation.

  14. A solid dietary fat containing fish oil redistributes lipoprotein subclasses without increasing oxidative stress in men

    DEFF Research Database (Denmark)

    Tholstrup, T.; Hellgren, Lars; Petersen, M.

    2004-01-01

    , a solid dietary fat containing (n-3) PUFA decreased plasma TAG, VLDL, and IDL cholesterol, and redistributed lipoprotein subclasses in LDL and HDL, with a higher concentration of the larger and less atherogenic subfractions. These changes took place without an increase in oxidative stress as measured...... of F than O fat (P oxidation measured as the ratio of plasma isoprostanes F-2 to arachidonic acid and urinary isoprostanes, whereas the vitamin E activity/plasma total lipids ratio was higher after intake of F than O (P = 0.008). In conclusion...

  15. In-depth analysis of subclass-specific conformational preferences of IgG antibodies

    DEFF Research Database (Denmark)

    Tian, Xinsheng; Vestergaard, Bente; Thorolfsson, Matthias

    2015-01-01

    IgG subclass-specific differences in biological function and in vitro stability are often referred to variations in the conformational flexibility, while this flexibility has rarely been characterized. Here, small-angle X-ray scattering data from IgG1, IgG2 and IgG4 antibodies, which were designe...... properties and tailored effector functions. In addition, this advanced computational approach is applicable to other flexible multi-domain systems and extends the potential for investigating flexibility in solutions of macromolecules by small-angle X-ray scattering....

  16. Effects of dietary saturated fat on LDL subclasses and apolipoprotein CIII in men

    OpenAIRE

    Faghihnia, Nastaran; Mangravite, Lara M.; Chiu, Sally; Bergeron, Nathalie; Krauss, Ronald M.

    2012-01-01

    Background/Objectives Small dense LDL particles and apolipoprotein (apo) CIII are risk factors for cardiovascular disease (CVD) that can be modulated by diet, but there is little information regarding the effects of dietary saturated fat on their plasma levels. We tested the effects of high vs. low saturated fat intake in the context of a high beef protein diet on levels and composition of LDL subclasses and on apoCIII levels in plasma and LDL. Subjects/Methods Following consumption of a base...

  17. Flavonoids, Flavonoid Subclasses, and Esophageal Cancer Risk: A Meta-Analysis of Epidemiologic Studies.

    Science.gov (United States)

    Cui, Lingling; Liu, Xinxin; Tian, Yalan; Xie, Chen; Li, Qianwen; Cui, Han; Sun, Changqing

    2016-06-08

    Flavonoids have been suggested to play a chemopreventive role in carcinogenesis. However, the epidemiologic studies assessing dietary intake of flavonoids and esophageal cancer risk have yielded inconsistent results. This study was designed to examine the association between flavonoids, each flavonoid subclass, and the risk of esophageal cancer with a meta-analysis approach. We searched for all relevant studies with a prospective cohort or case-control study design published from January 1990 to April 2016, using PUBMED, EMBASE, and Web of Science. Pooled odds ratios (ORs) were calculated using fixed or random-effect models. In total, seven articles including 2629 cases and 481,193 non-cases were selected for the meta-analysis. Comparing the highest-intake patients with the lowest-intake patients for total flavonoids and for each flavonoid subclass, we found that anthocyanidins (OR = 0.60, 95% CI: 0.49-0.74), flavanones (OR = 0.65, 95% CI: 0.49-0.86), and flavones (OR = 0.78, 95% CI 0.64-0.95) were inversely associated with the risk of esophageal cancer. However, total flavonoids showed marginal association with esophageal cancer risk (OR = 0.78, 95% CI: 0.59-1.04). In conclusion, our study suggested that dietary intake of total flavonoids, anthocyanidins, flavanones, and flavones might reduce the risk of esophageal cancer.

  18. Differences in immunoglobulin subclasses between dye exclusion and 51Cr release complement-dependent lymphocytotoxicity assays

    International Nuclear Information System (INIS)

    McConnachie, P.R.; Denegri, J.F.; Lower, F.E.; Torry, D.S.; McIntyre, J.A.

    1986-01-01

    Paradoxical differences previously noted between lymphocytotoxicity detected by dye exclusion at room temperature (CDCE) or by 51 Cr release (CDC 51 Cr) at 37 0 C in maternal antipaternal complement-dependent lymphocytotoxicity have suggested that CDCE and CDC 51 Cr at 37 0 C, but not at 20 degrees C, may detect different immunological antibody-antigen interactions. Reactions in the two test systems against the same target cells were compared in sera from known immune dialysis patients, secondary aborting women, and refractory platelet recipients before and after heat treatment of sera, absorption with solid-phase heparin, anti-light-chain augmentation, and the addition of murine monoclonal anti-IgG subclass antibodies. The results demonstrate significant differences between the two tests using the same target and sera. Further, the results imply the presence of an inhibitor and an inhibitor of inhibitor in sera. The involvement of different immunoglobulin subclasses was shown in the two tests. These data demonstrate the necessity for further study of the nature of the differences in the mechanisms of these clinically important antibody-detecting systems

  19. Abnormal serum IgG subclass pattern in children with Down's syndrome.

    Science.gov (United States)

    Annerén, G; Magnusson, C G; Lilja, G; Nordvall, S L

    1992-05-01

    Susceptibility to infections is a well known feature of Down's syndrome. The possible relation between this predisposition and the serum concentrations of the IgG subclasses was studied in 38 children with Down's syndrome aged 1-12 years. An age matched group of 50 healthy children served as controls. The serum concentrations of IgG1 and IgG3 were significantly raised among children with Down's syndrome in all three age groups studied (that is 1-2.5, 4-8, and 9-12 years). The serum concentrations of IgG2 were normal in the first two groups but significantly reduced in the third age group. In contrast, the concentrations of IgG4 among children with Down's syndrome were significantly reduced in all three age groups. Moreover, among the children with Down's syndrome aged 4-12 years 68% (15/22) had IgG4 concentrations below 2 SDs of the geometrical mean of the controls. The results may partially explain the proneness of children with Down's syndrome to infections with encapsulated bacteria. Although the underlying cause of these abnormalities is unknown, IgG subclass determination seems relevant in the clinical evaluation of children with Down's syndrome.

  20. In-depth analysis of subclass-specific conformational preferences of IgG antibodies

    Directory of Open Access Journals (Sweden)

    Xinsheng Tian

    2015-01-01

    Full Text Available IgG subclass-specific differences in biological function and in vitro stability are often referred to variations in the conformational flexibility, while this flexibility has rarely been characterized. Here, small-angle X-ray scattering data from IgG1, IgG2 and IgG4 antibodies, which were designed with identical variable regions, were thoroughly analysed by the ensemble optimization method. The extended analysis of the optimized ensembles through shape clustering reveals distinct subclass-specific conformational preferences, which provide new insights for understanding the variations in physical/chemical stability and biological function of therapeutic antibodies. Importantly, the way that specific differences in the linker region correlate with the solution structure of intact antibodies is revealed, thereby visualizing future potential for the rational design of antibodies with designated physicochemical properties and tailored effector functions. In addition, this advanced computational approach is applicable to other flexible multi-domain systems and extends the potential for investigating flexibility in solutions of macromolecules by small-angle X-ray scattering.

  1. Effects of adjuvants on IgG subclasses elicited by virus-like Particles

    Directory of Open Access Journals (Sweden)

    Visciano Maria Luisa

    2012-01-01

    Full Text Available Abstract Background Virus-Like Particles (VLPs represent an efficient strategy to present and deliver conformational antigens to the immune system, inducing both arms of the adaptive immune response. Moreover, their particulate structure surrounded by cell membrane provides an adjuvanted effect to VLP-based immunizations. In the present study, the elicitation of different patterns of IgG subclasses by VLPs, administered in CpG ODN1826 or poly(I:C adjuvants, has been evaluated in an animal model. Results Adjuvanted VLPs elicited a higher titer of total specific IgG compared to VLPs alone. Furthermore, while VLPs alone induced a balanced TH2 pattern, VLPs formulated with either adjuvant elicited a TH1-biased IgG subclasses (IgG2a and IgG3, with poly(I:C more potent than CpG ODN1826. Conclusions The results confirmed that adjuvants efficiently improve antigen immunogenicity and represent a suitable strategy to skew the adaptive immune response toward the differentiation of the desired T helper subset, also using VLPs as antigen.

  2. Low density lipoprotein subclasses and response to a low-fat diet in healthy men

    Energy Technology Data Exchange (ETDEWEB)

    Krauss, R.M.; Dreon, D.M. [Lawrence Berkeley Lab., CA (United States). Life Sciences Div.

    1994-11-01

    Lipid and lipoprotein response to reduced dietary fat intake was investigated in relation to differences in distribution of LDL subclasses among 105 healthy men consuming high-fat (46%) and low-fat (24%) diets in random order for six weeks each. On high-fat, 87 subjects had predominantly large, buoyant LDL as measured by gradient gel electrophoresis and confirmed by analytic ultracentrifugation (pattern A), while the remainder had primarily smaller, denser LDL (pattern B). On low-fat, 36 men changed from pattern A to B. Compared with the 51 men in the stable A group, men in the stable B group (n = 18) had a three-fold greater reduction in LDL cholesterol and significantly greater reductions in plasma apoB and mass of intermediate (LDL II) and small (LDL III) LDL subtractions measured by analytic ultracentrifugation. In both stable A and change groups, reductions in LDL-cholesterol were not accompanied by reduced plasma apoB, consistent with the observation of a shift in LDL particle mass from larger, lipid-enriched (LDL I and II) to smaller, lipid-depleted (LDL III and IV) subfractions, without significant change in particle number. Genetic and environmental factors influencing LDL subclass distributions thus may also contribute substantially to interindividual variation in response to a low-fat diet.

  3. Feeding spectra of Arctodiaptomus salinus (Calanoida, Copepoda) using fatty acid trophic markers in seston food in two salt lakes in South Siberia (Khakasia, Russia)

    OpenAIRE

    Tolomeev, A.; Sushchik, N.N.; Gulati, R.D.; Makhutova, O.N.; Kalacheva, G.S.; Zotina, T.A.

    2010-01-01

    During two vegetation seasons (2004–2005), we compared feeding spectra of Arctodiaptomus salinus (Calanoida, Copepoda) populations inhabiting two neighboring salt lakes, Shira and Shunet, Khakasia, Russia, using fatty acid (FA) trophic markers. Sestonic FA composition in two lakes moderately differed, whereas levels of diatom FA markers were higher in Lake Shunet and of Cyanobacteria and green algae markers in Lake Shira. In general, markers in storage lipids—triacylglycerols (TAG) of A. sali...

  4. Prevalence of Mytilicola intestinalis (Copepoda: Mytilicolidae) and Urastoma cyprinae (Turbellaria: Hypotrichinidae) in marketable mussels Mytilus galloprovincialis in Italy.

    Science.gov (United States)

    Canestri Trotti, G; Baccarani, E M; Giannetto, S; Giuffrida, A; Paesanti, F

    1998-03-05

    Marketable mussels Mytilus galloprovincialis traded with commercial certification from production sites in Italy and abroad (France, Spain) were examined for the presence of Mytilicola intestinalis (Copepoda: Mytilicolidae) and Urastoma cyprinae (Turbellaria: Hypotrichinidae) from October 1994 to February 1996. The prevalence of M. intestinalis was 4.1% and 4.7% respectively in mussels from Lerici (La Spezia) and S. Pietro in Volta (Venice), whereas it rose to 57.9% in the samples from Spain. M. intestinalis was absent in mussels from Chioggia (Venice), Ganzirri (Messina), Taranto, Trieste and France. The prevalence of U. cyprinae varied considerably, ranging from 0.3% in mussels from Trani (Bari) to 33.2% and 86.3% respectively in those from Chioggia and Trieste. It was 85.7% in samples from France and 63.7% in those from Spain.

  5. Listeria monocytogenes Meningitis in an Immunosuppressed Patient with Autoimmune Hepatitis and IgG4 Subclass Deficiency

    DEFF Research Database (Denmark)

    Gaini, Shahin

    2015-01-01

    A 51-year-old Caucasian woman with Listeria monocytogenes meningitis was treated and discharged after an uncomplicated course. Her medical history included immunosuppressive treatment with prednisolone and azathioprine for autoimmune hepatitis. A diagnostic work-up after the meningitis episode...... revealed that she had low levels of the IgG4 subclass. To our knowledge, this is the first case report describing a possible association between autoimmune hepatitis and the occurrence of Listeria monocytogenes meningitis, describing a possible association between Listeria monocytogenes meningitis...... and deficiency of the IgG4 subclass and finally describing a possible association between Listeria monocytogenes meningitis and immunosuppressive therapy with prednisolone and azathioprine....

  6. Desmozoon lepeophtherii n. gen., n. sp., (Microsporidia: Enterocytozoonidae infecting the salmon louse Lepeophtheirus salmonis (Copepoda: Caligidae

    Directory of Open Access Journals (Sweden)

    Freeman Mark A

    2009-11-01

    Full Text Available Abstract Background A microsporidian was previously reported to infect the crustacean parasite, Lepeophtheirus salmonis (Krøyer, 1837 (Copepoda, Caligidae, on farmed Atlantic salmon (Salmo salar L. in Scotland. The microsporidian was shown to be a novel species with a molecular phylogenetic relationship to Nucleospora (Enterocytozoonidae, but the original report did not assign it to a genus or species. Further studies examined the development of the microsporidian in L. salmonis using electron microscopy and re-evaluated the molecular findings using new sequence data available for the group. Here we report a full description for the microsporidian and assign it to a new genus and species. Results The microsporidian infects subcuticular cells that lie on the innermost region of the epidermal tissue layer beneath the cuticle and along the internal haemocoelic divisions. The mature spores are sub-spherical with a single nucleus and an isofilar polar filament with 5-8 turns in a double coil. The entire development is in direct contact with the host cell cytoplasm and is polysporous. During early merogony, a diplokaryotic nuclear arrangement exists which is absent throughout the rest of the developmental cycle. Large merogonial plasmodia form which divide to form single uninucleate sporonts. Sporogonial plasmodia were not observed; instead, binucleate sporonts divide to form two sporoblasts. Prior to final division, there is a precocious development of the polar filament extrusion apparatus which is associated with large electron lucent inclusions (ELIs. Analyses of DNA sequences reveal that the microsporidian is robustly supported in a clade with other members of the Enterocytozoonidae and confirms a close phylogenetic relationship with Nucleospora. Conclusion The ultrastructural findings of the precocious development of the polar filament and the presence of ELIs are consistent with those of the Enterocytozoonidae. However, the confirmed presence

  7. Different IgG-subclass distributions after whole-cell and acellular pertussis infant primary vaccinations in healthy and pertussis infected children

    NARCIS (Netherlands)

    Hendrikx, Lotte H.; Schure, Rose-Minke; Ozturk, Kemal; de Rond, Lia G. H.; de Greeff, S. C.; Sanders, Elisabeth A. M.; Berbers, Guy A. M.; Buisman, Anne-Marie

    2011-01-01

    The distribution of IgG-subclasses provides insight in the immunological mechanisms of protection against whooping cough. We investigated the effect of Dutch whole-cell pertussis and acellular pertussis vaccines administered in infancy on the IgG-subclass distributions in healthy children aged 12

  8. A systematic approach to obtain validated Partial Least Square models for predicting lipoprotein subclasses from serum NMR spectra

    NARCIS (Netherlands)

    Mihaleva, V.V.; van Schalkwijk, D.B.; de Graaf, A.A.; van Duynhoven, J.; van Dorsten, F.A.; Vervoort, J.; Smilde, A.; Westerhuis, J.A.; Jacobs, D.M.

    2014-01-01

    A systematic approach is described for building validated PLS models that predict cholesterol and triglyceride concentrations in lipoprotein subclasses in fasting serum from a normolipidemic, healthy population. The PLS models were built on diffusion-edited 1H NMR spectra and calibrated on

  9. A systematic approach to obtain validated partial least square models for predicting lipoprotein subclasses from serum NMR spectra

    NARCIS (Netherlands)

    Mihaleva, V.V.; Schalkwijk, van D.B.; Graaf, de A.A.; Duynhoven, van J.P.M.; Dorsten, van F.A.; Vervoort, J.J.M.; Smilde, A.K.; Westerhuis, J.A.; Jacobs, D.M.

    2014-01-01

    A systematic approach is described for building validated PLS models that predict cholesterol and triglyceride concentrations in lipoprotein subclasses in fasting serum from a normolipidemic, healthy population. The PLS models were built on diffusion-edited (1)H NMR spectra and calibrated on

  10. A systematic approach to obtain validated partial least square models for predicting lipoprotein subclasses from serum nmr spectra

    NARCIS (Netherlands)

    Mihaleva, V.V.; Schalkwijk, D.B. van; Graaf, A.A. de; Duynhoven, J. van; Dorsten, F.A. van; Vervoort, J.; Smilde, A.; Westerhuis, J.A.; Jacobs, D.M.

    2014-01-01

    A systematic approach is described for building validated PLS models that predict cholesterol and triglyceride concentrations in lipoprotein subclasses in fasting serum from a normolipidemic, healthy population. The PLS models were built on diffusion-edited 1H NMR spectra and calibrated on

  11. Immunoglobulin G1 Allotype Influences Antibody Subclass Distribution in Response to HIV gp140 Vaccination

    Directory of Open Access Journals (Sweden)

    Sven Kratochvil

    2017-12-01

    Full Text Available Antibody subclasses exhibit extensive polymorphisms (allotypes that could potentially impact the quality of HIV-vaccine induced B cell responses. Allotypes of immunoglobulin (Ig G1, the most abundant serum antibody, have been shown to display altered functional properties in regard to serum half-life, Fc-receptor binding and FcRn-mediated mucosal transcytosis. To investigate the potential link between allotypic IgG1-variants and vaccine-generated humoral responses in a cohort of 14 HIV vaccine recipients, we developed a novel protocol for rapid IgG1-allotyping. We combined PCR and ELISA assays in a dual approach to determine the IgG1 allotype identity (G1m3 and/or G1m1 of trial participants, using human plasma and RNA isolated from PBMC. The IgG1-allotype distribution of our participants mirrored previously reported results for caucasoid populations. We observed elevated levels of HIV gp140-specific IgG1 and decreased IgG2 levels associated with the G1m1-allele, in contrast to G1m3 carriers. These data suggest that vaccinees homozygous for G1m1 are predisposed to develop elevated Ag-specific IgG1:IgG2 ratios compared to G1m3-carriers. This elevated IgG1:IgG2 ratio was further associated with higher FcγR-dimer engagement, a surrogate for potential antibody-dependent cellular cytotoxicity (ADCC and antibody-dependent cellular phagocytosis (ADCP function. Although preliminary, these results suggest that IgG1 allotype may have a significant impact on IgG subclass distribution in response to vaccination and associated Fc-mediated effector functions. These results have important implications for ongoing HIV vaccine efficacy studies predicated on engagement of FcγR-mediated cellular functions including ADCC and ADCP, and warrant further investigation. Our novel allotyping protocol provides new tools to determine the potential impact of IgG1 allotypes on vaccine efficacy.

  12. Evidence of IgY subclass diversification in snakes: evolutionary implications.

    Science.gov (United States)

    Wang, Tao; Sun, Yi; Shao, Wenwei; Cheng, Gang; Li, Lingxiao; Cao, Zubing; Yang, Zhi; Zou, Huiying; Zhang, Wei; Han, Binyue; Hu, Yang; Ren, Liming; Hu, Xiaoxiang; Guo, Ying; Fei, Jing; Hammarström, Lennart; Li, Ning; Zhao, Yaofeng

    2012-10-01

    Mammalian IgG and IgE are thought to have evolved from IgY of nonmammalian tetrapods; however, no diversification of IgY subclasses has been reported in reptiles or birds, which are phylogenetically close to mammals. To our knowledge, we report the first evidence of the presence of multiple IgY-encoding (υ) genes in snakes. Two υ genes were identified in the snake Elaphe taeniura, and three υ genes were identified in the Burmese python (Python molurus bivittatus). Although four of the υ genes displayed a conventional four-H chain C region exon structure, one of the υ genes in the Burmese python lacked the H chain C region 2 exon, thus exhibiting a structure similar to that of the mammalian γ genes. We developed mouse mAbs specific for the IgY1 and IgY2 of E. taeniura and showed that both were expressed in serum; each had two isoforms: one full-length and one truncated at the C terminus. The truncation was not caused by alternative splicing or transcriptional termination. We also identified the μ and δ genes, but no α gene, in both snakes. This study provides valuable clues for our understanding of Ig gene evolution in tetrapods.

  13. Area-specific development of distinct projection neuron subclasses is regulated by postnatal epigenetic modifications

    Science.gov (United States)

    Harb, Kawssar; Magrinelli, Elia; Nicolas, Céline S; Lukianets, Nikita; Frangeul, Laura; Pietri, Mariel; Sun, Tao; Sandoz, Guillaume; Grammont, Franck; Jabaudon, Denis; Studer, Michèle; Alfano, Christian

    2016-01-01

    During cortical development, the identity of major classes of long-distance projection neurons is established by the expression of molecular determinants, which become gradually restricted and mutually exclusive. However, the mechanisms by which projection neurons acquire their final properties during postnatal stages are still poorly understood. In this study, we show that the number of neurons co-expressing Ctip2 and Satb2, respectively involved in the early specification of subcerebral and callosal projection neurons, progressively increases after birth in the somatosensory cortex. Ctip2/Satb2 postnatal co-localization defines two distinct neuronal subclasses projecting either to the contralateral cortex or to the brainstem suggesting that Ctip2/Satb2 co-expression may refine their properties rather than determine their identity. Gain- and loss-of-function approaches reveal that the transcriptional adaptor Lmo4 drives this maturation program through modulation of epigenetic mechanisms in a time- and area-specific manner, thereby indicating that a previously unknown genetic program postnatally promotes the acquisition of final subtype-specific features. DOI: http://dx.doi.org/10.7554/eLife.09531.001 PMID:26814051

  14. Igg Subclasses Targeting the Flagella of Salmonella enterica Serovar Typhimurium Can Mediate Phagocytosis and Bacterial Killing

    Science.gov (United States)

    Goh, Yun Shan; Armour, Kathryn L; Clark, Michael R; Grant, Andrew J; Mastroeni, Pietro

    2016-01-01

    Invasive non-typhoidal Salmonella are a common cause of invasive disease in immuno-compromised individuals and in children. Multi-drug resistance poses challenges to disease control, with a critical need for effective vaccines. Flagellin is an attractive vaccine candidate due to surface exposure and high epitope copy number, but its potential as a target for opsonophacytic antibodies is unclear. We examined the effect of targeting flagella with different classes of IgG on the interaction between Salmonella Typhimurium and a human phagocyte-like cell line, THP-1. We tagged the FliC flagellar protein with a foreign CD52 mimotope (TSSPSAD) and bacteria were opsonized with a panel of humanised CD52 antibodies with the same antigen-binding V-region, but different constant regions. We found that IgG binding to flagella increases bacterial phagocytosis and reduces viable intracellular bacterial numbers. Opsonisation with IgG3, followed by IgG1, IgG4, and IgG2, resulted in the highest level of bacterial uptake and in the highest reduction in the intracellular load of viable bacteria. Taken together, our data provide proof-of-principle evidence that targeting flagella with antibodies can increase the antibacterial function of host cells, with IgG3 being the most potent subclass. These data will assist the rational design of urgently needed, optimised vaccines against iNTS disease. PMID:27366588

  15. Brasilochondria riograndensis gen. nov., sp. nov. (Copepoda, Chondracanthidae a parasite of flounders of Rio Grande do Sul State, Brazil

    Directory of Open Access Journals (Sweden)

    Vernon E. Thatcher

    2004-09-01

    Full Text Available Brasilochondria riograndensis gen. nov., sp. nov. (Copepoda, Chondracanthidae a parasite of the flounder, Paralichthys orbignyanus (Valenciennes, 1839, is described. The new genus has a spherical head a post-mandibular "neck" and two pairs of modified biramous legs. In these respects, it resembles Argentinochondria patagonensis Etchegoin, Timi & Sardella, 2003. In the Argentine genus, however, the bulbous head has a medial constriction and the posterior of the female lacks the lateral extensions that are present in the new genus. Pseudolernentoma brasiliensis Luque & Alves, 2003, also resembles the new genus but it lacks the lateral extensions of the trunk and the latter is cylindrical rather than flat. The second leg of the new genus is small and the endopod is shorter than the exopod. The other two genera have large second legs with subequal rami.Brasilochondria riograndensis gen. nov., sp. nov. (Copepoda, Chondracanthidae, um parasito do linguado, Paralichthys orbignyanus (Valenciennes, 1839, é descrito. O novo gênero tem uma cabeça esférica, um "pescoço" pós-mandíbular e dois pares de pernas que são birremes e modificados na fêmea. Nestes aspectos, ela parece com Argentinochondria patagonensis Etchegoin, Timi & Sardella, 2003. Nesta, no entanto, a cabeça é esférica com uma constrição medial e na parte posterior do tronco faltam as extensões póstero-laterais que o novo gênero possui. Pseudolernentoma brasiliensis Luque & Alves, 2003, é também parecido com o novo gênero, mas carece das extensões póstero-laterais e o mesmo tronco é cilíndrico em vez de achatado. A segunda perna no novo gênero é pequena e o endopodito é mais curto que o exopodito. Nos outros dois gêneros, as segundas pernas são grandes e os ramos são sub-iguais.

  16. Listeria monocytogenes Meningitis in an Immunosuppressed Patient with Autoimmune Hepatitis and IgG4 Subclass Deficiency

    Directory of Open Access Journals (Sweden)

    Shahin Gaini

    2015-01-01

    Full Text Available A 51-year-old Caucasian woman with Listeria monocytogenes meningitis was treated and discharged after an uncomplicated course. Her medical history included immunosuppressive treatment with prednisolone and azathioprine for autoimmune hepatitis. A diagnostic work-up after the meningitis episode revealed that she had low levels of the IgG4 subclass. To our knowledge, this is the first case report describing a possible association between autoimmune hepatitis and the occurrence of Listeria monocytogenes meningitis, describing a possible association between Listeria monocytogenes meningitis and deficiency of the IgG4 subclass and finally describing a possible association between Listeria monocytogenes meningitis and immunosuppressive therapy with prednisolone and azathioprine.

  17. Isolation and characterization of a monoclonal anti CK-2 alpha subunit antibody of the IgG1 subclass

    DEFF Research Database (Denmark)

    Schmidt-Spaniol, I; Boldyreff, B; Issinger, O G

    1992-01-01

    A monoclonal antibody was produced against the recombinant human alpha subunit of CK-2. The antibody was of the IgG1 subclass and it was isolated from serum-free cell culture media and purified by affinity chromatography on Protein G Sepharose. The antibody can be used to detect specifically the CK......-2 alpha subunit in immunoblots from tissue extracts. An ELISA detection test was also established which also allows the identification of the CK-2 alpha subunit....

  18. Absolute Quantitation of Glycoforms of Two Human IgG Subclasses Using Synthetic Fc Peptides and Glycopeptides

    Science.gov (United States)

    Roy, Rini; Ang, Evelyn; Komatsu, Emy; Domalaon, Ronald; Bosseboeuf, Adrien; Harb, Jean; Hermouet, Sylvie; Krokhin, Oleg; Schweizer, Frank; Perreault, Hélène

    2018-05-01

    Immunoglobulins, such as immunoglobulin G (IgG), are of prime importance in the immune system. Polyclonal human IgG comprises four subclasses, of which IgG1 and IgG2 are the most abundant in healthy individuals. In an effort to develop an absolute MALDI-ToF-MS quantitative method for these subclasses and their Fc N-glycoforms, (glyco)peptides were synthesized using a solid-phase approach and used as internal standards. Tryptic digest glycopeptides from monoclonal IgG1 and IgG2 samples were first quantified using EEQYN(GlcNAc)STYR and EEQFN(GlcNAc)STFR standards, respectively. For IgG1, a similar glycopeptide where tyrosine (Y) was isotopically labelled was used to quantify monoclonal IgG1 that had been treated with the enzyme Endo-F2, i.e., yielding tryptic glycopeptide EEQYN(GlcNAc)STYR. The next step was to quantify single subclasses within polyclonal human IgG samples. Although ion abundances in the MALDI spectra often showed higher signals for IgG2 than IgG1, depending on the spotting solvent used, determination of amounts using the newly developed quantitative method allowed to obtain accurate concentrations where IgG1 species were predominant. It was observed that simultaneous analysis of IgG1 and IgG2 yielded non-quantitative results and that more success was obtained when subclasses were quantified one by one. More experiments served to assess the respective extraction and ionization efficiencies of EEQYNSTYR/EEQFNSTFR and EEQYN(GlcNAc)STYR/EEQFN(GlcNAc)STFR mixtures under different solvent and concentration conditions.

  19. Novel enzyme immunoassay system for simultaneous detection of six subclasses of antiphospholipid antibodies for differential diagnosis of antiphospholipid syndrome.

    Science.gov (United States)

    Nojima, Junzo; Motoki, Yukari; Hara, Kazusa; Sakata, Toshiyuki; Ichihara, Kiyoshi

    2017-06-01

    : Antiphospholipid syndrome, which often complicates systemic lupus erythematosus (SLE), features high occurrence of arterial and/or venous thrombosis and recurrent fetal loss. However, which antibody subclass contributes to which clinical event remains uncertain. We newly developed an up-to-date enzyme immunoassay system using the AcuStar automated analyzer (Instrumentation Laboratory, Bedford, Massachusetts, USA) for parallel detection of six subclasses of antiphospholipid antibodies (aPLs): anticardiolipin antibodies (aCL) of IgG, IgM, and IgA and anti-β2-glycoprotein I antibodies (aβ2GPI) of IgG, IgM, and IgA. They were measured in 276 healthy volunteers and 138 patients with SLE: 45 with thromboembolic complications (29 arterial; 16 venous) and 93 without. Lupus anticoagulant activity in their plasma was measured according to the guidelines recommended by the Subcommittee on Lupus Anticoagulant/Phospholipid-Dependent Antibodies. aCL/β2GPI was measured with a standard ELISA kit commonly used in Japan. The positive results of IgG aCL, IgA aCL, and IgG aβ2GPI were closely associated with thromboembolic complications, whereas IgM aCL and IgM aβ2GPI were not. receiver operating characteristic analysis revealed that the accuracy of predicting thromboembolic complications based on the composite test results of the former three antibodies were obviously higher than by each alone. Regarding agreement with the test results of lupus anticoagulant activity, IgG aβ2GPI showed the closest match. Patients with SLE frequently possess various combinations of the six aPL subclasses, and this antibody spectrum is closely associated with thromboembolic events in these patients. This new automated enzyme immunoassay system allows simultaneous analysis of the profile of aPL subclasses for the differential diagnosis of antiphospholipid antibody syndrome in its early stage.

  20. Correlation of Fc(gamma)RIIa (CD32) Polymorphism and IgG Antibody Subclasses in Hemolytic Disease of Newborn.

    Science.gov (United States)

    Wu, QiangJu; Zhang, Yan; Liu, MengLi; Wang, Bo; Liu, Sheng; He, Chen

    2009-01-01

    ABO-HDN is a common disease of newborn in China and currently there is no satisfactory method to predict it in the antepartum period. It has been reported that Fc(gamma)RIIa (CD32) genotype is associated with both infectious diseases induced by bacteria and parasitemia. There is a relationship between IgG subclass and RH-HDN. To study the pathogenesis of ABO-HDN and to find reliable method to diagnose ABO-HDN, we investigated the polymorphism of Fc(gamma)RIIa (CD32) and distribution of IgG subclass in infants with ABO-HDN and their mothers by polymerase chain reaction or ELISA assay. We observed that the frequency of HH131 genotype is lower in infants with ABO-HDN than in controls (p < 0.01), while the frequency of HR131 genotype is higher in ABO-HDN infants than that in controls (p < 0.01). The genotype HR131 and concentrations of IgG1 and IgG3 are significantly correlated with ABO-HDN. Our results demonstrated, for the first time, that there is a correlation between ABO-HDN and CD32, and different IgG subclass distribution. Our study may contribute to the development of an early diagnostic method for HDN. Copyright 2009 S. Karger AG, Basel.

  1. The complete mitogenome of the whale shark parasitic copepod Pandarus rhincodonicus norman, Newbound & Knott (Crustacea; Siphonostomatoida; Pandaridae)--a new gene order for the copepoda.

    Science.gov (United States)

    Austin, Christopher M; Tan, Mun Hua; Lee, Yin Peng; Croft, Laurence J; Meekan, Mark G; Pierce, Simon J; Gan, Han Ming

    2016-01-01

    The complete mitochondrial genome of the parasitic copepod Pandarus rhincodonicus was obtained from a partial genome scan using the HiSeq sequencing system. The Pandarus rhincodonicus mitogenome has 14,480 base pairs (62% A+T content) made up of 12 protein-coding genes, 2 ribosomal subunit genes, 22 transfer RNAs, and a putative 384 bp non-coding AT-rich region. This Pandarus mitogenome sequence is the first for the family Pandaridae, the second for the order Siphonostomatoida and the sixth for the Copepoda.

  2. Subtypes of the Type II Pit Pattern Reflect Distinct Molecular Subclasses in the Serrated Neoplastic Pathway.

    Science.gov (United States)

    Aoki, Hironori; Yamamoto, Eiichiro; Yamano, Hiro-O; Sugai, Tamotsu; Kimura, Tomoaki; Tanaka, Yoshihito; Matsushita, Hiro-O; Yoshikawa, Kenjiro; Takagi, Ryo; Harada, Eiji; Nakaoka, Michiko; Yoshida, Yuko; Harada, Taku; Sudo, Gota; Eizuka, Makoto; Yorozu, Akira; Kitajima, Hiroshi; Niinuma, Takeshi; Kai, Masahiro; Nojima, Masanori; Suzuki, Hiromu; Nakase, Hiroshi

    2018-03-15

    Colorectal serrated lesions (SLs) are important premalignant lesions whose clinical and biological features are not fully understood. We aimed to establish accurate colonoscopic diagnosis and treatment of SLs through evaluation of associations among the morphological, pathological, and molecular characteristics of SLs. A total of 388 premalignant and 18 malignant colorectal lesions were studied. Using magnifying colonoscopy, microsurface structures were assessed based on Kudo's pit pattern classification system, and the Type II pit pattern was subcategorized into classical Type II, Type II-Open (Type II-O) and Type II-Long (Type II-L). BRAF/KRAS mutations and DNA methylation of CpG island methylator phenotype (CIMP) markers (MINT1, - 2, - 12, - 31, p16, and MLH1) were analyzed through pyrosequencing. Type II-O was tightly associated with sessile serrated adenoma/polyps (SSA/Ps) with BRAF mutation and CIMP-high. Most lesions with simple Type II or Type II-L were hyperplastic polyps, while mixtures of Type II or Type II-L plus more advanced pit patterns (III/IV) were characteristic of traditional serrated adenomas (TSAs). Type II-positive TSAs frequently exhibited BRAF mutation and CIMP-low, while Type II-L-positive TSAs were tightly associated with KRAS mutation and CIMP-low. Analysis of lesions containing both premalignant and cancerous components suggested Type II-L-positive TSAs may develop into KRAS-mutated/CIMP-low/microsatellite stable cancers, while Type II-O-positive SSA/Ps develop into BRAF-mutated/CIMP-high/microsatellite unstable cancers. These results suggest that Type II subtypes reflect distinct molecular subclasses in the serrated neoplasia pathway and that they could be useful hallmarks for identifying SLs at high risk of developing into CRC.

  3. IgG4 subclass antibodies impair antitumor immunity in melanoma

    Science.gov (United States)

    Karagiannis, Panagiotis; Gilbert, Amy E.; Josephs, Debra H.; Ali, Niwa; Dodev, Tihomir; Saul, Louise; Correa, Isabel; Roberts, Luke; Beddowes, Emma; Koers, Alexander; Hobbs, Carl; Ferreira, Silvia; Geh, Jenny L.C.; Healy, Ciaran; Harries, Mark; Acland, Katharine M.; Blower, Philip J.; Mitchell, Tracey; Fear, David J.; Spicer, James F.; Lacy, Katie E.; Nestle, Frank O.; Karagiannis, Sophia N.

    2013-01-01

    Host-induced antibodies and their contributions to cancer inflammation are largely unexplored. IgG4 subclass antibodies are present in IL-10–driven Th2 immune responses in some inflammatory conditions. Since Th2-biased inflammation is a hallmark of tumor microenvironments, we investigated the presence and functional implications of IgG4 in malignant melanoma. Consistent with Th2 inflammation, CD22+ B cells and IgG4+-infiltrating cells accumulated in tumors, and IL-10, IL-4, and tumor-reactive IgG4 were expressed in situ. When compared with B cells from patient lymph nodes and blood, tumor-associated B cells were polarized to produce IgG4. Secreted B cells increased VEGF and IgG4, and tumor cells enhanced IL-10 secretion in cocultures. Unlike IgG1, an engineered tumor antigen-specific IgG4 was ineffective in triggering effector cell–mediated tumor killing in vitro. Antigen-specific and nonspecific IgG4 inhibited IgG1-mediated tumoricidal functions. IgG4 blockade was mediated through reduction of FcγRI activation. Additionally, IgG4 significantly impaired the potency of tumoricidal IgG1 in a human melanoma xenograft mouse model. Furthermore, serum IgG4 was inversely correlated with patient survival. These findings suggest that IgG4 promoted by tumor-induced Th2-biased inflammation may restrict effector cell functions against tumors, providing a previously unexplored aspect of tumor-induced immune escape and a basis for biomarker development and patient-specific therapeutic approaches. PMID:23454746

  4. Biochemical Characterization of CPS-1, a Subclass B3 Metallo-β-Lactamase from a Chryseobacterium piscium Soil Isolate

    DEFF Research Database (Denmark)

    Gudeta, Dereje Dadi; Pollini, Simona; Docquier, Jean-Denis

    2016-01-01

    CPS-1 is a subclass B3 metallo-β-lactamase from a Chryseobacterium piscium isolated from soil, showing 68 % amino acid identity to GOB-1 enzyme. CPS-1 was overproduced in Escherichia coli Rosetta (DE3), purified by chromatography and biochemically characterized. This enzyme exhibits a broad spect...... spectrum substrate profile including penicillins, cephalosporins and carbapenems, which overall resembles those of L1, GOB-1 and acquired subclass B3 enzymes AIM-1 and SMB-1....

  5. Indices of anti-dengue immunoglobulin G subclasses in adult Mexican patients with febrile and hemorrhagic dengue in the acute phase.

    Science.gov (United States)

    Posadas-Mondragón, Araceli; Aguilar-Faisal, José Leopoldo; Chávez-Negrete, Adolfo; Guillén-Salomón, Edith; Alcántara-Farfán, Verónica; Luna-Rojas, Lucero; Ávila-Trejo, Amanda Marineth; Del Carmen Pacheco-Yépez, Judith

    2017-10-01

    Heterologous secondary infections are at increased risk of developing dengue hemorrhagic fever (DHF) because of antibody-dependent enhancement (ADE). IgG subclasses can fix and activate complement and bind to Fcɣ receptors. These factors may also play an important role in the development of ADE and thus in the pathogenesis of DHF. The aim of this study was to analyze the indices of anti-dengue IgG subclasses in adult patients with febrile and hemorrhagic dengue in the acute phase. In 2013, 129 patients with dengue fever (DF) and 57 with DHF in Veracruz, Mexico were recruited for this study and anti-dengue IgM and IgG determined by capture ELISA. Anti-dengue IgG subclasses were detected by indirect ELISA. Anti-dengue IgG2 and IgG3 subclasses were detected in patients with dengue. IgG1 increased significantly in the sera of patients with both primary and secondary infections and DHF, but was higher in patients with secondary infections. The IgG4 subclass index was significantly higher in the sera of patients with DHF than in that of those with DF, who were in the early and late acute phase of both primary and secondary infection. In conclusion, indices of subclasses IgG1 and IgG4 were higher in patients with DHF. © 2017 The Societies and John Wiley & Sons Australia, Ltd.

  6. Antibody-Mediated Internalization of Infectious HIV-1 Virions Differs among Antibody Isotypes and Subclasses.

    Science.gov (United States)

    Tay, Matthew Zirui; Liu, Pinghuang; Williams, LaTonya D; McRaven, Michael D; Sawant, Sheetal; Gurley, Thaddeus C; Xu, Thomas T; Dennison, S Moses; Liao, Hua-Xin; Chenine, Agnès-Laurence; Alam, S Munir; Moody, M Anthony; Hope, Thomas J; Haynes, Barton F; Tomaras, Georgia D

    2016-08-01

    Emerging data support a role for antibody Fc-mediated antiviral activity in vaccine efficacy and in the control of HIV-1 replication by broadly neutralizing antibodies. Antibody-mediated virus internalization is an Fc-mediated function that may act at the portal of entry whereby effector cells may be triggered by pre-existing antibodies to prevent HIV-1 acquisition. Understanding the capacity of HIV-1 antibodies in mediating internalization of HIV-1 virions by primary monocytes is critical to understanding their full antiviral potency. Antibody isotypes/subclasses differ in functional profile, with consequences for their antiviral activity. For instance, in the RV144 vaccine trial that achieved partial efficacy, Env IgA correlated with increased risk of HIV-1 infection (i.e. decreased vaccine efficacy), whereas V1-V2 IgG3 correlated with decreased risk of HIV-1 infection (i.e. increased vaccine efficacy). Thus, understanding the different functional attributes of HIV-1 specific IgG1, IgG3 and IgA antibodies will help define the mechanisms of immune protection. Here, we utilized an in vitro flow cytometric method utilizing primary monocytes as phagocytes and infectious HIV-1 virions as targets to determine the capacity of Env IgA (IgA1, IgA2), IgG1 and IgG3 antibodies to mediate HIV-1 infectious virion internalization. Importantly, both broadly neutralizing antibodies (i.e. PG9, 2G12, CH31, VRC01 IgG) and non-broadly neutralizing antibodies (i.e. 7B2 mAb, mucosal HIV-1+ IgG) mediated internalization of HIV-1 virions. Furthermore, we found that Env IgG3 of multiple specificities (i.e. CD4bs, V1-V2 and gp41) mediated increased infectious virion internalization over Env IgG1 of the same specificity, while Env IgA mediated decreased infectious virion internalization compared to IgG1. These data demonstrate that antibody-mediated internalization of HIV-1 virions depends on antibody specificity and isotype. Evaluation of the phagocytic potency of vaccine

  7. Early diagnosis of congenital toxoplasmosis in newborn infants using IgG subclasses against two Toxoplasma gondii recombinant proteins

    Directory of Open Access Journals (Sweden)

    Carlos Henryque de Souza e Silva

    2012-05-01

    Full Text Available The aim of this work was to evaluate the utility of ELISA-based testing of total IgG (IgGt antibodies and its subclasses (IgG1, IgG2, IgG3 and IgG4 against soluble (STAg and recombinant (rSAG1 and rMIC3 antigens of Toxoplasma gondii for diagnosing congenital toxoplasmosis. Sera from 217 newborns initially testing positive for specific IgM in filter paper dried blood spots were tested for specific IgM and IgG by ELFA-VIDAS®. Congenital toxoplasmosis was confirmed in 175 and ruled out in 42 infants. The validity of the ELISA tests was determined using the persistence of IgG antibodies (ELFA-VIDAS® kit at the end of 12 months, which is considered the reference test for the diagnosis of congenital toxoplasmosis. The frequency of positivity with IgGt against STAg, rSAG1 and rMIC3 was found in 97.2%, 96.3% and 80.2%, respectively, of the newborns with confirmed congenital toxoplasmosis. IgG1 reacted with all three antigens, while IgG3 and IgG4 reacted preferentially with rMIC3. Higher mean values of reactivity (sample optical density/cut-off were found for all subclasses when using rMIC3. All of the antigens showed high sensitivity and low specificity in detecting anti-T. gondii IgGt and IgG1 and low sensitivity and high specificity in detecting IgG3 and IgG4. In conclusion, the combined detection of IgG antibody subclasses against recombinant toxoplasmic antigens may be useful for the early diagnosis of congenital toxoplasmosis.

  8. Effects of pregnancy and intensity of Plasmodium falciparum transmission on immunoglobulin G subclass responses to variant surface antigens

    DEFF Research Database (Denmark)

    Megnekou, Rosette; Staalsoe, Trine; Taylor, Diane W

    2005-01-01

    Placenta-sequestering Plasmodium falciparum involved in the pathogenesis of pregnancy-associated malaria (PAM) in otherwise clinically immune women expresses particular variant surface antigens (VSA(PAM)) on the surface of infected erythrocytes that differ from VSA found in parasitized nonpregnant...... individuals (non-PAM type VSA). We studied levels of immunoglobulin G (IgG) and IgG subclasses with specificity for VSA(PAM) and for non-PAM type VSA in pregnant and nonpregnant women from two sites with different endemicities in Cameroon. We found that VSA(PAM)-specific responses depended on the pregnancy......(PAM)-specific immunity to pregnancy-associated malaria....

  9. Multi-gene analysis reveals a lack of genetic divergence between Calanus agulhensis and C. sinicus (Copepoda; Calanoida.

    Directory of Open Access Journals (Sweden)

    Robert Kozol

    Full Text Available The discrimination and taxonomic identification of marine species continues to pose a challenge despite the growing number of diagnostic metrics and approaches. This study examined the genetic relationship between two sibling species of the genus Calanus (Crustacea; Copepoda; Calanidae, C. agulhensis and C. sinicus, using a multi-gene analysis. DNA sequences were determined for portions of the mitochondrial cytochrome c oxidase I (mtCOI; nuclear citrate synthase (CS, and large subunit (28S rRNA genes for specimens collected from the Sea of Japan and North East (NE Pacific Ocean for C. sinicus and from the Benguela Current and Agulhas Bank, off South Africa, for C. agulhensis. For mtCOI, C. sinicus and C. agulhensis showed similar levels of haplotype diversity (H(d = 0.695 and 0.660, respectively and nucleotide diversity (π = 0.003 and 0.002, respectively. Pairwise F(ST distances for mtCOI were significant only between C. agulhensis collected from the Agulhas and two C. sinicus populations: the Sea of Japan (F(ST = 0.152, p<0.01 and NE Pacific (F(ST = 0.228, p<0.005. Between the species, F(ST distances were low for both mtCOI (F(ST = 0.083, p = 0.003 and CS (F(ST = 0.050, p = 0.021. Large subunit (28S rRNA showed no variation between the species. Our results provide evidence of the lack of genetic distinction of C. sinicus and C. agulhensis, raise questions of whether C. agulhensis warrants status as a distinct species, and indicate the clear need for more intensive and extensive ecological and genetic analysis.

  10. A new and rapid method for immunoglobulin class and subclass determination of mouse monoclonal antibodies using a solid-phase immunoradiometric assay

    International Nuclear Information System (INIS)

    Storch, M.-J.; Lohmann-Matthes, M.-L.

    1984-01-01

    A solid-phase immunoradiometric assay is described for the detection of mouse immunoglobulin classes and subclasses in unpurified and unconcentrated supernatants of hybridomas. IgG fractions from rabbit antisera specific for mouse immunoglobulin classes and subclasses are used for coating the wells of flexible microtiter plates. Monoclonal antibody present in hybridoma supernatants is bound only to wells that contain the appropriate anti-subclass antibody. The binding of hybridoma antibodies to corresponding IgG subclasses or IgM is then detected by a labeled rabbit anti-mouse antibody binding to all mouse immunoglobulins (heavy and light chains). Thus, only 1 labeled antibody is needed for all assays. The advantages of the method described are the following: results are obtained within a few hours and antibody containing hybridoma supernatants may be used without a concentration step since minute amounts of antibody are detected by the immunoradiometric assay. Cultures producing several subclasses may be early recognized as oligo/polyclonal. (Auth.)

  11. VizieR Online Data Catalog: Abundances of 8 RR Lyrae subclass C variable stars (Govea+, 2014)

    Science.gov (United States)

    Govea, J.; Gomez, T.; Preston, G. W.; Sneden, C.

    2016-02-01

    We chose 10 candidate RR Lyrae variable stars of subclass c (RRc) stars for spectroscopic observation. Many of these stars were first identified as RRc variables by the All Sky Automated Survey (ASAS) of Pojmanski 2003 (cat. II/264). The target star list included ASAS 144154-0324.7 and ASAS 204440-2402.7. But our spectroscopic study suggest that these two stars are probably W UMa binaries instead of RR Lyrae stars Our spectra were obtained with the echelle spectrograph of the du Pont 2.5m telescope at the Las Campanas Observatory. Four observing runs during 2009-2010 were partly devoted to this project. The spectrograph was used with the 1.5*4'' entrance slit, which translates to a resolving power of R=λ/Δλ~27000 at the MgI b lines near 5180Å. The total continuous wavelength coverage of the spectra was 3500-9000Å. (6 data files).

  12. Lipoprotein subclasses in the Monitored Atherosclerosis Regression Study (MARS). Treatment effects and relation to coronary angiographic progression.

    Science.gov (United States)

    Mack, W J; Krauss, R M; Hodis, H N

    1996-05-01

    Accumulating evidence suggests that triglyceride-rich lipoproteins contribute to coronary artery disease. Using data from the Monitored Atherosclerosis Regression Study, an angiographic trial of middle-aged men and women randomized to lovastatin or placebo, we investigated relationships between lipoprotein subclasses and progression of coronary artery atherosclerosis. Coronary artery lesion progression was determined by quantitative coronary angiography in low-grade ( or = 50% diameter stenosis), and all coronary artery lesions in 220 baseline/2-year angiogram pairs. Analytical ultracentrifugation was used to measure lipoprotein masses that were statistically evaluated for treatment group differences and relationships to progression of coronary artery atherosclerosis. All low density lipoprotein (LDL), intermediate density lipoprotein (IDL), and very low density lipoprotein (VLDL) masses were significantly lowered and all high density lipoprotein (HDL) masses were significantly raised with lovastatin therapy. The mass of smallest LDL (Svedberg flotation rate [Sf] 0 to 3), IDL (Sf 12 to 20), all VLDL subclasses (Sf 20 to 60, Sf 60 to 100, and Sf 100 to 400), and peak LDL flotation rate were significantly related to the progression of coronary artery lesions, specifically low-grade lesions. Greater baseline levels of HDL3, were related to a lower likelihood of coronary artery lesion progression. In multivariate analyses, small VLDL (Sf 20 to 60) and HDL3 mass were the most important correlates of coronary artery lesion progression. These results provide further evidence for the importance of triglyceride-rich lipoproteins in the progression of coronary artery disease. In addition, these results present new evidence for the possible protective role of HDL3 in the progression of coronary artery lesions. More specific information on coronary artery lesion progression may be obtained through the study of specific apolipoprotein B-containing lipoproteins.

  13. Understanding of human metabolic pathways of different sub-classes of phenols from Arbutus unedo fruit after an acute intake.

    Science.gov (United States)

    Mosele, Juana I; Macià, Alba; Motilva, María-José

    2016-03-01

    Arbutus unedo is a small Mediterranean fruit, commonly named strawberry tree, which is a rich source of different sub-classes of phenolic compounds, the more representative being the gallic acid derivatives, including its mono and oligomeric forms esterified with quinic and shikimic acids. In addition, galloyl derivatives, particularly gallotannins, described in A. unedo, are part of a very selective phenolic group, present in a reduced number of plant-products. The aim of the present study is to provide a better understanding of human metabolic pathways of different sub-classes of phenols from the A. unedo fruit after an acute intake by healthy adults. Therefore, the A. unedo phenolic metabolites were studied in whole blood samples (0 to 24 h), urine (24 h) and feces (12 and 24 h). Special focus was placed on the application of dried blood spot (DBS) cards for the sample collection and for the analysis of phenolic metabolites in whole blood samples. The results of the blood analysis revealed two peaks for the maximum concentrations of the main phenolic metabolites. Furthermore, it is appropriate to highlight the application of DBS cards as an efficient and accurate way to collect blood samples in post-prandial bioavailability studies. The analysis of urine (24 h) gave a wide range of phenolic metabolites showing the extensive metabolism that A. unedo phenolic compounds underwent in the human body. The results of the study provide a relevant contribution to the understanding of the in vivo human bioavailability of phenolic compounds, especially galloyl derivatives, a singular phenolic sub-group present in the A. unedo fruit.

  14. COMMON PATTERNS IN THE EVOLUTION BETWEEN THE LUMINOUS NEUTRON STAR LOW-MASS X-RAY BINARY SUBCLASSES

    International Nuclear Information System (INIS)

    Fridriksson, Joel K.; Homan, Jeroen; Remillard, Ronald A.

    2015-01-01

    The X-ray transient XTE J1701–462 was the first source observed to evolve through all known subclasses of low-magnetic-field neutron star low-mass X-ray binaries (NS-LMXBs), as a result of large changes in its mass accretion rate. To investigate to what extent similar evolution is seen in other NS-LMXBs we have performed a detailed study of the color–color and hardness–intensity diagrams (CDs and HIDs) of Cyg X-2, Cir X-1, and GX 13+1—three luminous X-ray binaries, containing weakly magnetized neutron stars, known to exhibit strong secular changes in their CD/HID tracks. Using the full set of Rossi X-ray Timing Explorer Proportional Counter Array data collected for the sources over the 16 year duration of the mission, we show that Cyg X-2 and Cir X-1 display CD/HID evolution with close similarities to XTE J1701–462. Although GX 13+1 shows behavior that is in some ways unique, it also exhibits similarities to XTE J1701–462, and we conclude that its overall CD/HID properties strongly indicate that it should be classified as a Z source, rather than as an atoll source. We conjecture that the secular evolution of Cyg X-2, Cir X-1, and GX 13+1—illustrated by sequences of CD/HID tracks we construct—arises from changes in the mass accretion rate. Our results strengthen previous suggestions that within single sources Cyg-like Z source behavior takes place at higher luminosities and mass accretion rates than Sco-like Z behavior, and lend support to the notion that the mass accretion rate is the primary physical parameter distinguishing the various NS-LMXB subclasses

  15. Can non-cholesterol sterols and lipoprotein subclasses distribution predict different patterns of cholesterol metabolism and statin therapy response?

    Science.gov (United States)

    Gojkovic, Tamara; Vladimirov, Sandra; Spasojevic-Kalimanovska, Vesna; Zeljkovic, Aleksandra; Vekic, Jelena; Kalimanovska-Ostric, Dimitra; Djuricic, Ivana; Sobajic, Sladjana; Jelic-Ivanovic, Zorana

    2017-03-01

    Cholesterol homeostasis disorders may cause dyslipidemia, atherosclerosis progression and coronary artery disease (CAD) development. Evaluation of non-cholesterol sterols (NCSs) as synthesis and absorption markers, and lipoprotein particles quality may indicate the dyslipidemia early development. This study investigates associations of different cholesterol homeostasis patterns with low-density (LDL) and high-density lipoproteins (HDL) subclasses distribution in statin-treated and statin-untreated CAD patients, and potential use of aforementioned markers for CAD treatment optimization. The study included 78 CAD patients (47 statin-untreated and 31 statin-treated) and 31 controls (CG). NCSs concentrations were quantified using gas chromatography- flame ionization detection (GC-FID). Lipoprotein subclasses were separated by gradient gel electrophoresis. In patients, cholesterol-synthesis markers were significantly higher comparing to CG. Cholesterol-synthesis markers were inversely associated with LDL size in all groups. For cholesterol homeostasis estimation, each group was divided to good and/or poor synthetizers and/or absorbers according to desmosterol and β-sitosterol median values. In CG, participants with reduced cholesterol absorption, the relative proportion of small, dense LDL was higher in those with increased cholesterol synthesis compared to those with reduced synthesis (p<0.01). LDL I fraction was significantly higher in poor synthetizers/poor absorbers subgroup compared to poor synthetizers/good absorbers (p<0.01), and good synthetizers/poor absorbers (p<0.01). Statin-treated patients with increased cholesterol absorption had increased proportion of LDL IVB (p<0.05). The results suggest the existence of different lipoprotein abnormalities according to various patterns of cholesterol homeostasis. Desmosterol/β-sitosterol ratio could be used for estimating individual propensity toward dyslipidemia development and direct the future treatment.

  16. Complete chloroplast genome of Gracilaria firma (Gracilariaceae, Rhodophyta), with discussion on the use of chloroplast phylogenomics in the subclass Rhodymeniophycidae.

    Science.gov (United States)

    Ng, Poh-Kheng; Lin, Showe-Mei; Lim, Phaik-Eem; Liu, Li-Chia; Chen, Chien-Ming; Pai, Tun-Wen

    2017-01-06

    The chloroplast genome of Gracilaria firma was sequenced in view of its role as an economically important marine crop with wide industrial applications. To date, there are only 15 chloroplast genomes published for the Florideophyceae. Apart from presenting the complete chloroplast genome of G. firma, this study also assessed the utility of genome-scale data to address the phylogenetic relationships within the subclass Rhodymeniophycidae. The synteny and genome structure of the chloroplast genomes across the taxa of Eurhodophytina was also examined. The chloroplast genome of Gracilaria firma maps as a circular molecule of 187,001 bp and contains 252 genes, which are distributed on both strands and consist of 35 RNA genes (3 rRNAs, 30 tRNAs, tmRNA and a ribonuclease P RNA component) and 217 protein-coding genes, including the unidentified open reading frames. The chloroplast genome of G. firma is by far the largest reported for Gracilariaceae, featuring a unique intergenic region of about 7000 bp with discontinuous vestiges of red algal plasmid DNA sequences interspersed between the nblA and cpeB genes. This chloroplast genome shows similar gene content and order to other Florideophycean taxa. Phylogenomic analyses based on the concatenated amino acid sequences of 146 protein-coding genes confirmed the monophyly of the classes Bangiophyceae and Florideophyceae with full nodal support. Relationships within the subclass Rhodymeniophycidae in Florideophyceae received moderate to strong nodal support, and the monotypic family of Gracilariales were resolved with maximum support. Chloroplast genomes hold substantial information that can be tapped for resolving the phylogenetic relationships of difficult regions in the Rhodymeniophycidae, which are perceived to have experienced rapid radiation and thus received low nodal support, as exemplified in this study. The present study shows that chloroplast genome of G. firma could serve as a key link to the full resolution of

  17. COMMON PATTERNS IN THE EVOLUTION BETWEEN THE LUMINOUS NEUTRON STAR LOW-MASS X-RAY BINARY SUBCLASSES

    Energy Technology Data Exchange (ETDEWEB)

    Fridriksson, Joel K. [Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Homan, Jeroen; Remillard, Ronald A., E-mail: J.K.Fridriksson@uva.nl [Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139 (United States)

    2015-08-10

    The X-ray transient XTE J1701–462 was the first source observed to evolve through all known subclasses of low-magnetic-field neutron star low-mass X-ray binaries (NS-LMXBs), as a result of large changes in its mass accretion rate. To investigate to what extent similar evolution is seen in other NS-LMXBs we have performed a detailed study of the color–color and hardness–intensity diagrams (CDs and HIDs) of Cyg X-2, Cir X-1, and GX 13+1—three luminous X-ray binaries, containing weakly magnetized neutron stars, known to exhibit strong secular changes in their CD/HID tracks. Using the full set of Rossi X-ray Timing Explorer Proportional Counter Array data collected for the sources over the 16 year duration of the mission, we show that Cyg X-2 and Cir X-1 display CD/HID evolution with close similarities to XTE J1701–462. Although GX 13+1 shows behavior that is in some ways unique, it also exhibits similarities to XTE J1701–462, and we conclude that its overall CD/HID properties strongly indicate that it should be classified as a Z source, rather than as an atoll source. We conjecture that the secular evolution of Cyg X-2, Cir X-1, and GX 13+1—illustrated by sequences of CD/HID tracks we construct—arises from changes in the mass accretion rate. Our results strengthen previous suggestions that within single sources Cyg-like Z source behavior takes place at higher luminosities and mass accretion rates than Sco-like Z behavior, and lend support to the notion that the mass accretion rate is the primary physical parameter distinguishing the various NS-LMXB subclasses.

  18. Comparison of a reduced carbohydrate and reduced fat diet for LDL, HDL, and VLDL subclasses during 9-months of weight maintenance subsequent to weight loss.

    Science.gov (United States)

    LeCheminant, James D; Smith, Bryan K; Westman, Eric C; Vernon, Mary C; Donnelly, Joseph E

    2010-06-01

    This study compared LDL, HDL, and VLDL subclasses in overweight or obese adults consuming either a reduced carbohydrate (RC) or reduced fat (RF) weight maintenance diet for 9 months following significant weight loss. Thirty-five (21 RC; 14 RF) overweight or obese middle-aged adults completed a 1-year weight management clinic. Participants met weekly for the first six months and bi-weekly thereafter. Meetings included instruction for diet, physical activity, and behavior change related to weight management. Additionally, participants followed a liquid very low-energy diet of approximately 2092 kJ per day for the first three months of the study. Subsequently, participants followed a dietary plan for nine months that targeted a reduced percentage of carbohydrate (approximately 20%) or fat (approximately 30%) intake and an energy intake level calculated to maintain weight loss. Lipid subclasses using NMR spectroscopy were analyzed prior to weight loss and at multiple intervals during weight maintenance. Body weight change was not significantly different within or between groups during weight maintenance (p>0.05). The RC group showed significant increases in mean LDL size, large LDL, total HDL, large and small HDL, mean VLDL size, and large VLDL during weight maintenance while the RF group showed increases in total HDL, large and small HDL, total VLDL, and large, medium, and small VLDL (p0.05). Some individual lipid subclasses improved in both dietary groups. Large and medium VLDL subclasses increased to a greater extent across weight maintenance in the RF group.

  19. Analysis of gene expression data from non-small cell lung carcinoma cell lines reveals distinct sub-classes from those identified at the phenotype level.

    Directory of Open Access Journals (Sweden)

    Andrew R Dalby

    Full Text Available Microarray data from cell lines of Non-Small Cell Lung Carcinoma (NSCLC can be used to look for differences in gene expression between the cell lines derived from different tumour samples, and to investigate if these differences can be used to cluster the cell lines into distinct groups. Dividing the cell lines into classes can help to improve diagnosis and the development of screens for new drug candidates. The micro-array data is first subjected to quality control analysis and then subsequently normalised using three alternate methods to reduce the chances of differences being artefacts resulting from the normalisation process. The final clustering into sub-classes was carried out in a conservative manner such that sub-classes were consistent across all three normalisation methods. If there is structure in the cell line population it was expected that this would agree with histological classifications, but this was not found to be the case. To check the biological consistency of the sub-classes the set of most strongly differentially expressed genes was be identified for each pair of clusters to check if the genes that most strongly define sub-classes have biological functions consistent with NSCLC.

  20. Induction of a Th-1-biased IgG subclass response against equine herpesvirus type 1 in horses previously infected with type 4 virus.

    Science.gov (United States)

    Bannai, Hiroshi; Tsujimura, Koji; Kondo, Takashi; Nemoto, Manabu; Yamanaka, Takashi; Sugiura, Takeo; Maeda, Ken; Matsumura, Tomio

    2011-04-01

    An immunoglobulin G (IgG) subclass response against equine herpesvirus type 1 (EHV-1) infection was investigated in horses that were naïve to EHV-1/4 and those that had previously been exposed to EHV-4. The IgG subclass response was determined by an ELISA using EHV-1-specific recombinant gG protein as an antigen. In most horses naïve to EHV-1/4, IgGa, IgGb, and IgG(T) were induced after experimental infection with EHV-1. In contrast, a subclass response dominated by IgGa and IgGb, with no apparent increase in IgG(T), was observed after EHV-1 infection in horses previously infected with EHV-4. Horses naturally infected with EHV-1 in the field showed similar responses. These results indicated that pre-infection with EHV-4 induced a Th-1-biased IgG subclass response against subsequent EHV-1 infection.

  1. Common, low-frequency, and rare genetic variants associated with lipoprotein subclasses and triglyceride measures in Finnish men from the METSIM study.

    Directory of Open Access Journals (Sweden)

    James P Davis

    2017-10-01

    Full Text Available Lipid and lipoprotein subclasses are associated with metabolic and cardiovascular diseases, yet the genetic contributions to variability in subclass traits are not fully understood. We conducted single-variant and gene-based association tests between 15.1M variants from genome-wide and exome array and imputed genotypes and 72 lipid and lipoprotein traits in 8,372 Finns. After accounting for 885 variants at 157 previously identified lipid loci, we identified five novel signals near established loci at HIF3A, ADAMTS3, PLTP, LCAT, and LIPG. Four of the signals were identified with a low-frequency (0.005subclass traits. 30 established lipid-associated loci had a stronger association for a subclass trait than any conventional trait. These novel association signals provide further insight into the molecular basis of dyslipidemia and the etiology of metabolic disorders.

  2. Complete chloroplast genome sequence of MD-2 pineapple and its comparative analysis among nine other plants from the subclass Commelinidae.

    Science.gov (United States)

    Redwan, R M; Saidin, A; Kumar, S V

    2015-08-12

    Pineapple (Ananas comosus var. comosus) is known as the king of fruits for its crown and is the third most important tropical fruit after banana and citrus. The plant, which is indigenous to South America, is the most important species in the Bromeliaceae family and is largely traded for fresh fruit consumption. Here, we report the complete chloroplast sequence of the MD-2 pineapple that was sequenced using the PacBio sequencing technology. In this study, the high error rate of PacBio long sequence reads of A. comosus's total genomic DNA were improved by leveraging on the high accuracy but short Illumina reads for error-correction via the latest error correction module from Novocraft. Error corrected long PacBio reads were assembled by using a single tool to produce a contig representing the pineapple chloroplast genome. The genome of 159,636 bp in length is featured with the conserved quadripartite structure of chloroplast containing a large single copy region (LSC) with a size of 87,482 bp, a small single copy region (SSC) with a size of 18,622 bp and two inverted repeat regions (IRA and IRB) each with the size of 26,766 bp. Overall, the genome contained 117 unique coding regions and 30 were repeated in the IR region with its genes contents, structure and arrangement similar to its sister taxon, Typha latifolia. A total of 35 repeats structure were detected in both the coding and non-coding regions with a majority being tandem repeats. In addition, 205 SSRs were detected in the genome with six protein-coding genes contained more than two SSRs. Comparative chloroplast genomes from the subclass Commelinidae revealed a conservative protein coding gene albeit located in a highly divergence region. Analysis of selection pressure on protein-coding genes using Ka/Ks ratio showed significant positive selection exerted on the rps7 gene of the pineapple chloroplast with P less than 0.05. Phylogenetic analysis confirmed the recent taxonomical relation among the member of

  3. Macrophage cholesterol efflux correlates with lipoprotein subclass distribution and risk of obstructive coronary artery disease in patients undergoing coronary angiography

    Directory of Open Access Journals (Sweden)

    Kremer Werner

    2009-04-01

    Full Text Available Abstract Background Studies in patients with low HDL have suggested that impaired cellular cholesterol efflux is a heritable phenotype increasing atherosclerosis risk. Less is known about the association of macrophage cholesterol efflux with lipid profiles and CAD risk in normolipidemic subjects. We have therefore measured macrophage cholesterol efflux in142 normolipidemic subjects undergoing coronary angiography. Methods Monocytes isolated from blood samples of patients scheduled for cardiac catheterization were differentiated into macrophages over seven days. Isotopic cholesterol efflux to exogenously added apolipoprotein A-I and HDL2 was measured. Quantitative cholesterol efflux from macrophages was correlated with lipoprotein subclass distribution in plasma from the same individuals measured by NMR-spectroscopy of lipids and with the extent of coronary artery disease seen on coronary angiography. Results Macrophage cholesterol efflux was positively correlated with particle concentration of smaller HDL and LDL particles but not with total plasma concentrations of HDL or LDL-cholesterol. We observed an inverse relationship between macrophage cholesterol efflux and the concntration of larger and triglyceride rich particles (VLDL, chylomicrons. Subjects with significant stenosis on coronary angiography had lower cholesterol efflux from macrophages compared to individuals without significant stenosis (adjusted p = 0.02. Conclusion Macrophage cholesterol efflux is inversely correlated with lipoprotein particle size and risk of CAD.

  4. A livelock control policy for a flexible manufacturing system modeling with a subclass of generalized Petri nets

    Directory of Open Access Journals (Sweden)

    C.Q. Hou

    2014-12-01

    Full Text Available Livelocks, like deadlocks, can result in the serious problems in running process of flexible manufacturing systems (FMSs as well. Current deadlock control policies based on the approaches of siphon detection and control, cannot cope with livelocks in a system of sequential systems with shared resources (S4R, a typical subclass of Petri nets that can model FMSs. On the basis of the mixed integer programming method, this study proposes a livelock control policy (LCP that can not only solve the new smart siphons (NSSs associated with livelocks or deadlocks in an S4R system directly, but also make the solved NSSs max′-controlled by adding the corresponding control places (CPs. As a result, an original S4R system with livelocks or deadlocks can be turned into the live controlled one in which no NSSs can be found. The related theoretical analysis and several examples are given to demonstrate the proposed LCP. Compared with the existing methods in the literature, the proposed one is more general and powerful.

  5. IgG and IgG subclasses antibody responses to rK39 in Leishmania donovani infections

    International Nuclear Information System (INIS)

    Daifalla, N.S.; El Hassan, A.M.

    1998-01-01

    Leishmania donovani infection cause a wide spectrum of human diseases ranging from self-healing subclinical infections to severe visceral leishmaniasis, post kal-azar dermal leishmaiasis, and mucosal leishmaiasis. The infection associated with high levels of anti-leishmania antibodies which offer a potential parameter for the serological diagnosis of L. donovani infection replacing the invasive parasitological methods. rK39, a cloned antigen of L. chagasis was reported to have high levels of anti-leishmania antibodies in Sudanese and American visceral leishmaniasis patients. In an assessment of rK39-ELISA in detecting L. donovani infection we found that the antigen detected visceral leishmaniasis, post kala-azar dermal leishmaniasis, and mucosal leismaniasis with the sensitives of 96.6%, 95.91% and 90.91% respectively. The test has the specificity of 96.7%. Further investigation of 25 visceral leishmaniasis patients showed elevated anti-rK39 antibody responses of IgG subclasses with IgG1 and IgG3 significantly higher than IgG4. igG3 showed the highest sensitivity (84.00%) whereas IgG1 showed the highest sensitivity (100%). The dynamics of the serological reactivity to rK39 in l.donovani infections will be discussed in relation to exposure, infection, cure and relapse.(Author)

  6. Impact of liver fat on the differential partitioning of hepatic triacylglycerol into VLDL subclasses on high and low sugar diets.

    Science.gov (United States)

    Umpleby, A Margot; Shojaee-Moradie, Fariba; Fielding, Barbara; Li, Xuefei; Marino, Andrea; Alsini, Najlaa; Isherwood, Cheryl; Jackson, Nicola; Ahmad, Aryati; Stolinski, Michael; Lovegrove, Julie A; Johnsen, Sigurd; Jeewaka R Mendis, A S; Wright, John; Wilinska, Malgorzata E; Hovorka, Roman; Bell, Jimmy D; Thomas, E Louise; Frost, Gary S; Griffin, Bruce A

    2017-11-01

    Dietary sugars are linked to the development of non-alcoholic fatty liver disease (NAFLD) and dyslipidaemia, but it is unknown if NAFLD itself influences the effects of sugars on plasma lipoproteins. To study this further, men with NAFLD ( n = 11) and low liver fat 'controls' ( n = 14) were fed two iso-energetic diets, high or low in sugars (26% or 6% total energy) for 12 weeks, in a randomised, cross-over design. Fasting plasma lipid and lipoprotein kinetics were measured after each diet by stable isotope trace-labelling.There were significant differences in the production and catabolic rates of VLDL subclasses between men with NAFLD and controls, in response to the high and low sugar diets. Men with NAFLD had higher plasma concentrations of VLDL 1 -triacylglycerol (TAG) after the high ( P sugar ( P diets, a lower VLDL 1 -TAG fractional catabolic rate after the high sugar diet ( P sugar diet ( P sugar diet, was to channel hepatic TAG into a higher production of VLDL 1 -TAG ( P sugars. © 2017 The Author(s).

  7. Free-living copepods of the Arabian Sea: Distributions and research perspectives

    Digital Repository Service at National Institute of Oceanography (India)

    Madhupratap, M.

    The subclass Copepoda consists of 10 orders and exhibit great diversity in morphology as well as the habitats they occupy. Within the orders themselves, there are sometimes overlaps-some are free living or could be parasitic. There are approximately...

  8. Dynamics of Inter-heavy Chain Interactions in Human Immunoglobulin G (IgG) Subclasses Studied by Kinetic Fab Arm Exchange

    NARCIS (Netherlands)

    Rispens, Theo; Davies, Anna M.; Ooijevaar-de Heer, Pleuni; Absalah, Samira; Bende, Onno; Sutton, Brian J.; Vidarsson, Gestur; Aalberse, Rob C.

    2014-01-01

    Background: Fab arm exchange requires weak interactions between CH3 domains, such as in human IgG4. Results: CH3-CH3 interactions differ >1,000,000-fold between human subclasses and allotypes due to variations Lys/Asn-392, Val/Met-397, and Lys/Arg-409. Conclusion: For IgG2 and IgG3, but not IgG1,

  9. Pattern of pre-existing IgG subclass responses to a panel of asexual stage malaria antigens reported during the lengthy dry season in Daraweesh, Sudan

    DEFF Research Database (Denmark)

    Nasr, A; Iriemenam, N C; Troye-Blomberg, M

    2011-01-01

    The anti-malarial IgG immune response during the lengthy and dry season in areas of low malaria transmission as in Eastern Sudan is largely unknown. In this study, ELISA was used for the measurement of pre-existing total IgG and IgG subclasses to a panel of malaria antigens, MSP2-3D7, MSP2-FC27, ...

  10. Sudan ebolavirus long recovered survivors produce GP-specific Abs that are of the IgG1 subclass and preferentially bind FcγRI.

    Science.gov (United States)

    Radinsky, Olga; Edri, Avishay; Brusilovsky, Michael; Fedida-Metula, Shlomit; Sobarzo, Ariel; Gershoni-Yahalom, Orly; Lutwama, Julius; Dye, John; Lobel, Leslie; Porgador, Angel

    2017-07-20

    Ebolavirus is a highly lethal pathogen, causing a severe hemorrhagic disease with a high fatality rate. To better understand immune correlates of protection by virus specific IgG, we investigated the evolution of the Fcγ receptors (FcγRs)-activating capabilities of antiviral IgG in serum samples of long recovered survivors. To this end, longitudinal serum samples from survivors of Sudan ebolavirus (SUDV) infection, studied over years, were examined for the presence of Ebola-GP specific IgG subclasses, and for their binding to FcγRs. We developed a cell-based reporter system to quantitate pathogen-specific antibody binding to FcγRIIIA, FcγRIIA, FcγRIIB and FcγRI. With this system, we demonstrate that anti-GP-specific stimulation of the FcγRI reporter by survivors' sera was substantially high one year after acute infection, with a slight reduction in activity over a decade post infection. We further demonstrate that GP-specific IgG1 is by far the seroprevalent subclass that retained and even enhanced its presence in the sera, over ten years post infection; the prevalence of other GP-specific IgG subclasses was considerably reduced over time. In accordance, GP-specific FcγRI reporter response and GP-specific total IgG1 subclass correlated in the studied group of Ebola survivors. These observations are important for further informing Ebola vaccine and therapeutic development.

  11. Small high-density lipoprotein (HDL) subclasses are increased with decreased activity of HDL-associated phospholipase A₂ in subjects with prediabetes.

    Science.gov (United States)

    Filippatos, Theodosios D; Rizos, Evangelos C; Tsimihodimos, Vasilios; Gazi, Irene F; Tselepis, Alexandros D; Elisaf, Moses S

    2013-06-01

    Alterations in high-density lipoprotein (HDL) subclass distribution, as well as in the activities of HDL-associated enzymes, have been associated with increased cardiovascular disease (CVD) risk. HDL subclass distribution and the activities of HDL-associated enzymes remain unknown in prediabetic patients, a condition also associated with increased CVD risk. The aim of the present study was to assess any differences in HDL subclass distribution (using polyacrylamide gel electrophoresis) and in activities of HDL-associated enzymes between prediabetic (impaired fasting glucose, IFG, n = 80) and non-prediabetic subjects (n = 105). Subjects with prediabetes had significantly increased waist circumference, blood pressure and triacylglycerol (TAG) levels compared with subjects with fasting glucose levels prediabetic subjects compared with their controls (p prediabetes (p prediabetes. In a stepwise linear regression analysis, the proportion of small HDL3 over HDL-C concentration was independently associated with the presence of prediabetes and with total cholesterol and TAG concentration (positively), as well as with HDL-C levels (negatively). We also observed a trend of increased small dense low-density lipoprotein cholesterol levels in prediabetic subjects compared with their controls. Subjects with IFG exhibit increased proportion of small HDL3 particles combined with decreased activity of the anti-atherogenic HDL-LpPLA₂.

  12. Molecular systematic of three species of Oithona (Copepoda, Cyclopoida from the Atlantic Ocean: comparative analysis using 28S rDNA.

    Directory of Open Access Journals (Sweden)

    Georgina D Cepeda

    Full Text Available Species of Oithona (Copepoda, Cyclopoida are highly abundant, ecologically important, and widely distributed throughout the world oceans. Although there are valid and detailed descriptions of the species, routine species identifications remain challenging due to their small size, subtle morphological diagnostic traits, and the description of geographic forms or varieties. This study examined three species of Oithona (O. similis, O. atlantica and O. nana occurring in the Argentine sector of the South Atlantic Ocean based on DNA sequence variation of a 575 base-pair region of 28S rDNA, with comparative analysis of these species from other North and South Atlantic regions. DNA sequence variation clearly resolved and discriminated the species, and revealed low levels of intraspecific variation among North and South Atlantic populations of each species. The 28S rDNA region was thus shown to provide an accurate and reliable means of identifying the species throughout the sampled domain. Analysis of 28S rDNA variation for additional species collected throughout the global ocean will be useful to accurately characterize biogeographical distributions of the species and to examine phylogenetic relationships among them.

  13. Redescription of Tripaphylus musteli (van Beneden, 1851) (Copepoda: Sphyriidae) and the relegation of Paeon Wilson, 1919 to synonymy with Tripaphylus Richiardi in Anonymous, 1878.

    Science.gov (United States)

    Benz, George W; Boxshall, Geoffrey A

    2017-07-01

    Tripaphylus musteli (van Beneden, 1851) (Copepoda, Siphonostomatoida, Sphyriidae) is redescribed from an adult female collected from the branchial chamber of a starry smooth-hound, Mustelus asterias Cloquet (Carcharhiniformes, Triakidae), captured in the English Channel off Portland, UK. The new account of T. musteli is the first based on a complete adult female and highlighted the lack of a robust distinction separating Tripaphylus Richiardi, in Anonymous, 1878 and Paeon Wilson, 1919 prompting us to relegate Paeon to a junior subjective synonym of Tripaphylus. In the light of this synonymy the eight former species of Paeon are transferred to Tripaphylus as follows: T. ferox (Wilson, 1919) new combination, T. elongatus (Wilson, 1932) new combination, T. vassierei (Delamare Deboutteville & Nuñes-Ruivo, 1954) new combination, T. lobatus (Kirtisinghe, 1964) new combination, T. asymboli (Turner, Kyne & Bennett, 2003) new combination, T. versicolor (Wilson, 1919) new combination, T. australis (Kabata, 1993) new combination, and T. triakis (Castro Romero, 2001) new combination. Comparisons between terminology used in this report and that in the literature indicate that all transformed adult females of Tripaphylus probably possess a full complement of cephalic appendages and maxillipeds. All limbs, with the exception of the maxillae share a general morphological similarity to the corresponding appendages of conspecific males. The maxilla of the transformed adult female of Tripaphylus is a small digitiform protuberance associated with a swelling in some species.

  14. Subgroup-Elimination Transcriptomics Identifies Signaling Proteins that Define Subclasses of TRPV1-Positive Neurons and a Novel Paracrine Circuit

    Science.gov (United States)

    Isensee, Jörg; Wenzel, Carsten; Buschow, Rene; Weissmann, Robert; Kuss, Andreas W.; Hucho, Tim

    2014-01-01

    rather than enrichment of the subgroup of interest revealed proteins that define subclasses of TRPV1-positive neurons and suggests a novel paracrine circuit. PMID:25551770

  15. Lipoprotein subclass patterns in women with polycystic ovary syndrome (PCOS) compared with equally insulin-resistant women without PCOS.

    LENUS (Irish Health Repository)

    Phelan, N

    2012-02-01

    OBJECTIVES: Women with polycystic ovary syndrome (PCOS) are more insulin resistant and display an atherogenic lipid profile compared with normal women of similar body mass index (BMI). Insulin resistance (IR) at least partially underlies the dyslipidemia of PCOS, but it is unclear whether PCOS status per se confers additional risk. RESEARCH DESIGN AND METHODS: Using a case-control design, we compared plasma lipids and lipoprotein subclasses (using polyacrylamide gel tube electrophoresis) in 70 women with PCOS (National Institutes of Health criteria) and 70 normal women pair matched for age, BMI, and IR (homeostasis model assessment-IR, quantitative insulin sensitivity check index, and the Avignon Index). Subjects were identified as having a (less atherogenic) type A pattern consisting predominantly of large low-density lipoprotein (LDL) subfractions or a (more atherogenic) non-A pattern consisting predominantly of small-dense LDL subfractions. RESULTS: Total, high-density lipoprotein, or LDL cholesterol, or triacylglycerol did not differ between the groups, but very low-density lipoprotein levels (P<0.05) were greater in women with PCOS, whereas a non-A LDL profile was seen in 12.9% compared with 2.9% of controls (P<0.05, chi2). Multiple regression analysis revealed homeostasis model assessment-IR and waist circumference to be independent predictors of very low-density lipoprotein together explaining 40.2% of the overall variance. Logistic regression revealed PCOS status to be the only independent determinant of a non-A LDL pattern (odds ratio 5.48 (95% confidence interval 1.082-27.77; P<0.05). CONCLUSIONS: Compared with women matched for BMI and IR, women with PCOS have potentially important differences in lipid profile with greater very low-density lipoprotein levels and increased rates of a more atherogenic non-A LDL pattern.

  16. Isolation and growth characteristics of an EDTA-degrading member of the alpha-subclass of Proteobacteria.

    Science.gov (United States)

    Weilenmann, Hans-Ueli; Engeli, Barbara; Bucheli-Witschel, Margarete; Egli, Thomas

    2004-10-01

    A Gram-negative, ethylenediaminetetraacetic acid (EDTA)-degrading bacterium (deposited at the German Culture Collection as strain DSM 9103) utilising EDTA as the only source of carbon, energy and nitrogen was isolated from a mixed EDTA-degrading population that was originally enriched in a column system from a mixture of activated sludge and soil. Chemotaxonomic analysis of quinones, polar lipids and fatty acids allowed allocation of the isolate to the alpha-subclass of Proteobacteria. 16S rDNA sequencing and phylogenetic analysis revealed highest similarity to the Mesorhizobium genus followed by the Aminobacter genus. However, the EDTA-degrading strain apparently forms a new branch within the Phyllobacteriaceae/Mesorhizobia family. Growth of the strain was rather slow not only on EDTA (micro(max) = 0.05 h(-1)) but also on other substrates. Classical substrate utilisation testing in batch culture suggested a quite restricted carbon source spectrum with only lactate, glutamate, and complexing agents chemically related to EDTA (nitrilotriacetate, iminodiacetate and ethylenediaminedisuccinate) supporting growth. However, when EDTA-limited continuous cultures of strain DSM 9103 were pulsed with fumarate, succinate, glucose or acetate, these substrates were assimilated immediately. Apparently, the strain can use a broader spectrum than indicated by traditional substrate testing techniques. The EDTA species CaEDTA and MgEDTA served as growth substrates of the strain because in the mineral medium employed EDTA was predicted to be mainly present in the form of these two complexes. The bacterium was not able to degrade Fe3+-complexed EDTA.

  17. [Serum immunoglobulin IgG subclass distribution of antibody responses to pertussis toxin and filamentous hemagglutinin of Bordetella pertussis in patients with whooping cough].

    Science.gov (United States)

    Rastawicki, Waldemar; Smietańska, Karolina; Rokosz-Chudziak, Natalia; Jagielski, Marek

    2013-01-01

    The present study was aimed at determining the IgG subclass distribution against pertussis toxin (PT) and filamentous hemagglutinin (FHA) of Bordetella pertussis in patients with whooping cough. The total number of 222 serum samples obtained from patients suspected in clinical investigation for pertussis were tested separately by in-house ELISA for the presence of IgG antibodies to pertussis toxin and filamentous hemagglutinin. The percentage distribution of specific anti-PT and anti-FHA IgG subclass response was calculated only on the basis of group of sera confirmed in the present study as positive for total IgG antibodies (183 sera to PT antigen and 129 to FHA antigen). Paired serum specimens were obtained from 36 patients. Based on the results of determining the level of antibodies in the sera of 40 blood donors, the cut-off limit of serum antibodies for each subclass was set at arithmetic mean plus two standard deviations. Antibodies of IgG1 to pertussis toxin and filamentous hemagglutinin were diagnosed in 151 (82.5%) and 99 (76.7%), IgG2 in 72 (39.0%) and 50 (38.8%), IgG3 in 17 (9.3%) and 43 (33.3%), IgG4 in 55 (30.1%) and 53 (41.1%) serum samples, respectively. There were no significant differences in percentage of sera with IgG1, IgG2 and IgG3 in relation to age of the patients. However, the frequency of occurrence of IgG4 antibodies was highest in the group of the youngest children to the age of 6 years old (61.8% for PT and 68.0% for FHA), and decrease with age, reaching the minimum in the group of patients above 40 years old (13.2% and 4.2% for PT and FHA, respectively). We also found significantly higher frequency of IgG4 to PT and FHA antigens in men than in women. Statistically significant, essential changes in the pattern of IgG subclass during the course of infection were not found. In conclusion, this study showed that all four subclasses of IgG antibodies to pertussis toxin and filamentous hemagglutinin are produced during whooping cough.

  18. Co-suppression of synthesis of major x-kafirin sub-class together with y-kafirin-1 and y-kafirin-2 required for substantially improved protein digestibility in transgenic sorghum

    CSIR Research Space (South Africa)

    Grootboom, AW

    2014-01-01

    Full Text Available Co-suppressing major kafirin sub-classes is fundamental to improved protein digestibility and nutritional value of sorghum. The improvement is linked to an irregularly invaginated phenotype of protein bodies....

  19. Copepoda:Cyclopoida

    African Journals Online (AJOL)

    H. thermophilus Kiefer, 1929 (type locality, Java), H. spinifer Kiefer, 1935 (type locality India, near Calcutta), H. venezuelaensis Lindberg, 1954 (type locality Lake. Maracaibo, Venezuela), and the new species from Cape. Town. In H. venezuelaensis the spines are very blunt and are directed (in dorsal view) as much laterally ...

  20. The use of kDNA minicircle subclass relative abundance to differentiate between Leishmania (L.) infantum and Leishmania (L.) amazonensis.

    Science.gov (United States)

    Ceccarelli, Marcello; Galluzzi, Luca; Diotallevi, Aurora; Andreoni, Francesca; Fowler, Hailie; Petersen, Christine; Vitale, Fabrizio; Magnani, Mauro

    2017-05-16

    Leishmaniasis is a neglected disease caused by many Leishmania species, belonging to subgenera Leishmania (Leishmania) and Leishmania (Viannia). Several qPCR-based molecular diagnostic approaches have been reported for detection and quantification of Leishmania species. Many of these approaches use the kinetoplast DNA (kDNA) minicircles as the target sequence. These assays had potential cross-species amplification, due to sequence similarity between Leishmania species. Previous works demonstrated discrimination between L. (Leishmania) and L. (Viannia) by SYBR green-based qPCR assays designed on kDNA, followed by melting or high-resolution melt (HRM) analysis. Importantly, these approaches cannot fully distinguish L. (L.) infantum from L. (L.) amazonensis, which can coexist in the same geographical area. DNA from 18 strains/isolates of L. (L.) infantum, L. (L.) amazonensis, L. (V.) braziliensis, L. (V.) panamensis, L. (V.) guyanensis, and 62 clinical samples from L. (L.) infantum-infected dogs were amplified by a previously developed qPCR (qPCR-ML) and subjected to HRM analysis; selected PCR products were sequenced using an ABI PRISM 310 Genetic Analyzer. Based on the obtained sequences, a new SYBR-green qPCR assay (qPCR-ama) intended to amplify a minicircle subclass more abundant in L. (L.) amazonensis was designed. The qPCR-ML followed by HRM analysis did not allow discrimination between L. (L.) amazonensis and L. (L.) infantum in 53.4% of cases. Hence, the novel SYBR green-based qPCR (qPCR-ama) has been tested. This assay achieved a detection limit of 0.1 pg of parasite DNA in samples spiked with host DNA and did not show cross amplification with Trypanosoma cruzi or host DNA. Although the qPCR-ama also amplified L. (L.) infantum strains, the C q values were dramatically increased compared to qPCR-ML. Therefore, the combined analysis of C q values from qPCR-ML and qPCR-ama allowed to distinguish L. (L.) infantum and L. (L.) amazonensis in 100% of tested samples

  1. XTE J1701-462 AND ITS IMPLICATIONS FOR THE NATURE OF SUBCLASSES IN LOW-MAGNETIC-FIELD NEUTRON STAR LOW-MASS X-RAY BINARIES

    International Nuclear Information System (INIS)

    Homan, Jeroen; Fridriksson, Joel K.; Remillard, Ronald A.; Lewin, Walter H. G.; Van der Klis, Michiel; Wijnands, Rudy; Altamirano, Diego; Mendez, Mariano; Lin Dacheng; Casella, Piergiorgio; Belloni, Tomaso M.

    2010-01-01

    We report on an analysis of Rossi X-Ray Timing Explorer data of the transient neutron star low-mass X-ray binary (NS-LMXB) XTE J1701-462, obtained during its 2006-2007 outburst. The X-ray properties of the source changed between those of various types of NS-LMXB subclasses. At high luminosities, the source switched between two types of Z source behavior and at low luminosities we observed a transition from Z source to atoll source behavior. These transitions between subclasses primarily manifest themselves as changes in the shapes of the tracks in X-ray color-color (CD) and hardness-intensity diagrams (HID), but they are accompanied by changes in the kHz quasi-periodic oscillations, broadband variability, burst behavior, and/or X-ray spectra. We find that for most of the outburst the low-energy X-ray flux is a good parameter to track the gradual evolution of the tracks in CD and HID, allowing us to resolve the evolution of the source in greater detail than before and relate the observed properties to other NS-LMXBs. We further find that during the transition from Z to atoll, characteristic behavior known as the atoll upper banana can equivalently be described as the final stage of a weakening Z source flaring branch, thereby blurring the line between the two subclasses. Our findings strongly suggest that the wide variety in behavior observed in NS-LXMBs with different luminosities can be linked through changes in a single variable parameter, namely the mass accretion rate, without the need for additional differences in the neutron star parameters or viewing angle. We briefly discuss the implications of our findings for the spectral changes observed in NS-LMXBs and suggest that, contrary to what is often assumed, the position along the color-color tracks of Z sources is not determined by the instantaneous mass accretion rate.

  2. Nuclear Function of Subclass I Actin-Depolymerizing Factor Contributes to Susceptibility in Arabidopsis to an Adapted Powdery Mildew Fungus1[OPEN

    Science.gov (United States)

    Inada, Noriko; Higaki, Takumi; Hasezawa, Seiichiro

    2016-01-01

    Actin-depolymerizing factors (ADFs) are conserved proteins that function in regulating the structure and dynamics of actin microfilaments in eukaryotes. In this study, we present evidence that Arabidopsis (Arabidopsis thaliana) subclass I ADFs, particularly ADF4, functions as a susceptibility factor for an adapted powdery mildew fungus. The null mutant of ADF4 significantly increased resistance against the adapted powdery mildew fungus Golovinomyces orontii. The degree of resistance was further enhanced in transgenic plants in which the expression of all subclass I ADFs (i.e. ADF1–ADF4) was suppressed. Microscopic observations revealed that the enhanced resistance of adf4 and ADF1-4 knockdown plants (ADF1-4Ri) was associated with the accumulation of hydrogen peroxide and cell death specific to G. orontii-infected cells. The increased resistance and accumulation of hydrogen peroxide in ADF1-4Ri were suppressed by the introduction of mutations in the salicylic acid- and jasmonic acid-signaling pathways but not by a mutation in the ethylene-signaling pathway. Quantification by microscopic images detected an increase in the level of actin microfilament bundling in ADF1-4Ri but not in adf4 at early G. orontii infection time points. Interestingly, complementation analysis revealed that nuclear localization of ADF4 was crucial for susceptibility to G. orontii. Based on its G. orontii-infected-cell-specific phenotype, we suggest that subclass I ADFs are susceptibility factors that function in a direct interaction between the host plant and the powdery mildew fungus. PMID:26747284

  3. Malaria resistance genes are associated with the levels of IgG subclasses directed against Plasmodium falciparum blood-stage antigens in Burkina Faso

    Directory of Open Access Journals (Sweden)

    Afridi Sarwat

    2012-09-01

    Full Text Available Abstract Background HBB, IL4, IL12, TNF, LTA, NCR3 and FCGR2A polymorphisms have been associated with malaria resistance in humans, whereas cytophilic immunoglobulin G (IgG antibodies are thought to play a critical role in immune protection against asexual blood stages of the parasite. Furthermore, HBB, IL4, TNF, and FCGR2A have been associated with both malaria resistance and IgG levels. This suggests that some malaria resistance genes influence the levels of IgG subclass antibodies. Methods In this study, the effect of HBB, IL4, IL12, TNF, LTA, NCR3 and FCGR2A polymorphisms on the levels of IgG responses against Plasmodium falciparum blood-stage extract was investigated in 220 individuals living in Burkina Faso. The Pearson’s correlation coefficient among IgG subclasses was determined. A family-based approach was used to assess the association of polymorphisms with anti-P. falciparum IgG, IgG1, IgG2, IgG3 and IgG4 levels. Results After applying a multiple test correction, several polymorphisms were associated with IgG subclass or IgG levels. There was an association of i haemoglobin C with IgG levels; ii the FcγRIIa H/R131 with IgG2 and IgG3 levels; iii TNF-863 with IgG3 levels; iv TNF-857 with IgG levels; and, v TNF1304 with IgG3, IgG4, and IgG levels. Conclusion Taken together, the results support the hypothesis that some polymorphisms affect malaria resistance through their effect on the acquired immune response, and pave the way towards further comprehension of genetic control of an individual’s humoral response against malaria.

  4. Differential patterns of human immunoglobulin G subclass responses to distinct regions of a single protein, the merozoite surface protein 1 of Plasmodium falciparum

    DEFF Research Database (Denmark)

    Cavanagh, D R; Dobaño, C; Elhassan, I M

    2001-01-01

    Comparisons of immunoglobulin G (IgG) subclass responses to the major polymorphic region and to a conserved region of MSP-1 in three cohorts of African villagers exposed to Plasmodium falciparum revealed that responses to Block 2 are predominantly IgG3 whereas antibodies to MSP-1(19) are mainly IgG......1. The striking dominance of IgG3 to Block 2 may explain the short duration of this response and also the requirement for continuous stimulation by malaria infection to maintain clinical immunity....

  5. Effect of temperature and salinity on egg hatching and description of the life cycle of Lernanthropus latis (Copepoda: Lernanthropidae) infecting barramundi, Lates calcarifer.

    Science.gov (United States)

    Brazenor, Alexander K; Hutson, Kate S

    2013-10-01

    The parasite Lernanthropus latis (Copepoda: Lernanthropidae) is a major threat to the sustained mariculture of barramundi, Lates calcarifer (Perciformes: Latidae). We investigated the effect of water temperature and salinity on egg hatching success of L. latis and describe the life cycle for the first time. Wild and sea-caged L. calcarifer examined in tropical north Australia exhibited similar parasite prevalence (range: 80-100%) and mean parasite intensity (range: 3-6), whereas land-based maricultured fish were not infected. Hatching success and time to first and last hatch was determined for a range of water temperature (22, 30, 32 and 34°C) and salinity (0, 11, 22, 35 and 40‰) combinations representing current and predicted climate conditions. There was a significant interaction between water temperature and salinity on the hatching success of L. latis nauplii. Eggs hatched in all temperature treatments, with the greatest hatching success at 30°C and 32°C (98 and 92% success, respectively) in 35‰. Hatching did not occur at 0‰ and was severely reduced at 11‰ (1.6% success). Hatching began within 6h at all water temperatures with >95% of eggs hatched within 30h at 30, 32 and 34°C and within 60h at 22°C. Adult parasites differed from the original description by the presence of the parabasal flagellum, small setae on the legs and caudal rami and minor incongruences regarding morphological measurements. The life cycle of L. latis includes three free living stages and five parasitic stages. Although L. latis exhibits broad environmental tolerance, freshwater can be used as an effective management strategy to break the life cycle in aquaculture. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  6. Avaliação das subclasses IgG1 e IgG3 na doença hemolítica perinatal Assessment of IgG1 and IgG3 subclasses in perinatal hemolytic disease

    Directory of Open Access Journals (Sweden)

    Maria A. Araújo

    2003-01-01

    Full Text Available A doença hemolítica perinatal (DHPN ainda é um problema clínico. Nenhum teste isolado prediz, com segurança, a gravidade do quadro hemolítico. O objetivo do presente estudo foi determinar as subclasses de anticorpos IgG1 e IgG3 por citometria de fluxo no soro de 42 gestantes isoimunizadas e correlacionar os dados obtidos com a gravidade da DHPN. A distribuição dos fetos ou neonatos segundo a gravidade do quadro hemolítico evidenciou 13 casos com doença leve, 16 casos com doença moderada e 13 com doença grave. As subclasses foram detectadas em 33/42 (79% amostras. A subclasse IgG1, isoladamente, foi evidenciada em 14/33 (42,4% casos. Na relação entre gravidade da doença e subclasses de IgG, observou-se que IgG1 isolada foi encontrada em todos os grupos, e os valores da mediana de intensidade de fluorescência (MIF foram significativamente mais altos nas formas mais graves da DHPN (pThe hemolytic disease of the newborn (HDN continues to be a clinical problem in spite of prophylaxis. To date, none of the available tests, developed to predict the severity of HDN, has provided complete reliability. The objective of the present study was to determine the IgG1 and IgG3 subclasses in 42 isoimmunized pregnant women, and to correlate them with clinical severity of hemolytic disease. The IgG subclasses were determined employing flow cytometry. According to the clinical severity of HDN, fetuses and newborn babies were classified as 13 mild, 16 moderate and 13 severe cases. The IgG subclasses were detected in 33 of the 42 pregnant women. Of these, IgG1 was predominant in 72.7% of the cases; either isolated (42.4% or in association with IgG3 (30.3%. IgG1 was present in all the three clinical severity categories, however, its values were significantly higher in cases with greater clinical severity of HDN (p<0.01. On the other hand, the distribution of IgG3 values within each group was not statistically significant (p=0.11. IgG3 seems to be more

  7. Skin-transmitted pathogens and the heebie jeebies: evidence for a subclass of disgust stimuli that evoke a qualitatively unique emotional response.

    Science.gov (United States)

    Blake, Khandis R; Yih, Jennifer; Zhao, Kun; Sung, Billy; Harmon-Jones, Cindy

    2017-09-01

    Skin-transmitted pathogens have threatened humans since ancient times. We investigated whether skin-transmitted pathogens were a subclass of disgust stimuli that evoked an emotional response that was related to, but distinct from, disgust and fear. We labelled this response "the heebie jeebies". In Study 1, coding of 76 participants' experiences of disgust, fear, and the heebie jeebies showed that the heebie jeebies was elicited by unique stimuli which produced skin-crawling sensations and an urge to protect the skin. In Experiment 2,350 participants' responses to skin-transmitted pathogen, fear-inducing, and disgust-inducing vignettes showed that the vignettes elicited sensations and urges which loaded onto heebie jeebies, fear, and disgust factors, respectively. Experiment 3 largely replicated findings from Experiment 2 using video stimuli (178 participants). Results are consistent with the notion that skin-transmitted pathogens are a subclass of disgust stimuli which motivate behaviours that are functionally consistent with disgust yet qualitatively distinct.

  8. Length-weight regressions of the microcrustacean species from a tropical floodplain Regressões peso-comprimento das espécies de microcrustáceos em uma planície de inundação tropical

    Directory of Open Access Journals (Sweden)

    Fábio de Azevedo

    2012-03-01

    Full Text Available AIM: This study presents length-weight regressions adjusted for the most representative microcrustacean species and young stages of copepods from tropical lakes, together with a comparison of these results with estimates from the literature for tropical and temperate regions; METHODS: Samples were taken from six isolated lakes, in summer and winter, using a motorized pump and plankton net. The dry weight of each size class (for cladocerans or developmental stage (for copepods was measured using an electronic microbalance; RESULTS: Adjusted regressions were significant. We observed a trend of under-estimating the weights of smaller species and overestimating those of larger species, when using regressions obtained from temperate regions; CONCLUSION: We must be cautious about using pooled regressions from the literature, preferring models of similar species, or weighing the organisms and building new models.OBJETIVO: Este estudo apresenta as regressões peso-comprimento elaboradas para as espécies mais representativas de microcrustáceos e formas jovens de copépodes em lagos tropicais, bem como a comparação desses resultados com as estimativas da literatura para as regiões tropical e temperada; MÉTODOS: As amostragens foram realizadas em seis lagoas isoladas, no verão e no inverno, usando moto-bomba e rede de plâncton. O peso seco de cada classe de tamanho (para cladóceros e estágio de desenvolvimento (copépodes foi medido em microbalança eletrônica; RESULTADOS: As regressões ajustadas foram significativas. Observamos uma tendência em subestimar o peso das espécies de menor porte e superestimar as espécies de maior porte, quando se utiliza regressões peso-comprimento obtidas para a região de clima temperado; CONCLUSÃO: Devemos ter cautela no uso de regressões peso-comprimento existentes na literatura, preferindo modelos para as mesmas espécies, ou pesar os organismos e construir os próprios modelos.

  9. Correlation between the Amount of Anti-D Antibodies and IgG Subclasses with Severity of Haemolytic Disease of Foetus and Newborn

    Directory of Open Access Journals (Sweden)

    Emilija Velkova

    2015-05-01

    CONCLUSIONS: The titers of the pregnant women serum those are lower than 32 and those higher than 1000 can well predict HDFN. The titers of anti-D antibodies between 64 and 512 have no exact predictive value. IgG1 and IgG3 subclasses of anti-D have no predictive value by themselves, and cannot foresee the outcome of HDFN. The research study results suggest that IgG1 and IgG3 should be included in a multi – parameter protocol for evaluation of the HDFN intensity. They can give a real assessment of the expected HDFN intensity in combination with the titer hight and the significance of the antibodies.

  10. Affinity composite cryogel discs functionalized with Reactive Red 120 and Green HE 4BD dye ligands: Application on the separation of human immunoglobulin G subclasses

    Energy Technology Data Exchange (ETDEWEB)

    Huseynli, Sabina; Baydemir, Gözde; Sarı, Esma [Department of Chemistry, Biochemistry Division, Hacettepe University, Ankara (Turkey); Elkak, Assem [Laboraory of “Valorisation des Ressources Naturelles et Produits de Santé (VRNPS)”, Doctoral School of Sciences and Technology, Lebanese University, Rafic Hariri University Campus, Hadath (Lebanon); Denizli, Adil, E-mail: denizli@hacettepe.edu.tr [Department of Chemistry, Biochemistry Division, Hacettepe University, Ankara (Turkey)

    2015-01-01

    Naturally produced by the human immune system, immunoglobulin nowadays is widely used for in vivo and in vitro purposes. The increased needs for pure immunoglobulin have prompted researchers to find new immunoglobulin chromatographic separation processes. Cryogels as chromatographic adsorbents, congregate several mechanical features including good compatibility, large pore structure, flexibility, short diffusion pathway and stability. These different characteristics make them a good alternative to conventional chromatographic methods and allowing their potential use in separation technology. In the present study, two sets of poly(2-hydroxyethyl methacrylate) (PHEMA) based beads were prepared and functionalized with Reactive Red 120 (RR) and Reactive Green HE 4BD (RG) dyes, and then embedded into supermacroporous cryogels. The morphology, physical and chemical features of the prepared bead embedded composite cryogel discs (CCDs) were performed by scanning electron microscopy (SEM), swelling test, elemental analysis and Fourier transform infrared spectroscopy (FTIR). The results showed that the embedded composite cryogel discs have a specific surface area of 192.0 m{sup 2}/g with maximum adsorption capacity of HIgG 239.8 mg/g for the RR functionalized CCD and 170 mg/g for RG functionalized CCD columns, both at pH 6.2. - Highlights: • Dye attached composite cryogel discs were prepared to separate HIgG subclasses. • Composite cryogels characterized by swelling, FTIR, SEM and elemental analysis. • Reactive Green HE 4B and Reactive Red 120 dyes were used as the affinity ligand. • HIgG and subclasses were separate from both aqueous solution and human plasma.

  11. Neisseria meningitidis Group A IgG1 and IgG2 Subclass Immune Response in African Children Aged 12–23 Months Following Meningococcal Vaccination

    Science.gov (United States)

    Holme, Daniel; Findlow, Helen; Sow, Samba O.; Idoko, Olubukola T.; Preziosi, Marie-Pierre; Carlone, George; Plikaytis, Brian D.; Borrow, Ray

    2015-01-01

    Background. A group A meningococcal conjugate vaccine, PsA-TT, was licensed in 2010 and was previously studied in a phase 2 clinical trial to evaluate its safety and immunogenicity in African children 12–23 months of age. Methods. Subjects received either PsA-TT; meningococcal group A, C, W, Y polysaccharide vaccine (PsACWY); or Haemophilus influenzae type b conjugate vaccine (Hib-TT). Forty weeks following primary vaccination, the 3 groups were further randomized to receive either PsA-TT, one-fifth dose of PsACWY, or Hib-TT. Group A–specific immunoglobulin G (IgG) subclass response was characterized using an enzyme-linked immunosorbent assay. Results. The predominant IgG subclass response, regardless of vaccine, was IgG1. One month following primary vaccination, the geometric mean concentrations (GMCs) of IgG1 and IgG2 in the PsA-TT group were 21.73 µg/mL and 6.27 µg/mL, whereas in the PsACWY group the mean GMCs were 2.01 µg/mL and 0.97 µg/mL, respectively (P Group A–specific IgG1 and IgG2 GMCs remained greater in the PsA-TT group than in the PsACWY group 40 weeks following primary vaccination (P vaccines. Conclusions. Vaccination of African children aged 12–24 months with either PsA-TT or PsACWY elicited a predominantly IgG1 response. The IgG1:IgG2 mean ratio decreased following successive vaccination with PsACWY, indicating a shift toward IgG2, suggestive of the T-cell–independent immune response commonly associated with polysaccharide antigens. Clinical Trials Registration. SRCTN78147026. PMID:26553689

  12. GEOTECNOLOGIA APLICADA NA OBTENÇÃO DAS SUBCLASSES DE CAPACIDADE DE USO DAS TERRAS DE UMA MICROBACIA, VISANDO A CONSERVAÇÃO DOS RECURSOS NATURAIS

    Directory of Open Access Journals (Sweden)

    S. Campos

    2016-09-01

    Full Text Available A exploração da terra para produzir alimentos para o sustento do homem quase sempre foi de forma desordenada e sem planejamento.  A consequência dessa exploração predatória foi o empobrecimento do solo por erosão intensa, assoreamento de cursos d’água, desertificação, entre outros. O trabalho objetivou a utilização de geotecnologias na elaboração dos mapas de classes de declive, de solos e da capacidade de uso do solo numa microbacia, de forma a contribuir no processo de gestão ambiental e na tomada de decisões por parte dos Administradores Públicos.  A microbacia do Ribeirão das Agulhas, Botucatu (SP apresenta uma área de 1.429,28ha e está localizada entre os paralelos 22o 47' 05" a 22o 05' 55" de latitude S e 48o 28' 10” a 48o 30' 04" de longitude W Gr. Os resultados permitiram inferir que a subclasse mais significativa foi a IIIs,e (44,50% e o relevo ondulado (57,59%. As subclasses de capacidade de uso IIIs, IIIs,e, IVs, IVs,e e IVe ocuparam 89,36% da área, mostrando o grande potencial de uso para culturas anuais, perenes, pastagens e reflorestamentos. O Sistema de Informações Geográficas (SIG mostrou-se uma excelente ferramenta para determinação da capacidade de uso da terra, demonstrando que a utilização do geoprocessamento facilita e dá maior rapidez no cruzamento dos dados digitais, permitindo seu armazenamento, que poderão ser utilizados para outras análises em futuros planejamentos geoambientais. 

  13. Affinity composite cryogel discs functionalized with Reactive Red 120 and Green HE 4BD dye ligands: Application on the separation of human immunoglobulin G subclasses

    International Nuclear Information System (INIS)

    Huseynli, Sabina; Baydemir, Gözde; Sarı, Esma; Elkak, Assem; Denizli, Adil

    2015-01-01

    Naturally produced by the human immune system, immunoglobulin nowadays is widely used for in vivo and in vitro purposes. The increased needs for pure immunoglobulin have prompted researchers to find new immunoglobulin chromatographic separation processes. Cryogels as chromatographic adsorbents, congregate several mechanical features including good compatibility, large pore structure, flexibility, short diffusion pathway and stability. These different characteristics make them a good alternative to conventional chromatographic methods and allowing their potential use in separation technology. In the present study, two sets of poly(2-hydroxyethyl methacrylate) (PHEMA) based beads were prepared and functionalized with Reactive Red 120 (RR) and Reactive Green HE 4BD (RG) dyes, and then embedded into supermacroporous cryogels. The morphology, physical and chemical features of the prepared bead embedded composite cryogel discs (CCDs) were performed by scanning electron microscopy (SEM), swelling test, elemental analysis and Fourier transform infrared spectroscopy (FTIR). The results showed that the embedded composite cryogel discs have a specific surface area of 192.0 m 2 /g with maximum adsorption capacity of HIgG 239.8 mg/g for the RR functionalized CCD and 170 mg/g for RG functionalized CCD columns, both at pH 6.2. - Highlights: • Dye attached composite cryogel discs were prepared to separate HIgG subclasses. • Composite cryogels characterized by swelling, FTIR, SEM and elemental analysis. • Reactive Green HE 4B and Reactive Red 120 dyes were used as the affinity ligand. • HIgG and subclasses were separate from both aqueous solution and human plasma

  14. Genetic and biochemical characterization of HMB-1, a novel subclass B1 metallo-β-lactamase found in a Pseudomonas aeruginosa clinical isolate.

    Science.gov (United States)

    Pfennigwerth, Niels; Lange, Felix; Belmar Campos, Cristina; Hentschke, Moritz; Gatermann, Sören G; Kaase, Martin

    2017-04-01

    To characterize a novel subclass B1 metallo-β-lactamase (MBL) found in an MDR Pseudomonas aeruginosa clinical isolate. The isolate P. aeruginosa NRZ-03096 was recovered in 2012 from an anal swab from a patient hospitalized in Northern Germany and showed high MICs of carbapenems. MBL production was analysed by several phenotypic tests. Genetic characterization of the novel bla gene and MLST was performed by WGS. The novel bla gene was expressed in Escherichia coli TOP10 and the enzyme was subjected to biochemical characterization to determine the kinetic parameters K m and k cat . P. aeruginosa NRZ-03096 was resistant to all tested β-lactams and showed an MBL phenotype. Shotgun cloning experiments yielded a clone producing a novel subclass B1 enzyme with only 74.3% identity to the next nearest relative, KHM-1. The novel MBL was named HMB-1 (for Hamburg MBL). Analysis of WGS data showed that the bla HMB-1 gene was chromosomally located as part of a Tn 3 family transposon that was named Tn 6345 . Expression of bla HMB-1 in E. coli TOP10 led to increased resistance to β-lactams. Determination of K m and k cat revealed that HMB-1 had different hydrolytic characteristics compared with KHM-1, with lower hydrolytic rates for cephalosporins and a higher rate for imipenem. The identification of HMB-1 further underlines the ongoing spread and diversification of carbapenemases in Gram-negative human pathogens and especially in P. aeruginosa . © The Author 2017. Published by Oxford University Press on behalf of the British Society for Antimicrobial Chemotherapy. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  15. Combined roles of human IgG subclass, alternative complement pathway activation, and epitope density in the bactericidal activity of antibodies to meningococcal factor h binding protein.

    Science.gov (United States)

    Giuntini, Serena; Reason, Donald C; Granoff, Dan M

    2012-01-01

    Meningococcal vaccines containing factor H binding protein (fHbp) are in clinical development. fHbp binds human fH, which enables the meningococcus to resist complement-mediated bacteriolysis. Previously, we found that chimeric human IgG1 mouse anti-fHbp monoclonal antibodies (MAbs) had human complement-mediated bactericidal activity only if the MAb inhibited fH binding. Since IgG subclasses differ in their ability to activate complement, we investigated the role of human IgG subclasses on antibody functional activity. We constructed chimeric MAbs in which three different murine fHbp-specific binding domains were each paired with human IgG1, IgG2, or IgG3. Against a wild-type group B isolate, all three IgG3 MAbs, irrespective of their ability to inhibit fH binding, had bactericidal activity that was >5-fold higher than the respective IgG1 MAbs, while the IgG2 MAbs had the least activity. Against a mutant with increased fHbp expression, the anti-fHbp MAbs elicited greater C4b deposition (classical pathway) and greater bactericidal activity than against the wild-type strain, and the IgG1 MAbs had similar or greater activity than the respective IgG3 MAbs. The bactericidal activity against both wild-type and mutant strains also was dependent, in part, on activation of the alternative complement pathway. Thus, at lower epitope density in the wild-type strain, the IgG3 anti-fHbp MAbs had the greatest bactericidal activity. At a higher epitope density in the mutant, the IgG1 MAbs had similar or greater bactericidal activity than the IgG3 MAbs, and the activity was less dependent on the inhibition of fH binding than at a lower epitope density.

  16. The zooplankton of Santa Catarina continental shelf in southern Brazil with emphasis on Copepoda and Cladocera and their relationship with physical coastal processes El zooplancton de la plataforma continental de Santa Catarina, sur de Brasil con énfasis en Copepoda y Cladocera y sus relaciones con procesos físicos costeros

    Directory of Open Access Journals (Sweden)

    Renata Domingos-Nunes

    2012-11-01

    Full Text Available Very few studies have been carried out to exclusively investigate the zooplankton community of Santa Catarina State continental shelf, despite the economic and ecological importance of the area. This coastal region of southern Brazil presents highly relevant oceanographic processes, such as the strong influence of continental inputs, resurgence in the Cabo de Santa Marta Grande and River Plata plume water to the south. Two sampling cruises were carried out, in December 2005 and May 2006, in order to study temporal hydrological variations, and their influence on the biota of the region. Zooplankton samples for analysis were obtained by oblique hauls with Bongo nets at 33 sampling stations arranged in profiles perpendicular to the coast on each cruise. The predominant groups found in the samples were Copepoda, Cladocera, Salpidae and Chaetognatha, which presented higher densities at the stations closer to the coast. In the case of the December 2005 cruise, the salinity and temperature gradients perpendicular to the coast, promoted by the continental inputs to the north of the area and by the upwelling to the south, determined the limits of distribution of Acartia lilljeborgi and Penilia avirostris. However, the temperature and salinity gradients longitudinal to the coast determined on the May 2006 cruise did not explain the species distribution, indicating that biotic forcing mechanisms may have been active in the ecology of the system during this period.A pesar de la importancia económica y ecológica del área todavía no habían sido realizados estudios exclusivamente destinados a la investigación de la comunidad zooplanctónica de la plataforma continental del Estado de Santa Catarina. Esta región costera del sur de Brasil presenta procesos oceanográficos de alta relevancia, tales como fuerte influencia de aportes continentales, resurgencia en el Cabo de Santa Marta Grande y la pluma de agua del río Plata en el sur. Se efectuaron dos

  17. Subclass of individual IgA-secreting human lymphocytes. Investigation of in vivo pneumococcal polysaccharide-induced and in vitro mitogen-induced blood B cells by monolayer plaque-forming cell assays

    DEFF Research Database (Denmark)

    Heilmann, C; Barington, T; Sigsgaard, T

    1988-01-01

    The subclass of individual human IgA B cells was investigated by means of monolayer plaque-forming cell assays permitting analysis of all IgA-secreting cells as well as of cells secreting IgA anti-pneumococcal polysaccharide antibody. Center cells were examined by indirect immunofluorescence...

  18. Age-dependent association between IgG2 and IgG3 subclasses to Pf332-C231 antigen and protection from malaria, and induction of protective antibodies by sub-patent malaria infections, in Daraweesh

    DEFF Research Database (Denmark)

    Giha, Hayder A; Nasr, Amre; Iriemenam, Nnaemeka C

    2010-01-01

    The certainty of the protective role of acquired immunity in malaria is the major drive for malaria vaccine development. In this study, we measured the levels of total IgG and IgG subclasses to four candidate malaria vaccine antigens; MSP2-3D7, MSP2-FC27, AMA-1 and Pf332-C231, in plasma obtained ...

  19. Specificity of DNA-binding by the FAX-1 and NHR-67 nuclear receptors of Caenorhabditis elegans is partially mediated via a subclass-specific P-box residue

    Directory of Open Access Journals (Sweden)

    Smith Eric L

    2008-01-01

    Full Text Available Abstract Background The nuclear receptors of the NR2E class play important roles in pattern formation and nervous system development. Based on a phylogenetic analysis of DNA-binding domains, we define two conserved groups of orthologous NR2E genes: the NR2E1 subclass, which includes C. elegans nhr-67, Drosophila tailless and dissatisfaction, and vertebrate Tlx (NR2E2, NR2E4, NR2E1, and the NR2E3 subclass, which includes C. elegans fax-1 and vertebrate PNR (NR2E5, NR2E3. PNR and Tll nuclear receptors have been shown to bind the hexamer half-site AAGTCA, instead of the hexamer AGGTCA recognized by most other nuclear receptors, suggesting unique DNA-binding properties for NR2E class members. Results We show that NR2E3 subclass member FAX-1, unlike NHR-67 and other NR2E1 subclass members, binds to hexamer half-sites with relaxed specificity: it will bind hexamers with the sequence ANGTCA, although it prefers a purine to a pyrimidine at the second position. We use site-directed mutagenesis to demonstrate that the difference between FAX-1 and NHR-67 binding preference is partially mediated by a conserved subclass-specific asparagine or aspartate residue at position 19 of the DNA-binding domain. This amino acid position is part of the "P box" that plays a critical role in defining binding site specificity and has been shown to make hydrogen-bond contacts to the second position of the hexamer in co-crystal structures for other nuclear receptors. The relaxed specificity allows FAX-1 to bind a much larger repertoire of half-sites than NHR-67. While NR2E1 class proteins bind both monomeric and dimeric sites, the NR2E3 class proteins bind only dimeric sites. The presence of a single strong site adjacent to a very weak site allows dimeric FAX-1 binding, further increasing the number of dimeric binding sites to which FAX-1 may bind in vivo. Conclusion These findings identify subclass-specific DNA-binding specificities and dimerization properties for the NR2E1

  20. Antibody classes & subclasses induced by mucosal immunization of mice with Streptococcus pyogenes M6 protein & oligodeoxynucleotides containing CpG motifs.

    Science.gov (United States)

    Teloni, R; von Hunolstein, C; Mariotti, S; Donati, S; Orefici, G; Nisini, R

    2004-05-01

    Type-specific antibodies against M protein are critical for human protection as they enhance phagocytosis and are protective. An ideal vaccine for the protection against Streptococcus pyogenes would warrant mucosal immunity, but mucosally administered M-protein has been shown to be poorly immunogenic in animals. We used a recombinant M type 6 protein to immunize mice in the presence of synthetic oligodeoxynucleotides containing CpG motifs (immunostimulatory sequences: ISS) or cholera toxin (CT) to explore its possible usage in a mucosal vaccine. Mice were immunized by intranasal (in) or intradermal (id) administration with four doses at weekly intervals of M6-protein (10 microg/mouse) with or without adjuvant (ISS, 10 microg/mouse or CT, 0,5 microg/mouse). M6 specific antibodies were measured by enzyme linked immunosorbent assay using class and subclass specific monoclonal antibodies. The use of ISS induced an impressive anti M-protein serum IgG response but when id administered was not detectable in the absence of adjuvant. When used in, M-protein in the presence of both ISS and CT induced anti M-protein IgA in the bronchoalveolar lavage, as well as specific IgG in the serum. IgG were able to react with serotype M6 strains of S. pyogenes. The level of antibodies obtained by immunizing mice in with M-protein and CT was higher in comparison to M-protein and ISS. The analysis of anti-M protein specific IgG subclasses showed high levels of IgG1, IgG2a and IgG2b, and low levels of IgG3 when ISS were used as adjuvant. Thus, in the presence of ISS, the ratio IgG2a/IgG1 and (IgG2a+IgG3)/IgG1 >1 indicated a type 1-like response obtained both in mucosally or systemically vaccinated mice. Our study offers a reproducible model of anti-M protein vaccination that could be applied to test new antigenic formulations to induce an anti-group A Streptococcus (GAS) vaccination suitable for protection against the different diseases caused by this bacterium.

  1. Correlation between the Amount of Anti-D Antibodies and IgG Subclasses with Severity of Haemolytic Disease of Foetus and Newborn.

    Science.gov (United States)

    Velkova, Emilija

    2015-06-15

    The aim of this study was to investigate the influence of subclasses to IgG anti-D on the intensity of hemolytic disease of fetus and newborn (HDFN) at 45 fetuses/newborns with symptoms of mild and severe HDFN in Republic of Macedonia. In retrospective and prospective studies, in a period of 10 years, from 2004 to 2014, there have been immunohemathology tests performed on 22 009 samples on serums of pregnant women. At 37.78% of the total number of tested patients, IgG1 and IgG3 was the reason for severe HDFN. At 17.77% of the total number of tested patients, which had only IgG1detected, was the reason for serious intensity of HDFN. The correlation of the titer to anti-D antibodies in the mother's serum and the intensity of HDFN were researched in 48 newborns. The titers between 1:8 and 1:32 resulted in 3 cases of HDFN with symptoms of severe disease and in 4 cases there were no signs of HDFN. At 12 women that had a titre between 1:32 and 1:512, five of the newborns developed severe HDFN, and seven had symptoms of mild and weak intensity form. In 3 cases the titer was higher than 512, and out of them one newborn had weak symptoms of HDFN, one developed severe HDFN and one ended with foetal death. Only in one case the titer reached a value higher than 1000, and it ended with a fetal death. The titers of the pregnant women serum those are lower than 32 and those higher than 1000 can well predict HDFN. The titers of anti-D antibodies between 64 and 512 have no exact predictive value. IgG1 and IgG3 subclasses of anti-D have no predictive value by themselves, and cannot foresee the outcome of HDFN. The research study results suggest that IgG1 and IgG3 should be included in a multi - parameter protocol for evaluation of the HDFN intensity. They can give a real assessment of the expected HDFN intensity in combination with the titer hight and the significance of the antibodies.

  2. Marginal versus joint Box-Cox transformation with applications to percentile curve construction for IgG subclasses and blood pressures.

    Science.gov (United States)

    He, Xuming; Ng, K W; Shi, Jian

    2003-02-15

    When age-specific percentile curves are constructed for several correlated variables, the marginal method of handling one variable at a time has typically been used. We address the question, frequently asked by practitioners, of whether we can achieve efficiency gains by joint estimation. We focus on a simple but common method of Box-Cox transformation and assess the statistical impact of a joint transformation to multivariate normality on the percentile curve estimation for correlated variables. We find that there is little gain from the joint transformation for estimating percentiles around the median but a noticeable reduction in variances is possible for estimating extreme percentiles that are usually of main interest in medical and biological applications. Our study is motivated by problems in constructing percentile charts for IgG subclasses of children and for blood pressures in adult populations, both of which are discussed in the paper as examples, and yet our general findings are applicable to a wide range of other problems. Copyright 2003 John Wiley & Sons, Ltd.

  3. Multivariate DoE Optimization of Asymmetric Flow Field Flow Fractionation Coupled to Quantitative LC-MS/MS for Analysis of Lipoprotein Subclasses

    Directory of Open Access Journals (Sweden)

    Zsuzsanna Kuklenyik

    2015-02-01

    Full Text Available In this report we demonstrate a practical multivariate design of experiment (DoE approach for asymmetric flow field-flow fractionation (AF4 method optimization using separation of lipoprotein subclasses as an example. First, with the aid of commercially available software, we built a full factorial screening design where the theoretical outcomes were calculated by applying established formulas that govern AF4 channel performance for a 5–35 nm particle size range of interest for lipid particles. Second, using the desirable ranges of instrumental parameters established from theoretical optimization, we performed fractional factorial DoE for AF4 separation of pure albumin and ferritin with UV detection to narrow the range of instrumental parameters and allow optimum size resolution while minimizing losses from membrane immobilization. Third, the optimal range of conditions were tested using response surface DoE for sub-fractionation of high and low density lipoproteins (HDL and LDL in human serum, where the recovery of the analytes were monitored by fraction collection and isotope-dilution LC-MS/MS analysis of each individual fraction for cholesterol and apolipoproteins (ApoA-1 and ApoB-100. Our results show that DoE is an effective tool in combining AF4 theoretical knowledge and experimental data in finding the most optimal set of AF4 instrumental parameters for quantitative coupling with LC-MS/MS measurements.

  4. Type-IVC Secretion System: A Novel Subclass of Type IV Secretion System (T4SS) Common Existing in Gram-Positive Genus Streptococcus

    Science.gov (United States)

    Chen, Chen; Gao, George F.

    2012-01-01

    A growing number of pathogens are being found to possess specialized secretion systems which they use in various ways to subvert host defenses. Type IV secretion system (T4SS) is one of versatile secretion systems essential for the virulence and even survival of some bacteria species, and they enable the secretion of protein and DNA substrates across the cell envelope. T4SS was once believed to be present only in Gram-negative bacteria. In this study, we present evidence of a new subclass of T4SS, Type-IVC secretion system and indicate its common existence in the Gram-positive bacterial genus Streptococcus. We further identified that VirB1, VirB4, VirB6 and VirD4 are the minimal key components of this system. Using genome comparisons and evolutionary relationship analysis, we proposed that Type-IVC secretion system is movable via transposon factors and mediates the conjugative transfer of DNA, enhances bacterial pathogenicity, and could cause large-scale outbreaks of infections in humans. PMID:23056296

  5. Overproduction of a kinetic subclass of VLDL-apoB, and direct catabolism of VLDL-apoB in human endogenous hypertriglyceridemia: an analytical model solution of tracer data

    International Nuclear Information System (INIS)

    Eaton, R.P.; Allen, R.C.; Schade, D.S.

    1983-01-01

    To investigate the participation of the major apoprotein involved in triglyceride transport in the pathogenesis of endogenous hypertriglyceridemia, five kinetic studies of apoprotein B were conducted in volunteer normolipidemic subjects and six studies in four patients with endogenous hypertriglyceridemia. The transport of apoprotein B within four kinetic subclasses of very low density lipoprotein (VLDL), intermediate density lipoprotein (IDL), and low density lipoprotein (LDL) was studied by injection of [ 75 Se]selenomethionine. A 24-fold increase in the entry of newly synthesized apoprotein B at the initial kinetic subclass of the four-compartment VLDL delipidation sequence characterized the hypertriglyceridemic studies relative to normal subjects. Moreover, approximately 75 mg/kg per day of VLDL-B turnover reflected direct catabolism independent of conversion to IDL and/or to LDL, in contrast to the 8 mg/kg per day observed in controls. IDL-B was derived from VLDL-B in both normal and hypertriglyceridemic subjects, and was responsible for greater than 70% of all LDL-B synthesis. LDL-B pool size and turnover were indistinguishable in hypertriglyceridemic subjects from that observed in normal subjects. These studies suggest that two kinetic phenomena may characterize the pathophysiology of endogenous hypertriglyceridemia: a) over-production of apoB within a kinetic subclass of VLDL and b) preferential catabolism of hypertriglyceridemic VLDL without prior conversion to IDL/LDL

  6. Differential production of immunoglobulin classes and subclasses by mucosal-type human B-lymphocytes exposed in vitro to CpG oligodeoxynucleotides.

    Science.gov (United States)

    Cognasse, Fabrice; Acquart, Sophie; Beniguel, Lydie; Sabido, Odile; Chavarin, Patricia; Genin, Christian; Garraud, Olivier

    2005-01-01

    As B-lymphocytes play an important role in innate and adaptive immunity, we aimed to examine the effects of CpG oligodeoxynucleotides (ODNs) on purified tonsil-originating CD19+ B-cells, representing mucosal B-cells. We screened various K-type ODNs, reactive with human B-cells, and tested for the production of immunoglobulins in vitro. Using one CpG-ODN, DSP30, we observed that it could upregulate not only Toll-like receptor 9 (TLR9) mRNA expression in activated B-cells, but also the early expression of CD69 followed by the sequential expression of CD80, CD86 and the nuclear factor (NF)-kappaB pathway. Furthermore, mRNA expression of certain B-cell-derived cytokines was influenced by exposure to DSP30, with a strong upregulation of interleukin 6 (IL-6) and downregulation of IL1-beta. Stimulation of B-cells, co-stimulated with IL-2, IL-10 and soluble CD40 ligand (sCD40L) with different CpG-ODNs, had differing effects on the terminal differentiation in vitro of B-cells into immunoglobulin-secreting cells. TLR9 is involved in innate immunity and the recognition of bound CpG DNA from invading bacterial pathogens. As tonsillar B-cells are mucosal-type B-lymphocytes, this study suggests that CpG-ODNs show promise as mucosal adjuvants in modulating the local production of immunoglobulins of certain classes and subclasses, a crucial issue in vaccine perspectives.

  7. Multinuclear NMR resonance assignments and the secondary structure of Escherichia coli thioesterase/protease I: A member of a new subclass of lipolytic enzymes

    International Nuclear Information System (INIS)

    Lin Tahsien; Chen Chinpan; Huang Rongfong; Lee Yalin; Shaw Jeifu; Huang Taihuang

    1998-01-01

    Escherichia coli thioesterase/protease I is a 183 amino acid protein with a molecular mass of 20500. This protein belongs to a new subclass of lipolytic enzymes of the serine protease superfamily, but with a new GDSLS consensus motif, of which no structure has yet been determined. The protein forms a tetramer at pH values above 6.5 and exists as a monomer at lower pH values. Both monomer and tetramer are catalytically active. From analysis of a set of heteronuclear multidimensional NMR spectra with uniform and specific amino acid labeled protein samples, we have obtained near-complete resonance assignments of the backbone 1 H, 13 C and 15 N nuclei (BMRB databank accession number 4060). The secondary structure of E. coli thioesterase/protease I was further deduced from the consensus chemical shift indices, backbone short- and medium-range NOEs, and amide proton exchange rates. The protein was found to consist of four β-strands and seven α-helices, arranged in alternate order. The four β-strands were shown to form a parallel β-sheet. The topological arrangement of the β-strands of -1x, +2x, +1x appears to resemble that of the core region of the αβ hydrolase superfamily, typically found in common lipases and esterases. However, substantial differences, such as the number of β-strands and the location of the catalytic triad residues, make it difficult to give a definitive classification of the structure of E. coli thioesterase/protease I at present

  8. Cytology of the minor-vein phloem in 320 species from the subclass Asteridae suggests a high diversity of phloem-loading modes

    Directory of Open Access Journals (Sweden)

    Denis R. Batashev

    2013-08-01

    Full Text Available The discovery of abundant plasmodesmata at the bundle sheath/phloem interface in Oleaceae (Gamalei, 1974 and Cucurbitaceae (Turgeon et al., 1975 opened the questions whether these plasmodesmata are functional in phloem loading and how widespread is symplasmic loading. Analysis of over 800 dicot species allowed the definition of ‘open’ and ‘closed’ types of the minor vein phloem depending on the abundance of plasmodesmata between companion cells and bundle sheath (Gamalei, 1989; 1990. These types corresponded to potential symplasmic and apoplasmic phloem loaders, respectively; however, this definition covered a spectrum of diverse structures of phloem endings. Here, a review of detailed cytological analyses of minor veins in 320 species from the subclass Asteridae is presented, including data on several cell types and their combinations which have not been reported previously. The percentage of Asteridae species with ‘open’ minor vein cytology which also contain sieve-element-companion cell complexes with ‘closed’ cytology, i.e. that show specialization for both symplasmic and apoplasmic phloem loading, was determined. Along with recent data confirming the dissimilar functional specialization of structurally different parts of minor vein phloem in the stachyose-translocating species Alonsoa meridionalis (Voitsekhovskaja et al., 2009, these findings suggest that apoplasmic loading is indispensable in a large group of species previously classified as putative symplasmic loaders. Altogether, this study provides formal classifications of companion cells and of minor veins, respectively, in 24 families of the Asteridae based on their structural features, opening the way to a close investigation of the relationship between structure and function in phloem loading.

  9. (Copepoda: Siphonostomatoida) from southern Africa

    African Journals Online (AJOL)

    1988-08-22

    Aug 22, 1988 ... The three segments each bear 7-4-10 setae successively. The terminal segment bears one bifid seta. Second antenna three-segmented. (Figure 2a). Basal segment stout and about twice as long as second segment. Third segment transformed into a stout, sclerotized hook articulating laterally with second.

  10. HLA-A and -B alleles and haplotypes in 240 index patients with common variable immunodeficiency and selective IgG subclass deficiency in central Alabama

    Directory of Open Access Journals (Sweden)

    Barton James C

    2003-06-01

    Full Text Available Abstract Background We wanted to quantify HLA-A and -B phenotype and haplotype frequencies in Alabama index patients with common variable immunodeficiency (CVID and selective IgG subclass deficiency (IgGSD, and in control subjects. Methods Phenotypes were detected using DNA-based typing (index cases and microlymphocytotoxicity typing (controls. Results A and B phenotypes were determined in 240 index cases (114 CVID, 126 IgGSD and 1,321 controls and haplotypes in 195 index cases and 751 controls. Phenotyping revealed that the "uncorrected" frequencies of A*24, B*14, B*15, B*35, B*40, B*49, and B*50 were significantly greater in index cases, and frequencies of B*35, B*58, B*62 were significantly lower in index cases. After Bonferroni corrections, the frequencies of phenotypes A*24, B*14, and B*40 were significantly greater in index cases, and the frequency of B*62 was significantly lower in index cases. The most common haplotypes in index cases were A*02-B*44 (frequency 0.1385, A*01-B*08 (frequency 0.1308, and A*03-B*07 (frequency 0.1000, and the frequency of each was significantly greater in index cases than in control subjects ("uncorrected" values of p p p = 0.0166. Most phenotype and haplotype frequencies in CVID and IgGSD were similar. 26.7% of index patients were HLA-haploidentical with one or more other index patients. We diagnosed CVID or IgGSD in first-degree or other relatives of 26 of 195 index patients for whom HLA-A and -B haplotypes had been ascertained; A*01-B*08, A*02-B*44, and A*29-B*44 were most frequently associated with CVID or IgGSD in these families. We conservatively estimated the combined population frequency of CVID and IgGSD to be 0.0092 in adults, based on the occurrence of CVID and IgGSD in spouses of the index cases. Conclusions CVID and IgGSD in adults are significantly associated with several HLA haplotypes, many of which are also common in the Alabama Caucasian population. Immunoglobulin phenotype variability

  11. HLA class I antibodies trigger increased adherence of monocytes to endothelial cells by eliciting an increase in endothelial P-selectin and, depending on subclass, by engaging FcγRs.

    Science.gov (United States)

    Valenzuela, Nicole M; Mulder, Arend; Reed, Elaine F

    2013-06-15

    Ab-mediated rejection (AMR) of solid organ transplants is characterized by intragraft macrophages. It is incompletely understood how donor-specific Ab binding to graft endothelium promotes monocyte adhesion, and what, if any, contribution is made by the Fc region of the Ab. We investigated the mechanisms underlying monocyte recruitment by HLA class I (HLA I) Ab-activated endothelium. We used a panel of murine mAbs of different subclasses to crosslink HLA I on human aortic, venous, and microvascular endothelial cells and measured the binding of human monocytic cell lines and peripheral blood monocytes. Both anti-HLA I murine (m)IgG1 and mIgG2a induced endothelial P-selectin, which was required for monocyte adhesion to endothelium irrespective of subclass. mIgG2a but not mIgG1 could bind human FcγRs. Accordingly, HLA I mIgG2a but not mIgG1 treatment of endothelial cells significantly augmented recruitment, predominantly through FcγRI, and, to a lesser extent, FcγRIIa. Moreover, HLA I mIgG2a promoted firm adhesion of monocytes to ICAM-1 through Mac-1, which may explain the prominence of monocytes during AMR. We confirmed these observations using human HLA allele-specific mAbs and IgG purified from transplant patient sera. HLA I Abs universally elicit endothelial exocytosis leading to monocyte adherence, implying that P-selectin is a putative therapeutic target to prevent macrophage infiltration during AMR. Importantly, the subclass of donor-specific Ab may influence its pathogenesis. These results imply that human IgG1 and human IgG3 should have a greater capacity to trigger monocyte infiltration into the graft than IgG2 or IgG4 due to enhancement by FcγR interactions.

  12. HLA class I antibodies trigger increased adherence of monocytes to endothelial cells by eliciting an increase in endothelial P-selectin and, depending on subclass, by engaging FcγRs1

    Science.gov (United States)

    Valenzuela, Nicole M; Mulder, Arend; Reed, Elaine F

    2013-01-01

    Antibody-mediated rejection of solid organ transplants is characterized by intragraft macrophages. It is incompletely understood how donor specific antibody binding to graft endothelium promotes monocyte adhesion, and what, if any, contribution is made by the Fc region of the antibody. We investigated the mechanisms underlying monocyte recruitment by HLA class I antibody-activated endothelium. We used a panel of murine monoclonal antibodies of different subclasses to crosslink HLA I on human aortic, venous and microvascular endothelial cells, and measured the binding of human monocytic cell lines and peripheral blood monocytes. Both anti-HLA I murine IgG1 and mIgG2a induced endothelial P-selectin, which was required for monocyte adhesion to endothelium irrespective of subclass. Mouse IgG2a but not mIgG1 could bind human FcγRs. Accordingly, HLA I mIgG2a but not mIgG1 treatment of endothelial cells significantly augmented recruitment, predominantly through FcγRI, and, to a lesser extent, FcγRIIa. Moreover, HLA I mIgG2a promoted firm adhesion of monocytes to ICAM-1 through Mac-1, which may explain the prominence of monocytes during antibody mediated rejection. We confirmed these observations using human HLA allele specific monoclonal antibodies and IgG purified from transplant patient sera. HLA I antibodies universally elicit endothelial exocytosis leading to monocyte adherence, implying that P-selectin is a putative therapeutic target to prevent macrophage infiltration during antibody-mediated rejection. Importantly, the subclass of donor specific antibody may influence its pathogenesis. These results imply that hIgG1 and hIgG3 should have a greater capacity to trigger monocyte infiltration into the graft than IgG2 or IgG4 due to enhancement by FcγR interactions. PMID:23690477

  13. Data on carotid intima-media thickness and lipoprotein subclasses in type 1 diabetes from the Diabetes Control and Complications Trial and the Epidemiology of Diabetes Interventions and Complications (DCCT/EDIC

    Directory of Open Access Journals (Sweden)

    Arpita Basu

    2016-03-01

    Full Text Available Type 1 diabetes (T1DM is associated with increased risk of macrovascular complications. We examined longitudinal associations of serum conventional lipids and nuclear magnetic resonance (NMR-determined lipoprotein subclasses with carotid intima-media thickness (IMT in adults with T1DM (n=455 enrolled in the Diabetes Control and Complications Trial (DCCT. Data on serum lipids and lipoproteins were collected at DCCT baseline (1983–89 and were correlated with common and internal carotid IMT determined by ultrasonography during the observational follow-up of the DCCT, the Epidemiology of Diabetes Interventions and Complications (EDIC study, at EDIC ‘Year 1’ (199–1996 and EDIC ‘Year 6’ (1998–2000. This article contains data on the associations of DCCT baseline lipoprotein profiles (NMR-based VLDL & chylomicrons, IDL/LDL and HDL subclasses and ‘conventional’ total, LDL-, HDL-, non-HDL-cholesterol and triglycerides with carotid IMT at EDIC Years 1 and 6, stratified by gender. The data are supplemental to our original research article describing detailed associations of DCCT baseline lipids and lipoprotein profiles with EDIC Year 12 carotid IMT (Basu et al. in press [1]. Keywords: Lipids and lipoproteins, Carotid intima-media thickness, Type 1 diabetes

  14. Viscosity of high concentration protein formulations of monoclonal antibodies of the IgG1 and IgG4 subclass - Prediction of viscosity through protein-protein interaction measurements

    DEFF Research Database (Denmark)

    Neergaard, Martin S; Kalonia, Devendra S; Parshad, Henrik

    2013-01-01

    The purpose of this work was to explore the relation between protein-protein interactions (PPIs) and solution viscosity at high protein concentration using three monoclonal antibodies (mAbs), two of the IgG4 subclass and one of the IgG1 subclass. A range of methods was used to quantify the PPI...... low or high protein concentration determined using DLS. The PPI measurements were correlated with solution viscosity (measured by DLS using polystyrene nanospheres and ultrasonic shear rheology) as a function of pH (4-9) and ionic strength (10, 50 and 150mM). Our measurements showed that the highest...... solution viscosity was observed under conditions with the most negative kD, the highest apparent radius and the lowest net charge. An increase in ionic strength resulted in a change in the nature of the PPI at low pH from repulsive to attractive. In the neutral to alkaline pH region the mAbs behaved...

  15. [The impact of a 14- day regular physical exercise regime on the concentration of the classes and subclasses of lipoprotein particles in young subjects with a sedentary lifestyle].

    Science.gov (United States)

    Sabaka, P; Dukát, A; Oravec, S; Mistríková, L; Baláž, D; Bendžala, M; Gašpar, L

    2013-10-01

    Recommendations from the cardiological professional companies working in the area of primary prevention of cardiovascular diseases put an emphasis on regular aerobic physical activity. Its positive effect on both cardiovascular and overall mortality has repea-tedly been proven by the observations of prospective and cross sectional epidemiological studies. One of the possible explanations of this positive effect is a change in the concentration of lipoprotein classes and their subclasses, which is expressed as a change in their average size. In a group of young healthy men and women with a sedentary lifestyle we observed the effect of medium intensive physical exercise in the form of a 30- minute slow run per day lasting for 14 days. The concentration of lipoprotein classes and subclasses were determined through the method of a linear electrophoresis in polyacrylamide gel. In the observed group we found a statistically significant decrease of VLDL, large IDL particles, medium sized LDL, small dense LDL, and medium sized HDL particles. In the light of current knowledge all these lipoprotein particles are deemed as atherogenic. Thus, as little as 14 days of regular exercising has a positive effect on the concentration of plasmatic lipoproteins, and emphasises the role of regular physical activity in the primary prevention of cardiovascular diseases.

  16. IgA, IgE e subclasses de IgG anti-Candida albicans no soro e lavado vaginal de pacientes com candidíase vulvovaginal IgA, IgE and IgG subclasses to Candida albicans in serum and vaginal fluid from patients with vulvovaginal candidiasis

    Directory of Open Access Journals (Sweden)

    Ricardo José Victal de Carvalho

    2003-01-01

    Full Text Available OBJETIVO: Determinar níveis de anticorpos IgA, IgE, IgG e subclasses (IgG1, IgG4 específicos a C. albicans no soro e lavado vaginal de mulheres com ou sem candidíase vulvovaginal para avaliar o papel destes anticorpos na imunopatogênese desta doença. MÉTODOS: Foram selecionadas 30 mulheres com sintomas clínicos de candidíase vulvovaginal (15 com cultura de secreção vaginal positiva para C. albicans, 11 com cultura negativa e quatro com cultura positiva para Candida não-albicans e 12 mulheres controles assintomáticas (nove com cultura negativa. Amostras de soro e lavado vaginal foram obtidas para a detecção de anticorpos anti-C. albicans por ELISA. RESULTADOS: Pacientes sintomáticas com cultura positiva apresentaram níveis de IgA específicas significativamente maiores no lavado vaginal e menores no soro do que aquelas com cultura negativa. Níveis séricos de IgE específica foram extremamente baixos em relação ao lavado vaginal. Altos níveis de IgG total específica foram encontrados no soro e lavado vaginal em ambos os grupos, independente da presença do fungo. Níveis de IgG1 e IgG4 específicas foram significativamente maiores somente no lavado vaginal de mulheres sintomáticas e cultura positiva, com relação IgG1/IgG4 ligeiramente maior, indicando que a resposta de anticorpos IgG1 possa estar predominantemente envolvida na resolução da infecção fúngica. CONCLUSÕES: Nossos resultados indicam resposta acentuada de IgA, IgG1 e IgG4 anti-C. albicans no lavado vaginal de mulheres sintomáticas com cultura positiva, sugerindo importante papel destes anticorpos na resposta imune local estimulada pela presença do fungo.PURPOSE: To determine the levels of IgA, IgE, IgG and subclasses (IgG1, IgG4 antibodies specific to C. albicans in serum and vaginal washes from women with or without vulvovaginal candidiasis in order to evaluate the role of these antibodies in the immunopathogenesis of the disease. METHODS: Thirty women

  17. Evaluation of cysticercus-specific IgG (total and subclasses and IgE antibody responses in cerebrospinal fluid samples from patients with neurocysticercosis showing intrathecal production of specific IgG antibodies

    Directory of Open Access Journals (Sweden)

    Lisandra Akemi Suzuki

    Full Text Available In the present study, an enzyme-linked immunosorbent assay (ELISA standardized with vesicular fluid of Taenia solium cysticerci was used to screen for IgG (total and subclasses and IgE antibodies in cerebrospinal fluid (CSF samples from patients with neurocysticercosis showing intrathecal production of specific IgG antibodies and patients with other neurological disorders. The following results were obtained: IgG-ELISA: 100% sensitivity (median of the ELISA absorbances (MEA=1.17 and 100% specificity; IgG1-ELISA: 72.7% sensitivity (MEA=0.49 and 100% specificity; IgG2-ELISA: 81.8% sensitivity (MEA=0.46 and 100% specificity; IgG3-ELISA: 63.6% sensitivity (MEA=0.12 and 100% specificity; IgG4-ELISA: 90.9% sensitivity (MEA=0.85 and 100% specificity; IgE-ELISA 93.8% sensitivity (MEA=0.60 and 100% specificity. There were no significant differences between the sensitivities and specificities in the detection of IgG-ELISA and IgE-ELISA, although in CSF samples from patients with neurocysticercosis the MEA of the IgG-ELISA was significantly higher than that of the IgE-ELISA. The sensitivity and MEA values of the IgG4-ELISA were higher than the corresponding values for the other IgG subclasses. Future studies should address the contribution of IgG4 and IgE antibodies to the physiopathology of neurocysticercosis.

  18. Autoantibodies Specifically Against β1 Adrenergic Receptors and Adverse Clinical Outcome in Patients With Chronic Systolic Heart Failure in the β-Blocker Era: The Importance of Immunoglobulin G3 Subclass.

    Science.gov (United States)

    Nagatomo, Yuji; Li, Daniel; Kirsop, Jennifer; Borowski, Alan; Thakur, Akanksha; Tang, W H Wilson

    2016-06-01

    To elucidate the prevalence and role of β1 adrenergic receptor autoantibodies (β1AR-AAb) belonging to the immunoglobulin (Ig)G3 subclass in patients with heart failure (HF) treated with β-adrenergic blockers. Several cardiac AAbs have been reported to be present in sera from patients with dilated cardiomyopathy and other etiologies. Among AAbs, those recognizing β1AR-AAbs show agonist-like effects, have detrimental effects on cardiomyocytes, and may induce persistent myocardial damage. We quantify total IgG and IgG3 subclass β1AR-AAb in subjects with chronic stable HF with long-term follow-up. In our study cohort of 121 subjects, non-IgG3-β1AR-AAb and IgG3-β1AR-AAb were found to be positive in 20 (17%) and 26 patients (21%), respectively. The positive rate of IgG3-β1AR-AAb was significantly higher for those with nonischemic compared with ischemic HF etiology (27% vs 8%, P = .01), but the positive rate for non-IgG3-β1AR-AAb was similar between the 2 groups (18% vs 16%, respectively, P = NS). There were no significant differences in clinical and echocardiographic measures among total β1AR-AAb negative, non-IgG3-β1AR-AAb positive, and IgG3-β1AR-AAb positive groups at baseline. During 2.2 ± 1.2 years of follow-up, we observed similar rates of the composite endpoint of all-cause mortality, cardiac transplantation, or hospitalization resulting from HF between total IgG-β1AR-AAb negative and positive patients. However, the composite endpoint events were significantly more common in the patients without than in those with IgG3-β1AR-AAb (P = .048, log-rank test). Presence of IgG3-β1AR-AAb, not total IgG, was associated with paradoxically more favorable outcomes in our cohort of patients with chronic systolic HF largely treated by β-blockers. Copyright © 2016 Elsevier Inc. All rights reserved.

  19. Diversity of the Monstrilloida (Crustacea: Copepoda)

    Science.gov (United States)

    Suárez-Morales, Eduardo

    2011-01-01

    Monstrilloid copepods are protelean parasites of different groups of marine benthic invertebrates. Only their first naupliar, preadult, and adult phases are planktonic. Monstrilloids are currently represented by more than 115 nominal species contained in four genera. Its taxonomic knowledge has been hampered by nomenclatural and descriptive problems derived from their peculiar ontogeny and poor definitions of taxa. One of the most important difficulties is that of matching males to females. The only reliable methods to link the sexes of a species are the confirmation of particular apomorphies shared by both sexes, finding both sexes in the same host or as a pre-copulatory male-female pair in the plankton, or by the use of molecular markers. A general overview of the morphology of the group and its life cycle is provided herein. Recently, upgraded descriptive standards have been established and the relevance of redescribing taxa based on type and museum specimens has been demonstrated. The rate of species description per decade has had several peaks between 1840 and 2010: (1971–1980, 1991–2000, 2001–2010), each related to the activity of a few researchers. An analysis of the world distribution of published records of the Monstrilloida revealed that the Northeast Atlantic is the best studied region (45% of all records), followed by the Northwestern Atlantic (17%); the least surveyed areas include regions of the southern hemisphere (less than 3%). The Northeast Atlantic region harbors the highest number of known species (32 nominal species), followed by the Caribbean Sea/Gulf of Mexico (24), the Mediterranean/Black Sea (19), Indonesia-Malaysia-Philippines region (17), Japanese waters (17), and the Brazil-Argentina area (16). Other than these generalized patterns, little can be concluded concerning the biogeography of the group. Many species records are doubtful or improbable, and purportedly cosmopolitan nominal species are being revealed as species complexes yet to be studied. PMID:21853055

  20. Zur Biologie von Paramphiascella fulvofasciata (Copepoda, Harpacticoida)

    Science.gov (United States)

    Dahms, Hans-Uwe

    1986-09-01

    The benthic harpacticoid copepod Paramphiascella fulvofasciata Rosenfield & Coull was collected from holdfasts of Laminaria hyperborea from a subtidal area of Helgoland (North Sea). All developmental stages of P. fulvofasciata are raptorial feeders. The feeding of the nauplii is advanced by a marginal setule-crest of the labrum which prevents food-particles from being swept away. The oral appendages of the copepodites circumscribe a frustal space ventral to the mouth which facilitates uptake of food-particles. The nauplii are not able to swim and perform stalking movements with their antennal endopodites. Good swimming ability as well as digging-in-behaviour and negative phototaxis of the copepodites indicate epi- as well as inbenthic mode of life. Several life-cycle characters are described. Precopula lasts ca. one day. The mean egg-number is 27, and mean egg-diameter is 87 × 75 µm. The number of nauplii per egg (double)-sac amounts to 25 30. Developmental time at 19°C is 6 9 days (nauplii) and 20 24 days (copepodites). The whole developmental period lasts 28 days. The maximal lifespan in the laboratory is 193 days. Sex-ratio is almost balanced. Females produce egg-sacs more than 3.5 times during their life period. Seasonal effects on reproductive activity have not been detected in laboratory cultures.

  1. Histopathological changes induced by copepoda parasites ...

    African Journals Online (AJOL)

    User

    2014-01-13

    Jan 13, 2014 ... described from different hosts and locations in different. *Corresponding ... where the water is characterized by a high level of organic pollution. (Laleye et al. ... placed in a clean grease free slide which was then placed on a hot plate for 30 min in order .... bacteria, fungi, and virus) and cause mass mortality.

  2. Copepoda parasites in economically important fish, Mugilidae ...

    African Journals Online (AJOL)

    FUNMILAYO

    of economically important fish, both from the wild and fish farms, thus making them difficult to market. In this study ... Sakiti, 1997; Gbankoto et al., 2003) but no work has been carried out on ... digital weighing balance and recorded. ..... Life Sci. J. 9(3):733-737. Paperna I, Lahav M (1971). New records and further data on fish.

  3. Interpolation for a subclass of H

    Indian Academy of Sciences (India)

    |g(zm)| ≤ c |zm − zm |, ∀m ∈ N. Thus it is natural to pose the following interpolation problem for H. ∞. : DEFINITION 4. We say that (zn) is an interpolating sequence in the weak sense for H. ∞ if given any sequence of complex numbers (λn) verifying. |λn| ≤ c ψ(zn,z. ∗ n) |zn − zn |, ∀n ∈ N,. (4) there exists a product fg ∈ H.

  4. Propulsion and perception in intermediate Re regimes: aquatic microcrustacean copepod responses to wake structures.

    Science.gov (United States)

    Yen, J.; Pender Healy, L. A.; Heaphy, M.

    2016-02-01

    Flow sensing by the mechanoreceptive cuticular arrays of sensors on copepods has been shaped by over 400 million years of evolution and plays an important role in predator avoidance, foraging, mating, and rheotaxis. These 3D wakes are produced by animal propulsive activities and contain cues that guide these key survival responses. We have demonstrated that the fluid mechanical and chemical information retained in the hydrodynamic envelope can be interpreted by suitable sensor arrays; copepod sensor arrays are capable of perceiving minute differences in wake structures. Temora longicornis, a coastal marine copepod, and Hesperodiaptomus shoshone, a high-alpine freshwater lake copepod, track laminar trails. High-speed videography coupled with high-magnification Schlieren optics enabled us to visualize the deformation of the trail signal and the propulsive movements of the male copepod. Males followed the trail mimic and our observations show clear differences between the marine and freshwater species. Comparative analyses reveal tracking mechanisms that differ in sensor location with respect to the trail and locomotory kinematics. Copepods perform directed motions that lead them to a stimulus source in the absence of other collimating stimuli. Tracking by the copepod around the trail allows it to have one or numerous sensors inside and outside the trail to facilitate edge detection using spatial sampling. The advantage of this remarkable behavior of following trails fast and accurately is to encounter mates or food patches more frequently, thus contributing to population recruitment and energy transfer up the trophic food web. Precise mate and food finding strategies found for pelagic copepods may be a key adaptation, promoting survival in these open-ocean planktonic populations.

  5. Could artificial plant beds favour microcrustaceans during biomanipulation of eutrophic shallow lakes?

    DEFF Research Database (Denmark)

    Balayla, David; Boll, Thomas; Trochine, Carolina

    2017-01-01

    Introduction of artificial plants may facilitate the transition from a turbid to a clear-water state in shallow lakes, particularly when plant establishment is delayed. We investigated the usefulness of artificial plants as a restoration tool in an experimental setup mimicking open submerged plant...

  6. Human placenta: relative content of antibodies of different classes and subclasses (IgG1-IgG4) containing lambda- and kappa-light chains and chimeric lambda-kappa-immunoglobulins.

    Science.gov (United States)

    Lekchnov, Evgenii A; Sedykh, Sergey E; Dmitrenok, Pavel S; Buneva, Valentina N; Nevinsky, Georgy A

    2015-06-01

    The specific organ placenta is much more than a filter: it is an organ that protects, feeds and regulates the growth of the embryo. Affinity chromatography, ELISA, SDS-PAGE and matrix-assisted laser desorption ionization mass spectrometry were used. Using 10 intact human placentas deprived of blood, a quantitative analysis of average relative content [% of total immunoglobulins (Igs)] was carried out for the first time: (92.7), IgA (2.4), IgM (2.5), kappa-antibodies (51.4), lambda-antibodies (48.6), IgG1 (47.0), IgG2 (39.5), IgG3 (8.8) and IgG4 (4.3). It was shown for the first time that placenta contains sIgA (2.5%). In the classic paradigm, Igs represent products of clonal B-cell populations, each producing antibodies recognizing a single antigen. There is a common belief that IgGs in mammalian biological fluids are monovalent molecules having stable structures and two identical antigen-binding sites. However, similarly to human milk Igs, placenta antibodies undergo extensive half-molecule exchange and the IgG pool consists of 43.5 ± 15.0% kappa-kappa-IgGs and 41.6 ± 17.0% lambda-lambda-IgGs, while 15.0 ± 4.0% of the IgGs contained both kappa- and lambda-light chains. Kappa-kappa-IgGs and lambda-lambda-IgGs contained, respectively (%): IgG1 (47.7 and 34.4), IgG2 (36.3 and 44.5), IgG3 (7.4 and 11.8) and IgG4 (7.5 and 9.1), while chimeric kappa-lambda-IgGs consisted of (%): 43.5 IgG1, 41.0 IgG2, 5.6 IgG3 and 7.9 IgG4. Our data are indicative of the possibility of half-molecule exchange between placenta IgGs of various subclasses, raised against different antigens, which explains a very well-known polyspecificity and cross-reactivity of different human IgGs. © The Japanese Society for Immunology. 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  7. Evaluation of cysticercus-specific IgG (total and subclasses and IgE antibody responses in cerebrospinal fluid samples from patients with neurocysticercosis showing intrathecal production of specific IgG antibodies Avaliação das respostas de anticorpos anti-cisticercos IgG (total e subclasses e IgE em amostras de líquido cefalorraquidiano de pacientes com neurocisticercose apresentando produção intratecal de anticorpos específicos IgG

    Directory of Open Access Journals (Sweden)

    Lisandra Akemi Suzuki

    2013-01-01

    Full Text Available In the present study, an enzyme-linked immunosorbent assay (ELISA standardized with vesicular fluid of Taenia solium cysticerci was used to screen for IgG (total and subclasses and IgE antibodies in cerebrospinal fluid (CSF samples from patients with neurocysticercosis showing intrathecal production of specific IgG antibodies and patients with other neurological disorders. The following results were obtained: IgG-ELISA: 100% sensitivity (median of the ELISA absorbances (MEA=1.17 and 100% specificity; IgG1-ELISA: 72.7% sensitivity (MEA=0.49 and 100% specificity; IgG2-ELISA: 81.8% sensitivity (MEA=0.46 and 100% specificity; IgG3-ELISA: 63.6% sensitivity (MEA=0.12 and 100% specificity; IgG4-ELISA: 90.9% sensitivity (MEA=0.85 and 100% specificity; IgE-ELISA 93.8% sensitivity (MEA=0.60 and 100% specificity. There were no significant differences between the sensitivities and specificities in the detection of IgG-ELISA and IgE-ELISA, although in CSF samples from patients with neurocysticercosis the MEA of the IgG-ELISA was significantly higher than that of the IgE-ELISA. The sensitivity and MEA values of the IgG4-ELISA were higher than the corresponding values for the other IgG subclasses. Future studies should address the contribution of IgG4 and IgE antibodies to the physiopathology of neurocysticercosis.No presente estudo, uma reação imunoenzimática (ELISA padronizada com o fluido vesicular de cisticercos de Taenia solium foi utilizada para avaliar as respostas de anticorpos anti-cisticercos IgG (total e subclasses e IgE em amostras de líquido cefalorraquidiano (LCR de pacientes com neurocisticercose apresentando produção intratecal de anticorpos específicos IgG e pacientes com outras desordens neurológicas. Os seguintes resultados foram obtidos: ELISA-IgG: 100% de sensibilidade (mediana das absorbâncias das reações ELISA (MAE=1,17 e especificidade 100%; ELISA-IgG1: sensibilidade 72,7% (MAE=0,49 e especificidade 100%; ELISA-IgG2

  8. Prospective estimation of IgG, IgG subclass and IgE antibodies to dietary proteins in infants with cow milk allergy. Levels of antibodies to whole milk protein, BLG and ovalbumin in relation to repeated milk challenge and clinical course of cow milk allergy

    DEFF Research Database (Denmark)

    Høst, A; Husby, S; Gjesing, B

    1992-01-01

    Prospectively, serum levels of IgE, specific IgE antibodies (AB) to whole cow milk protein (CMP), bovine se-albumin, bovine immunoglobulin, bovine lactoferrin, bovine lactalbumin and beta-lactoglobulin (BLG), IgG and IgG subclass antibodies to ovalbumin (OA) and BLG, and IgG4 RAST to CMP (bovine...... whey) were measured in 39 infants with cow milk protein allergy (CMPA) at birth (cord blood), at time of diagnosis and before and after milk challenge at the age of 12 months. Immunological measurements were also undertaken in 33 control infants without CMPA at birth, at 6 months and at 18 months...... of the type of CMPA (IgE-mediated (CMA) or non-IgE-mediated (CMI)), and irrespective of whether remission had occurred. In cord blood 25/33 (76%) of the infants with CMPA had specific IgE-AB to one or more of the bovine milk proteins indicating a prenatal intrauterine sensitization to cow milk protein. At 6...

  9. Molecular effects of diethanolamine exposure on Calanus finmarchicus (Crustacea: Copepoda)

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, Bjorn Henrik, E-mail: bjorn.h.hansen@sintef.no [SINTEF Materials and Chemistry, Marine Environmental Technology, Brattorkaia 17B, N-7465 Trondheim (Norway); Altin, Dag [BioTrix, N-7022 Trondheim (Norway); Booth, Andy; Vang, Siv-Hege; Frenzel, Max; Sorheim, Kristin Rist; Brakstad, Odd Gunnar [SINTEF Materials and Chemistry, Marine Environmental Technology, Brattorkaia 17B, N-7465 Trondheim (Norway); Storseth, Trond R. [SINTEF Fisheries and Aquaculture, N-7465 Trondheim (Norway)

    2010-08-15

    Alkanolamines are surface-active chemicals used in a wide range of industrial, agricultural and pharmaceutical applications and products. Of particular interest is the use of alkanolamines such as diethanolamine (DEA) in the removal of CO{sub 2} from natural gas and for CO{sub 2} capture following fossil fuel combustion. Despite this widespread use, relatively little is known about the ecotoxicological impacts of these compounds. In an attempt to assess the potential effects of alkanolamines in the marine environment, a key species in the North Atlantic, the planktonic copepod Calanus finmarchicus, was studied for molecular effects following sublethal exposure to DEA. DEA-induced alterations in transcriptome and metabolome profiling were assessed using a suppression subtractive hybridization (SSH) gene library method and high resolution magic angle spinning nuclear magnetic resonance (HR-MAS NMR), respectively. Effects were observed on transcription of genes reportedly involved in lipid metabolism, antioxidant systems, metal binding, and amino acid and protein catabolism. These effects were accompanied by altered expression of fatty acid derivates, amino acids (threonine, methionine, glutamine, arginine, alanine and leucine) and cholines (choline, phosphocholine and glycerophosphocholine). Together, SSH and HR-MAS NMR offer complementary screening tools for the assessment of molecular responses of C. finmarchicus to DEA and can be used in the study of other chemicals and organisms. Concentration-response and time-response relationships between DEA exposure and single gene transcription were investigated using quantitative PCR. Specific relationships were found between DEA exposure and the transcription of genes involved in protein catabolism (ubiquitin-specific protease-7), metal ion homeostasis (ferritin) and defence against oxidative stress ({gamma}-glutamylcysteine synthase, glutathione synthase and Cu/Zn-superoxide dismutase). At the lowest alkanolamine concentration used in these experiments, which corresponded to 0.5% of the LC{sub 50} concentration, no transcriptional effects were observed, giving information regarding the lower molecular effect level. Finally, similar transcription patterns were observed for a number of different genes following exposure to DEA, which indicates analogous mechanisms of toxicity and response.

  10. A new species of Schizopera (Copepoda: Harpacticoida: Miraciidae from Colombia

    Directory of Open Access Journals (Sweden)

    Juan M. Fuentes-Reinés

    2014-09-01

    Full Text Available Objective. The present contribution aims at the description of a new species of the genus Schizopera. Materials and methods. Water samples were collected in littoral areas with mangrove and macrophytes, and in the limnetic zone. Twenty five liters of water were taken. Water samples were filtered with a zooplankton net (45μm and preserved in 70% ethanol. The filtered samples were concentrated to 100 ml and examined in a Bogorov camera. Copepods were separated. Observations and drawings of S. evelynae sp. nov. were made at a magnification of 1000X. Results. Schizopera evelynae sp. nov. seems to be closely related to S. giselae Jiménez -Álvarez 1988 and to S. pratensis Noodt 1958 based on the armature formula of P1-P4, but can be separated from these two species based on the relative length of P1ENP, length/width ratio of P1ENP2, relative length of the outer proximal and distal spines on P4EXP3, shape of the exopod and relative length of the exopodal setae of the female P5, shape and length/width ratio of the male P2ENP2, and male P5 baseoendopodal lobe:exopod length ratio. A key to the species of Schizopera from America is given. Conclusion. A new species of the genus Schizopera is described. The Colombian material shares most characters with S. giselae and S. pratensis.

  11. Distribution of scolecithricidae (Copepoda: Calanoida) in the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Gopalakrishnan, T.C.; Devi, K.S.

    .7, and 5.1% of the total numbers of specimens of Scolecithricidae collected respectively. High density areas of S. danae were found scattered between 15 degrees N and 15 degrees S latitudes, especially along the African coast. S. bradyi and S. echinatus...

  12. Spatial distribution of Nemesis lamna Risso 1826 (Copepoda ...

    African Journals Online (AJOL)

    The selection of a specific site of attachment by a copepod parasite is determined by a set of mostly unknown factors. The spatial distribution of Nemesis lamna on the gill filaments of white sharks Carcharodon carcharias was investigated. The complete set of left gills of 11 hosts was examined and the location, orientation ...

  13. Some new and rare Copepoda Calanoida from East Indian Seas

    NARCIS (Netherlands)

    Vervoort, W.

    1949-01-01

    The rich material of Copepods collected by the Snellius Expedition in the seas of the Eastern part of the Malay Archipelago was placed at my disposal in 1943 by Prof. Dr. H. Boschma. The material proved to be very interesting and contained, besides new species, many rare forms found for the first

  14. A study of the Levantine and Pontic Harpacticoida (Crustacea, Copepoda)

    NARCIS (Netherlands)

    Dov Por, F.

    1964-01-01

    INTRODUCTION Though both are parts of the Mediterranean basin, the eastern Mediterranean and the Black Sea form distinct units from both the hydrographic and the biological points of view. The Levantine basin — delimited by the Anatolian peninsula, the Syrio-Israelian shores and the Egyptian

  15. Phylogeny of the Paracalanidae Giesbrecht, 1888 (Crustacea: Copepoda: Calanoida).

    Science.gov (United States)

    Cornils, Astrid; Blanco-Bercial, Leocadio

    2013-12-01

    The Paracalanidae are ecologically-important marine planktonic copepods that occur in the epipelagic zone in temperate and tropical waters. They are often the dominant taxon - in terms of biomass and abundance - in continental shelf regions. As primary consumers, they form a vital link in the pelagic food web between primary producers and higher trophic levels. Despite the ecological importance of the taxon, evolutionary and systematic relationships within the family remain largely unknown. A multigene phylogeny including 24 species, including representatives for all seven genera, was determined based on two nuclear genes, small-subunit (18S) ribosomal RNA and Histone 3 (H3) and one mitochondrial gene, cytochrome c oxidase subunit I (COI). The molecular phylogeny was well supported by Maximum likelihood and Bayesian inference analysis; all genera were found to be monophyletic, except for Paracalanus, which was separated into two distinct clades: the Paracalanus aculeatus group and Paracalanus parvus group. The molecular phylogeny also confirmed previous findings that Mecynocera and Calocalanus are genera of the family Paracalanidae. For comparison, a morphological phylogeny was created for 35 paracalanid species based on 54 morphological characters derived from published descriptions. The morphological phylogeny did not resolve all genera as monophyletic and bootstrap support was not strong. Molecular and morphological phylogenies were not congruent in the positioning of Bestiolina and the Paracalanus species groups, possibly due to the lack of sufficient phylogenetically-informative morphological characters. Copyright © 2013 Elsevier Inc. All rights reserved.

  16. Lipoprotein particle subclasses, cardiovascular disease and HIV infection

    DEFF Research Database (Denmark)

    Duprez, Daniel A; Kuller, Lewis H; Tracy, Russell

    2009-01-01

    using conditional logistic models. RESULTS: Total, large and small HDL-p, but not VLDL-p nor LDL-p, were significantly and inversely associated with CVD and its major component, non-fatal coronary heart disease. The HDL-p associations with CVD were reduced after adjustment for high sensitive C...

  17. On a subclass of n-starlike functions

    Directory of Open Access Journals (Sweden)

    Mugur Acu

    2005-01-01

    Full Text Available In 1999, Kanas and Rønning introduced the classes of starlike and convex functions, which are normalized with f(w=f'(w−1=0 and w a fixed point in U. In 2005, the authors introduced the classes of functions close to convex and α-convex, which are normalized in the same way. All these definitions are somewhat similar to the ones for the uniform-type functions and it is easy to see that for w=0, the well-known classes of starlike, convex, close-to-convex, and α-convex functions are obtained. In this paper, we continue the investigation of the univalent functions normalized with f(w=f'(w−1=0 and w, where w is a fixed point in U.

  18. Nasal septal angiofibroma, a subclass of extranasopharyngeal angiofibroma.

    Science.gov (United States)

    Garcia-Rodriguez, Laura; Rudman, Kelli; Cogbill, Christopher H; Loehrl, Todd; Poetker, David M

    2012-01-01

    Extranasopharyngeal angiofibromas (ENA) arising from the nasal septum or nasal septal angiofibromas are extremely rare; only 13 such cases have been reported in the international literature. Our objective is to describe the presentation, workup, and surgical management of these lesions. Case reports were done. The setting was a tertiary care referral center and the Veterans Affairs Medical Center. PATIENTS, INTERVENTIONS, AND RESULTS: We present 2 cases of extranasopharyngeal angiofibroma occurring on the nasal septum. In this report, we discuss the occurrence, the histopathologic findings, and the treatment of nasal septal angiofibroma. Copyright © 2012 Elsevier Inc. All rights reserved.

  19. Sensitivity of some Immunoglobulin G class and subclass antibodies ...

    African Journals Online (AJOL)

    Indirect sandwich enzyme-linked immunosorbent assay (ELISA) was used to measure serum antibody responses in onchocerciasis patients. Apparently, IgG antibody class was more sensitive than IgG1, IgG3 and IgG4 responses to Onchocerca volvulus adult worms sodium duodecyl sulphate (SDS) extracted crude ...

  20. IMPROVED DISTANCES TO TYPE Ia SUPERNOVAE WITH TWO SPECTROSCOPIC SUBCLASSES

    International Nuclear Information System (INIS)

    Wang, X.; Filippenko, A. V.; Ganeshalingam, M.; Li, W.; Silverman, J. M.; Chornock, R.; Foley, R. J.; Macomber, B.; Serduke, F. J. D.; Steele, T. N.; Wong, D. S.; Wang, L.; Gates, E. L.

    2009-01-01

    We study the observables of 158 relatively normal Type Ia supernovae (SNe Ia) by dividing them into two groups in terms of the expansion velocity inferred from the absorption minimum of the Si II λ6355 line in their spectra near B-band maximum brightness. One group ('Normal') consists of normal SNe Ia populating a narrow strip in the Si II velocity distribution, with an average expansion velocity (v) = 10, 600 ± 400 km s -1 near B maximum; the other group ('HV') consists of objects with higher velocities, v ∼> 11, 800 km s -1 . Compared with the Normal group, the HV one shows a narrower distribution in both the peak luminosity and the luminosity decline rate Δm 15 . In particular, their B-V colors at maximum brightness are found to be on average redder by ∼ 0.1 mag, suggesting that they either are associated with dusty environments or have intrinsically red B-V colors. The HV SNe Ia are also found to prefer a lower extinction ratio R V ∼ 1.6 (versus ∼ 2.4 for the Normal ones). Applying such an absorption-correction dichotomy to SNe Ia of these two groups remarkably reduces the dispersion in their peak luminosity from 0.178 mag to only 0.125 mag.

  1. Carotenoid metabolic profiling and transcriptome-genome mining reveal functional equivalence among blue-pigmented copepods and appendicularia

    KAUST Repository

    Mojib, Nazia; Amad, Maan H.; Thimma, Manjula; Aldanondo, Naroa; Kumaran, Mande; Irigoien, Xabier

    2014-01-01

    The tropical oligotrophic oceanic areas are characterized by high water transparency and annual solar radiation. Under these conditions, a large number of phylogenetically diverse mesozooplankton species living in the surface waters (neuston) are found to be blue pigmented. In the present study, we focused on understanding the metabolic and genetic basis of the observed blue phenotype functional equivalence between the blue-pigmented organisms from the phylum Arthropoda, subclass Copepoda (Acartia fossae) and the phylum Chordata, class Appendicularia (Oikopleura dioica) in the Red Sea. Previous studies have shown that carotenoid–protein complexes are responsible for blue coloration in crustaceans. Therefore, we performed carotenoid metabolic profiling using both targeted and nontargeted (high-resolution mass spectrometry) approaches in four different blue-pigmented genera of copepods and one blue-pigmented species of appendicularia. Astaxanthin was found to be the principal carotenoid in all the species. The pathway analysis showed that all the species can synthesize astaxanthin from β-carotene, ingested from dietary sources, via 3-hydroxyechinenone, canthaxanthin, zeaxanthin, adonirubin or adonixanthin. Further, using de novo assembled transcriptome of blue A. fossae (subclass Copepoda), we identified highly expressed homologous β-carotene hydroxylase enzymes and putative carotenoid-binding proteins responsible for astaxanthin formation and the blue phenotype. In blue O. dioica (class Appendicularia), corresponding putative genes were identified from the reference genome. Collectively, our data provide molecular evidences for the bioconversion and accumulation of blue astaxanthin–protein complexes underpinning the observed ecological functional equivalence and adaptive convergence among neustonic mesozooplankton.

  2. Carotenoid metabolic profiling and transcriptome-genome mining reveal functional equivalence among blue-pigmented copepods and appendicularia

    KAUST Repository

    Mojib, Nazia

    2014-06-01

    The tropical oligotrophic oceanic areas are characterized by high water transparency and annual solar radiation. Under these conditions, a large number of phylogenetically diverse mesozooplankton species living in the surface waters (neuston) are found to be blue pigmented. In the present study, we focused on understanding the metabolic and genetic basis of the observed blue phenotype functional equivalence between the blue-pigmented organisms from the phylum Arthropoda, subclass Copepoda (Acartia fossae) and the phylum Chordata, class Appendicularia (Oikopleura dioica) in the Red Sea. Previous studies have shown that carotenoid–protein complexes are responsible for blue coloration in crustaceans. Therefore, we performed carotenoid metabolic profiling using both targeted and nontargeted (high-resolution mass spectrometry) approaches in four different blue-pigmented genera of copepods and one blue-pigmented species of appendicularia. Astaxanthin was found to be the principal carotenoid in all the species. The pathway analysis showed that all the species can synthesize astaxanthin from β-carotene, ingested from dietary sources, via 3-hydroxyechinenone, canthaxanthin, zeaxanthin, adonirubin or adonixanthin. Further, using de novo assembled transcriptome of blue A. fossae (subclass Copepoda), we identified highly expressed homologous β-carotene hydroxylase enzymes and putative carotenoid-binding proteins responsible for astaxanthin formation and the blue phenotype. In blue O. dioica (class Appendicularia), corresponding putative genes were identified from the reference genome. Collectively, our data provide molecular evidences for the bioconversion and accumulation of blue astaxanthin–protein complexes underpinning the observed ecological functional equivalence and adaptive convergence among neustonic mesozooplankton.

  3. Diet and trophic ecomorphology of the silverside, Odontesthes bonariensis, of the Salto Caxias reservoir, rio Iguaçu, Paraná, Brazil

    Directory of Open Access Journals (Sweden)

    Fernanda Aparecida da Silva Cassemiro

    Full Text Available This study aims to analyze the diet and trophic ecomorphology of Odontesthes bonariensis, relating these features with species' abundance in the natural environment and in the Salto Caxias reservoir (at Iguaçu river after the reservoir's formation. The samples were carried out before (from March 1997 to February 1998- pre and after (from October 1998 to February 2001 - post 1 and 2 the damming. The stomach contents of 218 individuals were analyzed by occurrence and volumetric methods. O. bonariensis' diet is based on insects, scales, plants and detritus. Microcrustaceans (Cladocera and Copepoda were the main items, allowing the characterization of the species as zooplanktivore. The species has a superior position and protractible mouth, with small teeth, creating a serrated pattern, uniformly lined side by side. There are many gill rakers, that are long and close together (typical of filtering fishes; the stomach is ill defined and the intestine is short. There was a gradual increase of O. bonariensis' abundance during the period of field study, mainly after the second year of damming. This fact seems to be closely related with the high abundance and availability of zooplankton in the dammed environment, and also with the ability of the species to exploit this resource.

  4. First Report of Tumor-Like Anomalies on the Copepods and their Seasonality from the Obhur Creek, Jeddah Coast, Central Red Sea

    Science.gov (United States)

    Al-Aidaroos, Ali M.; Mantha, Gopikrishna

    2018-06-01

    Monthly abundance of the subclass Copepoda was analyzed from the zooplankton samples collected at Obhur Creek, Jeddah, Saudi Arabia during December-2011 till December-2012. Zooplankton samples were collected through surface horizontal tows by a modified WP2 net ( via. mouth diameter 50 cm, length 180 cm, 150 μm mesh size). Order Calanoida dominated the abundance with mean annual average of 75.29%. We observed abnormal protuberances on copepods, known as tumour-like anomalies (TLAs). Calanoida showed more frequent and prominent TLAs on its dorsal surface with highest mean percentage occurring during Jun. 2012 (1.64%). The percentage prevalence of TLAs on the Copepoda was highest during Jun. 2012 (1.36%) and least during Nov. 2012 (0.03%). It is suggested that these TLAs might be caused due to the presence of potentially high levels of toxic substances, which weakens the exoskeleton and thereby making them more susceptible to infections or due to wounds from parasites or might be related to the occurrence of symbiotic tantulocarids or might be due to the radiation stress as a control measure. Whatever the reason, these TLAs have become a serious emerging threat to the aquatic food web. Our investigation is the first of its kind in the coastal waters of the Saudi Red Sea, which needs further investigations in order to elucidate the possible reasons for these abnormalities.

  5. The egg string attachment mechanism in salmon lice Lepeophtheirus salmonis (Copepoda: Caligidae)

    NARCIS (Netherlands)

    Schram, Thomas A.

    2000-01-01

    The anatomy of the genital complex and the hook apparatus that keeps the trailing egg strings in position, are illustrated and described. Based on light and scanning electron microscopy, it is shown how the sacs are mechanically secured by the penetration of a pair of hooks through the proximal ends

  6. Niche separation and reproduction of Clausocalanus species (Copepoda, Calanoida) in the Atlantic Ocean

    Science.gov (United States)

    Peralba, Àurea; Mazzocchi, Maria Grazia; Harris, Roger P.

    2017-11-01

    The distribution and reproductive traits of copepods of the genus Clausocalanus were investigated during the Atlantic Meridional Transect cruise AMT-15, in September-October 2004 to estimate their ecological niches and secondary production in the epipelagic layer along a latitudinal cline (48°N-40°S). The distribution patterns of selected environmental parameters, i.e., temperature, salinity and chlorophyll a concentration, enabled eco-provinces to be identified as described by Longhurst (2006). Clausocalanus represented on average 34% of total copepod abundance, with a large predominance of adult females and copepodites over males. Among the eleven Clausocalanus species found during the survey, eight species showed a wide distributional range, i.e.,C. paululus, C. pergens, C. furcatus, C. arcuicornis, C. jobei, C. parapergens, C. lividus, and C. mastigophorus, while C. ingens, C. brevipes, and C. laticeps were recorded only in the South Atlantic. The smallest C. furcatus, C. paululus, and C. pergens together accounted for 85% of total Clausocalanus adult abundance. The ecological niches were clearly separated among congeners of similar size and largely overlapped in congeners whose size differed. The small- and medium-sized species, which are egg-sac-spawners, had smaller clutch size and lower egg-production rate than the larger broadcaster congeners. Nevertheless, embryo viability was lower in broadcasters, which may explain their low abundance in terms of lower recruitment. A sex ratio largely skewed toward females in all Clausocalanus species and the observation of viable eggs in successive clutches from isolated females seem to indicate that re-mating is not necessary in this genus. Broadcast-spawners showed the highest weight-specific fecundity rates in the genus but similar secondary production to sac-spawners despite the fact that they never occurred at high abundance. In light of their abundant occurrence in oceanic waters and well-defined ecological niches, Clausocalanus species may be considered as good indicators of environmental conditions and monitored in relation to changes in ecosystem structure due to climate change.

  7. A new genus (Copepoda, Harpacticoida, Laophontidae from Jeju Island of Korea

    Directory of Open Access Journals (Sweden)

    Jinwook Back

    2014-10-01

    Full Text Available A survey on the harpacticoid copepods from an intertidal zone in Hyeopjae sandy beach, Jeju Island, Korea, resulted in the discovery of an unusual laophontid, Jejulaophonte hyeopjaeensis sp. n., which cannot be placed in any extant genus within the family. To accommodate the species, a new genus of the family Laophontidae T. Scott, 1905 is proposed and fully described here. The new species is closely related to the lineage of the five primitive genera, Carraroenia McCormack, 2006, Coullia Hamond, 1973, Hemilaophonte Jakubisiak 1933, Psammoplatypus Lee & Huys, 1999, and Robustunguis Fiers, 1992 (the CCHPR-lineage by the reduced P2 endopod, ovate shape of the female P5 exopod and sexual dimorphism in the P3 endopod. However, it displays discrepancies from the species of the CCHPR-lineage in the presence of an inner seta on P3 and P4 exp-2, four setae on P4 enp-2, and an inner seta on P3 and P4 enp-2 in the female. Furthermore, no other species within the family Laophontidae has three setae on P2 exp-3 and a seta on P2 enp-2 at the same time. The new species has sexual dimorphism in the antennule, genital segmentation and the legs from P2 to P5. The terminal seta on the second endopodal segment of P2 in the male is longer than that in the female. The endopod of P3 is 3-segmented and displays a short inner apophysis on the second segment in the male. The outer setae on the exopod of P3 and P4 are distinctly thicker and stronger in the male than in the female. Mitochondrial cytochrome oxidase subunit I (mtCOI sequencing of the new species has been realized in order to be used in future phylogenetic analysis.

  8. A new species of Mesocyclops (Copepoda, Cyclopoida, Cyclopidae from Southeastern Mexico

    Directory of Open Access Journals (Sweden)

    Eduardo SUÁREZ-MORALES

    2001-08-01

    Full Text Available The taxonomical status of several neotropical species of Mesocyclops is still uncertain. Furthermore, several new species with a restricted distributional range have been described recently in this region. From littoral zooplankton samples collected in the lowlands of the State of Tabasco, Southeastern Mexico, male and female specimens of a previously unknown species of Mesocyclops were found. This new species is described herein based on both sexes and following the upgraded standards set for the taxonomic study of this genus, including SEM analysis. The new species differs from its congeners by a combination of several characters: the unique shape of the antennular hyaline membrane, the ornamentation of both maxillule and maxilla, the ornamentation of the fourth swimming leg, the shape and structure of the genital receptacle, and the ornamentation of the furcal rami. It is most closely related to other neotropical species such as M. meridianus Kiefer, 1926 and M. pseudomeridianus Defaye & Dussart, 1989. This is the eleventh species of Mesocyclops known from Mexico, and also the third new species described upon Mexican material. Due to the affinity of the Tabasco fauna with the Caribbean and the South American copepod faunas, the new species is expected to have a relatively wide geographical distribution in the neotropical region.

  9. Vertical distribution, feeding and vulnerability to tactile predation in Metridia longa (Copepoda, Calanoida)

    KAUST Repository

    Vestheim, Hege

    2013-12-01

    We assessed the vertical distribution and feeding of the calanoid copepod Metridia longa in the Oslofjord, Norway during winter and spring 2006. Adult females of Metridia longa inhabited the whole 200 m deep-water column. Their distribution was shallower at night than during the day. Enumeration of egested faecal pellets suggested that feeding activity was greater at night than during the day and that more pellets were produced by individuals collected at shallow depths vs. by individuals found deeper. There was no pronounced difference between months in feeding activity. Although the hypothesis is that they prey on Calanus eggs and nauplii, scanning of Metridia faecal pellets by PCR using Calanus-specific primers did not confirm the presence of any Calanus prey DNA. Most pellets had a greenish colour, implying herbivorous feeding. Feeding is related to swimming, and the actively swimming Metridia would presumably be vulnerable to tactile invertebrate predators. However, predation experiments where the carnivorous copepod Pareuchaeta norvegica was offered similar-sized Metridia and Calanus proved that Pareuchaeta consumed the less-active Calanus, but not the Metridia. © 2013 Copyright Taylor and Francis Group, LLC.

  10. Marine Flora and Fauna of the Northeastern United States. Copepoda: Lernaeopodidae and Sphyriidae.

    Science.gov (United States)

    Ho, Ju-Shey

    This report is part of a sub-series to aid biology students, biologists, biological oceanographers, and informed laymen in the identification and study of marine flora and fauna of the Northeastern United States. Contents of this report include: (1) Introduction; (2) Glossary; (3) Key to the marine lernaeopodoid copepods of the Northeastern United…

  11. Resting eggs of zooplankton (copepoda and cladocera) from the Kiel Bay and adjacent waters (southwestern Baltic)

    Digital Repository Service at National Institute of Oceanography (India)

    Madhupratap, M.; Nehring, S.; Lenz, J.

    stream_size 11 stream_content_type text/plain stream_name Mar_Biol_125_77.pdf.txt stream_source_info Mar_Biol_125_77.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  12. Distribution of @iPleuromamma@@ spp (Copepoda-Calanoida) in the northern Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Goswami, S.C.

    P. gracilis@@ evinced restricted distribution with northern limit till lat. 18~'N. Copepodite stages (CIV and CV) of both species were distributed mostly in the euphotic zone. The adults occurred at deeper depths. The males were recorded at shallower depths...

  13. Pseudocyclops lakshmi, a new species (Pseudocyclopidae: Calanoidea: Copepoda) from the Laccadives, India

    Digital Repository Service at National Institute of Oceanography (India)

    Haridas, P.; Madhupratap, M.; Ohtsuka, S.

    Pseudocyclops lakshmi, new species, is described from the Kadmat and Agatti atolls of the Laccadives, India, along with its dimorphic males. Characters separating the new species from the rest of its congeners are discussed. This species...

  14. @iPseudocyclops lakshmi@@, a new species (Pseudocyclopidae: Calanoidea: Copepoda) from the Laccadives, India

    Digital Repository Service at National Institute of Oceanography (India)

    Haridas, P.; Madhupratap, M.; Ohtsuka, S.

    @iPseudocyclops lakshmi@@, new species, is described from the Kadmat and Agatti atolls of the Laccadives, India, along with its dimorphic males. Characters separating the new species from the rest of its congeners are discussed. This species...

  15. Morphometric differences in two calanoid sibling species, Boeckella gracilipes and B. titicacae (Crustacea, Copepoda

    Directory of Open Access Journals (Sweden)

    Patricio De los Ríos Escalante

    2012-12-01

    Full Text Available Calanoid copepods are abundant in South American inland waters and include widespread species, such as Boeckella gracilipes (Daday, 1902, which occurs from the Ecuador to Tierra del Fuego Island. This species occurs under various environmental conditions, and is found in oligotrophic lakes in Patagonia (39-54°S and in shallow mountain lakes north of 39°S. The aim of the present study is to conduct a morphometric comparison of male specimens of B. titicacae collected in Titicaca and B. gracilipes collected in Riñihue lakes, with a third population of B. gracilipes collected in shallow ponds in Salar de Surire. Titicaca and Riñihue lakes are stable environments, whereas Salar de Surire is an extreme environment. These ponds present an extreme environment due to high exposure to solar radiation and high salinity levels. The results of the study revealed differences among the three populations. These results agree well with systematic descriptions in the literature on differences between the populations of Titicaca and Riñihue lakes, and population of Salar de Surire differs slightly from the other two populations. It is probable that the differences between the population of Salar de Surire and the other two populations result from the extreme environment in Salar de Surire. High exposure to solar radiation, high salinity and extreme variations in temperature enhance genetic variations that are consequently expressed in morphology.

  16. Distribution of some Calanoida (Crustacea: Copepoda from the Yucatán Peninsula, Belize and Guatemala

    Directory of Open Access Journals (Sweden)

    Gerd-Oltmann Brandorff

    2012-03-01

    Full Text Available Southern Mexico and Central America have many water bodies of different morphology and water chemistry with an interesting zooplankton fauna, originating from North or South America. A set of 63 samples, taken in 2005 and 2008, from water bodies of the Yucatan Peninsula karst, Belize and Guatemala, were studied for the content of calanoid copepods. Old and recent literature was used to determine animals to species level. Drawings were prepared with a microscope and a camera lucida. A total of 32 samples with totally six species contained calanoid copepods: one estuarine pseudodiaptomid and five freshwater diaptomids. Pseudodiaptomus marshi was found at different salinities. It is confirmed that the commonest diaptomids in the Yucatan Peninsula are Arctodiaptomus dorsalis and Mastigodiaptomus nesus. The former was also recorded from Lake Amatitlan. Mastigodiaptomus nesus is as widespread as A. dorsalis but it is absent from the Lake Peten area in Guatemala. Mastigodiaptomus reidae was found in two shallow habitats, these specimens differ from those from the type locality by having a set of peculiar large spine-like processes on the last thoracic and the urosome segments of the females. Leptodiaptomus siciloides was found only in Lake Ayarza with high salinity. Prionodiaptomus colombiensis occurred in the highlands of Guatemala in Lago de Güija and in the Peten area in Laguna Sacpuy. We contributed with our occurrence records to a better knowledge of the geographic distribution of some calanoid copepods. Morphological findings in some species are of value for taxonomic differentiation between species.

  17. On Scambicornus Heegard, 1944, a senior synonym of Preherrmannella Seymour Sewell, 1949 (Copepoda, Cyclopoida)

    NARCIS (Netherlands)

    Stock, J.H.

    1964-01-01

    During the preparation of a report dealing with poecilostomes associated with holothurians, it was found desirable to obtain more information concerning a number of genera formerly described. Through the courtesy of Dr. T.Wolff of the Zoologisk Museum of Copenhagen, I was able to reexamine the

  18. The Salmon Louse Lepeophtheirus salmonis (Copepoda: Caligidae life cycle has only two Chalimus stages.

    Directory of Open Access Journals (Sweden)

    Lars A Hamre

    Full Text Available Each year the salmon louse (Lepeophtheirussalmonis Krøyer, 1838 causes multi-million dollar commercial losses to the salmon farming industry world-wide, and strict lice control regimes have been put in place to reduce the release of salmon louse larvae from aquaculture facilities into the environment. For half a century, the Lepeophtheirus life cycle has been regarded as the only copepod life cycle including 8 post-nauplius instars as confirmed in four different species, including L. salmonis. Here we prove that the accepted life cycle of the salmon louse is wrong. By observations of chalimus larvae molting in incubators and by morphometric cluster analysis, we show that there are only two chalimus instars: chalimus 1 (comprising the former chalimus I and II stages which are not separated by a molt and chalimus 2 (the former chalimus III and IV stages which are not separated by a molt. Consequently the salmon louse life cycle has only six post-nauplius instars, as in other genera of caligid sea lice and copepods in general. These findings are of fundamental importance in experimental studies as well as for interpretation of salmon louse biology and for control and management of this economically important parasite.

  19. Copepoda (Siphonostomatoida) associated with Ophiuroidea in Jamaica, Puerto Rico, and Barbados

    NARCIS (Netherlands)

    Humes, A.G.

    1998-01-01

    Three new siphonostomatoid copepods are associated with Ophiuroidea in the tropical western Atlantic. Collocheres vervoorti spec. nov., from Ophiothrix angulata in Jamaica, has an elongate, gently tapered genital double-somite in the female and the second segment of leg 5 has a distal outer notch.

  20. NUEVA ESPECIE DE ASTEROCHERES Y PRIMER REGISTRO PARA CUBA DE A. CRINOIDICOLA (COPEPODA: SIPHONOSTOMATOIDA: ASTEROCHERIDAE

    Directory of Open Access Journals (Sweden)

    Carlos Varela

    2011-06-01

    Two species of copepods belonging to the genus Asterocheres were found in recent collections in the North of Matanzas province. The one associated to the sponge of the genus Callyspongia Duchassaing y Michelotti, 1864 is described as a new species of siphonostomatoid copepod to science. The differences among the new specie and the more similar ones are also presented. A. crinoidicola, associated to a crinoid of the genus Davidaster Hoggett y Rowe, 1986 is recorded for the first time for the Cuban Archipelago.

  1. Cletocamptus goenchim sp. nov., a new harpacticoid (Copepoda: Harpacticoida) from India

    Digital Repository Service at National Institute of Oceanography (India)

    Gomez, S.; Ingole, B.; Sawant, M.; Singh, R.

    Académica Mazatlán; Joel Montes Camarena s/n, 82040, Mazatlán, Sinaloa, México (BI) (MS) (RS) National Institute of Oceanography (CSIR), Dona Paula, Goa-403004, India Corresponding author: Samuel Gómez; Instituto de Ciencias del Mar y Limnología..., Unidad Académica Mazatlán; Joel Montes Camarena s/n, Mazatlán 82040, Sinaloa, Mexico; Tel: (52)(669)9852845; e-mail: samuelgomez@ola.icmyl.unam.mx Abstract.---A new species of harpacticoid copepod, Cletocamptus goenchim sp. nov., was found...

  2. Morphological variability and distribution of the exotic Asian Mesocyclops thermocyclopoides (Copepoda: Cyclopoida: in the Neotropical region

    Directory of Open Access Journals (Sweden)

    Eduardo Suárez-Morales

    2011-10-01

    Full Text Available From a series of biological samples collected from different freshwater environments in Costa Rica, Central America, the exotic Asian cyclopoid Mesocyclops thermocyclopoides Harada, 1931 was identified. We analyzed the morphology and appendage ornamentation of different Neotropical populations of this species, including specimens from Honduras, southeastern Mexico, and Costa Rica. We also examined Asian specimens from Taiwan, Indonesia, Vietnam, and Thailand, and performed a comparison of the Neotropical and Asian populations including a Principal Component Analysis (PCA. The Neotropical and Asian specimens show subtle morphological variations in the antennules, antennae, mandibles, swimming legs 1-4, and fifth legs. Some characters in the Neotropical group appear to diverge from the Asian pattern and the PCA indicated that intercontinental populations of M. thermocyclopoides are far from being homogeneous. These intra-specific differences are described to expand the known morphological range of this species and to provide the first comparative analysis of an exotic copepod in the Americas. Our analysis suggests that the geographic isolation of the American populations and the subtle morphological divergences with respect to the Asian patterns could be related to speciation processes in the Neotropical region, but also intra-Asian differences are reported. In the Neotropical region this species appears to be restricted to southeastern Mexico, Central America, and one Caribbean island; its potential as biological control of mosquito might enhance its spread in the region.

  3. An overview of the limnetic Cyclopidae (Crustacea, Copepoda of the Philippines, with emphasis on Mesocyclops

    Directory of Open Access Journals (Sweden)

    Rey Donne S. Papa

    2013-08-01

    Full Text Available Approximately 120 (subspecies of Cyclopidae have been reported from South and Southeast (SE Asia, where the Philippine archipelago – with 16 (including two endemic taxa – is one of the least explored parts of the region. Our study, part of current efforts to assess freshwater biodiversity, was undertaken to update the diversity and geographic distribution of the cyclopid copepods living in the limnetic zone of the freshwater lakes in the Philippines. Examination of the samples from 22 lakes in five islands (Luzon, Mindoro, Cebu, Leyte and Mindanao revealed a novel species from lake Siloton (Mindanao, Mesocyclops augusti n. sp. The new species can be distinguished from the congeners by the surface ornamentation of the hindgut, among others. The same character state was found in a Mesocyclops from North Vietnam, which is provisionally identified as M. augusti n. sp., though the Vietnam and Mindanao specimens differ in a few (yet polymorphic in the close relatives characters. Mesocyclops microlasius Kiefer, 1981 endemic to the Philippines is redescribed, based on females and males from lake Paoay (North Luzon. Sister relationships of M. augusti n. sp. and M. microlasius were tested in a phylogenetic analysis that included the closely related Old World representatives of the genus. The max. parsimony trees show M. dissimilis Defaye et Kawabata, 1993 (East Asia as the closest relative of M. augusti n. sp. (Mindanao, Vietnam, and support sister relationship between M. geminus Holynska, 2000 (East Borneo and M. microlasius (Luzon, Mindanao. A mainland clade (M. francisci, M. parentium, M. woutersi, M. dissimilis, M. augusti appears in most reconstructions; all members of the clade occur in continental Asia though some species also live in islands that have never been connected to the SE Asian shelf. In most trees with the mainland clade the insular taxa (M. microlasius, M. geminus, M. friendorum form either a paraphyletic (basal to mainland or monophyletic sister group of the mainland clade. We also established the first records of Thermocyclops taihokuensis (Harada, 1931 in the Philippines (Luzon, so far known from East and Central Asia. In all, 11 taxa [Mesocyclops (4, Thermocyclops (4, Microcyclops (1, Tropocyclops (1 and Paracyclops (1] including only one endemic species (M. microlasius have so far been found in the limnetic waters. We expect significantly higher diversity and higher rate of endemism of the freshwater cyclopids in the littoral (paludal and subterranean habitats in the Philippines.

  4. Distribution of some Calanoida (Crustacea: Copepoda from the Yucatán Peninsula, Belize and Guatemala

    Directory of Open Access Journals (Sweden)

    Gerd-Oltmann Brandorff

    2012-03-01

    Full Text Available Southern Mexico and Central America have many water bodies of different morphology and water chemistry with an interesting zooplankton fauna, originating from North or South America. A set of 63 samples, taken in 2005 and 2008, from water bodies of the Yucatan Peninsula karst, Belize and Guatemala, were studied for the content of calanoid copepods. Old and recent literature was used to determine animals to species level. Drawings were prepared with a microscope and a camera lucida. A total of 32 samples with totally six species contained calanoid copepods: one estuarine pseudodiaptomid and five freshwater diaptomids. Pseudodiaptomus marshi was found at different salinities. It is confirmed that the commonest diaptomids in the Yucatan Peninsula are Arctodiaptomus dorsalis and Mastigodiaptomus nesus. The former was also recorded from Lake Amatitlan. Mastigodiaptomus nesus is as widespread as A. dorsalis but it is absent from the Lake Peten area in Guatemala. Mastigodiaptomus reidae was found in two shallow habitats, these specimens differ from those from the type locality by having a set of peculiar large spine-like processes on the last thoracic and the urosome segments of the females. Leptodiaptomus siciloides was found only in Lake Ayarza with high salinity. Prionodiaptomus colombiensis occurred in the highlands of Guatemala in Lago de Güija and in the Peten area in Laguna Sacpuy. We contributed with our occurrence records to a better knowledge of the geographic distribution of some calanoid copepods. Morphological findings in some species are of value for taxonomic differentiation between species.El sur de México y América Central tienen varios cuerpos de agua con diferente morfología, composición química y una interesante fauna de zooplancton procedente de América del Norte o del Sur. Un grupo de 63 muestras, fueron tomadas en 2005 y 2008 para conocer la cantidad de copépodos calanoides en los cuerpos de agua del karst Península de Yucatán, Belice y Guatemala. Se utilizó literatura antigua y reciente para la identificación de los especímenes a nivel de especie y se preparon dibujos con un microscopio y una cámara lúcida. En un total de 32 muestras se obtuvieron seis especies de copépodos calanoides: un pseudodiaptomidos estuarino y cinco diaptomidos de agua dulce. Pseudodiaptomus marshi fue encontrado a diferentes salinidades. Además, se confirmó que los diaptomidos más comunes en la Península de Yucatán fueron: Arctodiaptomus dorsalis y Mastigodiaptomus nesus. El primero se registró también en el lago de Amatitlán. Mastigodiaptomus nesus está ampliamente distribuido al igual que A. dorsalis, pero se encuentra ausente en el área del Lago Petén en Guatemala. Mastigodiaptomus reidae fue localizado en dos hábitats poco profundos, éstos especímenes difieren de los tipos de la localidad, por tener un grupo de espinas de gran tamaño en la última parte de la caja toráxica y los segmentos del urosoma de las hembras. Leptodiaptomus siciloides se encontró sólo en el Lago Ayarza, el cual contiene alta salinidad. Prionodiaptomus colombiensis se localizó en las tierras altas de Guatemala en el Lago de Güija y en la zona del Petén en Laguna Sacpuy. Se contribuye con registros de presencia de especies para un mejor conocimiento de la distribución geográfica de algunos copépodos calanoides. De la misma forma, los hallazgos morfológicos en algunas especies son de gran valor taxonómico para la diferenciación de especies.

  5. To Swim or Not to Swim: Potential Transmission of Balaenophilus manatorum (Copepoda: Harpacticoida) in Marine Turtles.

    Science.gov (United States)

    Domènech, Francesc; Tomás, Jesús; Crespo-Picazo, José Luis; García-Párraga, Daniel; Raga, Juan Antonio; Aznar, Francisco Javier

    2017-01-01

    Species of Balaenophilus are the only harpacticoid copepods that exhibit a widespread, obligate association with vertebrates, i.e., B. unisetus with whales and B. manatorum with marine turtles and manatees. In the western Mediterranean, juveniles of the loggerhead sea turtle, Caretta caretta are the only available hosts for B. manatorum, which has been found occurring at high prevalence (>80%) on them. A key question is how these epibionts are transmitted from host to host. We investigated this issue based on experiments with live specimens of B. manatorum that were cultured with turtle skin. Specimens were obtained from head-started hatchlings of C. caretta from the western Mediterranean. Hatched nauplii crawled only on rough substrates and lacked the ability to swim. Only copepodites IV and V, and adults, were able to perform directional swimming. Legs 2, 3 and 4 played a major role in swimming and were only well-developed in these stages. Nauplii reared in wells with turtle skin readily fed on this item. Late copepodites and adults also fed on turtle skin but did not consume other potential food items such as fish skin, baleen plates or planktonic algae. Evidences suggest that the transmission of B. manatorum should rely on hosts' bodily contacts and/or swimming of late developmental stages between spatially close hosts. The possibility of long-ranged dispersal is unlikely for two reasons. First, all developmental stages seem to depend on turtle skin as a food resource. Second, the average clutch size of ovigerous females was small (turtles that occur at very low densities (turtles·km-2) in the western Mediterranean. The high prevalence of B. manatorum in loggerhead turtles in this area raises the question whether these turtles have contacts, or tend to closely aggregate, more than is currently believed.

  6. Metacyclops woni n. sp., a New Cyclopoid Species (Copepoda: Cyclopoida: Cyclopidae from Cambodia

    Directory of Open Access Journals (Sweden)

    Lee, Jimin

    2015-10-01

    Full Text Available A new cyclopoid species belonging to the genus Metacyclops Kiefer, 1927 is described, based upon the specimens from a temporary pool in a forest of Mt. Phnom Domnak Dambouk, situated in the southwestern part of Cambodia. Metacyclops woni sp. nov. is characterized by its quite short caudal rami, about 2.5 times longer than wide, with a spinule row on anterior quarter of lateral margin. This new species belongs to the species group with the spine formula 3,4,4,3 of swimming legs 1-4. Among the members of the species group with the combination of characters of 11-segmented antennule and a single apical spine on the second endopodal segment of leg 4, it most resembles M. deserticus Mercado-Salas and Suárez-Morales, 2013 from Mexico in carrying an outermost caudal seta slightly longer than the innermost caudal seta and an apical spine on the second endopodal segment of leg 4 slightly shorter than the segment. However, it differs clearly from the present new species by much longer caudal rami with lateral caudal seta at nearly halfway of lateral margin of the ramus and smooth posterior margin of intercoxal sclerites of legs 1-4. This is the first record of the genus Metacyclops from Cambodia and the fourth one from Southeast Asia.

  7. A new species of Peltidium Philippi, 1839 (Crustacea, Copepoda, Harpacticoida) from the Pacific coast of Mexico

    Science.gov (United States)

    Suárez-Morales, Eduardo; Jarquín-González, Jani

    2013-01-01

    Abstract During the analysis of phytal meiobenthic samples collected from a rocky-sandy beach in the state of Nayarit, in the Mexican Pacific, several specimens of harpacticoid copepods were obtained and taxonomically examined. These specimens were found to represent an undescribed species of the peltidiid genus Peltidium Philippi, 1839. The new species, Peltidium nayarit sp. n. is described herein. It resembles Peltidium nichollsi Geddes and Peltidium lerneri Geddes from Bahamas but also the widespread Peltidium speciosum Thompson & Scott and Peltidium purpureum Philippi. The new species from the Mexican Pacific differs from its known congeners by its possession of a unique combination of characters, including a modified pectinate seta on the antennary exopod, three terminal setae on the second endopodal segment of leg 1, third exopodal segment of leg 1 with three elements, inner terminal claw twice as long as outer claw, female fifth leg with 5 exopodal setae, exopodal setae I-III stout, spinulose and seta IV being as long as seta V. This is the second species of the family known to be distributed in the Eastern Tropical Pacific and in Mexico. Pending additional data, the distribution of this species appears to be restricted to this area of the Mexican Pacific. PMID:24003319

  8. A new subspecies of Nitokra affinis Gurney, 1927 (Copepoda, Harpacticoida) from the Caribbean coast of Colombia

    Science.gov (United States)

    Fuentes-Reinés, Juan M.; Suárez-Morales, Eduardo

    2014-01-01

    Abstract Plankton samples from Laguna Navio Quebrado, La Guajira, northern Colombia, yielded male and female specimens of an harpacticoid copepod that was first identified as the widely distributed species Nitokra affinis Gurney, 1927 for which at least four subspecies have been described from different geographic areas. A more detailed examination of the Colombian specimens revealed that it differs from the other morphs so far considered as subspecies. The Colombian specimens differ from the other four known subspecies in the following aspects: (1) rostrum with long projection, (2) relatively long exopod of P1, almost as long as first endopodal segment, (3) endopodal and exopodal rami of P2 equally long, (4) a reduced number of endopodal setal elements of the male P5. It also differs from N. a. californica Lang in details of the ornamentation of the urosomites. Descriptions and illustrations of this new subspecies, the first one described from the Neotropical region, are presented together with a key to the five known subspecies of Nitokra affinis. As in many other cases of presumedly widespread species of harpacticoids, it is possible that N. affinis represents a species complex with more restricted distributional patterns, a notion that certainly deserves further study. PMID:24574850

  9. A new species of Metacyclops Kiefer, 1927 (Copepoda, Cyclopidae, Cyclopinae) from the Chihuahuan desert, northern Mexico

    Science.gov (United States)

    Mercado-Salas, Nancy F.; Suárez-Morales, Eduardo; Maeda-Martínez, Alejandro M.; Silva-Briano, Marcelo

    2013-01-01

    Abstract A new species of the freshwater cyclopoid copepod genus Metacyclops Kiefer, 1927 is described from a single pond in northern Mexico, within the binational area known as the Chihuahuan Desert. This species belongs to a group of Metacyclops species with a 3443 spine formula of swimming legs. It is morphologically similar to Metacyclops lusitanus Lindberg, 1961 but differs from this and other congeners by having a unique combination of characters, including a caudal rami length/width proportion of 3.5–3.8, a innermost terminal seta slightly longer than the outermost terminal seta, intercoxal sclerites of legs 1-4 naked, a strong apical spine of the second endopodal segment of leg 1 and one row of 6-8 small spinules at the insertion of this spine. The finding of this species represents also the first record of the genus in Mexico and the third in North America, where only two other species, Metacyclops gracilis (Lilljeborg, 1853)and Metacyclops cushae Reid, 1991 have been hitherto reported. This is also the first continental record of a species of Metacyclops from an arid environment in the Americas. This species appears to be endemic to the Chihuahuan Desert, thus emphasizing the high endemicity of this area. PMID:23794845

  10. Epibiotic ciliates Scyphidia sp. and diatoms on Tigriopus fulvus (Copepoda: Harpacticoida exoskeleton

    Directory of Open Access Journals (Sweden)

    Luigi Pane

    2014-12-01

    Full Text Available Several microorganisms – epibionts – can adhere to living supports taking advantage for their survival, feeding and movement. Epibiosis occurs particularly in aquatic environments, on both benthic and planktonic organisms, among which copepods and cladocerans represent an important living support. The harpacticoid copepod Tigriopus fulvus, living in the splashpools of rocky coasts, was studied to recognize the occurrence of epibionts on the exoskeleton surface using scanning electon microscopy techniques. The first evidence of ciliate Scyphidia sp. on Tigriopus fulvus has been described and the occurrence of algae Cocconeis sp. has been observed as well. Epibionts were found to adhere to antennae, a site linked to the exploitation of water currents carrying food particles to mouthparts and to swimming legs. The reason of the occurrence on swimming legs is less clear and needs further observations. Pertinent results are described and discussed and the influence of epibionts on life cycle and behavior of Tigriopus fulvus is considered.

  11. Lernaea cyprinacea (Crustacea: Copepoda in the Iberian Peninsula: climate implications on host–parasite interactions

    Directory of Open Access Journals (Sweden)

    Sánchez-Hernández Javier

    2017-01-01

    Full Text Available The non-native parasitic anchor worm (Lernaea cyprinacea may induce anaemia, malformations, reduced growth and increased susceptibility to secondary infection to its hosts. The objectives of this study were to (i compile a list of the host species of L. cyprinacea in the Iberian Peninsula and (ii assess if climate may impact on infestation levels of the parasite. There were two primary sources for data collection: (i fish sampling in the Tormes Basin (Ávila, central Spain during August 2010 and 2016 and (ii data retrieved from publications containing relevant information about L. cyprinacea. Eleven temperature variables were obtained from Worldclim. Next, the relationship between infestation levels of the anchor worm (prevalence, intensity and abundance and temperature was tested using mixed models. Fifteen cyprinids species among 18 species are host of L. cyprinacea in the Iberian Peninsula. Infestation levels of the anchor worm are highly connected to temperature. Finally, the possible implications of global warming for host–parasite interactions are discussed.

  12. Vertical distribution of paracalanus crassirostris (copepoda, calanoidea: analysis by the general linear model

    Directory of Open Access Journals (Sweden)

    Ana Milstein

    1979-01-01

    Full Text Available The vertical distribution of each developmental stage of Paracalanus crassirostris was studied in a shallow water station at Ubatuba, SP, Brazil (23º30'S-45º07'W. Samples were collected monthly at the surface, 2m and near bottom levels . Salinity, temperature, dissolved oxygen, tide height, light penetration arid solar radiation were also recorded. Data were analysed by the general linear model. It showed that the amount of individuals at any developmental stage is affected diversely by hour, depth, hour-depth interaction and environmental factors throughout the year and that these effects are stronger in summer. All developmental stages were spread in the water column showing no regular vertical migrations. On the other hand, the number of organisms caught in a particular hour seemed to dependmore on the tide than on the animals behaviour. The results of the present paper showed, as observed by some other authors, the lack of vertical migration of a coastal copepod which is a grazer of fine particles throughout its life.A distribuição vertical dos diferentes estádios de desenvolvimento de P. crassirostris foi estudada durante um ano (junho 1976 - maio 1977, numa estação pouco profunda (5 m em Ubatuba. As amostras foram coletadas mensalmente, em tres profundidades, cada quatro horas, com garrafa van Dorn de 9 l registrando-se dados ambientais. Os dados foram processados com a técnica dos Mínimos Quadrados, na forma de uma Aralise de Regressão de um Modelo Linear que inclui covariáveis. O modelo foi construído a priori, considerando densidade de organismos por amostra, fatores ambientais, diferenças entre amostras procedentes de diferentes profundidades e horas, também como interações entre hora e profundidade. Para cada estádio de P. crassirostris, o modelo foi repetido 9 vezes, com os dados de dois meses cada vez, a fim de obter a variação das respostas no ano. Os resultados do modelo indicaram que a quantidade de indivíduos desta especie de qualquer estádio é diferentemente afetada durante o ano pela hora, profundidade, interação hora-profundidade, e fatores ambientais. Esses efeitos seriam mais marcados no verão. A maior ou menor ocorrência de organismos numa dada hora parece depender mais da dinamica do sistema de correntes (mares que do comportamento dos animais. Todos os estádios apresentaram-se distribuídos na coluna de agua e não mostraram migrações verticais marcadas como parte do seu comportamento normal. Os fatores ambientais em conjunto mostraram-se importantes na distribuição deste organismo, especialmente no verão. Bjornberg & Wilbur (1968 e Sameoto (1975 relacionaram o comportamento migrador pouco marcado ou ausente com o nível trofico que os planctontes costeiros ocupam. Os primeiros autores assinalaram a presença de partículas finas em todas as profundidades em aguas rasas, e a migraçao pouco definida de copepodos filtradores provenientes desse tipo de ãgua; o segundo autor distinguiu, em aguas pouco p?ofundas também, uma comunidade formada por predadores e uma comunidade de presas formada por copepodos nao migradores. Os resultados do presente trabalho apoiam essas idéias, mostrando a falta de migraçao em todos os estádios de um copêpodo que e, durante toda a sua vida, filtrador de partículas finas.

  13. Vertical distribution, feeding and vulnerability to tactile predation in Metridia longa (Copepoda, Calanoida)

    KAUST Repository

    Vestheim, Hege; Brucet, Sandra; Kaartvedt, Stein

    2013-01-01

    deeper. There was no pronounced difference between months in feeding activity. Although the hypothesis is that they prey on Calanus eggs and nauplii, scanning of Metridia faecal pellets by PCR using Calanus-specific primers did not confirm the presence

  14. Effects of seven diets on the population dynamics of laboratory cultured Tisbe holothuriae Humes (Copepoda, Harpacticoida)

    Science.gov (United States)

    Miliou, H.; Moraïtou-Apostolopoulou, M.

    1991-09-01

    The harpacticoid copepod Tisbe holothuriae was collected from Saronicos Gulf (Greece) and reared under constant laboratory conditions. In order to study the effects of food on the population dynamics, seven diets were tested: the seaweed Ulva; five artificial compound feeds: the liquid Fryfood® (Waterlife), a powder of Mytilus, yeast, soya and Spirulina, respectively; and a mixed diet consisting of Ulva and Fryfood. The life cycle parameters (mortality, sex ratio, generation time, offspring production) were measured, and the demographic variables [mean generation time (T), net reproductive rate (Ro), and intrinsic rate of natural increase (rm)] were determined. As to their efficiency regarding population dynamics, the diets ranked as follows: (1) Ulva+Fryfood, (2), Ulva, (3) Fryfood, (4) Mytilus, (5) soya, (6) yeast, and (7) Spirulina. In this order they cause a progressive increase of both larval mortality and generation time, a progressive decrease of sex ratio, number of offspring per egg sac, number of egg sacs per female and, consequently, of Ro and rm. The observed differences between diets were most pronounced with respect to offspring production. Of the compound diets, those containing animal extracts were more efficient than those containing vegetable materials. Ulva plays an important role in the nutrition of T. holothuriae, favouring offspring production as well as larval survival, development and pigmentation. Ulva in combination with Fryfood led to a greater copepodid survival and offspring production. This mixed diet proved to be the most favourable for rearing the Greek population of t. holothuriae, resulting in an efficient intrinsic rate of natural increase (rm=0.304) of the population.

  15. To Swim or Not to Swim: Potential Transmission of Balaenophilus manatorum (Copepoda: Harpacticoida in Marine Turtles.

    Directory of Open Access Journals (Sweden)

    Francesc Domènech

    Full Text Available Species of Balaenophilus are the only harpacticoid copepods that exhibit a widespread, obligate association with vertebrates, i.e., B. unisetus with whales and B. manatorum with marine turtles and manatees. In the western Mediterranean, juveniles of the loggerhead sea turtle, Caretta caretta are the only available hosts for B. manatorum, which has been found occurring at high prevalence (>80% on them. A key question is how these epibionts are transmitted from host to host. We investigated this issue based on experiments with live specimens of B. manatorum that were cultured with turtle skin. Specimens were obtained from head-started hatchlings of C. caretta from the western Mediterranean. Hatched nauplii crawled only on rough substrates and lacked the ability to swim. Only copepodites IV and V, and adults, were able to perform directional swimming. Legs 2, 3 and 4 played a major role in swimming and were only well-developed in these stages. Nauplii reared in wells with turtle skin readily fed on this item. Late copepodites and adults also fed on turtle skin but did not consume other potential food items such as fish skin, baleen plates or planktonic algae. Evidences suggest that the transmission of B. manatorum should rely on hosts' bodily contacts and/or swimming of late developmental stages between spatially close hosts. The possibility of long-ranged dispersal is unlikely for two reasons. First, all developmental stages seem to depend on turtle skin as a food resource. Second, the average clutch size of ovigerous females was small (< 70 eggs for free-living phases to successfully contact turtles that occur at very low densities (< 0.6 turtles·km-2 in the western Mediterranean. The high prevalence of B. manatorum in loggerhead turtles in this area raises the question whether these turtles have contacts, or tend to closely aggregate, more than is currently believed.

  16. Molecular phylogeny of Oncaeidae (Copepoda using nuclear ribosomal internal transcribed spacer (ITS rDNA.

    Directory of Open Access Journals (Sweden)

    Iole Di Capua

    Full Text Available Copepods belonging to the Oncaeidae family are commonly and abundantly found in marine zooplankton. In the Mediterranean Sea, forty-seven oncaeid species occur, of which eleven in the Gulf of Naples. In this Gulf, several Oncaea species were morphologically analysed and described at the end of the XIX century by W. Giesbrecht. In the same area, oncaeids are being investigated over seasonal and inter-annual scales at the long-term coastal station LTER-MC. In the present work, we identified six oncaeid species using the nuclear ribosomal internal transcribed spacers (ITS rDNA and the mitochondrial cytochrome c oxidase subunit I (mtCOI. Phylogenetic analyses based on these two genomic regions validated the sisterhood of the genera Triconia and the Oncaea sensu stricto. ITS1 and ITS2 phylogenies produced incongruent results about the position of Oncaea curta, calling for further investigations on this species. We also characterised the ITS2 region by secondary structure predictions and found that all the sequences analysed presented the distinct eukaryotic hallmarks. A Compensatory Base Change search corroborated the close relationship between O. venusta and O. curta and between O. media and O. venusta already identified by ITS phylogenies. The present results, which stem from the integration of molecular and morphological taxonomy, represent an encouraging step towards an improved knowledge of copepod biodiversity: The two complementary approaches, when applied to long-term copepod monitoring, will also help to better understanding their genetic variations and ecological niches of co-occurring species.

  17. First record of small tropical calanoid copepod Parvocalanus crassirostris (Copepoda, Calanoida, Paracalanidae in the Adriatic Sea

    Directory of Open Access Journals (Sweden)

    O. VIDJAK

    2016-09-01

    Full Text Available In December 2014 the adult females and copepodites of alien paracalanid copepod Parvocalanus crassirostris were identified in the Central Adriatic port of Šibenik. The most probable transmission vector for this small copepod were ballast waters from the cargo ships that are regularly discharged at these locations. This paper is focused on P. crassirostris morphology and the state of population in the port of Šibenik. The possible path of introduction of Parvocalanus crassirostris into the Adriatic Sea is also discussed.

  18. First record of the Asian diaptomid Neodiaptomus schmackeri (Poppe & Richard, 1892 (Crustacea: Copepoda: Calanoida in Europe

    Directory of Open Access Journals (Sweden)

    Giuseppe Alfonso

    2014-06-01

    Full Text Available Albania, as well as a great part of the Balkan area in general, still suffers a lack of environmental studies especially in limnological research. The Dumre plateau, in Central Albania, is characterized by an extraordinary high number of karst lakes in a small geographic area. Despite their environmental peculiarity, very few biological data are to date available for these lakes, none on the zooplankton. For this reason, 15 water bodies located in the central area of the plateau were selected for a preliminary limnological survey carried out in the years 2008-2011. Neodiaptomus schmackeri (Poppe & Richard, 1892, a diaptomid calanoid copepod characterized by a South-Eastern Palearctic - Oriental distribution, and the most widely spread Neodiaptomus species in Asia, was found in 8 lakes of the Dumre area. This finding represents the first record of the species, and of the entire genus Neodiaptomus, for Europe. Several environmental variables were measured to characterize the lakes, and the co-occurring planktonic crustaceans were also identified. Taxonomical drawings and descriptions of the main morphological features of both sexes are herein provided in order to compare the Albanian populations of N. schmackeri with those of the native distribution area of the species. The possible causes which determined the occurrence of this non-indigenous species in several Dumre lakes are discussed.

  19. .i.Moraria brevipes./i. (Crustacea: Copepoda) in South Bohemian forest soils

    Czech Academy of Sciences Publication Activity Database

    Háněl, Ladislav; Christian, E.

    2004-01-01

    Roč. 68, - (2004), s. 169-171 ISSN 1211-376X R&D Projects: GA ČR(CZ) GA206/99/1416 Institutional research plan: CEZ:AV0Z6066911 Keywords : forest floor * spruce * Crustacea Subject RIV: EH - Ecology, Behaviour

  20. A new genus of Cletopsyllidae (Copepoda, Harpacticoida from Gulf of Mexico

    Directory of Open Access Journals (Sweden)

    Hyun Woo Bang

    2014-03-01

    Full Text Available A new genus and new species of the family Cletopsyllidae Huys & Willems, 1989 from deep-sea sediment in the Gulf of Mexico, are reported and fully described and illustrated. The new genus Pentacletopsyllus (type species: P. montagni sp. n. can be distinguished from the four known genera of the family by antennule segmentation, length ratio of first and second endopodal segments of P1, and armature pattern on P5 exopod. It also differs from its sister genera by the rostrum being bifid at the tip, third segment of the female antennulea smooth posterior margin, the baseoendopod of P5 with biarticulate outer setophore bearing basal seta, and female caudal rami without lobate expansion. A revised key to species of the family Cletopsyllidae Huys & Willems, 1989 is provided.

  1. Euryphorus suarezi n. sp. (Copepoda: Caligidae) parasitic on an elasmobranch from the Gulf of Mexico.

    Science.gov (United States)

    Morales-Serna, Francisco Neptalí; Rodríguez-Santiago, María Amparo; Gómez, Samuel

    2016-01-01

    Currently, the caligid genus Euryphorus Milne Edwards, 1840 contains two valid species. A new species, Euryphorus suarezi, is described based on adult females and males collected from the spotted eagle ray Aetobatus narinari (Euphrasen) (Elasmobranchii: Myliobatidae), captured off Campeche and Tabasco, Mexico (southern coast of the Gulf of Mexico). The new species is mainly distinguished from its congeners by the absence of dorsal plates, the presence of postantennal process, bifurcated maxillule, maxilliped with slender corpus, and leg 4 with 3-segmented endopod. Leg 6 is conspicuous in the male. Additional differences are described. This is the first record of a species of Euryphorus from an elasmobranch host, which may provide insight into the evolutionary relationships within the Caligidae.

  2. Cyclopidae (Crustacea, Copepoda from the upper Paraná River floodplain, Brazil

    Directory of Open Access Journals (Sweden)

    F. A. LANSAC-TÔHA

    Full Text Available Cyclopid copepods from samples of fauna associated with aquatic macrophytes and plancton obtained in lotic and lentic environments were obtained from the upper Paraná River floodplain (in the states of Paraná and Mato Grosso do Sul, Brazil. Macrophytes were collected in homogeneous stands and washed. Plankton samples, taken from the water column surface and bottom, were obtained using a motor pump, with a 70 mum mesh plankton net for filtration. Twelve taxa of Cyclopidae were identified. Among them, Macrocyclops albidus albidus, Paracyclops chiltoni, Ectocyclops rubescens, Homocyclops ater, Eucyclops solitarius, Mesocyclops longisetus curvatus, Mesocyclops ogunnus, and Microcyclops finitimus were new finds for this floodplain. Eight species were recorded exclusively in aquatic macrophyte samples. Among these species, M. albidus albidus and M. finitimus presented greatest abundances. Only four species were recorded in plankton samples, and Thermocyclops minutus and Thermocyclops decipiens are limited to this type of habitat. Among these four species, T. minutus is the most abundant, especially in lentic habitats.

  3. Cyclopidae (Crustacea, Copepoda from the upper Paraná River floodplain, Brazil

    Directory of Open Access Journals (Sweden)

    LANSAC-TÔHA F. A.

    2002-01-01

    Full Text Available Cyclopid copepods from samples of fauna associated with aquatic macrophytes and plancton obtained in lotic and lentic environments were obtained from the upper Paraná River floodplain (in the states of Paraná and Mato Grosso do Sul, Brazil. Macrophytes were collected in homogeneous stands and washed. Plankton samples, taken from the water column surface and bottom, were obtained using a motor pump, with a 70 mum mesh plankton net for filtration. Twelve taxa of Cyclopidae were identified. Among them, Macrocyclops albidus albidus, Paracyclops chiltoni, Ectocyclops rubescens, Homocyclops ater, Eucyclops solitarius, Mesocyclops longisetus curvatus, Mesocyclops ogunnus, and Microcyclops finitimus were new finds for this floodplain. Eight species were recorded exclusively in aquatic macrophyte samples. Among these species, M. albidus albidus and M. finitimus presented greatest abundances. Only four species were recorded in plankton samples, and Thermocyclops minutus and Thermocyclops decipiens are limited to this type of habitat. Among these four species, T. minutus is the most abundant, especially in lentic habitats.

  4. Cyclopidae (Crustacea, Copepoda) from the upper Paraná River floodplain, Brazil.

    Science.gov (United States)

    Lansac-Tôha, F A; Velho, L F M; Higuti, J; Takahashi, E M

    2002-02-01

    Cyclopid copepods from samples of fauna associated with aquatic macrophytes and plancton obtained in lotic and lentic environments were obtained from the upper Paraná River floodplain (in the states of Paraná and Mato Grosso do Sul, Brazil). Macrophytes were collected in homogeneous stands and washed. Plankton samples, taken from the water column surface and bottom, were obtained using a motor pump, with a 70 microns mesh plankton net for filtration. Twelve taxa of Cyclopidae were identified. Among them, Macrocyclops albidus albidus, Paracyclops chiltoni, Ectocyclops rubescens, Homocyclops ater, Eucyclops solitarius, Mesocyclops longisetus curvatus, Mesocyclops ogunnus, and Microcyclops finitimus were new finds for this floodplain. Eight species were recorded exclusively in aquatic macrophyte samples. Among these species, M. albidus albidus and M. finitimus presented greatest abundances. Only four species were recorded in plankton samples, and Thermocyclops minutus and Thermocyclops decipiens are limited to this type of habitat. Among these four species, T. minutus is the most abundant, especially in lentic habitats.

  5. Distribution and role of the genus Oithona (Copepoda: Cyclopoida in the South China Sea

    Directory of Open Access Journals (Sweden)

    Lianggen Wang

    2017-07-01

    Full Text Available The relationships between the small cyclopoid copepod Oithona and hydrological factors, phytoplankton and ichthyoplankton were evaluated using the data obtained in the central South China Sea (SCS in summer 2014. The genus abundance ranged from 6.00 ind. m−3 to 93.75 ind. m−3 with high abundance band occurring in the branch of SCS Monsoon Jet. The lower temperature and higher salinity in the surface water of the band than other zones indicated that deep water intrusion was a positive factor for aggregation of the genus. The community structure of the genus was dominated by Oithona plumifera and Oithona similis made up 97% of the genus abundance associated with Oithona tenuis. The result of db-RDA analysis showed that the community structure of the genus was affected by temperature, Chl a, larval fishes and fish spawns, and temperature was the most important limiting factor. The result of GAMs analysis showed that abundance of O. tenuis, and copepodites were affected by Chl a, larval fishes and fish spawns; abundance of O. similis was affected by Chl a and fish spawns; and abundance of O. plumifera was affected by Chl a and larval fishes. Therefore, we suggest that the branch of SCS Monsoon Jet and deep water intrusion favor aggregation of plankton in the central SCS in summer. We confirm that the temperature is the limiting factor to the reproduction of the genus Oithona in tropic seas and the genus Oithona is a food-web linker between primary production and larval fishes in the central SCS.

  6. Size as indicator of origin of salmon lice Lepeophtheirus salmonis (Copepoda: Caligidae)

    NARCIS (Netherlands)

    Nordhagen, J.R.; Heuch, P.A.; Schram, T.A.

    2000-01-01

    Salmon lice Lepeophtheirus salmonis (Krøyer, 1837) from farmed Atlantic salmon have been implicated in the drastic sea trout and salmon stock declines found in Ireland and Norway. Can salmon lice from farmed and wild fish be distinguished? The hypothesis has been advanced that the treatment of

  7. Ecology of Pleuromamma indica Wolfenden (Copepoda - Calanoida) in the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Saraswathy, M.; Iyer, H.K.

    , strong oxygen minimum above 500m depth and a wide range of salinity varying from 32 x 10-3 in Bay of Bengal to more than 37 x 10 -3 in the northern Arabian Sea were characteristics of the study area. P. indica showed a positive correlation with salinity...

  8. Life cycle of Epischura baicalensis Sars (Copepoda, Calanoida) in Lake Baikal

    Science.gov (United States)

    Afanasyeva, E. L.

    1998-06-01

    Epischura baicalensis Sars is a dominant pelagic species of Lake Baikal zooplankton. This is endemic to Lake Baikal and inhabits the entire water column. It produces two generations per year: the winter-spring and the summer. These copepods develop under different ecological conditions and vary in the duration of life stages, reproduction time, maturation of sex products and adult males and females lifespan. The total life period of the animals from each generation is one year. One female can produce 10 egg sacks every 10-20 days during its life time. The ratio of males and females is 1:1. One of the most essential features of the ecology of E. baicalensis is the alteration of its mass inhabited areas during a year, as well as in day time. This is due to the need for various conditions for gonad maturation, reproduction, nourishing and protection from being consumed by planktivors.

  9. Distribution of Pleuromamma (Copepoda: Metridiidae) along a north-south transect in the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Goswami, S.C.; Gajbhiye, S.N.; Padmavati, G.

    . quadrungulata, P. piseki and P. borealis were observed. There was a gradual increase in species number from northern latitudes towards subtropical convergence (35 degrees to 40 degrees S). The region between 10 degrees N and 10 degrees S lat. was congenial...

  10. Bathymetric distribution of Pleuromamma (Copepoda, Calanoida) species in the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Jayalakshmy, K.V.

    pronounced prediction of the total abundance of the Pleuromamma species. Diversity function H (s), in relation to latitude was a bell-shaped normal curve. H (s) was linearly related to evenness index, e, and was perfectly sloping up line. These relations were...

  11. Seasonal variability of planktonic copepods (Copepoda: Crustacea in a tropical estuarine region in Brazil

    Directory of Open Access Journals (Sweden)

    Cristina de Oliveira Dias

    2009-12-01

    Full Text Available The Caravelas River estuary and adjacent coastal region were studied during the rainy and dry seasons of 2003-2004 to assess the copepod community structure. Abiotic and biotic parameters were measured, and the total density, frequency and percentage of copepod taxa were determined for each sampling period. Copepod densities showed significant differences between sampling periods, with higher densities in the rainy seasons (Mean: 90,941.80 ind.m-3; S.D.: 26,364.79. The sampling stations located to the north and south, in the coastal region adjacent to the Caravelas River estuary presented the lowest copepod density values. The copepod assemblage was composed mainly of estuarine and estuarine/coastal copepods. The seasonal variations in temperature and salinity influenced the abundance of species during the rainy and dry seasons, with the following dominant species alternating: Paracalanus quasimodo Bowman, 1971 in the rainy season of 2003, Parvocalanus crassirostris Dahl, 1894 in the dry season of 2003 and Acartia lilljeborgii Giesbrecht, 1892 in the rainy and dry seasons of 2004. Non-parametric multidimensional scaling indicated differences in copepod assemblages between sampling periods, but not between sampling stations.

  12. A model for studying isolation mechanisms in parasite populations: the genus Lepeophtheirus (Copepoda, Caligidae).

    Science.gov (United States)

    De Meeus, T; Renaud, F; Gabrion, C

    1990-05-01

    In the Mediterranean, the parasitic copepod Lepeophtheirus thompsoni Baird, 1850 specifically infests turbot (Psetta maxima L., 1758), whereas L. europaensis Zeddam, Berrebi, Renaud, Raibaut, and Gabrion, 1988 infests brill (Scophthalmus rhombus L., 1758) and flounder (Platichthys flesus L., 1758). Experimental infestation of turbot by copepods from each of the three fish species showed an absence of any physiological incompatibility preventing natural development of the two parasite species, at least on one host species, i.e., the turbot. Moreover, interspecific hybrids were obtained experimentally, which implies that 1) there is no strict genetic barrier between the two species and 2) the natural prezygotic isolation results from a choice of the most favorable habitat. We discuss the origin and possible consequences of the presence, in the Mediterranean, of L. europaensis on brill and flounder, two hosts separated by their taxonomic status and ecobiology.

  13. Mating behaviour of Pseudodiaptomus annandalei (Copepoda Calanoida) with emphasis on rejection rate

    Science.gov (United States)

    Dur, G.; Souissi, S.; Schmitt, F. G.; Hwang, J. S.; Cheng, S. H.

    2009-04-01

    Mating behaviour has important consequences at both individual and population levels. Reproductive fitness is of paramount importance to sustain the success of planktonic copepod populations in aquatic environments. The calanoid copepod Pseudodiaptomus annandalei has one of the largest geographical ranges for Indo-Pacific Pseudodiaptomidae. It is also of great importance in fish culture pounds south of Taiwan. However, the mating behavior of this species has never been studied. Mating and predatory behaviour are conceptually the same. In both cases, the encounter and the interactions occur between two individuals with opposite characteristics: predator-prey for predation; male-female for mating. The mating behaviour may be defined as a sequence of encounter, pursuit, capture and copulation. Several observed behaviour suggest that both sexes asses and choose among available mates before the copulation. Pre-copulatory mate choice in copepods may manifest as mate guarding where males attached to CV females until their final moult, complicated pre-copulatory dance and escaping. During our preliminary observations, we notice that P. annandalei females escape by shaking, often violently, the males that have caught them. Consequently for such a species the act of mating may be visualized as a chain of six events (i.e. search, encounter, pursuit, capture, selective dance, copulation).Within this chain, encounter, capture and copulation are conditional events depending on the successful conclusion of their preceding events in the chain. In this study, we examined the different step in the mating behaviour of the scarcely studied sub-tropical copepod, Pseudodiaptomus annandalei, collected from the Danshuei estuary (North Taiwan). The individuals were observed using a 3D optical system to obtain simultaneous front and side views. Males, when placed in the water where females had previously swum in, showed significant increase of their swimming velocities. Additionally, their swimming trajectories are more convoluted, indicating that males explore larger volume of fluid to increase the probability to encounter a female. The mate finding behaviour appears to depend not only on chemical signal but also on hydromechanical signals. Some males exhibited shifts of direction when females were passing by. When male intercepted a chemical trail left by a female, they initiate tracking behaviour racing up the trail with increasing speed. Males pursued pheromone trails up to 24 sec old and 10 mm long. Most studies of mating behaviour have focused on detection and sometimes pursuit, but few have addressed the other components of successful mating, namely, capture and copulation. Moreover, mate choice issue has largely been ignored in regards to pelagic copepods. Consequently very few are known about the plasticity of rejection rates as a function of mate encounter rates. The second aim of this experiment is to describe the process used by female to select their mate and to fill the gap in the quantification of mating success. Once caught by a male, P. annandalei's females entered in intensive dance which sometimes lead to shake off the males suggesting a female mate choice. The three-dimensional trajectories described by the couple during this event were characterized by fast loops and intense jumps. Individual's access to mates may be affected by operational sex ratios, causing strong variation in mating success. We finally manipulated adult sex ratios of the brackish copepod P. annandalei, to examine the influence of population sex ratio on mating success of P. annandalei in a final set of experiment concluding the investigation. It should be notice that, to our knowledge, it the first quantification ever done before. The plasticity of rejection rate was therefore investigated as a function of sex-ratio and mate encounter rate. The encounter rate reached maximum value for balanced proportion of male and female and decreased as the sex ratio unbalanced. Higher value of success was nevertheless observed for a pro-male sex-ratio.

  14. Native Argentinean cyclopoids (Crustacea: Copepoda as predators of Aedes aegypti and Culex pipiens (Diptera: Culicidae mosquitoes

    Directory of Open Access Journals (Sweden)

    María C Tranchida

    2009-12-01

    Full Text Available Copepods from La Plata, Argentina were investigated to characterize the local community of larvivorous copepods inhabiting mosquito breeding sites and to identify new predator species of the mosquitoes which occur in artificial containers, Aedes aegypti and Culex pipiens. Diversity of larvivorous cyclopoids was highest in permanent pools. Predation by sex and age, selectivity on mosquito species, and daily predation rate during five days were studied for Acanthocyclops robustus, Diacyclops uruguayensis, Macrocyclops albidus and Mesocyclops longisetus. Female copepods presented the highest predatory capacity. No predatory preference for mosquito species was found. According to overall predation potential, copepods were ranked as follows: D. uruguayensis Se hizo una prospección de copépodos en La Plata, Argentina, con los objetivos de caracterizar la comunidad local de copépodos larvívoros en sitios de cría de mosquitos, e identificar nuevas especies depredadoras de los mosquitos de contenedores artificiales Aedes aegypti y Culex pipiens. La diversidad de ciclopoides larvívoros fue máxima en charcos permanentes. Se examinó la depredación por sexos y edad, la selectividad por especies de mosquito, y la tasa de depredación diaria durante cinco días en Acanthocyclops robustus, Diacyclops uruguayensis, Macrocyclops albidus y Mesocyclops longisetus. Los copépodos hembra presentaron la capacidad depredadora más alta. No se encontró preferencia por alguna especie de mosquito. De acuerdo al potencial de depredación en general, los copépodos se ordenan así: D. uruguayensis < A. robustus < M. albidus < M. longisetus. También se evaluó la tolerancia a la desecación del hábitat y la capacidad de resistir en agua de contenedores artificiales. D. uruguayensis y A. robustus sobrevivieron en condiciones de sequía, pero D. uruguayensis presentó menor supervivencia en agua de floreros de cementerio. M. albidus no sobrevivió condiciones de sequía y no toleró el agua extraída de contenedores artificiales. Los ciclopoides neotropicales D. uruguayensis and A. robustus son buenos candidatos y merecen investigación ulterior como agentes de control biológico de mosquitos.

  15. Redescription of Pseudodiaptomus jonesi (Copepoda: Calanoida) with notes on its distribution

    Digital Repository Service at National Institute of Oceanography (India)

    Madhupratap, M.; Haridas, P.

    Pseudodiaptomus jonesi Pillai 1970 is redescribed; several previously undescribed features are included and a few errors in the original description corrected. This species is assignable to the Ramosus group and Hickmani-subgroup. The present record...

  16. The distribution of exocrine glands in Lepeophtheirus salmonis and Caligus elongatus (Copepoda: Caligidae)

    NARCIS (Netherlands)

    Bell, S.; Bron, J.E.; Sommerville, C.

    2000-01-01

    The morphology, function and distribution of exocrine glands of copepods have rarely been studied in detail and almost nothing is known about them in the sea lice species L. salmonis and C. elongatus. This study utilised a novel application of a light-microscopy staining technique to reveal a

  17. Exocrine glands of Lepeophtheirus salmonis (Copepoda: Caligidae): Distribution, developmental appearance, and site of secretion.

    Science.gov (United States)

    Øvergård, Aina-Cathrine; Hamre, Lars A; Harasimczuk, Ewa; Dalvin, Sussie; Nilsen, Frank; Grotmol, Sindre

    2016-12-01

    Exocrine glands of blood-feeding parasitic copepods are believed to be important in host immune response modulation and inhibition of host blood coagulation, but also in the production of substances for integument lubrication and antifouling. In this study, we aimed to characterize the distribution of different types of salmon louse (Lepeophtheirus salmonis) exocrine glands and their site of secretion. The developmental appearance of each gland type was mapped and genes specifically expressed by glands were identified. Three types of tegumental (teg 1-3) glands and one labial gland type were found. The first glands to appear during development were teg 1 and teg 2 glands. They have ducts extending both dorsally and ventrally suggested to be important in lubricating the integument. Teg 1 glands were found to express two astacin metallopeptidases and a gene with fibronectin II domains, while teg 2 glands express a heme peroxidase. The labial glands were first identified in planktonic copepodids, with reservoirs that allows for storage of glandular products. The last gland type to appear during development was named teg 3 and was not seen before the preadult I stage when the lice become more virulent. Teg 3 glands have ducts ending ventrally at the host-parasite contact area, and may secrete substances important for the salmon lice virulence. Salmon lice teg 3 and labial glands are thus likely to be especially important in the host-parasite interaction. Proteins secreted from the salmon louse glands to its salmonid host skin or blood represents a potential interface where the host immune system can meet and elicit effective responses to sea lice antigens. The present study thus represents a fundamental basis for further functional studies and identification of possible vaccine candidates. J. Morphol. 277:1616-1630, 2016. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  18. A new species of Acartia (Copepoda, Calanoida) from Cochin Harbour, India, and adjacent areas

    Digital Repository Service at National Institute of Oceanography (India)

    Abraham, S.

    During the course of a study of the family Acartiidae of Cochin harbour and its neighbourhood, a species of Acartia different from all other known species of Acartia, was found. Its characteristics, habitat and seasonal distribution form the theme...

  19. A subclass of HER1 ligands are prognostic markers for survival in bladder cancer patients

    DEFF Research Database (Denmark)

    Thøgersen, Helle-Merete Vissing; Sørensen, B S; Poulsen, S S

    2001-01-01

    Members of the epidermal growth factor (EGF) family have been suggested as prognostic markers in patients with bladder cancer. Thus far, there has been no consensus on their usefulness. We report an analysis of six ligands and two receptors of which a subset correlate to tumor stage and survival...... of the EGF family, especially EPI, may be potential bladder tumor markers....

  20. Imaging-based surrogate markers of transcriptome subclasses and signatures in hepatocellular carcinoma. Preliminary results

    International Nuclear Information System (INIS)

    Taouli, Bachir; Hoshida, Yujin; Chen, Xintong; Sun, Xiaochen; Kojima, Kensuke; Toffanin, Sara; Hirschfield, Hadassa; Kakite, Suguru; Tan, Poh Seng; Kihira, Shingo; Fiel, M.I.; Wagner, Mathilde; Llovet, Josep M.

    2017-01-01

    In this preliminary study, we examined whether imaging-based phenotypes are associated with reported predictive gene signatures in hepatocellular carcinoma (HCC). Thirty-eight patients (M/F 30/8, mean age 61 years) who underwent pre-operative CT or MR imaging before surgery as well as transcriptome profiling were included in this IRB-approved single-centre retrospective study. Eleven qualitative and four quantitative imaging traits (size, enhancement ratios, wash-out ratio, tumour-to-liver contrast ratios) were assessed by three observers and were correlated with 13 previously reported HCC gene signatures using logistic regression analysis. Thirty-nine HCC tumours (mean size 5.7 ± 3.2 cm) were assessed. Significant positive associations were observed between certain imaging traits and gene signatures of aggressive HCC phenotype (G3-Boyault, Proliferation-Chiang profiles, CK19-Villanueva, S1/S2-Hoshida) with odds ratios ranging from 4.44-12.73 (P <0.045). Infiltrative pattern at imaging was significantly associated with signatures of microvascular invasion and aggressive phenotype. Significant but weak associations were also observed between each enhancement ratio and tumour-to-liver contrast ratios and certain gene expression profiles. This preliminary study demonstrates a correlation between phenotypic imaging traits with gene signatures of aggressive HCC, which warrants further prospective validation to establish imaging-based surrogate markers of molecular phenotypes in HCC. (orig.)

  1. Imaging-based surrogate markers of transcriptome subclasses and signatures in hepatocellular carcinoma. Preliminary results

    Energy Technology Data Exchange (ETDEWEB)

    Taouli, Bachir [Icahn School of Medicine at Mount Sinai, Department of Radiology, New York, NY (United States); Icahn School of Medicine at Mount Sinai, Translational and Molecular Imaging Institute, New York, NY (United States); Icahn School of Medicine at Mount Sinai, Liver Cancer Program, Tisch Cancer Institute, New York, NY (United States); Hoshida, Yujin; Chen, Xintong; Sun, Xiaochen; Kojima, Kensuke; Toffanin, Sara; Hirschfield, Hadassa [Icahn School of Medicine at Mount Sinai, Liver Cancer Program, Tisch Cancer Institute, New York, NY (United States); Icahn School of Medicine at Mount Sinai, Division of Liver Diseases, Department of Medicine, New York, NY (United States); Kakite, Suguru [Icahn School of Medicine at Mount Sinai, Translational and Molecular Imaging Institute, New York, NY (United States); Tottori University, Division of Radiology, Department of Pathophysiological and Therapeutic Science, Faculty of Medicine, Yonago City (Japan); Tan, Poh Seng [Icahn School of Medicine at Mount Sinai, Liver Cancer Program, Tisch Cancer Institute, New York, NY (United States); Icahn School of Medicine at Mount Sinai, Division of Liver Diseases, Department of Medicine, New York, NY (United States); National University Health System, Division of Gastroenterology and Hepatology, University Medicine Cluster, Singapore (Singapore); Kihira, Shingo [Icahn School of Medicine at Mount Sinai, Department of Radiology, New York, NY (United States); Fiel, M.I. [Icahn School of Medicine at Mount Sinai, Department of Pathology, New York, NY (United States); Wagner, Mathilde [Icahn School of Medicine at Mount Sinai, Translational and Molecular Imaging Institute, New York, NY (United States); Sorbonne Universites, UPMC, Department of Radiology, Hopital Pitie-Salpetriere, Paris (France); Llovet, Josep M. [Icahn School of Medicine at Mount Sinai, Liver Cancer Program, Tisch Cancer Institute, New York, NY (United States); Icahn School of Medicine at Mount Sinai, Division of Liver Diseases, Department of Medicine, New York, NY (United States); Universitat de Barcelona, HCC Translational Research Laboratory, Barcelona-Clinic Liver Cancer Group Institut d' Investigacions Biomediques August Pi i Sunyer (IDIBAPS), Hospital Clinic de Barcelona, Barcelona (Spain); Institucio Catalana de Recerca i Estudis Avancats, Barcelona (Spain)

    2017-11-15

    In this preliminary study, we examined whether imaging-based phenotypes are associated with reported predictive gene signatures in hepatocellular carcinoma (HCC). Thirty-eight patients (M/F 30/8, mean age 61 years) who underwent pre-operative CT or MR imaging before surgery as well as transcriptome profiling were included in this IRB-approved single-centre retrospective study. Eleven qualitative and four quantitative imaging traits (size, enhancement ratios, wash-out ratio, tumour-to-liver contrast ratios) were assessed by three observers and were correlated with 13 previously reported HCC gene signatures using logistic regression analysis. Thirty-nine HCC tumours (mean size 5.7 ± 3.2 cm) were assessed. Significant positive associations were observed between certain imaging traits and gene signatures of aggressive HCC phenotype (G3-Boyault, Proliferation-Chiang profiles, CK19-Villanueva, S1/S2-Hoshida) with odds ratios ranging from 4.44-12.73 (P <0.045). Infiltrative pattern at imaging was significantly associated with signatures of microvascular invasion and aggressive phenotype. Significant but weak associations were also observed between each enhancement ratio and tumour-to-liver contrast ratios and certain gene expression profiles. This preliminary study demonstrates a correlation between phenotypic imaging traits with gene signatures of aggressive HCC, which warrants further prospective validation to establish imaging-based surrogate markers of molecular phenotypes in HCC. (orig.)

  2. Correlation of circulating CD133+ progenitor subclasses with a mild phenotype in Duchenne muscular dystrophy patients.

    Directory of Open Access Journals (Sweden)

    Chiara Marchesi

    2008-05-01

    Full Text Available Various prognostic serum and cellular markers have been identified for many diseases, such as cardiovascular diseases and tumor pathologies. Here we assessed whether the levels of certain stem cells may predict the progression of Duchenne muscular dystrophy (DMD.The levels of several subpopulations of circulating stem cells expressing the CD133 antigen were determined by flow cytometry in 70 DMD patients. The correlation between the levels and clinical status was assessed by statistical analysis. The median (+/-SD age of the population was 10.66+/-3.81 (range 3 to 20 years. The levels of CD133+CXCR4+CD34- stem cells were significantly higher in DMD patients compared to healthy controls (mean+/-standard deviation: 17.38+/-1.38 vs. 11.0+/-1.70; P = 0.03 with a tendency towards decreased levels in older patients. Moreover, the levels of this subpopulation of cells correlated with the clinical condition. In a subgroup of 19 DMD patients after 24 months of follow-up, increased levels of CD133+CXCR4+CD34- cells was shown to be associated with a phenotype characterised by slower disease progression. The circulating CD133+CXCR4+CD34- cells in patients from different ages did not exhibit significant differences in their myogenic and endothelial in vitro differentiation capacity.Our results suggest that levels of CD133+CXCR4+CD34- could function as a new prognostic clinical marker for the progression of DMD.

  3. Architectural protein subclasses shape 3-D organization of genomes during lineage commitment

    Science.gov (United States)

    Phillips-Cremins, Jennifer E.; Sauria, Michael E. G.; Sanyal, Amartya; Gerasimova, Tatiana I.; Lajoie, Bryan R.; Bell, Joshua S. K.; Ong, Chin-Tong; Hookway, Tracy A.; Guo, Changying; Sun, Yuhua; Bland, Michael J.; Wagstaff, William; Dalton, Stephen; McDevitt, Todd C.; Sen, Ranjan; Dekker, Job; Taylor, James; Corces, Victor G.

    2013-01-01

    Summary Understanding the topological configurations of chromatin may reveal valuable insights into how the genome and epigenome act in concert to control cell fate during development. Here we generate high-resolution architecture maps across seven genomic loci in embryonic stem cells and neural progenitor cells. We observe a hierarchy of 3-D interactions that undergo marked reorganization at the sub-Mb scale during differentiation. Distinct combinations of CTCF, Mediator, and cohesin show widespread enrichment in looping interactions at different length scales. CTCF/cohesin anchor long-range constitutive interactions that form the topological basis for invariant sub-domains. Conversely, Mediator/cohesin together with pioneer factors bridge shortrange enhancer-promoter interactions within and between larger sub-domains. Knockdown of Smc1 or Med12 in ES cells results in disruption of spatial architecture and down-regulation of genes found in cohesin-mediated interactions. We conclude that cell type-specific chromatin organization occurs at the sub-Mb scale and that architectural proteins shape the genome in hierarchical length scales. PMID:23706625

  4. Ovarian antral follicle subclasses and anti-mullerian hormone during normal reproductive aging

    DEFF Research Database (Denmark)

    Bentzen, J G; Forman, J L; Johannsen, T H

    2013-01-01

    CONTEXT: The interindividual variation in the age-related decline of ovarian follicles is wide. Hence, it is important to identify reliable, sensitive, and specific markers to assess the ovarian reserve of the individual woman. OBJECTIVE: The aim of this study was to characterize the relation bet...

  5. On a new subclass of bi-univalent functions satisfying subordinate conditions

    Directory of Open Access Journals (Sweden)

    Altınkaya Şahsene

    2015-10-01

    Full Text Available In the present investigation, we find estimates on the coefficients |a2| and |a3| for functions in the function class SΣ (λ,φ . The results presented in this paper improve or generalize the recent work of Magesh and Yamini

  6. Ethnic differences in lipoprotein subclasses in obese adolescents: importance of liver and intraabdominal fat accretion.

    LENUS (Irish Health Repository)

    D'Adamo, Ebe

    2010-09-01

    Recently, the deleterious metabolic effects of visceral fat [visceral adipose tissue (VAT)] deposition were challenged, and liver fat emerged as having a key independent role in the modulation of cardiometabolic risk factors.

  7. Dopamine neurons projecting to the posterior striatum form an anatomically distinct subclass

    Science.gov (United States)

    Menegas, William; Bergan, Joseph F; Ogawa, Sachie K; Isogai, Yoh; Umadevi Venkataraju, Kannan; Osten, Pavel; Uchida, Naoshige; Watabe-Uchida, Mitsuko

    2015-01-01

    Combining rabies-virus tracing, optical clearing (CLARITY), and whole-brain light-sheet imaging, we mapped the monosynaptic inputs to midbrain dopamine neurons projecting to different targets (different parts of the striatum, cortex, amygdala, etc) in mice. We found that most populations of dopamine neurons receive a similar set of inputs rather than forming strong reciprocal connections with their target areas. A common feature among most populations of dopamine neurons was the existence of dense ‘clusters’ of inputs within the ventral striatum. However, we found that dopamine neurons projecting to the posterior striatum were outliers, receiving relatively few inputs from the ventral striatum and instead receiving more inputs from the globus pallidus, subthalamic nucleus, and zona incerta. These results lay a foundation for understanding the input/output structure of the midbrain dopamine circuit and demonstrate that dopamine neurons projecting to the posterior striatum constitute a unique class of dopamine neurons regulated by different inputs. DOI: http://dx.doi.org/10.7554/eLife.10032.001 PMID:26322384

  8. Proposal for a novel management of indeterminate thyroid nodules on the basis of cytopathological subclasses.

    Science.gov (United States)

    Rossi, Martina; Lupo, Sabrina; Rossi, Roberta; Franceschetti, Paola; Trasforini, Giorgio; Bruni, Stefania; Tagliati, Federico; Buratto, Mattia; Lanza, Giovanni; Damiani, Luca; Degli Uberti, Ettore; Zatelli, Maria Chiara

    2017-07-01

    Indeterminate thyroid nodules include heterogeneous lesions that could benefit from a differential management. Our aim is to better define the management of the Bethesda System for Reporting Thyroid Cytopathology class III and IV nodules, by identifying cytological subcategories among Bethesda System for Reporting Thyroid Cytopathology class III associated with different clinical risk, by means of ultrasound, repeated FNAB, and BRAFV600E molecular analysis. We also evaluated the outcome of nodules not operated, over a 5-year follow-up. Out of 460 nodules (269 Bethesda System for Reporting Thyroid Cytopathology class III and 191 Bethesda System for Reporting Thyroid Cytopathology class IV), 344 were operated on surgical group and 116 followed-up conservatively (follow-up group). Bethesda System for Reporting Thyroid Cytopathology class III was divided into four subcategories on the basis of cytomorphological features (III-1, III-2, III-3, III-4). Clinical risk was defined on the basis of histological, cytological, and ultrasound data. Malignancy was higher in Bethesda System for Reporting Thyroid Cytopathology class III vs. Bethesda System for Reporting Thyroid Cytopathology class IV (34.4 vs. 26.2 %; p management of Bethesda System for Reporting Thyroid Cytopathology III and IV classes and related subcategories: surgery may be indicated in Bethesda System for Reporting Thyroid Cytopathology class III-1, III-4, and IV; a conservative follow-up avoiding repeated FNAB may be appropriated in class III-3, while repeated FNAB may be useful in class III-2.

  9. Discovery of a new subclass of alpha-conotoxins in the venom of Conus australis

    Digital Repository Service at National Institute of Oceanography (India)

    Lebbe, E; Peigneur, S.; Maiti, M.; Mille, B.G.; Prabhadevi; Ravichandran, S.; Lescrinier, E; Waelkens, E; DeSouza, L.; Herdewijn, P.; Tytgat, J.

    -conotoxin family. We purified the venom of a yet unexplored cone snail species, i.e. Conus australis, and we isolated a 16-amino acid peptide named alpha-conotoxin AusIA. The peptide has the typical alpha-conotoxin CC-Xm-C-Xn-C framework...

  10. Human IgG subclass antibodies to the 19 kilodalton carboxy ...

    African Journals Online (AJOL)

    IgG2 or IgG4 antibodies were virtually nonexistent. The cross-reactivity between the 4 sequence variants (E-KNG, E-TSR, Q-KNG and. Q-TSR) of MSP119 was confirmed; however, a minority of sera preferentially recognised the KNG but not the TSR variants. All 33 P. falciparum isolates from different parts ofm Uganda

  11. A Peculiar Subclass of Type Ia Supernovae a.k.a. Type Iax

    Science.gov (United States)

    Singh, Mridweeka; Misra, Kuntal; Sahu, Devendra Kumar; Dastidar, Raya; Gangopadhyay, Anjasha; Bose, Subhash; Srivastav, Shubham; Anapuma, Gadiyara Chakrapani; Chakradhari, Nand Kumar; Kumar, Brajesh; Kumar, Brijesh; Pandey, Shashi Bhushan

    2018-04-01

    We present optical photometric (upto ˜ 410 days since Bmax) and spectroscopic (upto ˜ 235 days since Bmax) observations of a type Iax supernova SN 2014dt located in M61. The broad band light curves follow a linear decline up to ˜ 100 days after which a significant flattening is seen in the late-time (beyond 150 days) light curves of SN 2014dt. SN 2014dt best matches the light curve evolution of SN 2005hk and reaches a peak magnitude of MB˜ -18.12±0.04 with ?m15˜ 1.35±0.06 mag. The earliest spectrum at ˜ 23 days is dominated by FeII and CoII lines with the absence of the Si II 6150 Å line. Using the peak bolometric luminosity we estimate a 56Ni mass of 0.14 M⊙ in the case of SN 2005hk and the striking similarity between SN 2014dt and SN 2005hk implies that a comparable amount of 56Ni would have been synthesized in the explosion of SN 2014dt. There are several explosion scenarios proposed for these peculiar events. Being one of the brightest and closest SN! , SN 2014dt is an ideal candidate for long term monitoring. Late phase observations are very essential to understand the progenitor system and the actual explosion scenario for these events.

  12. Transitions between subclasses of bullying and victimization when entering middle school.

    Science.gov (United States)

    Williford, Anne; Boulton, Aaron J; Jenson, Jeffrey M

    2014-01-01

    We examined the effects of depressive symptoms, antisocial attitudes, and perspective-taking empathy on patterns of bullying and victimization during the transition from late elementary (4th grade to 5th grade) to middle school (6th grade) among 1,077 students who participated in the Youth Matters (YM) bullying prevention trial. Latent transition analysis was used to establish classes of bullying, victimization, bully-victimization, and uninvolvement. The intervention had a positive impact on children as they moved from elementary to middle school. More students in the YM group transitioned from the involved statuses to the uninvolved status than students in the control group during the move to middle school. Elementary school bullies with higher levels of depressive symptoms were less likely than other students to move to an uninvolved status in the first year of middle school. Students who held greater antisocial attitudes were more likely to be a member of the bully-victim status than the uninvolved status during the move to middle school. Perspective-taking empathy, however, was not a significant predictor of status change during the transition to middle school. Implications for school-based prevention programs during the move to middle school are noted. © 2013 Wiley Periodicals, Inc.

  13. Growth of chitinolytic dune soil ß-subclass Proteobacteria in response to invading fungal hyphae

    NARCIS (Netherlands)

    De Boer, W.; Klein Gunnewiek, P.J.A.; Kowalchuk, G.A.; Van Veen, J.A.

    2001-01-01

    It has frequently been reported that chitinolytic soil bacteria, in particular biocontrol strains, can lyse living fungal hyphae, thereby releasing potential growth substrate. However, the conditions used in such assays (high bacterial density, rich media, fragmented hyphae) make it difficult to

  14. MicroRNA-Mediated Dynamic Bidirectional Shift between the Subclasses of Glioblastoma Stem-like Cells

    Directory of Open Access Journals (Sweden)

    Arun K. Rooj

    2017-06-01

    Full Text Available Large-scale transcriptomic profiling of glioblastoma (GBM into subtypes has provided remarkable insight into the pathobiology and heterogeneous nature of this disease. The mechanisms of speciation and inter-subtype transitions of these molecular subtypes require better characterization to facilitate the development of subtype-specific targeting strategies. The deregulation of microRNA expression among GBM subtypes and their subtype-specific targeting mechanisms are poorly understood. To reveal the underlying basis of microRNA-driven complex subpopulation dynamics within the heterogeneous intra-tumoral ecosystem, we characterized the expression of the subtype-enriched microRNA-128 (miR-128 in transcriptionally and phenotypically diverse subpopulations of patient-derived glioblastoma stem-like cells. Because microRNAs are capable of re-arranging the molecular landscape in a cell-type-specific manner, we argue that alterations in miR-128 levels are a potent mechanism of bidirectional transitions between GBM subpopulations, resulting in intermediate hybrid stages and emphasizing highly intricate intra-tumoral networking.

  15. ABCD2 identifies a subclass of peroxisomes in mouse adipose tissue

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Xiaoxi, E-mail: xiaoxi.liu@uky.edu; Liu, Jingjing, E-mail: jingjing.liu0@gmail.com; Lester, Joshua D., E-mail: joshua.lester@uky.edu; Pijut, Sonja S., E-mail: srhee2@uky.edu; Graf, Gregory A., E-mail: Gregory.Graf@uky.edu

    2015-01-02

    Highlights: • We examined the D2 localization and the proteome of D2-containing compartment in mouse adipose tissue. • We confirmed the presence of D2 on a subcellular compartment that has typical structure as a microperoxisome. • We demonstrated the scarcity of peroxisome markers on D2-containing compartment. • The D2-containing compartment may be a subpopulation of peroxisome in mouse adipose tissue. • Proteomic data suggests potential association between D2-containing compartment and mitochondria and ER. - Abstract: ATP-binding cassette transporter D2 (D2) is an ABC half transporter that is thought to promote the transport of very long-chain fatty acyl-CoAs into peroxisomes. Both D2 and peroxisomes increase during adipogenesis. Although peroxisomes are essential to both catabolic and anabolic lipid metabolism, their function, and that of D2, in adipose tissues remain largely unknown. Here, we investigated the D2 localization and the proteome of D2-containing organelles, in adipose tissue. Centrifugation of mouse adipose homogenates generated a fraction enriched with D2, but deficient in peroxisome markers including catalase, PEX19, and ABCD3 (D3). Electron microscopic imaging of this fraction confirmed the presence of D2 protein on an organelle with a dense matrix and a diameter of ∼200 nm, the typical structure and size of a microperoxisome. D2 and PEX19 antibodies recognized distinct structures in mouse adipose. Immunoisolation of the D2-containing compartment confirmed the scarcity of PEX19 and proteomic profiling revealed the presence of proteins associated with peroxisome, endoplasmic reticulum (ER), and mitochondria. D2 is localized to a distinct class of peroxisomes that lack many peroxisome proteins, and may associate physically with mitochondria and the ER.

  16. The Biopharmaceutics Classification System: subclasses for in vivo predictive dissolution (IPD) methodology and IVIVC.

    Science.gov (United States)

    Tsume, Yasuhiro; Mudie, Deanna M; Langguth, Peter; Amidon, Greg E; Amidon, Gordon L

    2014-06-16

    The Biopharmaceutics Classification System (BCS) has found widespread utility in drug discovery, product development and drug product regulatory sciences. The classification scheme captures the two most significant factors influencing oral drug absorption; solubility and intestinal permeability and it has proven to be a very useful and a widely accepted starting point for drug product development and drug product regulation. The mechanistic base of the BCS approach has, no doubt, contributed to its wide spread acceptance and utility. Nevertheless, underneath the simplicity of BCS are many detailed complexities, both in vitro and in vivo which must be evaluated and investigated for any given drug and drug product. In this manuscript we propose a simple extension of the BCS classes to include sub-specification of acid (a), base (b) and neutral (c) for classes II and IV. Sub-classification for Classes I and III (high solubility drugs as currently defined) is generally not needed except perhaps in border line solubility cases. It is well known that the , pKa physical property of a drug (API) has a significant impact on the aqueous solubility dissolution of drug from the drug product both in vitro and in vivo for BCS Class II and IV acids and bases, and is the basis, we propose for a sub-classification extension of the original BCS classification. This BCS sub-classification is particularly important for in vivo predictive dissolution methodology development due to the complex and variable in vivo environment in the gastrointestinal tract, with its changing pH, buffer capacity, luminal volume, surfactant luminal conditions, permeability profile along the gastrointestinal tract and variable transit and fasted and fed states. We believe this sub-classification is a step toward developing a more science-based mechanistic in vivo predictive dissolution (IPD) methodology. Such a dissolution methodology can be used by development scientists to assess the likelihood of a formulation and dosage form functioning as desired in humans, can be optimized along with parallel human pharmacokinetic studies to set a dissolution methodology for Quality by Design (QbD) and in vitro-in vivo correlations (IVIVC) and ultimately can be used as a basis for a dissolution standard that will ensure continued in vivo product performance. Copyright © 2014 Elsevier B.V. All rights reserved.

  17. The rise of a novel classification system for endometrial carcinoma; integration of molecular subclasses.

    Science.gov (United States)

    McAlpine, Jessica; Leon-Castillo, Alicia; Bosse, Tjalling

    2018-04-01

    Endometrial cancer is a clinically heterogeneous disease and it is becoming increasingly clear that this heterogeneity may be a function of the diversity of the underlying molecular alterations. Recent large-scale genomic studies have revealed that endometrial cancer can be divided into at least four distinct molecular subtypes, with well-described underlying genomic aberrations. These subtypes can be reliably delineated and carry significant prognostic as well as predictive information; embracing and incorporating them into clinical practice is thus attractive. The road towards the integration of molecular features into current classification systems is not without obstacles. Collaborative studies engaging research teams from across the world are working to define pragmatic assays, improve risk stratification systems by combining molecular features and traditional clinicopathological parameters, and determine how molecular classification can be optimally utilized to direct patient care. Pathologists and clinicians caring for women with endometrial cancer need to engage with and understand the possibilities and limitations of this new approach, because integration of molecular classification of endometrial cancers is anticipated to become an essential part of gynaecological pathology practice. This review will describe the challenges in current systems of endometrial carcinoma classification, the evolution of new molecular technologies that define prognostically distinct molecular subtypes, and potential applications of molecular classification as a step towards precision medicine and refining care for individuals with the most common gynaecological cancer in the developed world. Copyright © 2018 Pathological Society of Great Britain and Ireland. Published by John Wiley & Sons, Ltd. Copyright © 2018 Pathological Society of Great Britain and Ireland. Published by John Wiley & Sons, Ltd.

  18. Sucessão de invertebrados durante o processo de decomposição de duas plantas aquáticas (Eichhornia azurea e Polygonum ferrugineum - DOI: 10.4025/actascibiolsci.v28i2.1017 Succession of invertebrates during the decomposition process of two aquatic plants (Eichhornia azurea and Polygonum ferrugineum - DOI: 10.4025/actascibiolsci.v28i2.1017

    Directory of Open Access Journals (Sweden)

    Alexandre Monkolski

    2006-03-01

    Full Text Available A colonização de invertebrados durante o período de 56 dias de decomposição de duas espécies de plantas aquáticas (Eichhornia azurea e Polygonum ferrugineum foi investigada para determinar o papel de macroinvertebrados no processo de fragmentação da folha. Durante a análise do material, foi constatado um total de 2096 invertebrados, associados a E.azurea e 6154 invertebrados associados a P. ferrugineum, identificados dentro de 18 táxons, com predominância de larvas de Diptera da família Chironomidae, seguido por espécimes de Oligochaeta, microcrustáceos como Cladocera e Copepoda. Em ambas as plantas, os macroinvertebrados mostraram um aumento significativo de densidade ao longo do processo de decomposição, o que provavelmente está associado à perda de compostos fenólicos. Os resultados sugerem que as espécies de macrófitas apresentam associações específicas com seus consumidores, ou seja, o processo de sucessão da colonização torna-se diferenciado de acordo com as características fenológicas da planta.The invertebrate colonization was investigated during 56-day decomposition of two macrophytes species (Eichhornia azurea and Polygonum ferrugineum. The aim was to determine the role of macroinvertebrates in the process of leaf fragmentation. During material analysis, 2096 invertebrates were associated with E.azurea and 6154 were associated with P. ferrugineum, identified in 18 taxons, with predominance of Diptera larvae (Chironomidae family specially, followed by Oligochaeta species and microcrustaceans such as Cladocera and Copepoda. In both macrophytes the macroinvertebrates showed a significant increase of density through the process of decomposition, which is probably associated with the loss of phenolic compounds. Results suggest that macrophytes specimens show specific associations with their consumers, i.e., the succession process of colonization becomes singular according to the phenolic characteristics of the

  19. Morphometric differences in two calanoid sibling species, Boeckella gracilipes and B. titicacae (Crustacea, Copepoda Diferencias morfométricas en dos especies hermanas Boeckella gracilipes y Boeckella titicacae (Crustacea, Copepoda

    Directory of Open Access Journals (Sweden)

    Patricio De los Ríos Escalante

    2012-12-01

    Full Text Available Calanoid copepods are abundant in South American inland waters and include widespread species, such as Boeckella gracilipes (Daday, 1902, which occurs from the Ecuador to Tierra del Fuego Island. This species occurs under various environmental conditions, and is found in oligotrophic lakes in Patagonia (39-54°S and in shallow mountain lakes north of 39°S. The aim of the present study is to conduct a morphometric comparison of male specimens of B. titicacae collected in Titicaca and B. gracilipes collected in Riñihue lakes, with a third population of B. gracilipes collected in shallow ponds in Salar de Surire. Titicaca and Riñihue lakes are stable environments, whereas Salar de Surire is an extreme environment. These ponds present an extreme environment due to high exposure to solar radiation and high salinity levels. The results of the study revealed differences among the three populations. These results agree well with systematic descriptions in the literature on differences between the populations of Titicaca and Riñihue lakes, and population of Salar de Surire differs slightly from the other two populations. It is probable that the differences between the population of Salar de Surire and the other two populations result from the extreme environment in Salar de Surire. High exposure to solar radiation, high salinity and extreme variations in temperature enhance genetic variations that are consequently expressed in morphology.Los copépodos calanoideos son abundantes en aguas continentales sudamericanas e incluyen especies de amplia distribución geográfica como Boeckella gracilipes (Daday, 1902 que se encuentra desde Ecuador hasta la isla de Tierra del Fuego. Esta especie vive bajo varias condiciones ambientales, y se encuentra en lagos oligotróficos en la Patagonia (39-54°S y en lagunas superficiales de montaña al norte de los 39°S. El objetivo del presente trabajo es realizar un estudio comparativo morfométrico de machos de B. titicacae colectado en el lago Titicaca y B. gracilipes colectado en el lago Riñihue, ambos son ambientes estables, con una tercera población colectada en lagunas superficiales en el Salar de Surire. Estas lagunas tienen condiciones ambientales extremas debido a alta exposición a la radiación solar y altos niveles de salinidad. Los resultados del presente estudio encontraron diferencias entre las tres poblaciones. Estos resultados concordarían con las descripciones sistemáticas en la literatura sobre las diferencias de las poblaciones de los lagos Titicaca y Riñihue, y la población del salar de Surire tuvo leves diferencias respecto a las dos poblaciones anteriores. Es probable que las diferencias entre la población del Salar de Surire y las otras dos se deban a alta exposición a la radiación solar, salinidad y condiciones extremas de temperatura que acelera las diferencias genéticas las que se expresan en diferencias morfológicas.

  20. Perulernaea gamitanae (Copepoda: Lernaeidae parasitizing tambaqui (Colossoma macropomum (Characidae and the hybrids tambacu and tambatinga, cultured in northern Brazil

    Directory of Open Access Journals (Sweden)

    M. Tavares-Dias

    2011-08-01

    Full Text Available The infestation rate in Colossoma macropomum, hybrid tambacu (C. macropomum x Piaractus mesopotamicus and hybrid tambatinga (C. macropomum x Piaractus brachypomum with Perulernaea gamitanae Thatcher and Paredes, 1985 from two fish farms in Amapá State, Brazil was studied. Lernaeid parasites (n=2887 were collected mainly on the tongue and the mouth cavity and also on cartilage of gill arches and filaments. Inflammation and fibrous nodules were observed on the attachment sites of the parasites. The infestation rate varied according to the fish farm and host. The prevalence of P. gamitanae was of 100% in hosts from one fish farm and was lower in the other fish farm. Higher intensity of P. gamitanae occurred in hybrids tambacu and tambatinga, but despite the high prevalence its intensity was moderate. This is the first report on epidemiology of P. gamitanae in cultured fishes from Brazilian Amazonia, and the occurrence of this crustacean parasite in two new hosts, the hybrids tambacu and tambatinga.

  1. A new species of Cletocamptus Schmankewitsch, 1875 (Crustacea, Copepoda, Harpacticoida from a high altitude saline lake in Central Mexico

    Directory of Open Access Journals (Sweden)

    Eduardo Suarez Morales

    2013-04-01

    Full Text Available During the analysis of littoral samples collected from a high-altitude saline crater lake in Central Mexico, several female and male specimens of harpacticoid copepods were recovered and taxonomically examined. They were found to represent an undescribed species of the canthocamptid genus Cletocamptus Schmankewitsch, 1875. The new species, C. gomezi n. sp. is described herein based on specimens of both sexes. It resembles C. stimpsoni Gómez, Fleeger, Rocha-Olivares and Foltz, 2004 from Louisiana but also C. trichotus Kiefer, 1929. The new species differs from C. stimpsoni and from other congeners by details of the maxillular armature, the setation of the endopodal segments of legs 2 and 3, and the armature of the third exopodal segment of legs 3 and 4. Also, the dorsal (VII and the outer (IV caudal setae are both relatively shorter than in C. stimpsoni. This is the second species of the genus known to be distributed in Mexico. The occurrence of the new species in a high-altitude saline lake, the isolation of the type locality, and its absence from adjacent freshwater lakes suggest that this species is endemic to this site.

  2. Occurrence of Cymbasoma longispinosum Bourne, 1890 (Copepoda: Monstrilloida in the Curuçá River estuary (Amazon Littoral

    Directory of Open Access Journals (Sweden)

    Natália R. Leite

    2010-09-01

    Full Text Available The present work was carried out to verify the occurrence and distribution of Cymbasoma longispinosum Bourne, 1890 in a tropical Amazon estuary from North Brazil. Samplings were performed bimonthly from July/2003 to July/2004 at two different transects (Muriá and Curuçá rivers situated along the Curuçá estuary (Pará, North Brazil. Samples were collected during neap tides via gentle (1 to 1.5 knots 200 μm-mesh net tows from a small boat. Additional subsurface water samples were collected for the determination of environmental parameters. Males and females of Cymbasoma longispinosum were only observed during September and November/2003. The highest number of organisms was found in September/2003 at the Muriá River transect. The presence of C. longispinosum in samples obtained during September and November/2003 could probably be related to the reproductive period of this species in the studied estuary, which is directly related to the dry period in the region. The highest salinity values and the highest number of individuals observed in September/2003 corroborate with the previous assumption, since no C. longispinosum was found during the months comprising the rainy period (January to June.O presente trabalho foi desenvolvido para verificar a ocorrência e distribuição de Cymbasoma longispinosum Bourne, 1890 em um estuário tropical amazônico da região norte do Brasil. As coletas foram realizadas bimestralmente de julho/2003 a julho/2004 em dois diferentes transectos (rios Muriá e Curuçá situados ao longo do estuário do Curuçá (Pará, Norte do Brasil. Amostras foram coletadas durante marés de quadratura por intermédio de arrastos com redes de plâncton de 200μm de abertura de malha, através de um pequeno barco a motor (1 a 1,5 knots. Amostras adicionais de água subsuperficial foram coletadas para determinação dos parâmetros ambientais. Machos e fêmeas de C. longispinosum foram observados apenas durante os meses de setembro e novembro/2003. O maior número de organismos foi encontrado em setembro/2003, no transecto do rio Muriá. A presença de C. longispinosum nas amostras obtidas durante setembro e novembro/2003 poderia estar provavelmente relacionada ao período reprodutivo desta espécie no estuário estudado, o qual está diretamente relacionado ao período seco na região. Os mais elevados valores de salinidade, bem como os elevados números de indivíduos observados no mês de setembro/2003 confirmam a suposição anterior, visto que nenhum indivíduo de C. longispinosum foi registrado durante os meses que incluem o período chuvoso (janeiro a junho.

  3. Ergasilus trygonophilus sp. nov. (Copepoda: Ergasilidae a branchial parasite of freshwater stingrays (Potamotrygonidae from state of Pará, Brazil

    Directory of Open Access Journals (Sweden)

    Marcus V. Domingues

    2010-10-01

    Full Text Available Ergasilus trygonophilus sp. nov. is described from freshwater stingrays (Potamotrygon spp. and Plesiotrygon iwamae Rosa, Castello & Thorson, 1987 from the state of Pará, Brazil. The new species differs from all known species of Ergasilus Nordman, 1832 from Brazilian waters by possessing: (1 an elongate bullet-shaped cephalosome; (2 antennule setal formula 1: 10: 4: 4: 2 + 1 ae: 6 + 1 ae; (3 maxillule bearing two distal setae; and (4 terminal endopodal segment of leg 1 with rosette-like array of blunt spinules. This is the first species of a freshwater stingray Ergasilus reported from Brazil.

  4. A new species of Harpacticella Sars, 1908 (Copepoda, Harpacticoida, from a tidal pool on Jeju Island, Korea

    Directory of Open Access Journals (Sweden)

    Seunghan Lee

    2014-10-01

    Full Text Available A new species of the genus Harpacticella Sars, 1908 is described from a tidal pool on Jeju Island, Korea. Harpacticella jejuensis sp. n. is closely related to H. itoi Chang & Kim, 1991, with regard to the structure of P1 exp-1 and enp-1, the length of P1 exp-1 and exp-2, and the setal number of the P5 exopod in males. However, the new species is clearly distinguishable from H. itoi by the combined following characters: six setae on the P5 exopod in females, one naked seta on the inner margin of P1 exp-2, the short endopod of P1 compared to the exopod, and a naked long seta on the proximal inner margin of the P5 exopod of males. The mtCOI partial sequence is provided as a DNA barcode for the new species.

  5. Overlooked cryptic endemism in copepods: systematics and natural history of the calanoid subgenus Occidodiaptomus Borutzky 1991 (Copepoda, Calanoida, Diaptomidae).

    Science.gov (United States)

    Marrone, Federico; Lo Brutto, Sabrina; Hundsdoerfer, Anna K; Arculeo, Marco

    2013-01-01

    Our comprehension of the phylogeny and diversity of most inland-water crustaceans is currently hampered by their pronounced morphological bradytely, which contributed to the affirmation of the "Cosmopolitanism Paradigm" of freshwater taxa. However, growing evidence of the existence of cryptic diversity and molecular regionalism is available for calanoid copepods, thus stressing the need for careful morphological and molecular studies in order to soundly investigate the systematics, diversity and distribution patterns of the group. Diaptomid copepods were here chosen as model taxa, and the morphological and molecular diversity of the species belonging to the west-Mediterranean diaptomid subgenus Occidodiaptomus were investigated with the aim of comparing the patterns of morphological and molecular evolution in freshwater copepods. Three species currently lumped under the binomen Hemidiaptomus (Occidodiaptomus) ingens and two highly divergent clades within H. (O.) roubaui were distinguished, thus showing an apparent discordance between the molecular distances recorded and Occidodiaptomus morphological homogeneity, and highlighting a noteworthy decoupling between the morphological and molecular diversity in the subgenus. Current Occidodiaptomus diversity pattern is ascribed to a combined effect of ancient vicariance and recent dispersal events. It is stressed that the lack of sound calibration points for the molecular clock makes it difficult to soundly temporally frame the diversification events of interest in the taxon studied, and thus to asses the role of morphological bradytely and of accelerated molecular evolutionary rates in shaping the current diversity of the group. Copyright © 2012 Elsevier Inc. All rights reserved.

  6. Sensitivity of the marine benthic copepod Tisbe biminiensis (copepoda, harpacticoida to potassium dichromate and sediment particle size

    Directory of Open Access Journals (Sweden)

    Cristiane M. V. Araújo-Castro

    2009-03-01

    Full Text Available For the future use of the marine benthic copepod Tisbe biminiensis in solid-phase sediment toxicological bioassays, the present study investigated the effect of muddy sediment from the Maracaípe estuary (northeastern Brazil, sediment particle size and the reference toxicant potassium dichromate on the species. Muddy sediment from Maracaípe can be used as control sediment, since it does not interfere in the copepod life-cycle and has metal contamination levels that are unlikely to produce any detrimental biological effects on benthic invertebrates. Neither survival nor fecundity was affected by grain size, suggesting that this species can be used with any kind of sediment from muddy to sandy. The sensitivity of T. biminiensis to K2Cr2O7 in acute tests was similar to that of other organisms. The LC50 (lethal concentration to 50% of the test organisms medium values for T. biminiensis were 7.51, 4.68 and 3.19 mg L-1 for Cr in 48, 72 and 96 h, respectively. These results suggest that T. biminiensis is a promising organism for use in solid-phase sediment toxicity assessments.Visando o uso futuro do copépodo marinho bentônico Tisbe biminiensis em bioensaios toxicológicos de sedimentos na fase sólida, o presente estudo investigou o efeito do sedimento lamoso do estuário de Maracaípe (Nordeste do Brasil. Foram considerados a granolometria e o tóxico de referência dicromato de potássio sobre a espécie. O sedimento lamoso de Maracaípe pode ser usado como controle, uma vez que não interfere no ciclo de vida do copépodo e possui níveis de contaminação de metais que não causariam efeitos biológicos em invertebrados bentônicos. Nem a sobrevivência ou fecundidade foi afetada pelo tamanho do grão, sugerindo que esta espécie pode ser usada com qualquer tipo de sedimento, de lama a areia. A sensibilidade de T. biminiensis ao K2Cr2O7 em testes agudos foi similar a de outros organismos. Os valores de CL50 (concentração letal a 50% dos organismos para T. biminiensis foram em média 7,51, 4,68 e 3,19 mg L-1 para o Cr em 48, 72 e 96h, respectivamente. Estes resultados sugerem que T. biminiensis é um organismo promissor para uso em avaliações de toxicidade com a fase sólida do sedimento.

  7. New records of Ergasilus (Copepoda: Ergasilidae) in the Laurentian Great Lakes, including a lakewide review of records and host associations

    Science.gov (United States)

    Hudson, Patrick L.; Bowen, Charles A.; Stedman, Ralph M.

    1994-01-01

    Ergasilus nerkae was found infecting ninespine stickleback (Pungitius pungitius) in lakes Huron, Michigan, and Superior and threespine stickleback (Gasterosteus aculeatus) and round whitefish (Prosopium cylindraceum) in Lake Huron. Based upon the literature and study of archived material, we propose that E. nerkae is enzootic to the Great Lakes and that ninespine stickleback are a preferred host in Lake Huron. Prevalence of E. nerkae on ninespine stickleback increased from 17% in June to 68% in September, but mean intensity remained light. Prevalence and mean intensity increased with host length. Ergasilus luciopercarum is also reported on lake trout (Salvelinus namaycush) and largemouth bass (Micropterus salmoides) for the first time. Host-parasite records of Ergasilus spp. in North America are reviewed, biology and taxonomy are summarized, and a checklist of Great Lakes host-parasite-locality records is provided. At present, eight species of Ergasilus are known to infect 42 Great Lakes fish species.

  8. A new culture system for in situ observation of the growth and development of Eucyclops serrulatus (Copepoda: Cyclopoida)

    Science.gov (United States)

    Park, Sung-Hee; Chang, Cheon-Young

    2005-01-01

    A practical and convenient method of rearing Eucyclops serrulatus in a microculture environment is described. A complete life cycle of E. serrulatus was maintained in a narrow space on a microscope slide glass on which a cover glass of 22 x 40 mm in size was mounted at a height of 0.8 mm. The culture medium was constituted by bottled mineral water boiled with grains of Glycine max (soybean). Chilomonas paramecium, a free-living protozoan organism, was provided as live food. Growth of nauplii hatched from eggs to the first stage of copepodite took an average of 7.7 days, and the growth of copepodite 1 to the egg-bearing adult female took an average of 20.1 days in the microculture cell with an average life time of 44.7 days. Continuous passage of copepods was successfully maintained as long as sufficient medium and food were provided. The microculture method enables an in situ microscopic observation on the growth and developmental process of helminth larvae experimentally infected to copepods as well as of copepod itself. Furthermore, it does not require anesthetization and, therefore, minimize the amount of stress exposed to copepods during the handling process. PMID:16340303

  9. Toxicity of antifouling biocides to the intertidal harpacticoid copepod Tigriopus japonicus (Crustacea, Copepoda): Effects of temperature and salinity

    International Nuclear Information System (INIS)

    Kwok, K.W.H.; Leung, K.M.Y.

    2005-01-01

    Intertidal harpacticoid copepods are commonly used in eco-toxicity tests worldwide. They predominately live in mid-high shore rock pools and often experience a wide range of temperature and salinity fluctuation. Most eco-toxicity tests are conducted at fixed temperature and salinity and thus the influence of these environmental factors on chemical toxicity is largely unknown. This study investigated the combined effect of temperature and salinity on the acute toxicity of the copepod Tigriopus japonicus against two common biocides, copper (Cu) and tributyltin (TBT) using a 2 x 3 x 4 factorial design (i.e. two temperatures: 25 and 35 o C; three salinities: 15.0 per mille , 34.5 per mille and 45.0 per mille ; three levels of the biocide plus a control). Copper sulphate and tributyltin chloride were used as the test chemicals while distilled water and acetone were utilised as solvents for Cu and TBT respectively. 96h-LC50s of Cu and TBT were 1024 and 0.149 μg l -1 respectively (at 25 o C; 34.5 per mille ) and, based on these results, nominal biocide concentrations of LC0 (i.e. control), LC30, LC50 and LC70 were employed. Analysis of Covariance using 'concentration' as the covariate and both 'temperature' and 'salinity' as fixed factors, showed a significant interaction between temperature and salinity effects for Cu, mortality increasing with temperature but decreasing with elevated salinity. A similar result was revealed for TBT. Both temperature and salinity are, therefore, important factors affecting the results of acute eco-toxicity tests using these marine copepods. We recommend that such eco-toxicity tests should be conducted at a range of environmentally realistic temperature/salinity regimes, as this will enhance the sensitivity of the test and improve the safety margin in line with the precautionary principle

  10. Toxicity of antifouling biocides to the intertidal harpacticoid copepod Tigriopus japonicus (Crustacea, Copepoda): Effects of temperature and salinity

    Energy Technology Data Exchange (ETDEWEB)

    Kwok, K.W.H. [Swire Institute of Marine Science, Department of Ecology and Biodiversity, University of Hong Kong, Pokfulam, Hong Kong (China); Leung, K.M.Y. [Swire Institute of Marine Science, Department of Ecology and Biodiversity, University of Hong Kong, Pokfulam, Hong Kong (China)]. E-mail: kmyleung@hkucc.hku.hk

    2005-07-01

    Intertidal harpacticoid copepods are commonly used in eco-toxicity tests worldwide. They predominately live in mid-high shore rock pools and often experience a wide range of temperature and salinity fluctuation. Most eco-toxicity tests are conducted at fixed temperature and salinity and thus the influence of these environmental factors on chemical toxicity is largely unknown. This study investigated the combined effect of temperature and salinity on the acute toxicity of the copepod Tigriopus japonicus against two common biocides, copper (Cu) and tributyltin (TBT) using a 2 x 3 x 4 factorial design (i.e. two temperatures: 25 and 35 {sup o}C; three salinities: 15.0 per mille , 34.5 per mille and 45.0 per mille ; three levels of the biocide plus a control). Copper sulphate and tributyltin chloride were used as the test chemicals while distilled water and acetone were utilised as solvents for Cu and TBT respectively. 96h-LC50s of Cu and TBT were 1024 and 0.149 {mu}g l{sup -1} respectively (at 25 {sup o}C; 34.5 per mille ) and, based on these results, nominal biocide concentrations of LC0 (i.e. control), LC30, LC50 and LC70 were employed. Analysis of Covariance using 'concentration' as the covariate and both 'temperature' and 'salinity' as fixed factors, showed a significant interaction between temperature and salinity effects for Cu, mortality increasing with temperature but decreasing with elevated salinity. A similar result was revealed for TBT. Both temperature and salinity are, therefore, important factors affecting the results of acute eco-toxicity tests using these marine copepods. We recommend that such eco-toxicity tests should be conducted at a range of environmentally realistic temperature/salinity regimes, as this will enhance the sensitivity of the test and improve the safety margin in line with the precautionary principle.

  11. A new genus and species of cyclopoid (Crustacea, Copepoda, Cyclopinidae) from a coastal system in the Gulf of Mexico

    Science.gov (United States)

    Suárez-Morales, Eduardo; Almeyda-Artigas, Roberto Javier

    2015-01-01

    Abstract A new, monotypic genus of the interstitial marine cyclopoid copepod family Cyclopinidae G.O. Sars, 1913 is described from male and female specimens collected at Laguna de Términos, a large coastal lagoon system in the southern Gulf of Mexico. Mexiclopina campechana gen. et sp. n. cannot be adequately placed in any extant genus within the family. It differs from other cyclopinid genera in having a unique combination of characters including: 1) absence of modified brush-like seta on the mandibular exopod; 2) maxillule exopod with stout setal elements and brush-like setae absent; 3) basis of mandible with one seta; 4) presence of a modified seta on endopod of fourth leg; 5) fifth leg exopod unsegmented, armed with three elements in the female and five in the male; 6) intercoxal sclerite of first swimming leg with two medial spiniform processes on distal margin. The new genus is monotypic and appears to be most closely related to Cyclopina Claus, 1863 and Heptnerina Ivanenko & Defaye, 2004; the new species was compared with species of Cyclopina and it resembles Cyclopina americana Herbst, 1982 and Cyclopina caissara Lotufo, 1994. This is the second record of a species of Cyclopinidae in Mexico and the first in the Gulf of Mexico; the number of cyclopinid species recorded from the Americas is now 13. PMID:26668545

  12. A new species of Mastigodiaptomus Light, 1939 from Mexico, with notes of species diversity of the genus (Copepoda, Calanoida, Diaptomidae

    Directory of Open Access Journals (Sweden)

    Martha Angélica Gutiérrez-Aguirre

    2016-11-01

    Full Text Available A new species of the genus Mastigodiaptomus Light, 1939, named Mastigodiaptomus cuneatus sp. n. was found in a freshwater system in the City of Mazatlán, in the northern region of Mexico. Morphologically, the females of this new species are distinguishable from those of its congeners by the following combination of features: the right distal corner of the genital double-somite and second urosomite have a wedge-shaped projection, the fourth urosomite has no dorsal projection and its integument is smooth. The males are distinct by the following features: the right caudal ramus has a wedge-shaped structure at the disto-ventral inner corner; the basis of the right fifth leg has one triangular and one rounded projection at the distal and proximal margins, respectively, plus one hyaline membrane on the caudal surface close to the inner margin; the aculeus length is almost the width of the right second exopod (Exp2; and the frontal and caudal surfaces of the right Exp2 are smooth. Furthermore, the analysis of the COI gene of M. cuneatus sp. n. has revealed that M. albuquerquensis (Herrick, 1895 is its nearest congener, with 18.64% of genetic distance. A key for the identification of the known species of the genus is provided.

  13. A new species of Mastigodiaptomus Light, 1939 from Mexico, with notes of species diversity of the genus (Copepoda, Calanoida, Diaptomidae)

    Science.gov (United States)

    Gutiérrez-Aguirre, Martha Angélica; Cervantes-Martínez, Adrián

    2016-01-01

    Abstract A new species of the genus Mastigodiaptomus Light, 1939, named Mastigodiaptomus cuneatus sp. n. was found in a freshwater system in the City of Mazatlán, in the northern region of Mexico. Morphologically, the females of this new species are distinguishable from those of its congeners by the following combination of features: the right distal corner of the genital double-somite and second urosomite have a wedge-shaped projection, the fourth urosomite has no dorsal projection and its integument is smooth. The males are distinct by the following features: the right caudal ramus has a wedge-shaped structure at the disto-ventral inner corner; the basis of the right fifth leg has one triangular and one rounded projection at the distal and proximal margins, respectively, plus one hyaline membrane on the caudal surface close to the inner margin; the aculeus length is almost the width of the right second exopod (Exp2); and the frontal and caudal surfaces of the right Exp2 are smooth. Furthermore, the analysis of the COI gene of Mastigodiaptomus cuneatus sp. n. has revealed that Mastigodiaptomus albuquerquensis (Herrick, 1895) is its nearest congener, with 18.64% of genetic distance. A key for the identification of the known species of the genus is provided. PMID:28138275

  14. A new species of Halicyclops (Copepoda, Cyclopoida, Cyclopidae) from a lagoon system of the Caribbean coast of Colombia

    Science.gov (United States)

    Suárez-Morales, Eduardo; Fuentes-Reinés, Juan M.

    2014-01-01

    Abstract Plankton samples obtained from the lagoon system Laguna Navío Quebrado, in northern Colombia, yielded male and female specimens of an undescribed cyclopoid copepod of the genus Halicyclops. The new species belongs to the highly diverse and widely distributed thermophilus-complex. It closely resembles Halicyclops clarkei Herbst, 1982 from Louisiana and Halicyclops bowmani Rocha & Iliffe, 1993 from Bermuda. These species share the same armature of P1-P4EXP3, with a 3443 spine formula and the terminal antennary segment with 5 setae. However, Halicyclops gaviriai sp. n. can be separated from both Halicyclops clarkei and Halicyclops bowmani by the morphology of the anal pseudoperculum, the proportions of the fourth antennulary segment, the length of the inner basipodal spine of P1, the P1EXP/inner basipodal spine inner length ratio and the length/width ratio of the caudal rami. This is the third species of Halicyclops recorded from Colombia and the first one described from this country. With the addition of Halicyclops gaviriai sp. n., the number of species of Halicyclops known from the Neotropics increases to 19. The regional diversity of the genus is probably underestimated. PMID:25561852

  15. A new Lepeophtheirus (Copepoda: Siphonostomatoida: Caligidae from Isla del Coco National Park, Costa Rica, Eastern Tropical Pacific

    Directory of Open Access Journals (Sweden)

    Eduardo Suárez-Morales

    2012-11-01

    Full Text Available Among the several groups of copepods that are teleost parasites, the siphonostomatoid family Caligidae is by far the most widespread and diverse. With more than 108 nominal species, the caligid genus Lepeophtheirus von Nordmann is one of the most speciose. There are no reports of this genus in Costa Rican waters. A new species of Lepeophtheirus is herein described based on female specimens collected from plankton samples in waters off Bahía Wafer, isla del Coco, an oceanic island in the Eastern Tropical Pacific. The new species, L. alvaroi sp. nov., has some affinities with other congeners bearing a relatively short abdomen, a wider than long genital complex and a 3-segmented exopod of leg 4. it differs from most of these species by the presence of an unbranched maxillular process and by the relative lengths of the terminal claws of leg 4, with two equally long elements. it is most closely related to two other Eastern Pacific species: L. dissimulatus Wilson, 1905 and L. clarionensis Shiino, 1959. it differs from these species by the proportions and shape of the genital complex, the shape of the sternal furca, the relative length of the maxillar segments, the absence of a pectiniform process on the distal maxillar segment, the length of leg 4 and the armature of leg 5. The new species represents the first Lepeophtheirus described from Costa Rican waters of the Pacific. The low diversity of this genus in this tropi- cal region is explained by its tendency to prefer hosts from temperate latitudes. Until further evidence is found, the host of this Lepeophtheirus species remains unknown.

  16. Negative binomial distribution to describe the presence of Trifur tortuosus (Crustacea: Copepoda in Merluccius gayi (Osteichthyes: Gadiformes

    Directory of Open Access Journals (Sweden)

    Giselle Garcia-Sepulveda

    2017-06-01

    Full Text Available This paper describes the frequency and number of Trifur tortuosus in the skin of Merluccius gayi, an important economic resource in Chile. Analysis of a spatial distribution model indicated that the parasites tended to cluster. Variations in the number of parasites per host can be described by a negative binomial distribution. The maximum number of parasites observed per host was one, similar patterns was described for other parasites in Chilean marine fishes.

  17. Complementary description of Ergasilus arthrosis Roberts, 1969 (Copepoda: Poecilostomatoida: Ergasilidae), a new parasite of cichlid teleosts in southeast Mexico.

    Science.gov (United States)

    Jiménez-García, María Isabel; Suárez-Morales, Eduardo

    2017-01-01

    During a parasitological survey of the ichthyofauna of Lake Catemaco, a freshwater system in the Mexican State of Veracruz, the widespread copepod Ergasilus arthrosis Roberts, 1969 was recovered from two cichlid teleosts, Mayaheros urophthalmus (Günther) and Oreochromis sp. This is the first confirmed record of this copepod species outside of the United States and from Mexico; its finding as a parasite of cichlids represents an expansion of the known host range for this copepod. The local prevalence and intensity of infection of E. arthrosis was highest in M. urophthalmus. The infection prevalence of E. arthrosis on M. urophthalmus (60%) was higher than that known for other ergasilids on cichlids. Ergasilus arthrosis can be distinguished from its closest congener E. lizae Krøyer, 1863 by the morphometry of the antennary segments, the ventral ornamentation of the thoracic sclerites and by details of the antennulary setation, but also by its habitat and host preferences. Taxonomic illustrations and morphological details of the specimens examined are also provided together with comments on the variability of this species.

  18. Egg production and hatching success of Paracartia grani (Copepoda, Calanoida, Acartiidae) in two hypersaline ponds of a Tunisian Solar Saltern

    Science.gov (United States)

    Annabi-Trabelsi, Neila; Rebai, Rayda Kobbi; Ali, Mohammad; Subrahmanyam, M. N. V.; Belmonte, Genuario; Ayadi, Habib

    2018-04-01

    Reproductive traits of Paracartia grani [percentage of spawning females, egg production rate (EPR), and hatching success (HS)] were investigated for the first time at high salinities (39-121 psu) to examine the impact of such a particular situation. The study was done in two hypersaline ponds [A1 (39-46 psu) and C31 (70-121 psu)] in Sfax Solar Saltern, central-eastern coast of Tunisia. These ponds also differed in terms of the composition and concentrations of nutritional parameters. The EPR differed significantly between the ponds (ANOVA, F = 29.45, p eggs female- 1 day- 1 (7 December 2009) and 14 ± 1 eggs female- 1 day- 1 (19 January 2010) with an average of 13.3 ± 0.44 eggs female- 1 day- 1. HS after 48 h of incubation were significantly higher than those after 24 h. The mean values of HS after 48 h were 42.72 ± 2.58% at pond A1 and 41.67 ± 3.92% at pond C31. The two peaks of HS (after 48 h) were observed at 15 °C in pond A1 (21 December 2009, 45.18% nauplii eggs- 1) and in C31 (4 January 2010, 48.78%) at the same temperature. This study confirms that a broad salinity tolerance allows P. grani to settle itself in environments, which are normally hostile to the development of other Acartiidae.

  19. Survey of cyclopids (Crustacea, Copepoda in Brazil and preliminary screening of their potential as dengue vector predators

    Directory of Open Access Journals (Sweden)

    Santos Luciana Urbano dos

    1997-01-01

    Full Text Available INTRODUCTION: Cyclopid copepods are known to be good mosquito controllers, specially as regards the larvae of the dengue vectors Aedes aegypti and Ae. albopictus. MATERIAL AND METHOD: The objective of the study was to survey the local copepod fauna and search for new strains of M. longisetus var. longisetus, comparing the potential of the samples found with the current strain ML-01 against Ae. albopictus larvae, under laboratory conditions. Eleven bodies of water in Campinas, SP, Brazil, were screened for copepods by collecting 1.5 l of water from each of then. The predatory potential of adults copepods was evaluated over 24 h, in the laboratory, for groups of 5 individuals preying upon 30 first instar Ae. albopictus larvae. RESULTS AND CONCLUSION: The following cyclopid species were found: Metacyclops mendocinus, Tropocyclops prasinus, Eucyclops sp, Eucyclops serrulatus, Eucyclops solitarius, Eucyclops ensifer, Macrocyclops albidus var. albidus and Mesocyclops longisetus var. longisetus. The predatory potential of these copepods ranged from nil to 97.3%. A sample collected in the field containing only M. longisetus var. longisetus showed the best control efficiency with no significant difference from a three-year old laboratory culture (ML-01 of the same species evaluated for comparison. The sample with few M. albidus var. albidus was ranked in second place showing an average 25.9% efficiency. The use of copepods in trap tires as dengue vector controllers is discussed.

  20. Laboratory evaluation of Mesocyclops annulatus (Wierzejski, 1892 (Copepoda: Cyclopidea as a predator of container-breeding mosquitoes in Argentina

    Directory of Open Access Journals (Sweden)

    María V Micieli

    2002-09-01

    Full Text Available In laboratory bioassays we tested the predatory capacity of the copepod Mesocyclops annulatus on Aedes aegypti and Culex pipiens larvae. A single adult female of M. annulatus caused 51.6% and 52.3% mortality of 50 first instar larvae of Ae. aegypti and Cx. pipiens respectively, in a 72 h test period. When alternative food was added to the containers, mortality rates declined to 16% and 10.3% for Ae. aegypti and Cx. pipiens respectively. When 50 first instar larvae of each of the two mosquito species tested were placed together with a single adult female of M. annulatus, mortality rates were 75.5% for Ae. aegypti larvae and 23.5% for Cx. pipiens larvae in a three day test period. Different density of adult females of M. annulatus ranged from 5 to 25 females produced mortality rates of Ae. aegypti first instar larvae from 50% to 100% respectively. When a single adult female of M. annulatus was exposed to an increasing number of first-instar Ae. aegypti larvae ranging from 10 to 100, 100% mortality was recorded from 1 to 25 larvae, then mortality declined to 30% with 100 larvae. The average larvae killed per 24 h period by a single copepod were 29.

  1. New records and redescriptions of American species of Mesocyclops and of Diacyclops bernardi (Petkovski, 1986) (Copepoda: Cyclopoida)

    NARCIS (Netherlands)

    Reid, Janet W.

    1993-01-01

    Recent collections in the south central U.S.A. have included three neotropical and one probably introduced species that are presently assigned to the cyclopoid copepod genus Mesocyclops. Mesocyclops longisetus var. curvatus Dussart, 1987, is reported from Louisiana, U.S.A., and Panama; published

  2. Hallazgo de mesocyclops aspericornis (Daday) (Copepoda: Cyclopidae) depredador de larvas de aedes aegypti en Anapoima Colombia (1)

    OpenAIRE

    Marco Fidel Suárez; Dwight Ayala; Michael J. Nelson; Janet W. Reid

    1984-01-01

    En Anapoima, Colombia, se encontró que el copépodo Mesocyclops aspericornis era depredador de larvas del mosquito Aedes aegypti. Este encuentro representa el primer hallazgo de este copépodo en recipientes artificiales en la región neotropical, y el primer hallazgo como depredador de larvas de Aedes aegypti.

  3. Distribution and hosts of Stellicola (Copepoda, Cyclopoida) associated with Linckia (Asteroidea) in the Indo-West Pacific

    NARCIS (Netherlands)

    Humes, Arthur G.

    1976-01-01

    Five lichomolgid copepods belonging to the genus Stellicola are reported from three species of the sea star genus Linckia in the Moluccas: Stellicola flexilis n. sp. from Linckia guildingi. L. laevigata, and L. multiflora, S. caeruleus (Stebbing, 1900) from L. laevigata, L. guildingi, and L.

  4. Effects of Mesocyclops longisetus (Copepoda:Cyclopidae) on mosquitoes that inhabit tires: influence of litter type, quality, and quantity.

    Science.gov (United States)

    Schreiber, E T; Hallmon, C F; Eskridge, K M; Marten, G G

    1996-12-01

    A 59-week study was conducted to evaluate the impact of adult Mesocyclops longisetus populations on larval mosquito species inhabiting tires. Greater than 90% reduction of number of 1st and 2nd instars was recorded by 4 wk with 90% reduction of number of 3rd and 4th instars after 7 wk. Reduced control was noted with the onset of cooler winter water temperature. Overall. a 52% reduction in the number of 1st and 2nd instars was achieved, and a 57% reduction was noted in number of 3rd- and 4th-instar mosquito larvae. Cooler temperatures resulted in a decline of adult Mesocyclops, which resulted in reduced larval control. Significantly greater numbers of Mesocyclops adults were collected in tires with either new litter or heavy amounts of litter regardless of litter type. Lastly, litter type, either oak leaves or pine needles, did not influence mosquito reduction or abundance of Mesocyclops populations.

  5. De novo assembly of a transcriptome for Calanus finmarchicus (Crustacea, Copepoda--the dominant zooplankter of the North Atlantic Ocean.

    Directory of Open Access Journals (Sweden)

    Petra H Lenz

    Full Text Available Assessing the impact of global warming on the food web of the North Atlantic will require difficult-to-obtain physiological data on a key copepod crustacean, Calanus finmarchicus. The de novo transcriptome presented here represents a new resource for acquiring such data. It was produced from multiplexed gene libraries using RNA collected from six developmental stages: embryo, early nauplius (NI-II, late nauplius (NV-VI, early copepodite (CI-II, late copepodite (CV and adult (CVI female. Over 400,000,000 paired-end reads (100 base-pairs long were sequenced on an Illumina instrument, and assembled into 206,041 contigs using Trinity software. Coverage was estimated to be at least 65%. A reference transcriptome comprising 96,090 unique components ("comps" was annotated using Blast2GO. 40% of the comps had significant blast hits. 11% of the comps were successfully annotated with gene ontology (GO terms. Expression of many comps was found to be near zero in one or more developmental stages suggesting that 35 to 48% of the transcriptome is "silent" at any given life stage. Transcripts involved in lipid biosynthesis pathways, critical for the C. finmarchicus life cycle, were identified and their expression pattern during development was examined. Relative expression of three transcripts suggests wax ester biosynthesis in late copepodites, but triacylglyceride biosynthesis in adult females. Two of these transcripts may be involved in the preparatory phase of diapause. A key environmental challenge for C. finmarchicus is the seasonal exposure to the dinoflagellate Alexandrium fundyense with high concentrations of saxitoxins, neurotoxins that block voltage-gated sodium channels. Multiple contigs encoding putative voltage-gated sodium channels were identified. They appeared to be the result of both alternate splicing and gene duplication. This is the first report of multiple NaV1 genes in a protostome. These data provide new insights into the transcriptome and physiology of this environmentally important zooplankter.

  6. Infestation of Lernaea cyprinacea (Copepoda: Lernaeidae in two invasive fish species in Romania, Lepomis gibbosus and Pseudorasbora parva

    Directory of Open Access Journals (Sweden)

    Stavrescu-Bedivan M.M.

    2014-01-01

    Full Text Available In this study we analyzed comparatively the host-parasite associations between two fish host species invasive in Europe (Lepomis gibbosus and Pseudorasbora parva and one known generalist parasite species, the copepod Lernaea cyprinacea. We used a fragment of the hypervariable region D1-D2 of the 28S rRNA to confirm that the copepod specimens collected on both host species in our study are indeed conspecific. The prevalence of infection was significantly different between the two host species in all three aquatic ecosystems. Two populations of L. gibbosus exhibited a positive correlation coefficient between the standard body length and infection intensity, while a negative correlation coefficient was observed in one population of P. parva. This is one of the few studies providing parasitological parameters of infections of Lernaea cypriancea in Lepomis gibbosus and Pseudorasbora parva.

  7. Histopathology of a mesoparasitic hatschekiid copepod in hospite: does Mihbaicola sakamakii (Copepoda: Siphonostomatoida: Hatschekiidae) fast within the host fish tissue?

    Science.gov (United States)

    Hirose, Euichi; Uyeno, Daisuke

    2014-08-01

    Mihbaicola sakamakii is a mesoparasitic copepod that infests the branchiostegal membranes of groupers (Perciformes: Serranidae). In this study, we observed M. sakamakii within host tissue. Histologically, copepods were found enclosed inside a pouch composed of the thickened epidermis of the host, tightly encased on all sides by the host epidermal pouch wall. There were no host blood cells or other food resources in the pouch lumen. Since the host epidermis was intact and continuous, even in the vicinity of the oral region of the parasite, the copepod would not have access to the host blood in this state. However, the stomach (ampullary part of the mid gut) was filled with granular components, the majority of which were crystalloids that likely originated from fish erythrocyte hemoglobin. We supposed that the parasite drinks blood exuded from the lesion in the fish caused by copepod entry into the host tissue. Invasion of the parasite may elicit immune responses in the host, but there were no traces on the copepod of any cellular immune reactions, such as encapsulation. The array of minute protuberances on the copepod cuticle surface may be involved in avoidance of cell adhesion. After the lesion has healed, the copepod is enclosed in a tough epidermal pouch, in which it gradually digests the contents of its stomach and continues egg production.

  8. New records of the rare glacial relict Eurytemora lacustris (Poppe 1887 (Copepoda; Calanoida in atypical lake habitats of northern Germany

    Directory of Open Access Journals (Sweden)

    Peter KASPRZAK

    2011-02-01

    Full Text Available During monitoring investigations of lakes in Schleswig-Holstein (northern Germany in 2000 and 2008, the calanoid copepod Eurytemora lacustris (POPPE 1887 was found in three lakes of the Ratzeburger Lake complex: the Kleine Küchensee, the Große Küchensee and the Große Ratzeburger See. The species has a broad geographic distribution but has become rare and endangered by eutrophication and global change. The lakes are mesotrophic (Gr. Ratzeburger See and eutrophic (Kl. Küchensee, Gr. Küchensee with cool (1 mg O2 L-1. Food and physical conditions seem to be favourable enough to permit survival and reproduction of the species at least in spring. It remains unclear, however, whether the populations in the studied lakes are autochthonous. Eurytemora lacustris possibly invaded the lakes or was transported via a canal from the Schaalsee upstream, where a viable population exists.

  9. Reconstruction of arietellid copepod phylogenetic relationship, with description of a new species of Sarsarietellus (Copepoda, Calanoida, Arietellidae) from Korean waters.

    Science.gov (United States)

    Soh, Ho Young; Moon, Seong Yong; Ohtsuka, Susumu; Pae, Se Jin; Jeong, Hyeon Gyeong

    2013-11-01

    A new species of the genus Sarsarietellus from Korean waters, S. orientalis n. sp. is described based on both sexes. This is very closely related to S. suluensis Ohtsuka, Nishida and Machida, 2005 , but is readily distinguished by the following characteristics: in the female (1) narrow head; (2) nearly symmetrical posterior corners of last pedigerous somite, not extending beyond the genital double-somite; (3) antennary endopod slightly longer than the exopod; (4) nearly equal length of three outer spines and the terminal spine of the exopod of the fifth leg, except for the proximal third outer spine; and in the male the left fifth leg with two whip-like setae on the tip of the second exopodal segment not being rotated outside. Sarsarietellus orientalis is the fourth species of the genus Sarsarietellus, while the male of Sarsarietellus species is the first reported. The habitat colonization of arietellids is reconsidered.

  10. The reproductive effort of Lepeophtheirus pectoralis (Copepoda: Caligidae): insights into the egg production strategy of parasitic copepods.

    Science.gov (United States)

    Frade, D G; Santos, M J; Cavaleiro, F I

    2016-01-01

    The reproductive effort of Lepeophtheirus pectoralis (Müller O. F., 1776), a caligid copepod, which is commonly found infecting the European flounder, Platichthys flesus (Linnaeus, 1758), is studied in detail for the first time. Seasonal variation in body dimensions and reproductive effort are analysed. Data for 120 ovigerous females, 30 from each season of the year, were considered in the analyses. Females were larger and produced a larger number of smaller eggs in winter, than during the summer. The relationship between egg number and egg size is similar to that recorded for other copepods exploiting fish hosts. Much of the recorded variation was also similar to that reported for a copepod parasitic on an invertebrate host, which suggests the possibility of a general trend in copepod reproduction. Overall, our results provide further support for the hypothesis that there is an alternation of summer and winter generations.

  11. Infestation of gill copepod Lernanthropus latis (Copepoda: Lernanthropidae) and its effect on cage-cultured Asian sea bass Lates calcarifer.

    Science.gov (United States)

    Kua, B C; Noraziah, M R; Nik Rahimah, A R

    2012-09-01

    Twenty Asian sea bass Lates calcarifer from a floating cage in Bt. Tambun, Penang were examined for the presence of parasitic gill copepod, Lernanthropus latis. The prevalence of L. latis was 100% with the intensity of infection ranging from 1 to 18 parasites per host or 3.75 of mean intensity. Female parasites having oblong cephalothorax and egg-strings were seen mainly on the entire gill of examined Asian sea bass. The infected gill of Asian sea bass was pale and had eccessive mucus production. Under light and scanning electron microscopies (SEM), L. latis was seen grasping or holding tightly to the gill filament using their antenna, maxilla and maxilliped. These structures are characteristically prehensile and uncinate for the parasite to attach onto the host tissue. The damage was clearly seen under SEM as the hooked end of the antenna was embedded into the gill filament. The parasite also has the mandible which is styliform with eight teeth on the inner margin. The pathological effects such as erosion, haemorrhages, hyperplasia and necrosis along the secondary lamellae of gill filaments were seen and more severe at the attachment site. The combined actions of the antenna, maxilla and maxilliped together with the mandible resulted in extensive damage as L. latis attached and fed on the host tissues.

  12. Thermocyclops decipiens (Kiefer, 1929 (Copepoda, Cyclopoida as indicator of water quality in the State of Minas Gerais, Brazil

    Directory of Open Access Journals (Sweden)

    Giovanni Guimarães Landa

    2007-07-01

    Full Text Available The aim of this work was to study the possible utilization of Thermocyclops decipiens as indicator of the trophic degree and water quality of some watersheds of the state of Minas Gerais. From the beginning of the decade of 90, T. decipiens was recorded in several water collections of the state, including the basins of the rivers Paranaíba, São Francisco, Doce and Grande, within environments mainly of meso and eutrophics characteristics. Of the 28 places of occurrence of the species and according to the water quality index (WQI used by Environmental Foundation of Minas Gerais (FEAM, 7 of these environments presented WQI good, 16 medium, 4 bad and one very bad. This classification corroborated the hypothesis that T. decipiens could be used as indicator species of eutrophic environments and of low water quality thus constituting an important tool for the biomonitoring of aquatic ecosystems.Thermocyclops decipiens é uma espécie pioneira de grande dispersão e altamente adaptável a colonizar novos ambientes. É comumente encontrada no sudeste do Brasil, em ambientes com características meso e eutróficas. Considerando a dominânciadesta espécie no reservatório da Pampulha e a sua provável relação com o grau de trofia, este trabalho objetivou verificar a possibilidade de utilizar este organismo como indicador do grau de trofia e/ou qualidade de água de algumas bacias hidrográficas do Estado de Minas Gerais. Para isso, foi feita uma revisão sobre a ocorrência da espécie no Estado. A partir dos anos 90, T. decipiens foi registrada em várias coleções de água do Estado, abrangendo as bacias dos rios Paranaíba, São Francisco, Doce e Grande, na sua grande maioria, com características meso e eutróficas. Dos 28 locais de ocorrência da espécie, e conforme o índice de qualidade de água (IQA utilizado pela FEAM, 7 destes ambientes apresentam IQA bom, 16 um IQA médio, 4 um IQA ruim e um IQA muito ruim. Esta classificação reforça a hipótese de que T. decipiens pode ser utilizada como espécie indicadora de ambientes eutróficos e de baixa qualidade de água, e como tal, constitui ferramenta importante no biomonitoramento de ecossistemas aquáticos.

  13. A new Lepeophtheirus (Copepoda: Siphonostomatoida: Caligidae from Isla del Coco National Park, Costa Rica, Eastern Tropical Pacific

    Directory of Open Access Journals (Sweden)

    Eduardo Suárez-Morales

    2012-11-01

    Full Text Available Among the several groups of copepods that are teleost parasites, the siphonostomatoid family Caligidae is by far the most widespread and diverse. With more than 108 nominal species, the caligid genus Lepeophtheirus von Nordmann is one of the most speciose. There are no reports of this genus in Costa Rican waters. A new species of Lepeophtheirus is herein described based on female specimens collected from plankton samples in waters off Bahía Wafer, isla del Coco, an oceanic island in the Eastern Tropical Pacific. The new species, L. alvaroi sp. nov., has some affinities with other congeners bearing a relatively short abdomen, a wider than long genital complex and a 3-segmented exopod of leg 4. it differs from most of these species by the presence of an unbranched maxillular process and by the relative lengths of the terminal claws of leg 4, with two equally long elements. it is most closely related to two other Eastern Pacific species: L. dissimulatus Wilson, 1905 and L. clarionensis Shiino, 1959. it differs from these species by the proportions and shape of the genital complex, the shape of the sternal furca, the relative length of the maxillar segments, the absence of a pectiniform process on the distal maxillar segment, the length of leg 4 and the armature of leg 5. The new species represents the first Lepeophtheirus described from Costa Rican waters of the Pacific. The low diversity of this genus in this tropi- cal region is explained by its tendency to prefer hosts from temperate latitudes. Until further evidence is found, the host of this Lepeophtheirus species remains unknown.Entre los varios grupos de copépodos que son parásitos de teleósteos, la familia sifonostomatoide Caligidae incluye los más dispersos y diversos. Con más de 108 especies nominales, el género de calígidos Lepeophtheirus von Nordmann es uno de los más diversos. No existen registros previos de este género en aguas de Costa Rica. Se describe una nueva especie de copépodo calígido del género Lepeophtheirus con base en especímenes femeninos recolectados a partir de muestras de plancton en aguas de Bahía Wafer, isla del Coco, una isla oceánica del Pacífico Tropical Oriental. La nueva especie, L. alvaroi sp. nov., tiene algunas afinidades con congéneres que poseen un abdomen relativamente corto, un complejo genital más ancho que largo y un exópodo de la pata 4 con 3 segmentos. Esta especie difiere de la mayoría de estas especies por la presencia de un proceso maxilular no ramificado y por el tamaño relativo de las garras terminales de la pata 4, con dos elementos igualmente largos. Está más cercanamente relacionada con otras dos especies del Pacífico Oriental: L. dissimulatus Wilson, 1905 y L. clarionensis Shiino, 1959. Difiere de estas especies por las proporciones y forma del complejo genital, la forma de la furca esternal, la longitud relativa de los segmentos maxilares, la ausencia de un proceso pectiniforme en el segmento maxilar distal, la longitud de la pata 4 y la armadura de la pata 5. La nueva especie representa el primer Lepeophtheirus descrito en aguas del Pacífico de Costa Rica. La baja diversidad del género en esta región tropical se explica por su tendencia a preferir hospederos de latitudes templadas. Hasta encontrar más evidencia, el hospedero de esta especie de Lepeophtheirus permanece desconocida.

  14. First record of the Calanoid Copepod Pseudodiaptomus serricaudatus (Scott, T. 1894), (Copepoda: Calanoida: Pseudodiaptomidae) in the equatorial Indian ocean.

    Digital Repository Service at National Institute of Oceanography (India)

    Rebello, V.; Narvekar, J.; Gadi, P.; Venenkar, A.; Gauns, M.; PrasannaKumar, S.

    , Pondicherry University, Port Blair, Andaman 3Happy Home Apartment, Near Canara Bank, Fatorda, Margao, Goa-403602 Abstract Pseudodiaptomus serricaudatus (Scott, T. 1894), a planktonic copepod belonging to the family Pseudodiaptomidae, though has...

  15. Drought-associated absence of alien invasive anchorworm, Lernaea cyprinacea (Copepoda: Lernaeidae, is related to changes in fish health

    Directory of Open Access Journals (Sweden)

    Rachel L. Welicky

    2017-12-01

    Full Text Available Recently, Mozambique tilapia (Oreochromis mossambicus Peters, 1852 were listed on the IUCN Red List as near-threatened as their populations are at risk due to hybridization. Another factor that potentially contributes to their population decline is that they are regularly infected by the invasive parasitic copepod anchorworm, Lernaea cyprinacea Linnaeus, 1758. Considering anchorworm-infected Mozambique tilapia are common, understanding their condition with respect to infection is difficult as uninfected fish from the same localities have been unavailable for comparison. A severe drought in southern Africa has created hypersaline environments in the Phongolo River floodplain of north-eastern South Africa, such that freshwater parasites cannot survive and uninfected fish are now found. To determine how infection influences host health, infected and uninfected Mozambique tilapia were collected before and during drought conditions, from Nyamiti pan of the Phongolo River floodplain. Anchorworm-infected fish prevalence was recorded, and anchorworms were collected from hosts and identified to the species level using molecular data of the 18S rRNA gene. For each fish, intensity of anchorworm infection, total length, and weights of the gutted body, liver, spleen, and gonads were recorded. Gutted condition factor, hepato-, spleeno-, and gonado-somatic index values per fish, and prevalence of infection per collection were determined. A rapid health assessment was also conducted to determine a health score for each fish. Molecular analyses confirmed the anchorworm studied was L. cyprinacea. Prior to and during drought, prevalence of infection was 100%, and 0%, respectively. Before drought, fish had significantly reduced hepato-, spleeno-, and gonado-somatic index values, and higher health assessment scores, yet significantly higher gutted condition. Anchorworm intensity was indirectly correlated with fish liver and gonad condition. This study demonstrates that host condition and health varies greatly with respect to drought and infection, and provides the necessary data for follow-up studies in post-drought conditions. Keywords: Alien invasive, Cichlidae, Fish parasites, Host condition, Tilapia, 18S ribosomal DNA

  16. Harpacticoida (Crustacea, Copepoda of Mussel Beds and Macroalgae on the Rocky Substrates in the North-Western Black Sea

    Directory of Open Access Journals (Sweden)

    Portianko V. V.

    2017-10-01

    Full Text Available The role of harpacticoid copepods in total abundance, biomass and species diversity of meiobenthos on rocky substrates is described. Th e fauna of harpacticoid copepods consists of 19 species in algal beds, 23 species in mussel beds and 24 species in mixed aggregation of molluscs and macrophytes. In the macrophyte aggregation, the maximal abundance was registered in Cladophora vagabunda - 88 750 ind. × m-2, while minimal was on Laurensia paniculata - 8250 ind. × m-2. According to the frequency of occurrence, the habitat preferred by copepods was Ceramium elegans, but according to their percentage in total meiobenthos among macrophytes it was Ulva intestinalis, 56.6 %. The percentage of copepods in the pure mussel beds was higher comparing to mixed aggregation of molluscs and macrophytes.

  17. Distribution of Hatschekia pagellibogneravei (Copepoda: Hatschekiidae) on the gills of Pagellus bogaraveo (Teleostei: Sparidae) from Madeira, Portugal.

    Science.gov (United States)

    Hermida, Margarida; Cruz, Cristina; Saraiva, Aurélia

    2012-06-01

    A population of the gill parasite Hatschekia pagellibogneravei (Hesse, 1878) was studied on one of its sparid fish hosts, the blackspot seabream, Pagellus bogaraveo (Brünnich), off the coast of Madeira Island, Portugal, northeast Atlantic. Very high infection levels of this copepod were detected, with no significant seasonal differences. Abundance was negatively correlated with fish size. There were significant differences in the distribution of this copepod among the gill arches of the host, which seem to be best explained by differences in water flow within the gill habitat.

  18. Genome- and transcriptome-assisted development of nuclear insertion/deletion markers for Calanus species (Copepoda: Calanoida) identification

    DEFF Research Database (Denmark)

    Smolina, I.; Kollias, S.; Poortvliet, M.

    2014-01-01

    Copepods of the genus Calanus are key zooplankton species in temperate to arctic marine ecosystems. Despite their ecological importance, species identification remains challenging. Furthermore, the recent report of hybrids among Calanus species highlights the need for diagnostic nuclear markers t...

  19. A new species of Monstrillopsis (Crustacea, Copepoda, Monstrilloida from the lower Northwest Passage of the Canadian Arctic

    Directory of Open Access Journals (Sweden)

    Aurélie Delaforge

    2017-10-01

    Full Text Available A new species of monstrilloid copepod, Monstrillopsis planifrons sp. n., is described from an adult female that was collected beneath snow-covered sea ice during the 2014 Ice Covered Ecosystem – CAMbridge bay Process Study (ICE-CAMPS in Dease Strait of the Canadian Arctic Archipelago. Currently, up to six species of this order are known to occur in polar latitudes. The new species described herein shares similarities with Monstrillopsis dubia (Scott, 1904 but differs in its body proportions and cephalothorax ornamentation; the cephalothorax is covered by minute scattered papillae on dorsal and ventral surfaces; this species has a reduced fifth leg endopod, fifth leg exopod armed with three setae, antennule with fused segments 3–4, and the genital double-somite bears unique posterolateral processes. This is the second species of this genus recorded in the Arctic, after Monstrillopsis ferrarii (Suárez-Morales & Ivanenko, 2004, described from the White Sea, and is the first record of Monstrillopsis in Canadian waters. With the addition of this new species and the recognition of Monstrillopsis bernardensis comb. nov. as a member of this genus, the number of nominal species is now 15. Overall, this genus has a tendency to be distributed in temperate and cold waters, while only three species have been found in tropical and subtropical latitudes.

  20. Size and distribution of Pandarus satyrus (Copepoda: Pandaridae) on the blue shark Prionace glauca (Carcharhiniformes: Carcharhinidae) in Costa Rica.

    Science.gov (United States)

    Rojas, J R; Rodríguez Solano, O; Morales-Ramírez, A

    2001-03-01

    A total of 80 specimens of Pandarus satyrus, a cosmopolitan ectoparasitic copepod, were taken from fishery catches of blue sharks (Prionace glauca) in the Eastern Pacific coast of Costa Rica. All specimens were found in the dorsal surface of pectoral fins (8-30 per shark). Longer specimens were most abundant.

  1. Size and distribution of Pandarus satyrus (Copepoda: Pandaridae on the blue shark Prionace glauca (Carcharhiniformes: Carcharhinidae in Costa Rica

    Directory of Open Access Journals (Sweden)

    José Rodrigo Rojas M.

    2001-03-01

    Full Text Available A total of 80 specimens of Pandarus satyrus, a cosmopolitan ectoparasitic copepod, were taken from fishery catches of blue sharks (Prionace glauca in the Eastern Pacific coast of Costa Rica. All specimens were found in the dorsal surface of pectoral fins (8-30 per shark. Longer specimens were most abundant.Un total de 80 especímenes de Pandarus satyrus, un copépodo ectoparásito cosmopolita, fueron tomados de tiburones azules (Prionace glauca capturados en la costa del Pacífico Oriental de Costa Rica. Todos los especímenes fueron encontrados en la superficie dorsal de las aletas pectorales (entre 8 y 30 por tiburón. Los parásitos más grandes son los más abundantes.

  2. Observations on feeding behaviour and survival rates in the estuarine calanoid copepods Acartia spinicauda and Heliodiaptomus cinctus (Crustacea: Copepoda: Calanoida)

    Digital Repository Service at National Institute of Oceanography (India)

    Srivastava, Y.; Fernandes, Brenda; Goswami, S.C.; Goswami, U.; Achuthankutty, C.T.

    of Tetraselmis gracilis (Chlorophyta) and Skeletonema costatum (Bacillariophyta), whereas, adults of H. cinctus were fed on five different combinations of phytoplankton feed. Total hourly differences in pigment concentrations indicate that A. spinicauda preferred...

  3. The discovery of Caligus temnodontis Brian, 1924 (Copepoda: Caligidae) from the bluefish Pomatomus saltatrix (Linnaeus) in the eastern Mediterranean Sea.

    Science.gov (United States)

    Ozak, Argun A; El-Rashidy, Hoda H; Demirkale, Ibrahim; Boxshall, Geoff A

    2010-07-01

    The temnodontis variety of Caligus mauritanicus Brian, 1924 described by Brian (1924) is a valid species known only from a single host species, Pomatomus saltatrix (Linnaeus). New material of this species has been examined from the same host fish caught from Abuqir Bay, Alexandria (Egypt), from Iskenderun Bay (Turkey) and from off the coast of South Africa. Using this material, C. temnodontis Brian, 1924 is redescribed and compared with related species. It is most closely related to the Indo-Pacific species C. pagrosomi Yamaguti, 1939.

  4. Lovenula (Neolovenula) alluaudi (Guerne and Richard, 1890) in the Canary Islands (Copepoda: Calanoida: Paradiaptominae). Stygofauna of the Canary Islands, 19

    NARCIS (Netherlands)

    Bowman, Thomas E.

    1990-01-01

    Lovenula (Neolovenula) alluaudi is widespread on Lanzarote, where it occurred at 22 of the 105 stations. On Fuerteventura it was found at only 2 of the 53 stations, both in the extreme northwest part of the island. It was also found in a reservoir on the south side of the small island of Alegranza.

  5. An Asset Pricing Approach to Testing General Term Structure Models including Heath-Jarrow-Morton Specifications and Affine Subclasses

    DEFF Research Database (Denmark)

    Christensen, Bent Jesper; van der Wel, Michel

    of the risk premium is associated with the slope factor, and individual risk prices depend on own past values, factor realizations, and past values of other risk prices, and are significantly related to the output gap, consumption, and the equity risk price. The absence of arbitrage opportunities is strongly...... is tested, but in addition to the standard bilinear term in factor loadings and market prices of risk, the relevant mean restriction in the term structure case involves an additional nonlinear (quadratic) term in factor loadings. We estimate our general model using likelihood-based dynamic factor model...... techniques for a variety of volatility factors, and implement the relevant likelihood ratio tests. Our factor model estimates are similar across a general state space implementation and an alternative robust two-step principal components approach. The evidence favors time-varying market prices of risk. Most...

  6. Correlation of chromosomal instability, telomere length and telomere maintenance in microsatellite stable rectal cancer: a molecular subclass of rectal cancer.

    Directory of Open Access Journals (Sweden)

    Lisa A Boardman

    Full Text Available Colorectal cancer (CRC tumor DNA is characterized by chromosomal damage termed chromosomal instability (CIN and excessively shortened telomeres. Up to 80% of CRC is microsatellite stable (MSS and is historically considered to be chromosomally unstable (CIN+. However, tumor phenotyping depicts some MSS CRC with little or no genetic changes, thus being chromosomally stable (CIN-. MSS CIN- tumors have not been assessed for telomere attrition.MSS rectal cancers from patients ≤50 years old with Stage II (B2 or higher or Stage III disease were assessed for CIN, telomere length and telomere maintenance mechanism (telomerase activation [TA]; alternative lengthening of telomeres [ALT]. Relative telomere length was measured by qPCR in somatic epithelial and cancer DNA. TA was measured with the TRAPeze assay, and tumors were evaluated for the presence of C-circles indicative of ALT. p53 mutation status was assessed in all available samples. DNA copy number changes were evaluated with Spectral Genomics aCGH.Tumors were classified as chromosomally stable (CIN- and chromosomally instable (CIN+ by degree of DNA copy number changes. CIN- tumors (35%; n=6 had fewer copy number changes (<17% of their clones with DNA copy number changes than CIN+ tumors (65%; n=13 which had high levels of copy number changes in 20% to 49% of clones. Telomere lengths were longer in CIN- compared to CIN+ tumors (p=0.0066 and in those in which telomerase was not activated (p=0.004. Tumors exhibiting activation of telomerase had shorter tumor telomeres (p=0.0040; and tended to be CIN+ (p=0.0949.MSS rectal cancer appears to represent a heterogeneous group of tumors that may be categorized both on the basis of CIN status and telomere maintenance mechanism. MSS CIN- rectal cancers appear to have longer telomeres than those of MSS CIN+ rectal cancers and to utilize ALT rather than activation of telomerase.

  7. Applications of Fractional q-Calculus to Certain Subclass of Analytic p-Valent Functions with Negative Coefficients

    Directory of Open Access Journals (Sweden)

    Ben Wongsaijai

    2015-01-01

    Full Text Available By making use of the concept of fractional q-calculus, we firstly define q-extension of the generalization of the generalized Al-Oboudi differential operator. Then, we introduce new class of q-analogue of p-valently closed-to-convex function, and, consequently, new class by means of this new general differential operator. Our main purpose is to determine the general properties on such class and geometric properties for functions belonging to this class with negative coefficient. Further, the q-extension of interesting properties, such as distortion inequalities, inclusion relations, extreme points, radii of generalized starlikeness, convexity and close-to-convexity, quasi-Hadamard properties, and invariant properties, is obtained. Finally, we briefly indicate the relevant connections of our presented results to the former results.

  8. Evidence of a common regulation of IgE and IgG-subclass antibodies in humans during immunotherapy

    DEFF Research Database (Denmark)

    Søndergaard, I; Poulsen, L K; Osterballe, O

    1992-01-01

    Based on a 3-year prospective study of 20 pollen-allergic patients, where a detailed analysis of the IgE, IgG1 and IgG4 immune response was performed, we propose that a common regulatory mechanism exists between the IgE and IgG1 synthesis and between IgE and IgG4 synthesis during immunotherapy. I...

  9. The effect of plant sterols and different low doses of omega-3 fatty acids from fish oil on lipoprotein subclasses

    NARCIS (Netherlands)

    Jacobs, D.M.; Mihaleva, V.V.; Schalkwijk, D.B. van; Graaf, A.A. de; Vervoort, J.; Dorsten, F.A. van; Ras, R.T.; Demonty, I.; Trautwein, E.A.; Duynhoven, J. van

    2015-01-01

    Scope: Consumption of a low-fat spread enriched with plant sterols (PS) and different low doses (<2 g/day) of eicosapentaenoic acid (EPA) and docosahexaenoic acid (DHA) from fish oil reduces serum triglycerides (TGs) and low-density lipoprotein-cholesterol (LDL-Chol) and thus beneficially affects

  10. A simple and efficient total genomic DNA extraction method for individual zooplankton.

    Science.gov (United States)

    Fazhan, Hanafiah; Waiho, Khor; Shahreza, Md Sheriff

    2016-01-01

    Molecular approaches are widely applied in species identification and taxonomic studies of minute zooplankton. One of the most focused zooplankton nowadays is from Subclass Copepoda. Accurate species identification of all life stages of the generally small sized copepods through molecular analysis is important, especially in taxonomic and systematic assessment of harpacticoid copepod populations and to understand their dynamics within the marine community. However, total genomic DNA (TGDNA) extraction from individual harpacticoid copepods can be problematic due to their small size and epibenthic behavior. In this research, six TGDNA extraction methods done on individual harpacticoid copepods were compared. The first new simple, feasible, efficient and consistent TGDNA extraction method was designed and compared with the commercial kit and modified available TGDNA extraction methods. The newly described TGDNA extraction method, "Incubation in PCR buffer" method, yielded good and consistent results based on the high success rate of PCR amplification (82%) compared to other methods. Coupled with its relatively consistent and economical method the "Incubation in PCR buffer" method is highly recommended in the TGDNA extraction of other minute zooplankton species.

  11. Two new stygobiotic species of Elaphoidella (Crustacea: Copepoda: Harpacticoida) with comments on geographical distribution and ecology of harpacticoids from caves in Thailand.

    Science.gov (United States)

    Watiroyram, Santi; Brancelj, Anton; Sanoamuang, La-Orsri

    2015-02-16

    Elaphoidella thailandensis sp. nov. and E. jaesornensis sp. nov., collected during an investigation of cave-dwelling copepod fauna in the northern part of Thailand, are described and figured herein. The new species were collected from pools filled by percolating water from the unsaturated zone of a karstic aquifer in Phitsanulok and Lampang Provinces, respectively. Elaphoidella thailandensis, from Tham Khun cave, is distinguished from its congeners by the two-segmented endopod of pediger 1, the absence of endopod on pediger 4, and the setal formula 4, 5, 6 for the distal exopodal segment of pedigers 2-4. Elaphoidella jaesornensis, from Tham Phar Ngam cave, is distinguished from its most closely related species, E. namnaoensis Brancelj, Watiroyram & Sanoamuang, 2010, by the armature formula of the endopod of pedigers 2-5. The geographical distribution and ecology of Harpacticoida from Thai caves is also presented.

  12. Effects of cold selective breeding on the body length, fatty acid content, and productivity of the tropical copepod Apocyclops royi (Cyclopoida, Copepoda)

    DEFF Research Database (Denmark)

    Pan, Yen-Ju; Souissi, Anissa; Sadovskaya, Irina

    2017-01-01

    In this study, we conducted a novel approach of selective breeding by using temperature acclimation to enhance the aquaculture potential of the tropical cyclopoid copepod Apocyclops royi. Two copepod culture strains were acclimated separately at high (28°C, control strain) and low (18°C, selective...

  13. Microsporidia in a woodland pool I. Lanatospora costata sp. n. (Opisthosporidia, Microsporidia), parasite of Megacyclops viridis (Crustacea, Copepoda): fine structure and molecular phylogeny

    Czech Academy of Sciences Publication Activity Database

    Vávra, Jiří; Hyliš, M.; Fiala, Ivan; Refardt, D.; Larsson, J.I.R.

    2016-01-01

    Roč. 55, č. 4 (2016), s. 269-280 ISSN 0065-1583 Institutional support: RVO:60077344 Keywords : microsporidian parasite * Megacyclops viridis * SSU rRNA Subject RIV: EE - Microbiology, Virology Impact factor: 1.481, year: 2016

  14. First record and redescription of Macandrewella cochinensis Gopalakrishnan, 1973 (Copepoda, Scolecitrichidae) from the Red Sea, with notes on swarm formation.

    Science.gov (United States)

    El-Sherbiny, Mohsen M; Al-Aidaroos, Ali M

    2013-01-01

    During a study of the epipelagic zooplankton carried out near the fringing reef around Sharm El-Sheikh area, in the northern Red Sea, female and male specimens of the poorly known calanoid copepod Macandrewella cochinensis Gopalakrishnan, 1973 were collected. This is the first record of species occurrence in the Red Sea. Macandrewella cochinensis was previously known only from the offshore water of Cochin, south west of India. The Red Sea specimens are described in details herein to allow their comparison with the specimens from the type locality, because original description of M. cochinensis is incomplete and causes some taxonomic confusion. The most important characters that may have been overlooked in the original description are: shape of projections of the female distolateral prosomal borders, details of morphology of the asymmetrical female genital double-somite and presence of leg 5 in female.

  15. Characteristics of suspensions of Kuwait oil and Corexit 7664 and their short- and long-term effects on Tisbe bulbisetosa (Copepoda: Harpacticoida)

    Energy Technology Data Exchange (ETDEWEB)

    Dalla Venezia, L; Fossato, V U

    1977-01-01

    A technique for preparing seawater suspensions of Kuwait oil and Corexit was developed. The resulting hydrocarbon concentrations were analyzed by gas-chromatography and spectrofluorometric methods and the stability of the suspensions with time was determined. It was established that the suspensions have an effective stability from Days 3 to 15 after preparation, since in this period the concentration varies within a relatively narrow range. Adult female Tisbe bulbisetosa appeared to be quite tolerant of this type of hydrocarbon suspension, in short-term experiments, especially considering that the concentrations used in the bioassays were about 200 times higher than those measured in a relatively polluted area of the lagoon of Venice. Long-term effects on number of eggs produced, number of nauplii and hatching success for females of the third and fourth generations, subject to continuous exposure, were negligible compared with controls.

  16. Harpacticoida (Crustacea: Copepoda associated with cold-water coral substrates in the Porcupine Seabight (NE Atlantic: species composition, diversity and reflections on the origin of the fauna

    Directory of Open Access Journals (Sweden)

    Hendrik Gheerardyn

    2009-12-01

    Full Text Available The harpacticoid copepod fauna associated with the coral degradation zone of Lophelia pertusa (Linnaeus, 1758 reefs was investigated for the first time in the Porcupine Seabight (NE Atlantic. The species list of the coral degradation zone includes 157 species, 62 genera and 19 families, and the most species-rich families were Ectinosomatidae (36 species, Ameiridae (29 species and Argestidae (17 species. At least 80% of the species were considered new to science. Most of the 23 known species have been reported from NE Atlantic coastlines and from higher latitudes in northern Subpolar and Polar Seas. At the family level, the harpacticoid fauna in the Porcupine Seabight did not seem to differ markedly from other deep-sea areas, with essentially the same abundant families. However, the presence of typically epifaunal taxa indicates that the hard substrates of the coral degradation zone provide an exceptional habitat. Further, harpacticoid composition and diversity of sediment and coral fragments were compared with similar substrates in a tropical reef lagoon (Zanzibar, Tanzania. Both regions harboured different fauna and the difference between coral and sediment was more obvious in the tropical lagoon. Species richness and evenness of the two microhabitats in the tropical lagoon were lower than in the deep sea.

  17. Effect of water quality parameters on the distribution of Pleuromamma (Copepoda-Calanoida) species in the Indian Ocean: A statistical approach

    Digital Repository Service at National Institute of Oceanography (India)

    Jayalakshmy, V.K.; Saraswathy, M.; Nair, M.

    degrees N, 10 degrees N to 10 degrees S, 10 degrees S to 30 degrees S, along the Somali Coast (38 degrees S-40 degrees S) and a fifth region along the western boundary of the above four regions. Relation between Pleuromamma species` abundance and the water...

  18. Control of aedes vectors of dengue in three provinces of Vietnam by use of Mesocyclops (Copepoda) and community-based methods validated by entomologic, clinical, and serological surveillance.

    Science.gov (United States)

    Kay, Brian H; Nam, Vu Sinh; Tien, Tran Van; Yen, Nguyen Thi; Phong, Tran Vu; Diep, Vu Thi Bich; Ninh, Truong Uyen; Bektas, Ahmet; Aaskov, John G

    2002-01-01

    We describe remarkable success in controlling dengue vectors, Aedes aegypti (L.) and Aedes albopictus (Skuse), in 6 communes with 11,675 households and 49,647 people in the northern provinces of Haiphong, Hung Yen, and Nam Dinh in Vietnam. The communes were selected for high-frequency use of large outdoor concrete tanks and wells. These were found to be the source of 49.6-98.4% of Ae. aegypti larvae, which were amenable to treatment with local Mesocyclops, mainly M. woutersi Van der Velde, M. aspericornis (Daday) and M. thermocyclopoides Harada. Knowledge, attitude, and practice surveys were performed to determine whether the communities viewed dengue and dengue hemorrhagic fever as a serious health threat; to determine their knowledge of the etiology, attitudes, and practices regarding control methods including Mesocyclops; and to determine their receptivity to various information methods. On the basis of the knowledge, attitude, and practice data, the community-based dengue control program comprised a system of local leaders, health volunteer teachers, and schoolchildren, supported by health professionals. Recycling of discards for economic gain was enhanced, where appropriate, and this, plus 37 clean-up campaigns, removed small containers unsuitable for Mesocyclops treatment. A previously successful eradication at Phan Boi village (Hung Yen province) was extended to 7 other villages forming Di Su commune (1,750 households) in the current study. Complete control was also achieved in Nghia Hiep (Hung Yen province) and in Xuan Phong (Nam Dinh province); control efficacy was > or = 99.7% in the other 3 communes (Lac Vien in Haiphong, Nghia Dong, and Xuan Kien in Nam Dinh). Although tanks and wells were the key container types of Ae. aegypti productivity, discarded materials were the source of 51% of the standing crop of Ae. albopictus. Aedes albopictus larvae were eliminated from the 3 Nam Dinh communes, and 86-98% control was achieved in the other 3 communes. Variable dengue attack rates made the clinical and serological comparison of control and untreated communes problematic, but these data indicate that clinical surveillance by itself is inadequate to monitor dengue transmission.

  19. A new species of Caligus (Copepoda, Siphonostomatoida) from the plankton of the Caribbean coast of Venezuela with a key to species

    Science.gov (United States)

    Suárez-Morales, Eduardo; Camisotti, Humberto; Martín, Alberto

    2012-01-01

    Abstract During a survey of the zooplankton community of Bahía Amuay, Venezuelan Caribbean, specimens of an undescribed species of Caligus Müller were collected. It resembles Caligus xystercus Cressey and Caligus ocyurus Cressey, both known only from the Caribbean Sea. The new species can be distinguished from these and other congeners by a combination of characters including the armature of legs 1 and 4, but mainly by its unique female genital complex. This is the first species of Caligus described from Venezuela. The species is described in full and a key to the species of the genus recorded in Venezuela is provided. PMID:22768004

  20. A new anchialine Stephos Scott from the Yucatan Peninsula with notes on the biogeography and diversity of the genus (Copepoda, Calanoida, Stephidae

    Directory of Open Access Journals (Sweden)

    Eduardo Suárez-Morales

    2017-04-01

    Full Text Available Surveys of the anchialine crustacean fauna of the Yucatan Peninsula (YP, Mexico, have revealed the occurrence of calanoid copepods. The genus Stephos Scott, 1892, belonging to the family Stephidae is among the most frequent and widely distributed groups in anchialine caves but has not been hitherto recorded from the YP. Recent collections from an anchialine cave in an island off the northern coast of the YP yielded many specimens of a new species of Stephos. The new taxon, S. fernandoi sp. n., is described here based on male and female specimens. The new species is clearly distinguished from its congeners by the following characters: male left fifth leg with three terminal lamellae plus subdistal process, right leg with distal row of peg-like elements; female fifth leg with single long, acute apical process; genital double-somite with two rows each of 4 long spinules adjacent to operculum; legs 2-4 with articulated setae. The diversity of the genus shows regional differences; the Australia-Western Pacific region is the most diverse (eleven species, followed by the Mediterranean (seven species and the Northeastern Atlantic (six species; only four species are known from the Northwestern Tropical Atlantic (NWTA. The morphology of the female fifth leg was examined to explore possible biogeographic trends in the genus; patterns suggest multiple colonization events in the highly diverse regions and a relatively recent radiation in the NWTA, characterized by anchialine forms. The introduction of stephid copepods in the region may be a relatively recent event derived from colonization of benthopelagic ancestral forms and subsequent invasion onto cave habitats. The new species appears to be linked to the strictly anchialine Miostephos.

  1. Host specificity of Lepeophtheirus crassus (Wilson and Bere) (Copepoda: Caligidae) parasitic on the marlin sucker Remora osteochir (Cuvier) in the Atlantic Ocean.

    Science.gov (United States)

    Ho, Ju-shey; Collete, Bruce B; Madinabeitia, Ione

    2006-10-01

    Three species of remoras--Remora brachyptera (Lowe), Remora osteochir (Cuvier), and Remora remora (Linnaeus)--were collected from 4 species of billfishes--Istiophorus platypterus (Shaw), Makaira nigricans Lacepéde, Tetrapturus albidus Poey, and Tetrapturus pfluegeri Robins and de Sylva--on board a Japanese long-liner Shoyo Maru during her cruise in 2002 across the Atlantic. However, only the marlin sucker (R. osteochir) was found to carry a parasitic copepod, Lepeophtheirus crassus (Wilson and Bere, 1936). Although 12 species of parasitic copepods have been reported from billfishes around the world ocean, none of them is L. crassus. Thus, L. crassus is considered a parasite specific to the marlin sucker.

  2. Review of Pennella Oken, 1816 (Copepoda: Pennellidae) with a description of Pennella benzi sp. nov., a parasite of Escolar, Lepidocybium flavobrunneum (Pisces) in the northwest Atlantic Ocean.

    Science.gov (United States)

    Hogans, W E

    2017-03-17

    The genus Pennella Oken, 1816, mesoparasitic copepods from marine fish and mammals, is reviewed with the objective of determining the validity of members of the genus. Details of the external morphological structures of the adult female are presented. Pennella species are differentiated based on a combination of characters: the type of host parasitized, overall length of the parasite, shape, size and configuration of cephalothoracic papillae, segmentation of the first and second antenna, holdfast horn number, shape and configuration, and structure of the abdominal plumes. A new species of Pennella, Pennella benzi sp. nov., is described from the escolar, Lepidocybium flavobrunneum in the northwest Atlantic. Pennella balaenoptera Koren & Danielssen, 1877 is reported from the harbor porpoise (Phocaena phocaena) in the Bay of Fundy, a new locality record. The validity of 44 species is assessed; nine species (P. balaenoptera Koren & Danielssen, 1877, P. benzi sp. nov., P. diodontis Oken, 1816, P. exocoeti (Holten, 1802), P. filosa Linnaeus, 1758, P. hawaiiensis Kazachenko & Kurochkin, 1974, P. instructa Wilson, 1917, P. makaira Hogans, 1988 and P. sagitta Linnaeus, 1758) are considered substantiated and valid; six species (P. elegans Gnanamuthu, 1957, P. longicauda Gnanamuthu, 1957, P. platycephalus Gnanamuthu, 1957, P. remorae Murray, 1856, P. robusta Gnanamuthu, 1957, and P. selaris Kirtisinghe, 1964) exhibit unique characteristics, but are based on descriptions of single specimens, have not been found since the original reports and are considered as species inquirendae; the remaining species are unsubstantiated and invalid based on inadequate or missing original descriptions, or are designated as synonyms of valid species. A key to the valid species of the genus is provided.

  3. New species of Pseudodiaptomus (Copepoda: Calanoida) from the salt pans of the Gulf of Kutch, India and a comment on its speciation

    Digital Repository Service at National Institute of Oceanography (India)

    Madhupratap; Haridas, P.

    A new species of calanoid copepod Pseudodiaptomus pankajus (family Pseudodiaptomidae) is described from the north-west coast of India. This species inhabits high saline waters of salt pans. It appears to have evolved allopatrically during...

  4. Vertical distribution and structure of copepod (Arthropoda: Copepoda assemblages in two different seasons down to 1,200 m in the tropical Southwestern Atlantic

    Directory of Open Access Journals (Sweden)

    Cristina de Oliveira Dias

    2018-05-01

    Full Text Available ABSTRACT The vertical distribution of copepod assemblages, ascertained from the surface down to 1,200 m, was investigated during two sampling periods (rainy and dry seasons, at four depths, in the oligotrophic waters of the southwestern Atlantic Ocean. Total density, diversity, and richness differed among sampling depths. Copepod density decreased with depth in the two sampling periods, with a maximum at 1 m and a slight decrease at 800 m. Higher diversities were observed at 250 m and 1,200 m during the rainy season and at 1 m and 1,200 m during the dry season. The maximum number of species was found at 1,200 m during the rainy season and at 1 m during the dry season. Various copepod assemblages were delimited in the water column in the two sampling periods. The deeper copepod assemblages occupied a wider range of depths. Salinity and temperature influenced the structure of copepod assemblages and reflected the hydrographic characteristics of the water masses in the region. Candacia pachydactyla (Dana, 1849, Scolecithrix danae (Lubbock, 1856, and Agetus limbatus (Brady, 1883 were the indicator species found at 1 m. The effects of different environmental factors on the copepod assemblages suggest that these consortia occupy distinct niches in the ocean.

  5. Redescriptions of two species of Lepeophtheirus (Copepoda, Siphonostomatoida, Caligidae parasitic on teleost marine fishes from the coastal zone of the State of Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    José Luis Luque

    2000-12-01

    Full Text Available Two species of Lepeophtheirus Nordmann, 1832 parasitic on the ariid fish Netuma barba Lacépède, 1803, and the bothiid fish Paralichthys sp. from the coastal zone of the State of Rio de Janeiro, are redescribed and illustrated: L. bagri Dana, 1852, and L. monacanthus Heller, 1865. New junior synonyms for these species are proposed: L. marginatus syn.n., L. christianensis syn.n. and L. platensis syn.n. of L. bagri and L. unispinosus syn.n. of L. monacanthus.

  6. Ergasilus turkayi n. sp. (Copepoda, Cyclopoida, Ergasilidae: a gill parasite of Serrasalmus hollandi Jégu, 2003 (Characiformes, Serrasalmidae from the Paragua River, Bolivia

    Directory of Open Access Journals (Sweden)

    Taísa M. Marques

    Full Text Available Abstract A new parasitic copepod species, Ergasilus turkayi n. sp., found on the gills of the Holland’s piranha, Serrasalmus hollandi Jégu, 2003, in the Paragua River, Bolivia, is described based on 10 adult females. The new species presents a triangular-shaped cephalothorax, spinules on interpodal plates and aesthetascs on antennule - two aesthetascs on the sixth, and one aesthetasc plus two setae on the fifth segment. Additionally, the second abdominal somite of E. turkayi n. sp. bears an anal pseudoperculum, a dorsal and elongate projection which is usually absent or vestigial in poecilostome families within the Cyclopoida but that was never reported in species of Ergasilidae.

  7. Scanning electron microscopy of damage caused by Mesocyclops thermocyclopoides (Copepoda: Cyclopoidea on larvae of the Dengue fever vector Aedes aegypti (Diptera: Culicidae

    Directory of Open Access Journals (Sweden)

    Stefan Schaper

    2006-09-01

    Full Text Available Dengue fever is a mosquito-borne viral disease, whose main biological vector is Aedes aegypti. This mosquito colonizes tropical areas where the disease is endemic. The most obvious action against dengue is attacking its vector. Biological control appears to be an alternative approach, using natural enemies of the mosquitoes, such as predatory copepods. Thus, the morphological study of the damage caused by copepods is important to understand its predatory capacity. Twenty-five A. aegypti larvae were exposed to the copepod Mesocyclops thermocyclopoides and the damage caused by the copepods was evaluated using scanning electron microscopy. The larvae showed damage mainly at the anal segment, the siphon and the abdomen; only three attacks to the head were observed. The size of the siphon might be of importance in determining whether or not a copepod will attack a mosquito larva. Rev. Biol. Trop. 54 (3: 843-846. Epub 2006 Sept. 29.El dengue es una enfermedad viral transmitida por mosquitos, cuyo principal vector es Aedes aegypti. Este mosquito coloniza muchas áreas tropicales donde la enfermedad es endémica. La acción más obvia contra el dengue es el ataque a su vector. El control biológico parece una buena alternativa, empleando enemigos naturales de los mosquitos, como los copépodos. Por lo tanto, es importante el estudio morfológico del daño causado por los copépodos para comprender su capacidad depredadora. Veinticinco larvas de A. aegypti fueron expuestas a la actividad depredadora del copépodo Mesocyclops thermocyclopoides. Mediante microscopia electrónica de rastreo se evaluó el daño causado por los copépodos. Éstos atacaron principalmente el segmento anal, el sifón y el abdomen de las larvas; sólo vimos tres ataques a la cabeza. El tamaño del sifón podría ser de importancia para predecir si los copépodos pudiesen atacar larvas de determinado mosquito.

  8. A new species of the rare endoparasitic copepod Entobius (Copepoda: Entobiidae) from Mexico with a key to the species of the genus.

    Science.gov (United States)

    Suárez-Morales, Eduardo; Carrera-Parra, Luis F

    2012-09-01

    Abstract: In a study of the benthic polychaete fauna of the southern Gulf of Mexico and the Caribbean Sea, several specimens of the terebellid polychaete Scionides reticulata (Ehlers) were found to host endoparasitic copepods that represent an undescribed species of the rare cyclopoid genus Entobius Dogiel, 1948. The new species, E. scionides sp. n., can be distinguished from its congeners by a combination of characters including a genital region without constrictions, three-segmented antennules, a reduced antenna with a blunt terminal process, reduced ornamentation of endopods of legs 1-4 and its relatively small size (2.3-2.7 mm). It is the smallest species of the genus. Comments on immature females are also provided, but males of this species remain unknown. It has a high prevalence (53%) in populations of the terebellid S. reticulata in the southern Gulf of Mexico, but it is absent from the Caribbean. This is the first occurrence of this copepod genus in the Americas. The finding of the new species of Entobius in S. reticulata confirms the strict specificity of most members of the genus and expands the host range of this copepod genus. A key for the identification of the species of Entobius is provided.

  9. Spatial and temporal distribution in density and biomass of two Pseudodiaptomus species (Copepoda: Calanoida in the Caeté river estuary (Amazon region - North of Brazil

    Directory of Open Access Journals (Sweden)

    A. Magalhães

    Full Text Available Spatial and temporal density and biomass distribution of the planktonic copepods Pseudodiaptomus richardi and P. acutus along a salinity gradient were investigated in the Caeté River Estuary (North-Brazil in June and December, 1998 (dry season and in February and May, 1999 (rainy season. Copepod biomass was estimated using regression parameters based on the relation of dry weight and body length (prosome of adult organisms. The Caeté River Estuary was characterized by high spatial and temporal variations in salinity (0.8-37.2‰. Exponential length-weight relationships were observed for both Pseudodiaptomus species. Density and biomass values oscillated between 0.28-46.18 ind. m-3 and 0.0022-0.3507 mg DW. m-3 for P. richardi; and between 0.01-17.02 ind. m-3 and 0.0005-0.7181 mg DW. m-3 for P. acutus. The results showed that the contribution of P. richardi for the secondary production in the Caeté River Estuary is more important in the limnetic zone than in other zones where euhaline-polyhaline regimes were predominant. However, it was not possible to observe a clear pattern of spatial and temporal distribution for P. acutus.

  10. Discovery of the male of the rare caligiform copepod Kabataia Kazachenko, Korotaeva & Kurochkin, 1972 (Copepoda: Siphonostomatoida), with a reconsideration of its phylogenetic affinities.

    Science.gov (United States)

    Hutson, Kate S; Boxshall, Geoffrey A

    2016-10-11

    We report the discovery of the male of the rare caligiform copepod Kabataia ostorhynchi Kazachenko, Korotaeva & Kurochkin, 1972 on the gills of the type-host Oplegnathus woodwardi (Waite, 1900) captured in the Southern Ocean, off Australia. Light and scanning electron microscopy confirmed the unusual body plan of Kabataia Kazachenko, Korotaeva & Kurochkin, 1972, where only the first pedigerous somite is incorporated into the cephalothorax and the second and third pedigerous somites are fused to form a double-somite, visible both dorsally and ventrally. The adult female carries paired dorsal plates originating from the second pedigerous somite within this double-somite. In the male the second and third pedigerous somites are free and paired dorsal plates are present on the former. Kabataia exhibits sexual dimorphism in an unusually wide range of limbs. Most remarkable is the tubular extension from the exit pore of the maxillary gland at the base of the maxilla which reaches beyond the anterior margin of the mouth tube; this is present in the male only. Kabataia exhibits a functional articulation between the first and second pedigerous somites and thus lacks the diagnostic apomorphy of the family Trebiidae (incorporation of both first and second pedigerous somites into the cephalothorax). We propose to transfer Kabataia to the Pandaridae, since it shares the key synapomorphies of this family. Furthermore, we propose to transfer Innaprokofevnas Kazachenko, 2001 to the Dissonidae, which leaves Trebius Krøyer, 1838 as the only genus within the Trebiidae. The correct spelling of Philorthragoriscus Horst, 1897 is noted.

  11. A new subspecies of Nitokra affinis Gurney, 1927 (Copepoda, Harpacticoida from the Caribbean coast of Colombia

    Directory of Open Access Journals (Sweden)

    Juan Fuentes

    2014-02-01

    Full Text Available Plankton samples from Laguna Navio Quebrado, La Guajira, northern Colombia, yielded male and female specimens of an harpacticoid copepod that was first identified as the widely distributed species Nitokra affinis Gurney, 1927 for which at least four subspecies have been described from different geographic areas. A more detailed examination of the Colombian specimens revealed that it differs from the other morphs so far considered as subspecies. The Colombian specimens differ from the other four known subspecies in the following aspects: (1 rostrum with long projection, (2 relatively long exopod of P1, almost as long as first endopodal segment, (3 endopodal and exopodal rami of P2 equally long, (4 a reduced number of endopodal setal elements of the male P5. It also differs from N. a. californica Lang in details of the ornamentation of the urosomites. Descriptions and illustrations of this new subspecies, the first one described from the Neotropical region, are presented together with a key to the five known subspecies of Nitokra affinis. As in many other cases of presumedly widespread species of harpacticoids, it is possible that N. affinis represents a species complex with more restricted distributional patterns, a notion that certainly deserves further study.

  12. Effects of elevated carbon dioxide (CO2) concentrations on early developmental stages of the marine copepod Calanus finmarchicus Gunnerus (Copepoda: Calanoidae).

    Science.gov (United States)

    Pedersen, Sindre Andre; Våge, Vegard Thorset; Olsen, Anders Johny; Hammer, Karen Marie; Altin, Dag

    2014-01-01

    Ocean acidification poses an ongoing threat to marine organisms, and early life stages are believed to be particularly sensitive. The boreal calanoid copepod Calanus finmarchicus seasonally dominates the standing stock of zooplankton in the northern North Sea and North Atlantic, and due to its size and abundance is considered an ecological key species linking energy from primary producers to higher trophic levels. To examine whether the early stages of C. finmarchicus are particularly vulnerable to elevated levels of CO2, eggs and nauplii were subjected to different levels of CO2-acidified seawater for 1 wk. The first experiment, with eggs as the starting point, revealed no marked effect on hatching success, but a significant reduction in nauplii survival during incubation at 8800 ppm CO2. In addition, a significant decrease in ontogenetic development rate during incubation at 8800 ppm CO2 was observed in this experiment. In the second experiment, where third-stage nauplii represented the starting point, no significant effects on ontogenetic development and survival following exposure to pCO2 ≥ 7700 ppm were observed. Data suggest that the two first nauplii stages, which are fed endogenously, may be more vulnerable and therefore likely to represent the "bottleneck" for this species in a more acidic ocean. However, the absence of significant effects in the most sensitive stages during exposure to 2800 ppm CO2, a level that is well above worst-case scenario predictions for year 2300 (approximately 2000 ppm CO2), suggests that this species may be generally robust to direct effects of ocean acidification.

  13. Potential zooplankton preys (Copepoda and Appendicularia for Engraulis anchoita in relation to early larval and spawning distributions in the Patagonian frontal system (SW Atlantic Ocean

    Directory of Open Access Journals (Sweden)

    Mariela L. Spinelli

    2011-11-01

    Full Text Available We investigated the spatial distribution of the abundance, biomass and size of zooplankton (nauplii, calanoids, cyclopoids and appendicularians in relation to the distribution of first-feeding larvae and eggs of Engraulis anchoita across the frontal system of Peninsula Valdés. Twelve samples of zooplankton and ichthyoplankton were taken with small Bongo (67 μm and Pairovet (200 μm nets during the spring of 2004 along two transects. The total abundance of zooplankton and the chlorophyll a concentration were higher in homogeneous waters, while total biomasses were higher in stratified waters. Temperature was negatively correlated with biological variables and was the main factor affecting the zooplankton distribution. In both transects, abundance peaks of first-feeding larvae were detected at coastal stations along with the smallest fraction of zooplankton ( < 500 μm, while the largest fraction was dominant at the external stations, coinciding with the highest egg abundance. The physical structure of this front generates different levels of food availability for first-feeding larvae. Calanoids (southern transect and cyclopoids (northern transect are predominant followed by nauplii and appendicularians. The biomass of zooplankton preys contributes to the carbon transfer to the upper trophic levels and is probably important for the survival and growth of anchovy larvae in this frontal system.

  14. A new species of Caligus (Copepoda, Siphonostomatoida from the plankton of the Caribbean coast of Venezuela with a key to species

    Directory of Open Access Journals (Sweden)

    Eduardo Suarez-Morales

    2012-06-01

    Full Text Available During a survey of the zooplankton community of Bahía Amuay, Venezuelan Caribbean, specimens of an undescribed species of Caligus Müller were collected. It resembles C. xystercus Cressey and C. ocyurus Cressey, both known only from the Caribbean Sea. The new species can be distinguished from these and other congeners by a combination of characters including the armature of legs 1 and 4, but mainly by its unique female genital complex. This is the first species of Caligus described from Venezuela. The species is described in full and a key to the species of the genus recorded in Venezuela is provided.

  15. Genetic Diversity and Population Structure of Two Freshwater Copepods (Copepoda: Diaptomidae, Neodiaptomus schmackeri (Poppe and Richard, 1892 and Mongolodiaptomus birulai (Rylov, 1922 from Taiwan

    Directory of Open Access Journals (Sweden)

    Shuh-Sen Young

    2013-11-01

    Full Text Available We used the mitochondria DNA COI (cytochrome c oxidase subunit I sequence as a genetic marker to analyze the population genetic structure of two species of freshwater copepods, Neodiaptomus schmackeri (Poppe and Richard, 1892 and Mongolodiaptomus birulai (Rylov, 1922 from Taiwan. Four populations with 51 individuals of N. schmackeri and five populations with 65 individuals of M. birulai were included. We compared the nucleotide sequences of a 635-bp fragment of the COI gene of N. schmackeri and a 655-bp fragment of the COI gene of M. birulai, and eight and 14 unique haplotypes were recorded, respectively. Tseng-Wen reservoir and Wu-San-Tao reservoir are linked by a channel, and the gene flow between them was unrestricted (Fst = 0.058; Nm = 4.04; Fst, population differentiation parameter; Nm, the number of succesfull migrants per generation; the gene flow between all other populations of both species was restricted (Fst = 0.4–0.99; Nm = 0–0.37. Based on the COI gene diversification pattern, we suggest that most populations of N. schmackeri and M. birulai are isolated from each other. According to the neighbor-joining tree and the minimum spanning network (MSN, the species have similar metapopulation genetic structures. Genetic distance was not found to be correlated with geographical distance. The genetic diversification pattern was not shown to be comparable with geographical isolation owing to long-distance separation. The genetic structure of the present populations may result from serial extinction and redistribution of the populations formed in each reservoir relative to time. Human activity in the reservoirs with regards to water resource management and the fishery industry also exerts an effect on population redistribution.

  16. Exotic "Gill Lice" Species (Copepoda: Lernaeopodidae: Salmincola SPP.) Infect Rainbow Trout (Oncorhynchus mykiss) and Brook Trout (Salvelinus fontinalis) in the Southeastern United States.

    Science.gov (United States)

    Ruiz, Carlos F; Rash, Jacob M; Besler, Doug A; Roberts, Jackson R; Warren, Micah B; Arias, Cova R; Bullard, Stephen A

    2017-08-01

    Salmincola californiensis infected 25 of 31 (prevalence 0.8; intensity 2-35 [mean 6.6 ± standard deviation 7.7; n = 25]) rainbow trout, Oncorhynchus mykiss, from a private trout farm connected to the Watauga River, North Carolina. Salmincola edwardsii infected all of 9 (1.0; 2-43 [9.3 ± 13.0; 9]) brook trout, Salvelinus fontinalis, from Big Norton Prong, a tributary of the Little Tennessee River, North Carolina. Both lernaeopodids are well-known salmonid pathogens, but neither is native to, nor has been previously taxonomically confirmed from, the southeastern United States. Herein, we (1) use light and scanning electron microscopy to identify and provide supplemental morphological observations of these lernaeopodids, (2) furnish complementary molecular sequence data from the 28S rDNA (28S), and (3) document the pathological effects of gill infections. We identified and differentiated these lernaeopodids by the second antenna (exopod tip with large [S. californiensis] vs. slender [S. edwardsii] spines; endopod terminal segment with subequal ventral processes shorter than [S. californiensis] vs. longer than or equal to [S. edwardsii] dorsal hook), maxilliped palp (length typically ≤1/3 [S. californiensis] vs. 1/3-1/2 [S. edwardsii] subchela length exclusive of claw), and bulla (sub-circular and concave on manubrium's side [S. californiensis] vs. non-stellate [S. edwardsii]). Analysis of the 28S rDNA sequences confirmed our taxonomic assignments as demonstrated by 100% sequence similarity among the sympatric, morphologically-conspecific isolates. Histopathology revealed focal gill epithelial hyperplasia, obstruction of interlamellar water channels, lamellar fusion, and crypting of gill filaments. High intensity infections by either lernaeopodid are surveillance-worthy because they are potentially pathogenic to trout in the southeastern United States.

  17. A new genus of speleophriid copepod (Copepoda: Misophrioida) from a cenote in the Yucatan, Mexico with a phylogenetic analysis at the species level.

    Science.gov (United States)

    Boxshall, Geoff A; Zylinski, Sarah; Jaume, Damià; Iliffe, Thomas M; Suárez-Morales, Eduardo

    2014-06-23

    A new genus and species of speleophriid copepod, Mexicophria cenoticola gen. et sp. nov., is described based on material collected from a cenote in the Yucatan Peninsula of Mexico. It is characterised by relatively reduced fifth legs that are located adjacent to the ventral midline in both sexes, by the possession of a bulbous swelling on the first antennulary segment in both sexes, and by the reduced setation of the swimming legs. The presence of just one inner margin seta on the second endopodal segment of legs 2 to 4 is a unique feature for the family. A phylogenetic analysis places the new genus on a basal lineage of the family together with its sister taxon, Boxshallia Huys, 1988, from Lanzarote in the Canary Islands, and recovers the existing genera as monophyletic units. The zoogeography is discussed at local, regional, ocean basin  and global scales.

  18. Short-term variation of nutritive and metabolic parameters in Temora longicornis females (Crustacea, Copepoda) as a response to diet shift and starvation

    Science.gov (United States)

    Kreibich, Tobias; Saborowski, Reinhard; Hagen, Wilhelm; Niehoff, Barbara

    2008-09-01

    Changes in fatty acid patterns, digestive and metabolic enzyme activities and egg production rates (EPR) were studied in the small calanoid copepod Temora longicornis. Female copepods were collected in spring 2005 off Helgoland (North Sea). In the laboratory one group of copepods was fed with the cryptophycean Rhodomonas baltica for a period of 3 days. Another group of copepods was maintained without food. According to the fatty acid patterns, animals from the field were feeding on a more detrital, animal-based and to a minor extent to a diatom-based diet. Under laboratory conditions, females rapidly accumulated fatty acids such as 18:4 (n-3), 18:3 (n-3) and 18:2 (n-6) which are specific of R. baltica. Diatom-specific fatty acids such as 16:1 (n-7) were strongly reduced. In fed animals the activities of digestive and metabolic enzymes remained constant and egg production rates were highest on day 2. Starving animals, in contrast, showed significantly reduced faecal pellet production and EPR. Proteolytic enzyme activity decreased rapidly within 24 h and remained at a low level until the end of the experiment. Citrate synthase decreased continuously as well. T. longicornis rapidly reacts to dietary changes and food depletion. It has limited energy stores and, thus, strongly depends on continuous food supply.

  19. Consequences of energy conservation violation: late time solutions of Λ(T)CDM subclass of f(R,T) gravity using dynamical system approach

    Energy Technology Data Exchange (ETDEWEB)

    Shabani, Hamid [University of Sistan and Baluchestan, Physics Department, Faculty of Sciences, Zahedan (Iran, Islamic Republic of); Ziaie, Amir Hadi [Islamic Azad University, Department of Physics, Kahnooj Branch, Kerman (Iran, Islamic Republic of)

    2017-05-15

    Very recently, Josset and Perez (Phys. Rev. Lett. 118:021102, 2017) have shown that a violation of the energy-momentum tensor (EMT) could result in an accelerated expansion state via the appearance of an effective cosmological constant, in the context of unimodular gravity. Inspired by this outcome, in this paper we investigate cosmological consequences of a violation of the EMT conservation in a particular class of f(R,T) gravity when only the pressure-less fluid is present. In this respect, we focus on the late time solutions of models of the type f(R,T) = R + βΛ(-T). As the first task, we study the solutions when the conservation of EMT is respected, and then we proceed with those in which violation occurs. We have found, provided that the EMT conservation is violated, that there generally exist two accelerated expansion solutions of which the stability properties depend on the underlying model. More exactly, we obtain a dark energy solution for which the effective equation of state depends on the model parameters and a de Sitter solution. We present a method to parametrize the Λ(-T) function, which is useful in a dynamical system approach and has been employed in the model. Also, we discuss the cosmological solutions for models with Λ(-T) = 8πG(-T){sup α} in the presence of ultra-relativistic matter. (orig.)

  20. Effect of IgG subclasses on in vivo bioavailability and metabolic fate of immune-complexed insulin in Lewis rats

    International Nuclear Information System (INIS)

    Arquilla, E.R.; Stenger, D.; McDougall, B.; Ulich, T.R.

    1987-01-01

    The bioavailability, distribution, and metabolic fate of 125 I-labeled insulin complexed to antibodies in guinea pig antiserum, purified guinea pig IgG1, IgG2, a mixture of IgG1 and IgG2, and homologous Lou/m rat antiserum were studied in inbred Lewis rats. 125 I-insulin complexed to purified guinea pig IgG2 antibodies was rapidly cleared from the blood and sequestered in increasing amounts with time in the liver. Large amounts of the 125 I-insulin complexed to guinea pig IgG1 antibodies remained in the blood for at least 30 min. The bioavailability of 125 I-insulin bound to IgG1 and IgG2 antibodies was inhibited for at least 30 min because significantly less was available for rapid binding to insulin receptors on hepatocytes and renal tubular cells and its subsequent rapid degradation. The bioavailability of 125 I-insulin was further decreased when bound to antibodies in native guinea pig antiserum or a mixture of IgG1 and IgG2 antibodies compared with the 125 I-insulin complexed to either purified IgG1 or IgG2 antibodies alone. The 125 I-insulin bound to antibodies in native guinea pig antiserum or a mixture of IgG1 and IgG2 antibodies was distributed in vivo in a manner reflecting the relative concentrations of the IgG1 and IgG2 antibodies present. The bioavailability, distribution, and metabolic fate of 125 I-insulin in immune complexes prepared with homologous Lou/m rat insulin antiserum was qualitatively similar to that observed with immune complexes prepared with guinea pig insulin antiserum. It appears that the Lewis rat can be used as an in vivo model to study the bioavailability,distribution,and metabolic fate of insulin bound to xenogenic or homologous insulin antibodies

  1. A Regional Guidebook for Applying the Hydrogeomorphic Approach to Assessing Wetland Functions of Selected Regional Wetland Subclasses, Yazoo Basin, Lower Mississippi River Alluvial Valley

    National Research Council Canada - National Science Library

    SMith, R

    2002-01-01

    .... However, a variety of other potential uses have been identified, including the determination of minimal effects under the Food Security Act, design of wetland restoration projects, and management of wetlands...

  2. Short-term changes in lipoprotein subclasses and C-reactive protein levels of hypertriglyceridemic adults on low-carbohydrate and low-fat diets.

    Science.gov (United States)

    Stoernell, Colene K; Tangney, Christy C; Rockway, Susie W

    2008-07-01

    Diets designed to promote weight loss and improve atherogenic lipid profiles traditionally include a reduction in total fat and, in particular, saturated fats. This study was designed to test the efficacy of a low-fat diet vs a carbohydrate (CHO)-restricted (low-CHO) diet in hypertriglyceridemic patients on lipid profile, weight loss, high-sensitivity C-reactive protein (hs-CRP), and satiety. Twenty-eight hypertriglyceridemic subjects (based on fasting triacylglycerol [TG] levels exceeding 1.69 mmol/L) were randomized to either the low-CHO or low-fat diet for 8 weeks. Fasting bloods were acquired at weeks 0 and 8 and analyzed for lipids and hs-CRP. Body weight and other anthropometric measures were also obtained. Three random 24-hour food recalls were used to assess compliance during the trial and 2 recalls before randomization to permit individualized dietary education. A significant time-by-treatment interaction was observed (P = .045), wherein the small low-density lipoprotein cholesterol concentrations were reduced by 46% in the low-CHO-assigned subjects and increased by 36% for those assigned the low-fat plan. The observed decrease in TG (18%) among low-CHO subjects, in contrast to the 4% increase for low-fat group, was not significant, nor were there significant differences in hs-CRP, overall dietary compliance, satiety, or the magnitude of body weight loss between groups (low-CHO group, -3.8% vs low-fat group, -1.6%). Favorable reductions in small low-density lipoprotein concentrations after 8 weeks suggest that a moderately restricted carbohydrate diet (20% CHO as energy) can promote a less atherogenic lipid profile when compared to the low-fat diet.

  3. The blocking activity of birch pollen-specific immunotherapy-induced IgG4 is not qualitatively superior to that of other IgG subclasses

    DEFF Research Database (Denmark)

    Ejrnaes, Anne M; Bødtger, Uffe; Larsen, Jørgen N

    2004-01-01

    IgE were detected using 125I-labelled rBet v 1.2801, a recombinant variant of the major allergen of Betula verrucosa pollen. Results show that IgG4-depletion resulted in equivalent reductions in binding and blocking activities. In contrast, a significant but less than two-fold higher relative...... for the clinical efficacy of SIT. In this study, fractionated serum samples from 14 SIT-treated birch pollen allergic individuals enabled determination of the inhibitory capacity of IgG4 alone versus non-IgG4 IgG. Allergen-binding activities of IgG and the IgG-mediated inhibition of allergen binding to autologous...

  4. In vitro functional test of two subclasses of an anti-RhD antibody produced by transient expression in COS cells

    DEFF Research Database (Denmark)

    Nielsen, Leif Kofoed; Norderhaug, Lars; Sandlie, Inger

    2006-01-01

    For over 35 years hemolytic disease of the fetus and newborn (HDFN) due to RhD has been effectively prevented by anti-RhD antibodies obtained from alloimmunized women or deliberately immunized men. However, due to the reduced number of immunized women and for ethical reasons it is foreseen...

  5. Whole-cell or acellular pertussis vaccination in infancy determines IgG subclass profiles to DTaP booster vaccination

    NARCIS (Netherlands)

    van der Lee, Saskia; Sanders, Elisabeth A.M.; Berbers, Guy A M; Buisman, Anne-Marie

    2018-01-01

    Introduction Duration of protection against pertussis is shorter in adolescents who have been immunized with acellular pertussis (aP) in infancy compared with adolescents who received whole-cell pertussis (wP) vaccines in infancy, which is related to immune responses elicited by these priming

  6. Whole-cell or acellular pertussis vaccination in infancy determines IgG subclass profiles to DTaP booster vaccination.

    NARCIS (Netherlands)

    van der Lee, Saskia; Sanders, Elisabeth A M; Berbers, Guy A M; Buisman, Anne-Marie

    2018-01-01

    Duration of protection against pertussis is shorter in adolescents who have been immunized with acellular pertussis (aP) in infancy compared with adolescents who received whole-cell pertussis (wP) vaccines in infancy, which is related to immune responses elicited by these priming vaccines. To better

  7. Microcrustacean assemblages composition and environmental variables in lakes and ponds of the Andean region - South of Chile (37-39° S Composição de comunidades de microcustáceos e variáveis ambientais em lagos e lagoas da região andina - sul do Chile (37-39° S

    Directory of Open Access Journals (Sweden)

    P. De los Ríos-Escalante

    2011-05-01

    Full Text Available The zooplankton assemblages in Chilean Patagonian lakes are characterised mainly by their low biodiversity and high predominance of calanoids copepods, a pattern that has been studied for large and deep lakes between 38-51° S, and shallow ponds at 51° S. The aim of the present study was analyse the zooplankton assemblages in different water bodies located in coastal zones, middle valleys and mountain zones between 37-39° S. For this purpose, the following variables were considered: maximum depth, latitude, altitude, chlorophyll-a and species number, and to these variables, a Principal Component Analysis (PCA was applied. A co-occurrence null model analysis was also applied for determining the existence of a random process in crustacean species associations. The results denoted low species richness, and different species associations for studied sites, and the null model analysis revealed the absence of a random process as regulator of species associations. Furthermore, a low species/genera ratio was identified, which denotes low productivity of the studied sites. These results were supported by a PCA analysis which denoted that the main determinant factors are chlorophyll concentration and species number that are directly associated. The obtained results are in agreement with descriptions in the literature for species diversity for lakes of Chilean Patagonia that describes oligotrophy as the main regulator of zooplankton assemblages. Other ecological and limnological topics are discussed in the present study.As comunidades zooplantônicas em lagos chilenos são caracterizadas, principalmente, por sua baixa biodiversidade e alta predominância de copépodos calanoides, um padrão que tem sido estudado em lagos grandes e profundos entre 38-51° S, e lagoas rasas em 51° S. O objetivo do presente estudo foi analisar as comunidades zooplantônicas em diferentes corpos de água localizados em zonas costeiras, vales intermediários e regiões de montanhas entre 37-39° S. Para este propósito, as seguintes variáveis foram consideradas: profundidade máxima, latitude, altitude, clorofila "a" e número de espécies, e a estas variáveis, foi aplicada a Análise de Componentes Principais (PCA. Um modelo nulo de coocorrência também foi aplicado para determinar a existência de um processo aleatório na associação de espécies de crustáceos. Os resultados denotam baixa diversidade de espécies e diferentes associações de espécies nos diferentes locais estudados, e o modelo nulo de análises revelou a ausência de um processo aleatório como regulador de associação de espécies. Além disso, a baixa relação espécie/gênero foi identificada, o que denota baixa produtividade dos locais estudados. Estes resultados foram apoiados pelas análises de PCA que mostraram que os fatores determinantes principais como a concentração de clorofila e número de espécies estão diretamente associados. Os resultados obtidos concordam com as descrições na literatura sobre a diversidade de espécies para lagos da Patagônia Chilena, que descreve a oligotrofia como principal regulador de comunidades zooplanctônicas. Outros tópicos ecológicos e limnológicos foram discutidos no presente estudo.

  8. Microcrustáceos y Vibrio cholerae O1 viable no cultivable (VNC: resultados en la Cuenca del Río Salí, Tucumán, Argentina Microcrustaceans and viable but nonculturable (VNC Vibrio cholerae O1: results in the Salí River basin, Tucumán, Argentina

    Directory of Open Access Journals (Sweden)

    Cecilia Locascio de Mitrovich

    2010-01-01

    Full Text Available Vibrio cholerae reside habitualmente en aguas marinas y continentales. Según las condiciones ambientales y los recursos le sean “favorables” o “desfavorables”, se generan estados viables cultivables (VC o viables no cultivables (VNC respectivamente y, bajo esta última forma sobrevive. Para abordar la problemática del cólera en la Cuenca del Río Salí (Tucumán, Argentina, se realizaron muestreos durante los años 2003-2005 donde se consideraron aspectos fisicos, químicos, biológicos y sanitarios. Para evaluar los probables reservorios del patógeno, se analizó el zooplancton del Río Salí (Canal Norte y Banda Río Salí y Río Lules. La mayor representatividad taxonómica la registraron los copépodos, especialmente Eucyclops neumani (Pesta, 1927, junto a Acanthocyclops robustus (Sars, 1863, Metacyclops sp., Paracyclops chiltoni y Notodiaptomus incompositus (Brian, 1925, además de algunos rotíferos y cladóceros como (Lecane sp., y (Brachionus sp., Moina sp. y Leydigia sp.. La frecuencia de ocurrencia fue baja y no superó el 25%. El Canal Norte fue ambiente más propicio por la riqueza específica, abundancia y constancia de la comunidad. Las variables fisicas y químicas asociadas al zooplancton coincidirían con los valores que por nuestros registros y los antecedentes, se conocen para el desarrollo del patógeno. En el período estival hubo coincidencia entre la presencia de la forma VNC de V. cholerae O1 (inmunofluorescencia con anticuerpos anti O1 y el desarrollo del zooplancton. Se observaron formas VNC sobre apéndices o estructuras de copépodos ciclopoideos y cladóceros quidóridos, reflejando probablemente afinidad con sustratos quitinosos.Vibrio cholerae habitually lives in marine and continental waters. According to "favourable" or "unfavourable" resources and environmental conditions, viable (VC or viable non-culturable (VNC states will be generated, surviving only the latter form. To address the problem of cholera in the Salí River Basin (Tucumán Argentina, samples were taken during the years 2003 to 2005, taking into consideration physic -chemical, biological and sanitary aspects. To infer about the probable reservoirs of the pathogen, we examined the zooplankton of the Salí River (“Canal Norte” and “Banda Río Salí” and Lules River. The highest taxonomic representation was recorded for copepods, especially Eucyclops neumani (Pesta, 1927, along with Acanthocyclops robustus (Sars, 1863, Metacyclops sp., Paracyclops chiltoni and Notodiaptomus incompositus (Brian, 1925, plus some rotifers and cladocerans such as Lecane sp. and Brachionus sp., Moina sp. and Leydigia sp. The occurrence frequency was low, not exceeding 25%. Canal Norte stood out as the best environment for the species richness, abundance and constancy of the community. The physicochemical variables associated with the zooplankton would coincide with the values that, for our records and previous reports, are known for the development of the pathogen. In summer periods there was coincidence between the presence of the VNC form of V. cholerae O1 (immunofluorescence with antibodies anti O1 and the development of zooplankton. VNC forms on ciclopoid copepods and chidorids cladocerans appendages or structures were observed, probably showing an affinity with chitin substrates.

  9. The mitochondrial genomes of Amphiascoides atopus and Schizopera knabeni (Harpacticoida: Miraciidae) reveal similarities between the copepod orders Harpacticoida and Poecilostomatoida.

    Science.gov (United States)

    Easton, Erin E; Darrow, Emily M; Spears, Trisha; Thistle, David

    2014-03-15

    Members of subclass Copepoda are abundant, diverse, and-as a result of their variety of ecological roles in marine and freshwater environments-important, but their phylogenetic interrelationships are unclear. Recent studies of arthropods have used gene arrangements in the mitochondrial (mt) genome to infer phylogenies, but for copepods, only seven complete mt genomes have been published. These data revealed several within-order and few among-order similarities. To increase the data available for comparisons, we sequenced the complete mt genome (13,831base pairs) of Amphiascoides atopus and 10,649base pairs of the mt genome of Schizopera knabeni (both in the family Miraciidae of the order Harpacticoida). Comparison of our data to those for Tigriopus japonicus (family Harpacticidae, order Harpacticoida) revealed similarities in gene arrangement among these three species that were consistent with those found within and among families of other copepod orders. Comparison of the mt genomes of our species with those known from other copepod orders revealed the arrangement of mt genes of our Harpacticoida species to be more similar to that of Sinergasilus polycolpus (order Poecilostomatoida) than to that of T. japonicus. The similarities between S. polycolpus and our species are the first to be noted across the boundaries of copepod orders and support the possibility that mt-gene arrangement might be used to infer copepod phylogenies. We also found that our two species had extremely truncated transfer RNAs and that gene overlaps occurred much more frequently than has been reported for other copepod mt genomes. Published by Elsevier B.V.

  10. The Afro-Asian cyclopoid Mesocyclops aspericornis (Crustacea: Copepoda in eastern Mexico with comments on the distribution of exotic copepods El cyclopoide afro-asiático Mesocyclops aspericornis (Crustacea: Copepoda en el este de México con comentarios sobre la distribución de copépodos exóticos

    Directory of Open Access Journals (Sweden)

    Eduardo Suárez-Morales

    2011-03-01

    Full Text Available The Afro-Asian freshwater copepod Mesocyclops aspericornis (Daday, 1906, deemed as an exotic species in the Americas, is known to occur disjunctly in Mexico, South America, and the insular Caribbean. Adult females of this species were recorded.from samples collected in the state of Veracruz, on the Atlantic coast of Mexico.The morphology of these specimens is identical in most characters to those described or depicted in previous taxonomic accounts. The 3 known Mexican populations belong to the "western" group of M. aspericornis. The subtle morphological variations among the Mexican populations and their isolation suggest that each could be the result of independent events of dispersion or introduction via aquaculture. This is the third confirmed report of M. aspericornis in Mexico, but the first one in the Atlantic side of Middle America. The states of Tabasco and Chiapas harbour 3 of the 4 species of exotic freshwater copepods known to occur in Mexico.El copépodo dulceacuícola afro-asiático Mesocyclops aspericornis (Daday, 1906, considerado como especie exótica en América, se sabía presente de modo disperso en México, Sudamérica y en las islas del Caribe. A partir de muestras recolectadas en el estado de Veracruz, en la costa del Atlántico de México, se registraron hembras adultas de esta especie. La morfología de estos ejemplares es idéntica en la mayoría de los caracteres a la descrita o ilustrada en trabajos taxonómicos previos. Las 3 poblaciones conocidas en México pertenecen al grupo "occidental" de M. aspericornis. Las sutiles variaciones morfológicas entre las poblaciones mexicanas y su aislamiento sugieren que cada una podría ser resultado de eventos independientes por dispersión o introducción vía la acuacultura. Este es el tercer registro confirmado de M. aspericornis en México, pero el primero en Mesoamérica en el lado del Atlántico. Los estados de Tabasco y Chiapas alojan 3 de las 4 especies de copépodos exóticos de aguas continentales que se conocen en México.

  11. Establishment of a new genus for Parastenocaris itica (Copepoda, Harpacticoida from El Salvador, Central America, with discussion of the Parastenocaris fontinalis and P. proserpina groups Proposta de um novo gênero para Parastenocaris itica (Copepoda, Harpacticoida de El Salvador, América Central e discussão dos grupos Parastenocaris fontinalis e P. proserpina

    Directory of Open Access Journals (Sweden)

    Paulo Henrique C. Corgosinho

    2012-01-01

    Full Text Available A new genus of Parastenocarididae is described from the Neotropical region. Iticocaris gen. nov. is established to include Parastenocaris itica Noodt, 1962. Iticocaris gen. nov. is defined by the following characters: 1 male leg 3 with 2-segmented exopod; 2 first exopodal segment short and rectangular; 3 thumb hypertrophic, longer than the second exopodal segment and inserted on the distal edge of exopod segment 1, occupying the whole distal margin; 4 exopod 2 or apophysis strongly sclerotized, articulated with the exopod segment 1 on its inner margin and curved against the thumb, forming a strong forceps; 5 leg 4 endopod without dimorphism in shape and size vs. minor dimorphism in ornamentation; 6 leg 5 with three setae and 7 lack of the anterolateral furcal seta II. The new genus is monotypic, represented by Iticocaris itica (Noodt, 1962 comb. nov., from El Salvador, Central America. A close relationship is hypothesized between I. itica and the genus Brasilibathynellocaris Jakobi, 1972, the males of which both share the forceps-like elongated apophysis.Um novo gênero de Parastenocarididae é proposto para a Região Neotropical para incluir Parastenocaris itica Noodt, 1962. Iticocaris gen. nov. é diagnosticado pela presença dos seguintes caracteres: 1 toracópodo 3 do macho com exópodo bissegmentado; 2 primeiro segmento exopodal curto e retangular; 3 "thumb" hipertrófico, mais longo que o segundo segmento do exópodo e inserido na margem distal do exópodo 1, ocupando toda a margem distal do segmento; 4 exópodo 2 ou apófise fortemente esclerotizado, articulado com o exópodo 1 em sua margem interna e curvado contra o "thumb", formando um forte fórceps; 5 endópodo do toracópodo 4 sem dimorfismo sexual quanto à forma e tamanho vs. discreto dimorfismo quanto à ornamentação; 6 toracópodo 5 com três cerdas e 7 furca sem a cerda anterolateral II. O novo gênero é monotípico, sendo representado por Iticocaris itica (Noodt, 1962 comb. nov., proveniente de El Salvador na América Central. É hipotetizado que I. itica e o gênero Brasilibathynellocaris Jakobi, 1972 sejam próximos filogeneticamente, possuindo os machos de ambos os gêneros uma apófise alongada e "thumb" formando uma estrutura similar a um fórceps.

  12. Kroyeria brasiliense sp. nov. (Copepoda, Kroyeriidaea gill parasite of the shark, Galeorhinus vitaminicus de Buen, in Rio Grande do Sul State, Brazil Kroyeria brasiliense sp. nov. (Copepoda, Kroyeriidae um parasito de guelras do tubarão, Galeorhinus vitaminicus de Buen, no Rio Grande do Sul, Brasil

    Directory of Open Access Journals (Sweden)

    Vernon E. Thatcher

    2006-12-01

    Full Text Available Kroyeria brasiliense sp. nov. from the shark, Galeorhinus vitaminicus de Buen, 1950, from Rio Grande do Sul, State, Brazil, is described on the basis of 14 adult females. The new species is superficially similar to Kroyeria deetsi Dippenaar, Benz & Olivier, 2000, but differs from it in the following characters. The maxillipeds of the new species are large and project well beyond the lateral margins of the cephalothorax. Those of K. deetsi are much smaller. The third endopodal segments of K. deetsi are twice as long as the second endopodal segments and are provided with prominent marginal denticles. The second and third endopodal segments of the new species are rounded, of similar length and lack teeth.Kroyeria brasiliense sp. nov. proveniente de guelras de G. vitaminicus de Buen, 1950 do Rio Grande do Sul, é descrita baseada em 14 fêmeas adultas. A nova espécie aproxima-se de Kroyeria deetsi Dippenaar, Benz & Oliver, 2000, mas a nova espécie se distingue por apresentar os maxilípedes grandes e estendendo-se bem além das margens do cefalotorax. Os terceiros segmentos dos endopoditos de K. deetsi são duas vezes mais cumpridos que os segundos e têm dentículos marginais proeminentes. Os segundos e terceiros segmentos dos endopoditos da nova espécie são arredondados, de tamanhos parecidos e carecem de dentículos.

  13. Local and regional factors influencing zooplankton communities in ...

    African Journals Online (AJOL)

    2010-02-19

    Feb 19, 2010 ... important grazer of algae during periods of high zooplank- ton abundance. This is .... arctic tundra pond microcrustacean communities. Can. J. Fish. Aquat. Sci. ... Guides to the Identification of the Micro- invertebrates of the ...

  14. ZOOPLANKTON FAUNA OF BİNGÖL FLOATING ISLANDS IN WINTER SEASON

    OpenAIRE

    Şen Özdemir, Nurgül; Caf, Fatma

    2015-01-01

    In this study was carried out winter season in 2011; zooplankton faunaof the Bingol Floating Islands. To­tally 18 zooplankton species were determinedas fol­lows; 14 Rotifera, 3 Cladocera and 1 Copepoda. It was determined thatthis zooplanktonic organisms consist­ed of 87.74 % Rotifera, 6.83 % Cladocera, and3.36 %  copepodit stages, 2.07 %  nauplii of copepoda. Rotif­era were thedominant group with regard to both spe­cies numbers, and individual numbers ofspecies. Cy­clops vicinus from Copepoda...

  15. Zoogeography of the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, T.S.S.

    The distribution pattern of zooplankton in the Indian Ocean is briefly reviewed on a within and between ocean patterns and is limited to species within a quite restricted sort of groups namely, Copepoda, Chaetognatha, Pteropoda and Euphausiacea...

  16. Analysis of the gut contents of the needlefish, Hyporhamphus ...

    African Journals Online (AJOL)

    Food items were identified as far as possible. Amphipods and isopods were usually broken up and difficult to separate, and consequently grouped together in the .... Protozoa. Foraminifera. Filamentous algae. Aquatic macrophytes. Ruppia spiralis +. Potamogeton pectinatus. Polychaeta. Crustacea. Ostracoda. Copepoda.

  17. Zooplankton biomass & composition in the Western Bay of Bengal during late SW monsoon; 15 August 1978 to 07 September 1978 (NODC Accession 0000941)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Copepoda formed the predominant group except in the southern region where a swarm of pelagic tunicates reduced their contribution to only 19% of the total...

  18. Phytoplankton-zooplankton inter-relationships in tropical waters - Grazing and gut pigment dynamics

    Digital Repository Service at National Institute of Oceanography (India)

    Goes, J.I.; Caeiro, S.; Gomes, H.

    An examination of the feeding mechanisms in two taxonomically dissimilar classes of tropical planktonic harbivores Evadne tergestina (Cladocera) and Acrocalanus spp. (Copepoda) revealed a distinct rhythmicity of food intake. Brief bouths...

  19. Zooplankton composition and diversity in western Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Nair, S.R.S.; Nair, V.R.; Achuthankutty, C.T.; Madhupratap, M.

    higher standing stock. Copepoda formed the dominant group followed by Decapoda and Chaetognatha. Species composition of various groups and their distribution is discussed. A general inverse relationship between biomass and species diversity was the trend...

  20. Phytoplankton community in relation to physico-chemical ...

    African Journals Online (AJOL)

    Michael Horsfall

    distribution of the plankton of reservoirs is stable or ephemeral. ... Length of Talar river in Caspian beach is more than .... abundance of Copepoda and Crustacean larvae. (Table 5). .... to understand more about plankton diversity and.

  1. An annotated list of fish parasites (Isopoda, Copepoda, Monogenea, Digenea, Cestoda, Nematoda) collected from Snappers and Bream (Lutjanidae, Nemipteridae, Caesionidae) in New Caledonia confirms high parasite biodiversity on coral reef fish

    OpenAIRE

    Justine, Jean-Lou; Beveridge, Ian; Boxshall, Geoffrey A; Bray, Rodney A; Miller, Terrence L; Moravec, František; Trilles, Jean-Paul; Whittington, Ian D

    2012-01-01

    Background Coral reefs are areas of maximum biodiversity, but the parasites of coral reef fishes, and especially their species richness, are not well known. Over an 8-year period, parasites were collected from 24 species of Lutjanidae, Nemipteridae and Caesionidae off New Caledonia, South Pacific. Results Host-parasite and parasite-host lists are provided, with a total of 207 host-parasite combinations and 58 parasite species identified at the species level, with 27 new host records. Results ...

  2. An annotated list of fish parasites (Isopoda, Copepoda, Monogenea, Digenea, Cestoda, Nematoda) collected from Snappers and Bream (Lutjanidae, Nemipteridae, Caesionidae) in New Caledonia confirms high parasite biodiversity on coral reef fish.

    Science.gov (United States)

    Justine, Jean-Lou; Beveridge, Ian; Boxshall, Geoffrey A; Bray, Rodney A; Miller, Terrence L; Moravec, František; Trilles, Jean-Paul; Whittington, Ian D

    2012-09-04

    Coral reefs are areas of maximum biodiversity, but the parasites of coral reef fishes, and especially their species richness, are not well known. Over an 8-year period, parasites were collected from 24 species of Lutjanidae, Nemipteridae and Caesionidae off New Caledonia, South Pacific. Host-parasite and parasite-host lists are provided, with a total of 207 host-parasite combinations and 58 parasite species identified at the species level, with 27 new host records. Results are presented for isopods, copepods, monogeneans, digeneans, cestodes and nematodes. When results are restricted to well-sampled reef fish species (sample size > 30), the number of host-parasite combinations is 20-25 per fish species, and the number of parasites identified at the species level is 9-13 per fish species. Lutjanids include reef-associated fish and deeper sea fish from the outer slopes of the coral reef: fish from both milieus were compared. Surprisingly, parasite biodiversity was higher in deeper sea fish than in reef fish (host-parasite combinations: 12.50 vs 10.13, number of species per fish 3.75 vs 3.00); however, we identified four biases which diminish the validity of this comparison. Finally, these results and previously published results allow us to propose a generalization of parasite biodiversity for four major families of reef-associated fishes (Lutjanidae, Nemipteridae, Serranidae and Lethrinidae): well-sampled fish have a mean of 20 host-parasite combinations per fish species, and the number of parasites identified at the species level is 10 per fish species. Since all precautions have been taken to minimize taxon numbers, it is safe to affirm than the number of fish parasites is at least ten times the number of fish species in coral reefs, for species of similar size or larger than the species in the four families studied; this is a major improvement to our estimate of biodiversity in coral reefs. Our results suggest that extinction of a coral reef fish species would eventually result in the coextinction of at least ten species of parasites.

  3. New record and redescription of Calanopia thompsoni A. Scott, 1909 (Copepoda, Calanoida, Pontellidae) from the Red Sea, with notes on the taxonomic status of C. parathompsoni Gaudy, 1969 and a key to species.

    Science.gov (United States)

    Al-Aidaroos, Ali M; Salama, Adnan J; El-Sherbiny, Mohsen M

    2016-01-01

    During a plankton sampling programme around Al-Wajh area, Saudi Arabian coast of the northern Red Sea, a copepod Calanopia thompsoni A. Scott, 1909 (Calanoida: Pontellidae) was reported for the first time in the Red Sea. Both sexes are fully redescribed and compared to previous descriptions as well as the closely related species, Calanopia parathompsoni. The zoogeographical distribution of the species confirms that it is of Indo-Pacific origin. A dichotomous key for the identification of males and females of the species of Calanopia is included.

  4. Shallow-water and not deep-sea as most plausible origin for cave-dwelling Paramisophria species (Copepoda: Calanoida: Arietellidae), with description of three new species from Mediterranean bathyal hyperbenthos and littoral caves

    NARCIS (Netherlands)

    Jaume, Damià; Cartes, Joan E.; Boxshall, Geoffrey A.

    2000-01-01

    Japan (Tanaka, 1967; Ohtsuka, 1985; Ohtsuka & Mitsuzumi, 1990; Ohtsuka et al., 1991), Australia (McKinnon & Kimmerer, 1985), and New Zealand (Othman & Greenwood, 1992). Records of species far from their ordinary ranges, such as those of Paramisophria cluthae T. Scott, 1897 from the Mediterranean

  5. Hydrobiological studies in the catchment of Vaal dam, South Africa part 3. Notes on the Cladocera and Copepoda of stones-in-current, marginal vegetation and stony backwater biotopes

    CSIR Research Space (South Africa)

    Chutter, FM

    1971-01-01

    Full Text Available A general description of the study area be found in part 1(Chutter, 1970), where the fauna other than Cladocera and Copera of store-in-current, marginal vegetation and story backwater has been described. It was found that the streams and rivers...

  6. A new species of Labidocera (Copepoda, Calanoida, Pontellidae) collected from Okinawa, southwestern Japan, with establishment of five Indo-West Pacific species groups in the L.detruncata species complex.

    Science.gov (United States)

    Hirabayashi, Takeshi; Ohtsuka, Susumu

    2014-01-01

    Labidocerachuraumi sp. n. is described from Okinawa, southwestern Japan. The female of the new species differs from other congeners in genital compound somite with right postero-lateral and left antero-lateral processes. The male is distinguished from other congeners by the structure of the fifth leg. This new species is assigned to a newly proposed species group, the Labidoceramadurae species group, within the Labidoceradetruncata species complex. In this species complex five Indo-West Pacific species groups are recognized (cervi, detruncata, gangetica, madurae, and pavo) and defined on the basis of difference in sexual dimorphism.

  7. A new species of Labidocera (Copepoda, Calanoida, Pontellidae collected from Okinawa, southwestern Japan, with establishment of five Indo-West Pacific species groups in the L. detruncata species complex

    Directory of Open Access Journals (Sweden)

    Takeshi Hirabayashi

    2014-10-01

    Full Text Available Labidocera churaumi sp. n. is described from Okinawa, southwestern Japan. The female of the new species differs from other congeners in genital compound somite with right postero-lateral and left antero-lateral processes. The male is distinguished from other congeners by the structure of the fifth leg. This new species is assigned to a newly proposed species group, the L. madurae species group, within the L. detruncata species complex. In this species complex five Indo-West Pacific species groups are recognized (cervi, detruncata, gangetica, madurae, and pavo and defined on the basis of difference in sexual dimorphism.

  8. A new species of Labidocera (Copepoda, Calanoida, Pontellidae) collected from Okinawa, southwestern Japan, with establishment of five Indo-West Pacific species groups in the L. detruncata species complex

    Science.gov (United States)

    Hirabayashi, Takeshi; Ohtsuka, Susumu

    2014-01-01

    Abstract Labidocera churaumi sp. n. is described from Okinawa, southwestern Japan. The female of the new species differs from other congeners in genital compound somite with right postero-lateral and left antero-lateral processes. The male is distinguished from other congeners by the structure of the fifth leg. This new species is assigned to a newly proposed species group, the Labidocera madurae species group, within the Labidocera detruncata species complex. In this species complex five Indo-West Pacific species groups are recognized (cervi, detruncata, gangetica, madurae, and pavo) and defined on the basis of difference in sexual dimorphism. PMID:25349514

  9. Taxonomy, ecology, and geographical distribution of the species of the genus Thermocyclops Kiefer, 1927 (Copepoda, Cyclopoida in São Paulo State, Brazil, with description of a new species

    Directory of Open Access Journals (Sweden)

    W. M. Silva

    Full Text Available The taxonomy and ecology of the cyclopoid copepod genus Thermocyclops were studied. Samples were collected in 207 water bodies located in the 22 hydrographic basins of São Paulo State, Brazil, including large reservoirs, small and shallow lakes, and ponds and rivers. The genus Thermocyclops inhabits mainly water bodies within a limnetic region. Four species were found, of which one is new: Thermocyclops iguapensis, which occurred in the reservoirs of the Ribeira do Iguape and Paraíba do Sul basins. The description of the new species and the geographical distribution of all four species in São Paulo State are presented. Thermocyclops decipiens was the most frequent species, occurring in 71% of the water bodies within a limnetic region. This species is characteristic of eutrophic environments where it can occur in great abundance, whereas Thermocyclops minutus is characteristic in oligotrophic systems. Thermocyclops inversus and Thermocyclops iguapensis n. sp. were not common but can occur together with Thermocyclops decipiens.

  10. Local variations in size and activity among Calanus finmarchicus and Metridia longa (Copepoda, Calanoida) overwintering on the west coast of Norway. Journal of Plankton Research, 01 January 1994 to 31 December 2002 (NODC Accession 0000489)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Vertical net hauls were taken at thirteen stations between latitude 60 degrees 8 minutes N - 61 degrees 20 minutes N and longitude 3 degrees 4 minutes E - 7 degrees...

  11. An annotated list of fish parasites (Isopoda, Copepoda, Monogenea, Digenea, Cestoda, Nematoda) collected from Snappers and Bream (Lutjanidae, Nemipteridae, Caesionidae) in New Caledonia confirms high parasite biodiversity on coral reef fish

    Czech Academy of Sciences Publication Activity Database

    Justine, J.-L.; Beveridge, I.; Boxshall, G.A.; Bray, R. A.; Miller, T.L.; Moravec, František; Trilles, J.-P.; Whittington, I.D.

    2012-01-01

    Roč. 8, č. 1 (2012), s. 22 ISSN 2046-9063 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : biodiversity * coral reef s * parasites * coextinction * New Caledonia * South Pacific Subject RIV: EG - Zoology

  12. An annotated list of fish parasites (Copepoda, Monogenea, Digenea, Cestoda and Nematoda) collected from Emperors and Emperor Bream (Lethrinidae) in New Caledonia further highlights parasite biodiversity estimates on coral reef fish

    Czech Academy of Sciences Publication Activity Database

    Justine, J.-L.; Beveridge, I.; Boxshall, G.A.; Bray, R. A.; Moravec, František; Whittington, I.D.

    2010-01-01

    Roč. 2691, - (2010), s. 1-40 ISSN 1175-5326 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : fish * new host records * new geographical records * inventory * biogeography * South Pacific Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.853, year: 2010

  13. The DAL10 gene from Norway spruce (Picea abies) belongs to a potentially gymnosperm-specific subclass of MADS-box genes and is specifically active in seed cones and pollen cones.

    Science.gov (United States)

    Carlsbecker, Annelie; Sundström, Jens; Tandre, Karolina; Englund, Marie; Kvarnheden, Anders; Johanson, Urban; Engström, Peter

    2003-01-01

    Transcription factors encoded by different members of the MADS-box gene family have evolved central roles in the regulation of reproductive organ development in the flowering plants, the angiosperms. Development of the stamens and carpels, the pollen- and seed-bearing organs, involves the B- and C-organ-identity MADS-box genes. B- and C-type gene orthologs with activities specifically in developing pollen- and seed-bearing organs are also present in the distantly related gymnosperms: the conifers and the gnetophytes. We now report on the characterization of DAL10, a novel MADS-box gene from the conifer Norway spruce, which unlike the B- and C-type conifer genes shows no distinct orthology relationship to any angiosperm gene or clade in phylogenetic analyses. Like the B- and C-type genes, it is active specifically in developing pollen cones and seed cones. In situ RNA localization experiments show DAL10 to be expressed in the cone axis, which carry the microsporophylls of the young pollen cone. In contrast, in the seed cone it is expressed both in the cone axis and in the bracts, which subtend the ovuliferous scales. Expression data and the phenotype of transgenic Arabidopsis plants expressing DAL10 suggest that the gene may act upstream to or in concert with the B- and C-type genes in the establishment of reproductive identity of developing cones.

  14. Distinct patterns of blood-stage parasite antigens detected by plasma IgG subclasses from individuals with different level of exposure to Plasmodium falciparum infections

    DEFF Research Database (Denmark)

    Olesen, Cathrine Holm; Brahimi, Karima; Vandahl, Brian

    2010-01-01

    ABSTRACT: BACKGROUND: In endemic regions naturally acquired immunity against Plasmodium falciparum develops as a function of age and exposure to parasite infections and is known to be mediated by IgG. The targets of protective antibodies remain to be fully defined. Several immunoepidemiological s...

  15. FcGammaRIIa polymorphism and anti-malaria specific IgG and IgG subclass responses in populations differing in susceptibility to malaria in Burkina Faso

    DEFF Research Database (Denmark)

    Cherif, Mariama K; Sanou, Guillaume S; Maiga, Boubakar

    2012-01-01

    Fc¿RIIa is known to be polymorphic; and certain variants err associated with differt susceptibilities to malaria. Studies involving the Fulani ethnic group reported an ethnic difference in Fc¿RIIa-R131H genotype frequencies between the Fulani and other sympatric groups. No previous studies have a...

  16. Quantitative analysis of the IgG and IgG subclass immune responses to chromosomal Pseudomonas aeruginosa beta-lactamase in serum from patients with cystic fibrosis by western blotting and laser scanning densitometry

    DEFF Research Database (Denmark)

    Petersen, T D; Ciofu, O; Pressler, T

    1996-01-01

    BACKGROUND: Antibodies against chromosomal beta-lactamase of Pseudomonas aeruginosa (a beta ab) are markers of the development of resistance of P aeruginosa to beta-lactam antibiotics in patients with cystic fibrosis and chronic lung infection. The role of these antibodies in patients with chronic...... of the chronic infection the a beta ab titres were higher in patients with good lung function than in those with poor lung function. CONCLUSIONS: The association of a weak IgG3 and a strong IgG4 a beta ab response suggests that the contribution of a beta ab antibodies to lung diseases mediated by immune...... complexes might be less important than other antipseudomonal antibodies. A beneficial neutralising effect of the a beta ab antibodies on the antibiotic destroying enzymes may be an additional factor....

  17. Observing copepods through a genomic lens

    Science.gov (United States)

    2011-01-01

    Background Copepods outnumber every other multicellular animal group. They are critical components of the world's freshwater and marine ecosystems, sensitive indicators of local and global climate change, key ecosystem service providers, parasites and predators of economically important aquatic animals and potential vectors of waterborne disease. Copepods sustain the world fisheries that nourish and support human populations. Although genomic tools have transformed many areas of biological and biomedical research, their power to elucidate aspects of the biology, behavior and ecology of copepods has only recently begun to be exploited. Discussion The extraordinary biological and ecological diversity of the subclass Copepoda provides both unique advantages for addressing key problems in aquatic systems and formidable challenges for developing a focused genomics strategy. This article provides an overview of genomic studies of copepods and discusses strategies for using genomics tools to address key questions at levels extending from individuals to ecosystems. Genomics can, for instance, help to decipher patterns of genome evolution such as those that occur during transitions from free living to symbiotic and parasitic lifestyles and can assist in the identification of genetic mechanisms and accompanying physiological changes associated with adaptation to new or physiologically challenging environments. The adaptive significance of the diversity in genome size and unique mechanisms of genome reorganization during development could similarly be explored. Genome-wide and EST studies of parasitic copepods of salmon and large EST studies of selected free-living copepods have demonstrated the potential utility of modern genomics approaches for the study of copepods and have generated resources such as EST libraries, shotgun genome sequences, BAC libraries, genome maps and inbred lines that will be invaluable in assisting further efforts to provide genomics tools for

  18. Observing copepods through a genomic lens

    Directory of Open Access Journals (Sweden)

    Johnson Stewart C

    2011-09-01

    Full Text Available Abstract Background Copepods outnumber every other multicellular animal group. They are critical components of the world's freshwater and marine ecosystems, sensitive indicators of local and global climate change, key ecosystem service providers, parasites and predators of economically important aquatic animals and potential vectors of waterborne disease. Copepods sustain the world fisheries that nourish and support human populations. Although genomic tools have transformed many areas of biological and biomedical research, their power to elucidate aspects of the biology, behavior and ecology of copepods has only recently begun to be exploited. Discussion The extraordinary biological and ecological diversity of the subclass Copepoda provides both unique advantages for addressing key problems in aquatic systems and formidable challenges for developing a focused genomics strategy. This article provides an overview of genomic studies of copepods and discusses strategies for using genomics tools to address key questions at levels extending from individuals to ecosystems. Genomics can, for instance, help to decipher patterns of genome evolution such as those that occur during transitions from free living to symbiotic and parasitic lifestyles and can assist in the identification of genetic mechanisms and accompanying physiological changes associated with adaptation to new or physiologically challenging environments. The adaptive significance of the diversity in genome size and unique mechanisms of genome reorganization during development could similarly be explored. Genome-wide and EST studies of parasitic copepods of salmon and large EST studies of selected free-living copepods have demonstrated the potential utility of modern genomics approaches for the study of copepods and have generated resources such as EST libraries, shotgun genome sequences, BAC libraries, genome maps and inbred lines that will be invaluable in assisting further efforts to

  19. The temporal dynamics of zooplankton communities of different types of water bodies within Ichniansky National Park

    Directory of Open Access Journals (Sweden)

    Z. V. Burian

    2017-05-01

    Full Text Available In recent decades, the influence of anthropogenic impact on aquatic ecosystems has increased. This has led to a restructuring of aquatic ecosystems and affected the structural and functional organization of groups of aquatic organisms, causing qualitative and quantitative changes. Particular attention is drawn to the different types of water bodies of protected areas like IchnyanskyNational Park, which is located in Ichnyansky district of Chernihiv region. This park is a newly created one, so the reduction in intensity of anthropogenic pressure can be traced within its waters. Zooplankton plays an important role in the functioning of trophic networks because it transfers energy from producers and primary consumers to young fish and planktonophagous fish. Therefore, three main groups of zooplankton were chosen as the object of study: rotifers (class Eurotatoria, cladocerans (class Branchiopoda, order Cladocera, different age stages of copepods (class Copepoda, and also ostracods (Class Ostracoda. The zooplankton used as research material was collected in the daytime in spring (April, summer (late July – early August and autumn (late September – early October in the years 2015–2016 from ten experimental stations. During this period 81 species of zooplankton were recorded within heterogeneous reservoirs of IchnianskyNational Park. Monogonont rotifers (subclass Monogononta included 35 species (43% of all species and bdelloid rotifers (subclass Bdelloidea, cladocerns, comprised 28 species (35%, and copepods included 18 species (22%. The faunal range of zooplankton over different years and seasons was characterized by the predominance of the rotator complex in spring, rotator-cladocerans and cladocerans in summer, and of the cladocerans complex in autumn. This was due to the formation during spring and summer of favourable conditions in the waters for filter feeders, which consist generally of rotifers and cladocerans. In autumn the water

  20. Characterization and properties of the biosurfactant produced by Candida lipolytica UCP 0988

    Directory of Open Access Journals (Sweden)

    Raquel Diniz Rufino

    2014-01-01

    Conclusions: The isolated biosurfactant showed no toxicity against different vegetable seeds: Brassica oleracea, Solanum gilo and Lactuca sativa L. and the micro-crustacean Artemia salina. The properties of the biosurfactant produced suggest its potential application in industries that require the use of effective compounds at low cost.

  1. 76 FR 76337 - Endangered and Threatened Wildlife and Plants; Designation of Critical Habitat for Lost River...

    Science.gov (United States)

    2011-12-07

    ... information on the Lost River sucker's and shortnose sucker's biology and habitat, population abundance and... consumed chironomid larvae as well as micro-crustaceans (amphipods, copepods, cladocerans, and ostracods... information above, we identify an abundant food base, including a broad array of chironomids, micro...

  2. Genetics of non-conventional lipoprotein fractions

    Science.gov (United States)

    Lipoprotein subclass measures associate with cardiometabolic disease risk. Currently the information that lipoproteins convey on disease risk over that of traditional demographic and lipid measures is minimal, and so their use is clinics is limited. However, lipoprotein subclass perturbations repres...

  3. Sequence diversity and copy number variation of Mutator-like transposases in wheat

    Directory of Open Access Journals (Sweden)

    Nobuaki Asakura

    2008-01-01

    Full Text Available Partial transposase-coding sequences of Mutator-like elements (MULEs were isolated from a wild einkorn wheat, Triticum urartu, by degenerate PCR. The isolated sequences were classified into a MuDR or Class I clade and divided into two distinct subclasses (subclass I and subclass II. The average pair-wise identity between members of both subclasses was 58.8% at the nucleotide sequence level. Sequence diversity of subclass I was larger than that of subclass II. DNA gel blot analysis showed that subclass I was present as low copy number elements in the genomes of all Triticum and Aegilops accessions surveyed, while subclass II was present as high copy number elements. These two subclasses seemed uncapable of recognizing each other for transposition. The number of copies of subclass II elements was much higher in Aegilops with the S, Sl and D genomes and polyploid Triticum species than in diploid Triticum with the A genome, indicating that active transposition occurred in S, Sl and D genomes before polyploidization. DNA gel blot analysis of six species selected from three subfamilies of Poaceae demonstrated that only the tribe Triticeae possessed both subclasses. These results suggest that the differentiation of these two subclasses occurred before or immediately after the establishment of the tribe Triticeae.

  4. First report of Limnoricus ponticus Dovgal and Lozowskiy (Ciliophora: Suctorea) as epibionts on Pycnophyes (Kinorhyncha) from the Indian Ocean with key to species of the genus Limnoricus

    Digital Repository Service at National Institute of Oceanography (India)

    Dovgal, I.; Chatterjee, T.; Ingole, B.S.; Nanajkar, M.

    of individuals from type copepoda host: body length (individuals from Kinorhyncha) 14-24 µm (47-49 µm under colonization of the type copepod host); width in the middle of body 12-17 µm (22-30 µm); macronucleus diameter 6-8 µm (13-16 µm); length of the lorica 44...

  5. The effect of some environmental factors on zooplankton community ...

    African Journals Online (AJOL)

    The zooplankton of Lake Qarun was studied January–December 2003. A total of 26 species was recorded, amongst which protozoa, primarily ciliophora, were most abundant (79% of the species total), followed by rotifera (13%) and copepoda (8%). The average density ranged from 965–1 452 l–1. The highest density (2 ...

  6. Zooplankton composition and community structure in Lake Tiga ...

    African Journals Online (AJOL)

    Zooplankton in Lake Tiga was identified and its community structure assessed between March 2009 and March 2011. A total of 54 species of zooplankton was recorded, comprising two species of Protozoa, 26 species of Rotifera, eight species of Copepoda, 11 species of Cladocera, four species of Ostracoda and three ...

  7. Some observations on the larval development of Cyclops leuckarti Claus and Cyclops hyalinus Rehberg

    NARCIS (Netherlands)

    Andreae, J.C.

    1955-01-01

    Introduction. Whilst examining the vertical distribution of planktonic Copepoda in the Klinkenberger Put, a deep pond at Warmond near Leiden, wide about 400 m, without any connection with other water, samples were taken in October 1951, November 1951, January 1952, February 1952, and March 1952. In

  8. Composition and abundance of the zooplankton community in the ...

    African Journals Online (AJOL)

    The taxonomic composition of the zooplankton community of the Bitter Lakes, Egypt, was examined in 2003–2004 in relation to the spatial and temporal distribution of environmental factors. Copepoda were dominant, forming 49% of the zooplankton, followed by Protista at 37%. During the autumn, zooplankton in Small ...

  9. Photocatalytic degradation of an organophosphorus pesticide from agricultural waste by immobilized TiO2 under solar radiation

    Directory of Open Access Journals (Sweden)

    Marcia Regina Assalin

    2016-11-01

    Full Text Available This paper describes solar heterogeneous photocatalysis using immobilized TiO2 applied in the treatment of agricultural waste resulting from the application of commercial formulations of methyl parathion. The disappearance of the insecticide, as well as the formation of its metabolite, was monitored by high-performance liquid chromatography-tandem mass spectrometry (LC-MS/MS, while mineralization efficiency was monitored by measurements of total organic carbon (TOC. Toxicity studies were performed using the microcrustacean Artemia salina. The TOC removal efficiency by photocatalytic process was 48.5%. After 45 minutes of treatment, the removal efficiency of methyl parathion was 90%, being completely mineralized at the end of treatment. The formation and removal of the metabolite methyl paraoxon was observed during the photocatalytic process. The photocatalytic treatment resulted in increased microcrustacean mobility, indicating a reduction of acute toxicity.

  10. Feeding of juvenile pirarucu (Arapaima gigas, Arapaimidae in their natural environment, lago Quatro Bocas, Araguaiana-MT, Brazil

    Directory of Open Access Journals (Sweden)

    Valdézio de Oliveira

    Full Text Available The stomach content of samples of juvenile Arapaima gigas was analized to obtain information about feeding in natural environments. This species occurs in the Amazonian basin, predominantly in floodplain environment. This is the case of the valley of the middle rio Araguaia, where the lago Quatro Bocas is situated. Juveniles A. gigas prefered insects, microcrustaceans and gastropods, most of autochthonous origin. All the stomachs examined contained at least one food item.

  11. Transcriptional basis of phenotypic plasticity in Daphnia pulex

    OpenAIRE

    Spanier, Katina

    2009-01-01

    The planktonic microcrustacean Daphnia pulex is among the best-studied animals in ecological, toxicological, and evolutionary research. The genome of D. pulex has recently been sequenced as the rst crustacean genome by the Daphnia Genomics Consortium (DGC), which opens new doors for interpreting and using the vast knowledge about this model organism from a genomic perspective. From an evolutionary ecological point of view, D. pulex is particularly interesting due to its ability to respo...

  12. Parasites of the flatfish Paralichthys adspersus (Steindachner, 1867 (Pleuronectiformes from northern Chile

    Directory of Open Access Journals (Sweden)

    Marcelo E Oliva

    1996-06-01

    Full Text Available Three species of protistan and 22 species of metazoan parasites were obtained from a sample of 179 flatfish, (Paralichthys adspersus taken-off Antofagasta, northern Chile. Prevalence of infection of seven parasites (Protista: 1, Copepoda: 2, Digenea: 1, Acantocephala: 1, Nematoda: 2 was significantly and positively correlated with host size. Host's sex do not seem to affect prevalence of infection, except for Nybelinia surmenicola, Capillaria sp. and Anisakis sp. (prevalence of infection significantly greater in males than females and Philometra sp. (prevalence higher in females. Mean abundance is correlated with size in nine species (Protista: 1, Copepoda: 2, Digenea: 3, Acantocephala: 1, Nematoda: 2. Host's sex do not affect mean abundance, except for Cainocreadium sp. and Philometra sp.(mean abundance higher in females and Nybelinia surmenicola, Capillaria sp. and Anisakis sp. (mean abundance higher in males.

  13. Zooplankton assemblage of Oyun Reservoir, Offa, Nigeria.

    Science.gov (United States)

    Mustapha, Moshood K

    2009-12-01

    The influence of physico-chemical properties of Oyun Reservoir, Offa, Nigeria (a shallow tropical African reservoir) on its zooplankton composition and abundance were investigated at three stations for two years between January 2002 and December 2003. Diversity is not high: only three groups of zooplankton were found: Rotifera with eight genera; and Cladocera and Copepoda with three genera each. Rotifera dominated numerically (71.02%), followed by Cladocera (16.45%) and Copepoda (12.53%). The zooplankton was more prevalent during the rainy season, and there were variations in the composition and abundance along the reservoir continuum. Factors such as temperature, nutrients, food availability, shape and hydrodynamics of the reservoir, as well as reproductive strategies of the organisms, strongly influence the generic composition and population density of zooplankton. Prevention of ecological deterioration of the water body would greatly should result in a more productive water body, rich in zooplankton and with better fisheries.

  14. Metazoan Parasite Infracommunities in Five Sciaenids from the Central Peruvian Coast

    Directory of Open Access Journals (Sweden)

    Oliva Marcelo E

    1998-01-01

    Full Text Available Parasitological analysis of 237 Menticirrhus ophicephalus, 124 Paralonchurus peruanus, 249 Sciaena deliciosa, 50 Sciaena fasciata and 308 Stellifer minor from Callao (Perú yielded 37 species of metazoan parasites (14 Monogenea, 11 Copepoda, 4 Nematoda, 3 Acanthocephala, 1 Digenea, 1 Aspidobothrea, 1 Eucestoda, 1 Isopoda and 1 Hirudinea. Only one species, the copepoda Bomolochus peruensis, was common to all five hosts. The majority of the components of the infracommunities analyzed are ectoparasites. The Brillouin index (H and evenness (J´ were applied to the fully sampled metazoan parasite infracommunities. High values of prevalence and mean abundance of infection are associated to the polyonchoinean monogeneans; the low values of J' reinforce the strong dominance of this group in the studied communities. The paucity of the endoparasite fauna may be a consequence of the unstable environment due to an upwelling system, aperiodically affected by the El Niño Southern Oscillation phenomena.

  15. An evaluation of invertebrate dynamics in a drinking water distribution system: a South African perspective

    OpenAIRE

    2008-01-01

    M.Sc. The occurrence of invertebrates in drinking water supplies is a common consumer complaint with studies showing that very few drinking water distribution networks are totally free of organisms. A detailed investigation of different types of metazoan animals in the drinking water supply networks of South Africa has not been undertaken. In limited worldwide studies, invertebrates (mainly Amphipoda, Chironomidae, Cladocera, Copepoda and Ostracoda) have been detected in produced drinking ...

  16. Strong typing of object-oriented languages revisited

    DEFF Research Database (Denmark)

    Madsen, Ole Lehrmann; Magnusson, Boris; Møller-Pedersen, Birger

    1990-01-01

    This paper is concerned with the relation between subtyping and subclassing and their influence on programming language design. Traditionally subclassing as introduced by Simula has also been used for defining a hierarchical type system. The type system of a language can be characterized as strong...

  17. Static Typing for Object-Oriented Programming

    DEFF Research Database (Denmark)

    Schwartzbach, Michael Ignatieff; Palsberg, Jens

    1994-01-01

    We develop a theory of statically typed object-oriented languages. It represents classes as labeled, regular trees, types as finit sets of classes , and sub-classing as a partial order on trees. We show that our sub-classing order strictly generalizes inheritance, and that a novel genericity mech...

  18. On New p-Valent Meromorphic Function Involving Certain Differential and Integral Operators

    Directory of Open Access Journals (Sweden)

    Aabed Mohammed

    2014-01-01

    Full Text Available We define new subclasses of meromorphic p-valent functions by using certain differential operator. Combining the differential operator and certain integral operator, we introduce a general p-valent meromorphic function. Then we prove the sufficient conditions for the function in order to be in the new subclasses.

  19. Identification of a novel group of bacteria in sludge from a deteriorated biological phosphorus removal reactor

    DEFF Research Database (Denmark)

    Nielsen, Alex Toftgaard; Liu, Wen-Tso; Filipe, Carlos

    1999-01-01

    most dominant of these bands was further isolated and sequenced. Comparative phylogenetic analysis of the partial 16S rRNA sequences suggested that one sequence type was affiliated with the alpha subclass of the Proteobacteria, one was associated with the Legionella group of the gamma subclass...

  20. PetriCode: A Tool for Template-Based Code Generation from CPN Models

    DEFF Research Database (Denmark)

    Simonsen, Kent Inge

    2014-01-01

    Code generation is an important part of model driven methodologies. In this paper, we present PetriCode, a software tool for generating protocol software from a subclass of Coloured Petri Nets (CPNs). The CPN subclass is comprised of hierarchical CPN models describing a protocol system at different...

  1. Job strain in relation to body mass index

    DEFF Research Database (Denmark)

    Nyberg, S T; Heikkilä, K; Fransson, E I

    2012-01-01

    Evidence of an association between job strain and obesity is inconsistent, mostly limited to small-scale studies, and does not distinguish between categories of underweight or obesity subclasses.......Evidence of an association between job strain and obesity is inconsistent, mostly limited to small-scale studies, and does not distinguish between categories of underweight or obesity subclasses....

  2. Prevalence of Colacium vesiculosum (Colaciales: Euglenophyceae on planktonic crustaceans in a subtropical shallow lake of Argentina

    Directory of Open Access Journals (Sweden)

    Yolanda Zalocar

    2011-09-01

    Full Text Available Colacium vesiculosum (Euglenophyceae is an epibiont common on planktonic microcrustaceans of continental waters. The interaction between epibionts and substrate organisms is not very well known, particularly in subtropical environments of South America. In the present work, we analyzed the prevalence, density, biomass and attachment sites of C. vesiculosum on planktonic microcrustaceans from Paiva Lake, a subtropical lake of Argentina. With the aim to evaluate whether epibionts affect the filtering rates of Notodiaptomus spiniger, the dominant planktonic crustacean, we carried out bioassays using phytoplankton <53µm. Crustaceans were sampled using a PVC tube (1.2m long and 10cm in diameter, filtering 50L of water through a 53µm-mesh. Microcrustaceans were counted in Bogorov chambers under a stereoscopic microscope. The infested organisms were separated and observed with a photonic microscope to determine density and biovolume of epibionts, by analyzing their distribution on the exoskeleton. The prevalence of C. vesiculosum was higher in adult crustaceans than in their larvae and juveniles. The most infested group was that of calanoid copepods, related to their high density. The attachment sites on the exoskeleton were found to be the portions of the body which have a higher probability of encounter with epibionts during locomotion and feeding, i.e., antennae and thoracic legs in copepods, and thoracic legs and postabdomen in cladocerans. The similar values found in the filtering rate of infested and uninfested individuals of N. spiniger and the constant prevalence (<40% of epibiont algae, suggest that C. vesiculosum does not condition the life of planktonic crustaceans of Paiva Lake. Rev. Biol. Trop. 59 (3: 1295-1306. Epub 2011 September 01.

  3. Ecotoxicological evaluation of water of the hydrographic Basin of the Una River using the bioindicator Ceriodaphnia dubia

    Directory of Open Access Journals (Sweden)

    Tatiane Alves

    2013-12-01

    Full Text Available The majority of the Una River Basin is located in Taubaté County and contributes significantly to its water supply. The main goal of this research was to evaluate the water quality of the Una River using the microcrustacean C. dubia as bioindicator for tests of chronic and acute toxicity. Bimonthly water samples were obtained from each of six localities throughout the Una Basin, from March to October, 2011. Physical-chemical water parameters such as pH, electrical conductivity, hardness, dissolved oxygen and precipitation were measured and correlated to the C. dubia reproductive rates. No significant relationships were found between the water’s electrical conductivity and precipitation with respect to bioindicator reproductive rates. However, at the Sete Voltas, Antas and Rocinha Sub-Basins, significant interactions were detected between some water parameters and reproductive rates, suggesting that water may constrain the reproduction of C. dubia. Acute toxicity was not detected in any of the six sites, while chronic toxicity was recorded at Rocinha, Sete Voltas, Antas, Médio and Baixo Una Sub-Basins. In general, the water quality of the Una Basin, as indicated by the absence of acute toxicity, still remains in an acceptable conservation condition. Caution is needed, however, since slight pollution sources are causing chronic toxicity in some localities. In addition, as the microcrustacean C. dubia, appeared to be a reliable bioindicator in this investigation, we suggest that it be used for continuous water quality monitoring programs.

  4. Magnetic resonance imaging of unicornuate uterus

    Energy Technology Data Exchange (ETDEWEB)

    Fedele, L.; Dorta, M.; Brioschi, D.; Giudici, M.N.; Villa, L. (1st Dept. of Obstetrics and Gynecology, Univ. of Milan (Italy))

    1990-01-01

    Five patient with a hysterosalpingographic diagnosis of unicornuate uterus underwent resonance imaging (MRI) and subsequently laparoscopy/laparotomy to evaluate the ability of MRI to identify the various subclasses of this malformation. The method was demonstrated to be valid, since in all 5 cases (one subclass A1b, two subclass B) were correctly diagnosed. Compared with laparoscopy, MRI is less expensive, less invasive, and can be performed in women in whom laparoscopic examination is risky. However, unlike laparoscopy, MRI can not detect the presence of minimal and mild endometriosis and does not allow assessment of the tubal conditions. (au).

  5. Composição e variabilidade espaço-temporal da meiofauna de uma praia arenosa na região amazônica (Ajuruteua, Pará Composition and spatio-temporal variability of meiofauna community on a sandy beach in the Amazon region (Ajuruteua, Pará, Brazil

    Directory of Open Access Journals (Sweden)

    Tatianne P. Gomes

    2009-06-01

    Full Text Available Este trabalho avalia a variabilidade espaço-temporal da meiofauna do médiolitoral na praia de Ajuruteua, Estado do Pará. As coletas foram realizadas a cada dois meses, entre abril de 2003 a fevereiro de 2004 durante as marés de sizígia, em diferentes zonas da praia. As amostras foram retiradas com um amostrador cilíndrico de 3,14 cm² e fixadas em formalina salina a 5%. Em laboratório, as amostras foram passadas em malha de 0,063 mm de abertura e os organismos retidos identificados em nível de grandes grupos taxonômicos, contados e fixados em álcool etílico a 70%. A meiofauna esteve representada por oito grupos: Turbellaria, Nematoda, Tardigrada, Polychaeta, Oligochaeta, Acari, adultos de Copepoda Harpacticoida e juvenis de Copepoda Harpacticoida. Nematoda foi o grupo dominante, representando 74% do total de indivíduos, seguido de Copepoda (19%. Pôde-se observar clara zonação horizontal da fauna, que se distribuiu em três faixas paralelas à linha de praia, com características significativamente distintas quanto à abundância, riqueza e densidade dos principais grupos taxonômicos. No médiolitoral médio foram observados valores significativamente mais elevados de riqueza e abundância, enquanto os valores mais baixos foram registrados no médiolitoral superior e inferior. A comunidade de meiofauna, ainda que não tenha variado significativamente entre períodos climáticos, foi mais rica e abundante nos meses secos. Os principais fatores responsáveis pelas variações espaço-temporais da meiofauna foram a ação das ondas e das marés e as variações na salinidade da água.The present study investigates the spatio-temporal changes in the meiofauna community along the intertidal zone of Ajuruteua Beach, State of Pará, Brazil. Samples were collected during spring tides at different levels of the beach face every two months from April 2003 to February 2004. The material was sampled using a cylindrical corer (3.14 cm² and

  6. Comparisons between POC and zooplankton swimmer flux from sediment traps in the subarctic and subtropical North Pacific

    Science.gov (United States)

    Yokoi, Naoya; Abe, Yoshiyuki; Kitamura, Minoru; Honda, Makio C.; Yamaguchi, Atsushi

    2018-03-01

    Seasonal changes in zooplankton swimmer (ZS) abundance, biomass and community structure were evaluated based on samples collected by moored sediment traps at a depth of 200 m in the subarctic (SA) and subtropical (ST) western North Pacific. Based on these samples, we made comparisons on two topics: 1) latitudinal (subarctic vs. subtropical) changes in ZS abundance, biomass and community and 2) quantitative differences between the ZS and particle organic carbon (POC) fluxes based on data from moored or drifting sediment traps. The results showed that the ZS flux was greater in the SA (annual mean: 311 ind. m-2 day-1 or 258 mg C m-2 day-1) than in the ST (135 ind. m-2 day-1 or 38 mg C m-2 day-1). The peak ZS flux was observed from July-August in the SA and from April-May in the ST. The dominant taxa were Copepoda and Chaetognatha in the SA and Ostracoda and Mollusca in the ST. These latitudinal differences are likely related to the dominance of large-sized Copepoda in the SA, regional differences in the timing of the spring phytoplankton bloom, and the magnitude and size structure of primary producers. The percent composition of ZS to the total C flux (= ZS+POC flux) varied by region: 85-95% in the SA and 47-75% in the ST. These differences between the ZS composition and the total C flux are most likely caused by the dominance of large-sized Copepoda (Neocalanus spp. and Eucalanus bungii) in the SA.

  7. Mesozooplankton of the estuarine system of Barra das Jangadas, Pernambuco, Brazil

    OpenAIRE

    Cavalcanti, Eliane A. H.; Neumann-Leitão, Sigrid; Vieira, Dilma A. do N.

    2008-01-01

    Estudos sobre o mesozooplâncton foram realizados no sistema estuarino de Barra das Jangadas, Pernambuco, Brasil (8º14'36"S, 34º56'28"W) visando analisar a estrutura da comunidade. As amostras foram obtidas com rede de plâncton, com malha de 300 µm, durante os períodos, seco (janeiro/2001) e chuvoso (julho/2001), nas marés de sizígia e de quadratura, em intervalos de três horas. Foram identificados 37 taxa, destacando-se Copepoda com as espécies Pseudodiaptomus acutus (F. Dahl, 1894), Pseudodi...

  8. Hydrobiological survey of some surface waters in the area of Mochovce nuclear power plant and their saprobiological assessment

    International Nuclear Information System (INIS)

    Kovacik, L.

    1987-01-01

    The results are presented of a hydrobiological study of three flows and one retention reservoir in the surroundings of the Mochovce nuclear power plant (Western Slovakia) performed in June 1982 and May 1983. The research was aimed at obtaining necessary information on the species composition of the algal flora (include blue-green algae) and selected groups of invertebrate hydrofauna (Sarcodina, Rotatoria, Cladocera, Copepoda, Oligochaeta and Chironomidae) in this territory. Natural waters were classified on the basis of the species composition of water organisms according to saprobiological criteria. (author). 4 refs

  9. Zooplankton assemblage of Oyun Reservoir, Offa, Nigeria

    Directory of Open Access Journals (Sweden)

    Moshood K Mustapha

    2009-12-01

    Full Text Available The influence of physico-chemical properties of Oyun Reservoir, Offa, Nigeria (a shallow tropical African reservoir on its zooplankton composition and abundance were investigated at three stations for two years between January 2002 and December 2003. Diversity is not high: only three groups of zooplankton were found: Rotifera with eight genera; and Cladocera and Copepoda with three genera each. Rotifera dominated numerically (71.02%, followed by Cladocera (16.45% and Copepoda (12.53%. The zooplankton was more prevalent during the rainy season, and there were variations in the composition and abundance along the reservoir continuum. Factors such as temperature, nutrients, food availability, shape and hydrodynamics of the reservoir, as well as reproductive strategies of the organisms, strongly influence the generic composition and population density of zooplankton. Prevention of ecological deterioration of the water body would greatly should result in a more productive water body, rich in zooplankton and with better fisheries. Rev. Biol. Trop. 57 (4: 1027-1047. Epub 2009 December 01.La influencia de las propiedades fisicoquímicas del Reservorio Oyun, Offa, Nigeria (un embalse tropical somero sobre la composición y abundancia del zooplancton fue investigada en tres estaciones entre enero de 2002 y diciembre de 2003. La diversidad no resultó muy alta con tres grupos de zooplancton: Rotifera con ocho géneros, y Cladocera y Copepoda con tres géneros cada uno. Rotifera dominó (71.02%, seguido de Cladocera (16.45% y Copepoda (12.53%. El zooplancton fue más común durante la temporada de lluvias, y hubo variaciones en su composición y abundancia a lo largo del embalse. Factores tales como la temperatura, los nutrientes, la disponibilidad de alimentos, la forma y la hidrodinámica del embalse, así como las estrategias reproductivas de los organismos, influyen fuertemente en la composición genérica y la densidad poblacional del zooplancton. La

  10. Mixed-linker zeolitic imidazolate framework mixed-matrix membranes for aggressive CO2 separation from natural gas

    KAUST Repository

    Thompson, Joshua A.; Vaughn, Justin T.; Brunelli, Nicholas A.; Koros, William J.; Jones, Christopher W.; Nair, Sankar

    2014-01-01

    Zeolitic imidazolate framework (ZIF) materials are a promising subclass of metal-organic frameworks (MOF) for gas separations. However, due to the deleterious effects of gate-opening phenomena associated with organic linker rotation near

  11. Hybrid Zeolitic Imidazolate Frameworks: Controlling Framework Porosity and Functionality by Mixed-Linker Synthesis

    KAUST Repository

    Thompson, Joshua A.; Blad, Catherine R.; Brunelli, Nicholas A.; Lydon, Megan E.; Lively, Ryan P.; Jones, Christopher W.; Nair, Sankar

    2012-01-01

    Zeolitic imidazolate frameworks (ZIFs) are a subclass of nanoporous metal-organic frameworks (MOFs) that exhibit zeolite-like structural topologies and have interesting molecular recognition properties, such as molecular sieving and gate

  12. COLOCALIZATION OF MUSCARINIC AND NICOTINIC RECEPTORS IN CHOLINOCEPTIVE NEURONS OF THE SUPRACHIASMATIC REGION IN YOUNG AND AGED RATS

    NARCIS (Netherlands)

    VANDERZEE, EA; STREEFLAND, C; STROSBERG, AD; SCHRODER, H; LUITEN, PGM; Schröder, H.

    1991-01-01

    In the present study muscarinic and nicotinic cholinergic receptors in the SCN region were demonstrated and analyzed, employing monoclonal antibodies to purified muscarinic and nicotinic cholinergic receptor proteins. A near-total colocalization of the two acetylcholine receptor subclasses in

  13. Occupational exposure to pesticides and endotoxin and Parkinson disease in the Netherlands

    NARCIS (Netherlands)

    van der Mark, Marianne; Vermeulen, Roel; Nijssen, Peter C. G.; Mulleners, Wim M.; Sas, Antonetta M. G.; van Laar, Teus; Brouwer, Maartje; Huss, Anke; Kromhout, Hans

    2014-01-01

    Objectives Previous research has indicated that occupational exposure to pesticides and possibly airborne endotoxin may increase the risk of developing Parkinson disease (PD). We studied the associations of PD with occupational exposure to pesticides, specifically to the functional subclasses

  14. The fast and furious : Cocaine, amphetamines and harm reduction

    NARCIS (Netherlands)

    J-P.C. Grund (Jean-Paul); P. Coffin (Philip); M. Jauffret-Roustide (Marie); M. Dijkstra (Minke); D. de Bruin (Dick); P. Blanken (Peter)

    2010-01-01

    textabstractCocaine and amphetamines (‘stimulants’) are distinct central nervous system stimulants with similar effects (Pleuvry, 2009; Holman, 1994). Cocaine is a crystalline tropane alkaloid extracted from coca leaves. Amphetamines are a subclass of phenylethylamines with primarily stimulant

  15. Multi-objective parametric optimization of powder mixed electro ...

    Indian Academy of Sciences (India)

    Multiple linear regression models have ... surface optimization scheme to select the parameters in powder mixed EDM process. Keskin ... Genetic algorithm (GA) is a subclass of population based stochastic search procedure which is.

  16. 2581-IJBCS-Article-Fokam Z

    African Journals Online (AJOL)

    hp

    correlation analysis between soil physico-chemical parameters and biological .... The following formula was used to obtain ... is further divided into three equivalent parts: ... Astomes and hysterocinedae sub-classes. ... Moisture and soil texture.

  17. Coping with living in the soil: : the genome of the parthenogenetic springtail Folsomia candida

    NARCIS (Netherlands)

    Faddeeva-Vakhrusheva, Anna; Kraaijeveld, Ken; Derks, Martijn F L; Anvar, Seyed Yahya; Agamennone, Valeria; Suring, Wouter; Kampfraath, Andries A.; Ellers, Jacintha; Le Ngoc, Giang; van Gestel, Cornelis A.M.; Mariën, Janine; Smit, Sandra; van Straalen, Nico M.; Roelofs, Dick

    2017-01-01

    BACKGROUND: Folsomia candida is a model in soil biology, belonging to the family of Isotomidae, subclass Collembola. It reproduces parthenogenetically in the presence of Wolbachia, and exhibits remarkable physiological adaptations to stress. To better understand these features and adaptations to

  18. Protein (Cyanobacteria): 553729681 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available WP_023064372.1 ... 1117:4910 ... 1150:25585 1301283:43816 ... 28073:3666 118322:924 ... PEP-CTERM sorting , cyanoba...cterial subclass domain protein Lyngbya aestuarii MQNATIDGVYFVPEPFTILGTGTALGFGVLFKKESSKKRKKEKAKV

  19. Szekeres spacetimes with heat flow

    International Nuclear Information System (INIS)

    Lima, J.A.S. de.

    1986-01-01

    A new class of inhomogeneous exact solutions of Einstein field equations is given. They generalize the dust-filled models found by Szekeres. In the course of time a subclass of models present a friedmannian phase.(Author) [pt

  20. 21 CFR 173.150 - Milk-clotting enzymes, microbial.

    Science.gov (United States)

    2010-04-01

    ...; family, Bacillaceae; genus, Bacillus; species, cereus (Frankland and Frankland). (3) Mucor pusillus Lindt...; genus, Mucor; species, pusillus; variety, Lindt. (4) Mucor miehei Cooney et Emerson classified as follows: Class, Phycomycetes; subclass, Zygomycetes; order, Mucorales; family, Mucoraceae; genus, Mucor...

  1. Measurement of food flavonoids by high-performance liquid chromatography: A review.

    Science.gov (United States)

    Merken, H M; Beecher, G R

    2000-03-01

    The flavonoids are plant polyphenols found frequently in fruits, vegetables, and grains. Divided into several subclasses, they include the anthocyanidins, pigments chiefly responsible for the red and blue colors in fruits, fruit juices, wines, and flowers; the catechins, concentrated in tea; the flavanones and flavanone glycosides, found in citrus and honey; and the flavones, flavonols, and flavonol glycosides, found in tea, fruits, vegetables, and honey. Known for their hydrogen-donating antioxidant activity as well as their ability to complex divalent transition metal cations, flavonoids are propitious to human health. Computer-controlled high-performance liquid chromatography (HPLC) has become the analytical method of choice. Many systems have been developed for the detection and quantification of flavonoids across one, two, or three subclasses. A summary of the various HPLC and sample preparation methods that have been employed to quantify individual flavonoids within a subclass or across several subclasses are tabulated in this review.

  2. Measurement of antibodies to tubulin by radioimmunoassay

    Energy Technology Data Exchange (ETDEWEB)

    Mead, G M; Cowin, P; Whitehouse, J M.A. [CRC Medical Oncology Unit, Southampton General Hospital, Southampton, U.K.

    1979-07-24

    A solid-phase double antibody radioimmunoassay capable of measuring antibody to tubulin, the principal component of microtubules, is described. This assay is simple, combining sensitivity with specificity and also allowing determination of antibody subclasses.

  3. Context-sensitive intra-class clustering

    KAUST Repository

    Yu, Yingwei; Gutierrez-Osuna, Ricardo; Choe, Yoonsuck

    2014-01-01

    This paper describes a new semi-supervised learning algorithm for intra-class clustering (ICC). ICC partitions each class into sub-classes in order to minimize overlap across clusters from different classes. This is achieved by allowing partitioning

  4. Using the generalised invariant formalism: a class of conformally flat pure radiation metrics with a negative cosmological constant

    Energy Technology Data Exchange (ETDEWEB)

    Edgar, S Brian [Department of Mathematics, Linkoepings Universitet Linkoeping, S-581 83 (Sweden); Ramos, M P Machado [Departamento de Matematica para a Ciencia e Tecnologia, Azurem 4800-058 Guimaraes, Universidade do Minho (Portugal)

    2007-05-15

    We demonstrate an integration procedure for the generalised invariant formalism by obtaining a subclass of conformally flat pure radiation spacetimes with a negative cosmological constant. The method used is a development of the methods used earlier for pure radiation spacetimes of Petrov types O and N respectively. This subclass of spacetimes turns out to have one degree of isotropy freedom, so in this paper we have extended the integration procedure for the generalised invariant formalism to spacetimes with isotropy freedom,.

  5. Using the generalised invariant formalism: a class of conformally flat pure radiation metrics with a negative cosmological constant

    International Nuclear Information System (INIS)

    Edgar, S Brian; Ramos, M P Machado

    2007-01-01

    We demonstrate an integration procedure for the generalised invariant formalism by obtaining a subclass of conformally flat pure radiation spacetimes with a negative cosmological constant. The method used is a development of the methods used earlier for pure radiation spacetimes of Petrov types O and N respectively. This subclass of spacetimes turns out to have one degree of isotropy freedom, so in this paper we have extended the integration procedure for the generalised invariant formalism to spacetimes with isotropy freedom,

  6. Forest Grammar(Ⅰ)

    Institute of Scientific and Technical Information of China (English)

    张松懋

    1994-01-01

    Forest grammar,a new type of high-dimensional grammar,is proposed in this paper,of which both the left and the right parts of every production are concatenations of tree structures.A classification of forest grammar is studied,especially,a subclass of the forest grammar,i.e.the context-sensitive forest grammar,and one of its subclasses is defined,called the weak precedence forest grammar.

  7. Untitled

    African Journals Online (AJOL)

    Our results showed that except for IgG4 (22.3%), the prevalence of each IgG subclass was above 70% and that the level of total IgG correlated with those of all the four IgG subclassics. The level of gC4 to crude malaria antigens positively correlated with the episode of clinical fever and negatively with the age of the study ...

  8. Structural characterization of the Man5 glycoform of human IgG3 Fc

    Energy Technology Data Exchange (ETDEWEB)

    Shah, Ishan S.; Lovell, Scott; Mehzabeen, Nurjahan; Battaile, Kevin P.; Tolbert, Thomas J. (Kansas); (HWMRI)

    2017-12-01

    Immunoglobulin G (IgG) consists of four subclasses in humans: IgG1, IgG2, IgG3 and IgG4, which are highly conserved but have unique differences that result in subclass-specific effector functions. Though IgG1 is the most extensively studied IgG subclass, study of other subclasses is important to understand overall immune function and for development of new therapeutics. When compared to IgG1, IgG3 exhibits a similar binding profile to Fcγ receptors and stronger activation of complement. All IgG subclasses are glycosylated at N297, which is required for Fcγ receptor and C1q complement binding as well as maintaining optimal Fc conformation. We have determined the crystal structure of homogenously glycosylated human IgG3 Fc with a GlcNAc2Man5 (Man5) high mannose glycoform at 1.8 Å resolution and compared its structural features with published structures from the other IgG subclasses. Although the overall structure of IgG3 Fc is similar to that of other subclasses, some structural perturbations based on sequence differences were revealed. For instance, the presence of R435 in IgG3 (and H435 in the other IgG subclasses) has been implicated to result in IgG3-specific properties related to binding to protein A, protein G and the neonatal Fc receptor (FcRn). The IgG3 Fc structure helps to explain some of these differences. Additionally, protein-glycan contacts observed in the crystal structure appear to correlate with IgG3 affinity for Fcγ receptors as shown by binding studies with IgG3 Fc glycoforms. Finally, this IgG3 Fc structure provides a template for further studies aimed at engineering the Fc for specific gain of function.

  9. PLANT SPECIES, USING AGAINST VIROUS INFECTIONS OF MAN AND ANIMALS: REGULARITIES OF THE DISTRIBUTION IN THE PHYLOGENETIC CLASSIFICATION SYSTEM

    OpenAIRE

    Popov P.L.

    2008-01-01

    The list of 674 species of flowering plants, using against 21 virous infections of man and animals is presented. Systematic units of high levels (classes, subclasses) are defined by frequency of such species. Frequency (distinction of percentage parts of species with certain use between the systematic unit and the rest of flora of flowering plants) was estimated by Fisher's statistical criterion. Subclasses Lamiidae and Asteridae, latter in the evolution range, are most rich by uses against v...

  10. Bianchi like classification of cosmologies in conformally flat space-times

    International Nuclear Information System (INIS)

    Tauber, G.E.

    1989-01-01

    Solutions of Killing's equations for a conformally flat line element have been found, which are seen to correspond to the conformal group of transformations consisting of the pure conformal group, the Lorentz group, translation and dilation. A classification of the line element has been carried out, singly and combining several of them. Upon comparison with expanding universes it has been found that the Friedmann universes are a subclass with other cosmologies resulting in wider subclasses. (orig.)

  11. Variaciones de abundancia y biomasa del zooplancton en un embalse tropical oligo-mesotrófico del norte de Venezuela

    Directory of Open Access Journals (Sweden)

    Sandra Merayo

    2010-06-01

    Full Text Available La abundancia del zooplancton en los embalses está determinada principalmente por la velocidad y el contenido del agua, pero se sabe relativamente poco sobre los embalses tropicales. Se estudió la distribución temporal y espacial de la abundancia y la biomasa del zooplancton en el eje longitudinal del embalse de Clavellinos, en el norte de Venezuela, entre octubre 2006 y septiembre 2007. El zooplancton fue recolectado en el estrato oxigenado con una red de plancton. Un total de 16 taxones fueron identificados: Copepoda, Cladocera, Rotifera, Ostracoda y Diptera. Thermocyclops decipiens (Copepoda, Cyclopoida dominó la comunidad, mientras que los rotíferos fueron los más diversos, con 10 especies. La abundancia del zooplancton varió de 31 a 101ind/l en E1, 36 a 84ind/l en E2, y, de 30 a 250ind/L en el E3. La biomasa varió de 97,4 a 1406.3μg/l en E1, 108,5 a 397.2μg/l en E2, y de 25,9 a 763.9μg/l en el E3. Esta comunidad de zooplancton pareciσ responder a las variaciones ambientales en el embalse, mαs que a las variaciones en la disponibilidad de recursos.

  12. Spatial Distribution of Zooplankton Diversity across Temporary Pools in a Semiarid Intermittent River

    Directory of Open Access Journals (Sweden)

    Thaís X. Melo

    2013-01-01

    Full Text Available This study describes the richness and density of zooplankton across temporary pools in an intermittent river of semiarid Brazil and evaluates the partitioning of diversity across different spatial scales during the wet and dry periods. Given the highly patchy nature of these pools it is hypothesized that the diversity is not homogeneously distributed across different spatial scales but concentrated at lower levels. The plankton fauna was composed of 37 species. Of these 28 were Rotifera, 5 were Cladocera, and 4 were Copepoda (nauplii of Copepoda were also recorded. We showed that the zooplankton presents a spatially segregated pattern of species composition across river reaches and that at low spatial scales (among pools or different habitats within pools the diversity of species is likely to be affected by temporal changes in physical and chemical characteristics. As a consequence of the drying of pool habitats, the spatial heterogeneity within the study river reaches has the potential to increase β diversity during the dry season by creating patchier assemblages. This spatial segregation in community composition and the patterns of partition of the diversity across the spatial scales leads to a higher total diversity in intermittent streams, compared to less variable environments.

  13. The impact of water table drawdown and drying on subterranean aquatic fauna in in-vitro experiments.

    Directory of Open Access Journals (Sweden)

    Christine Stumpp

    Full Text Available The abstraction of groundwater is a global phenomenon that directly threatens groundwater ecosystems. Despite the global significance of this issue, the impact of groundwater abstraction and the lowering of groundwater tables on biota is poorly known. The aim of this study is to determine the impacts of groundwater drawdown in unconfined aquifers on the distribution of fauna close to the water table, and the tolerance of groundwater fauna to sediment drying once water levels have declined. A series of column experiments were conducted to investigate the depth distribution of different stygofauna (Syncarida and Copepoda under saturated conditions and after fast and slow water table declines. Further, the survival of stygofauna under conditions of reduced sediment water content was tested. The distribution and response of stygofauna to water drawdown was taxon specific, but with the common response of some fauna being stranded by water level decline. So too, the survival of stygofauna under different levels of sediment saturation was variable. Syncarida were better able to tolerate drying conditions than the Copepoda, but mortality of all groups increased with decreasing sediment water content. The results of this work provide new understanding of the response of fauna to water table drawdown. Such improved understanding is necessary for sustainable use of groundwater, and allows for targeted strategies to better manage groundwater abstraction and maintain groundwater biodiversity.

  14. Zooplankton community of Parnaíba River, Northeastern Brazil

    Directory of Open Access Journals (Sweden)

    Ludmilla Cavalcanti Antunes Lucena

    2015-03-01

    Full Text Available Aim:The objective of the present work is to present a list of species of zooplankton (Rotifera, Cladocera and Copepoda from the Parnaíba River. Additionally, we provide comments on their distribution along the river, and between dry and wet seasons.MethodsZooplankton was collected with a plankton net (60 µm mesh and concentrated into a volume of 80 mL for further analysis, during the dry (October 2010 and wet (April 2011 seasons. Sampling was restricted to the marginal areas at depths between 80 and 150 cm.ResultsA total of 132 species was recorded among the three zooplankton groups studied. During the dry season a total of 82 species was registered and 102 species was registered for the wet season. Rotifera contributed with 66.7% of the species, followed by Cladocera (26.5% and Copepoda (6.8%.ConclusionsThe richness of species observed was high compared to other large rivers in Brazil. In the context of current policies for water management and river diversions in northeastern Brazil, the present study highlights the importance of this river system for biodiversity conservation.

  15. An Eocene orthocone from Antarctica shows convergent evolution of internally shelled cephalopods

    Science.gov (United States)

    Bengtson, Stefan; Reguero, Marcelo A.; Mörs, Thomas

    2017-01-01

    Background The Subclass Coleoidea (Class Cephalopoda) accommodates the diverse present-day internally shelled cephalopod mollusks (Spirula, Sepia and octopuses, squids, Vampyroteuthis) and also extinct internally shelled cephalopods. Recent Spirula represents a unique coleoid retaining shell structures, a narrow marginal siphuncle and globular protoconch that signify the ancestry of the subclass Coleoidea from the Paleozoic subclass Bactritoidea. This hypothesis has been recently supported by newly recorded diverse bactritoid-like coleoids from the Carboniferous of the USA, but prior to this study no fossil cephalopod indicative of an endochochleate branch with an origin independent from subclass Bactritoidea has been reported. Methodology/Principal findings Two orthoconic conchs were recovered from the Early Eocene of Seymour Island at the tip of the Antarctic Peninsula, Antarctica. They have loosely mineralized organic-rich chitin-compatible microlaminated shell walls and broadly expanded central siphuncles. The morphological, ultrustructural and chemical data were determined and characterized through comparisons with extant and extinct taxa using Scanning Electron Microscopy/Energy Dispersive Spectrometry (SEM/EDS). Conclusions/Significance Our study presents the first evidence for an evolutionary lineage of internally shelled cephalopods with independent origin from Bactritoidea/Coleoidea, indicating convergent evolution with the subclass Coleoidea. A new subclass Paracoleoidea Doguzhaeva n. subcl. is established for accommodation of orthoconic cephalopods with the internal shell associated with a broadly expanded central siphuncle. Antarcticerida Doguzhaeva n. ord., Antarcticeratidae Doguzhaeva n. fam., Antarcticeras nordenskjoeldi Doguzhaeva n. gen., n. sp. are described within the subclass Paracoleoidea. The analysis of organic-rich shell preservation of A. nordenskjoeldi by use of SEM/EDS techniques revealed fossilization of hyposeptal cameral soft tissues

  16. Reliability of nine programs of topological predictions and their application to integral membrane channel and carrier proteins.

    Science.gov (United States)

    Reddy, Abhinay; Cho, Jaehoon; Ling, Sam; Reddy, Vamsee; Shlykov, Maksim; Saier, Milton H

    2014-01-01

    We evaluated topological predictions for nine different programs, HMMTOP, TMHMM, SVMTOP, DAS, SOSUI, TOPCONS, PHOBIUS, MEMSAT-SVM (hereinafter referred to as MEMSAT), and SPOCTOPUS. These programs were first evaluated using four large topologically well-defined families of secondary transporters, and the three best programs were further evaluated using topologically more diverse families of channels and carriers. In the initial studies, the order of accuracy was: SPOCTOPUS > MEMSAT > HMMTOP > TOPCONS > PHOBIUS > TMHMM > SVMTOP > DAS > SOSUI. Some families, such as the Sugar Porter Family (2.A.1.1) of the Major Facilitator Superfamily (MFS; TC #2.A.1) and the Amino Acid/Polyamine/Organocation (APC) Family (TC #2.A.3), were correctly predicted with high accuracy while others, such as the Mitochondrial Carrier (MC) (TC #2.A.29) and the K(+) transporter (Trk) families (TC #2.A.38), were predicted with much lower accuracy. For small, topologically homogeneous families, SPOCTOPUS and MEMSAT were generally most reliable, while with large, more diverse superfamilies, HMMTOP often proved to have the greatest prediction accuracy. We next developed a novel program, TM-STATS, that tabulates HMMTOP, SPOCTOPUS or MEMSAT-based topological predictions for any subdivision (class, subclass, superfamily, family, subfamily, or any combination of these) of the Transporter Classification Database (TCDB; www.tcdb.org) and examined the following subclasses: α-type channel proteins (TC subclasses 1.A and 1.E), secreted pore-forming toxins (TC subclass 1.C) and secondary carriers (subclass 2.A). Histograms were generated for each of these subclasses, and the results were analyzed according to subclass, family and protein. The results provide an update of topological predictions for integral membrane transport proteins as well as guides for the development of more reliable topological prediction programs, taking family-specific characteristics into account. © 2014 S. Karger AG, Basel.

  17. Feeding ecology of Rivulus luelingi (Aplocheiloidei: Rivulidae in a Coastal Atlantic Rainforest stream, southern Brazil

    Directory of Open Access Journals (Sweden)

    Vinícius Abilhoa

    Full Text Available Feeding habits of the killifish Rivulus luelingi collected in a black water stream of the Coastal Atlantic Rainforest in southern Brazil were investigated. Eight samplings were made between April 2003 and January 2004. The diet, assessed through a similarity matrix with the estimated contribution values of food items, included microcrustaceans, aquatic immature insects (larvae and pupae, aquatic adult insects, terrestrial insects, insect fragments, spiders, and plant fragments. Differences in the diet according to temporal variations (months were registered, but changes related with size classes evaluated and high/low precipitation period were not observed. The species presented an insectivorous feeding habit, and its diet in the studied stream was composed of autochthonous (mainly aquatic immature insects and allochthonous (mainly insect fragments material.

  18. A new species of dwarf sea bass, genus Serranus (Serranidae: Actinopterygii, from the southwestern Atlantic Ocean

    Directory of Open Access Journals (Sweden)

    Alfredo Carvalho Filho

    Full Text Available Serranus aliceae n. sp. is described from Rio de Janeiro and Espírito Santo States, southeastern Brazilian coast. The species is readily distinguished from its congeners by the following combination of characters: scales around the caudal peduncle 20 or 21; total gill rakers on first branchial arch 23-29; cheek-scales rows 5 or 6; and by the coloration of live specimens, which are reddish with a broad, conspicuous, white stripe from post-orbital region to the caudal-fin base and a white abdomen. The new species apparently inhabits the deeper (30 or more meters portions of reef environments along the subtropical Brazilian coast, and is possibly associated with upwelling cold-water masses. The species was observed hovering above rocky bottoms, feeding on micro-crustaceans, squid larvae, and zooplankton. This new species increases to eight the number of valid Serranus species recorded in the southwestern Atlantic.

  19. Predatory impact of the mosquitofish (Gambusia holbrooki Girard on zooplanktonic populations in a pond at Tenuta di Castelporziano (Rome, Central Italy

    Directory of Open Access Journals (Sweden)

    Ornella FERRARA

    2001-08-01

    Full Text Available A study of a permanent pond located in a nature reserve in Central Italy was carried out over two periods (1985-87; 1995-98 to determine the structure and dynamics of planktonic biocoenosis. The composition of the zooplankton community was quite different in the two periods of study: in the first period, rotifers, small-bodied cladocerans and larval copepods were the dominant groups; in the second there was a shift from rotifers and microcrustaceans to dominance by large-bodied Daphnidae and adult copepods. The possibility is stressed that Gambusia holbrooki, present in 1985 and absent in 1995, may be responsible for the changes in the planktonic community.

  20. Male meiosis in Crustacea: synapsis, recombination, epigenetics and fertility in Daphnia magna.

    Science.gov (United States)

    Gómez, Rocío; Van Damme, Kay; Gosálvez, Jaime; Morán, Eugenio Sánchez; Colbourne, John K

    2016-09-01

    We present the first detailed cytological study of male meiosis in Daphnia (Crustacea: Branchiopoda: Cladocera)-an aquatic microcrustacean with a cyclical parthenogenetic life cycle. Using immunostaining of the testes in Daphnia magna for baseline knowledge, we characterized the different stages of meiotic division and spermiogenesis in relation to the distribution of proteins involved in synapsis, early recombination events and sister chromatid cohesion. We also studied post-translational histone modifications in male spermatocytes, in relation to the dynamic chromatin progression of meiosis. Finally, we applied a DNA fragmentation test to measure sperm quality of D. magna, with respect to levels of inbreeding. As a proxy for fertility, this technique may be used to assess the reproductive health of a sentinel species of aquatic ecosystems. Daphnia proves to be a model species for comparative studies of meiosis that is poised to improve our understanding of the cytological basis of sexual and asexual reproduction.

  1. Ecotoxicological impact of pharmaceuticals found in treated wastewaters: study of carbamazepine, clofibric acid, and diclofenac.

    Science.gov (United States)

    Ferrari, Benoît; Paxéus, Nicklas; Lo Giudice, Roberto; Pollio, Antonino; Garric, Jeanne

    2003-07-01

    In four countries (France, Greece, Italy, and Sweden) occurrence in sewage treatment plant (STP) effluents and ecotoxicity of the pharmaceuticals carbamazepine, clofibric acid, and diclofenac were investigated. Bioassays were performed on bacteria, algae, microcrustaceans, and fishes in order to calculate their predicted no-effect concentrations (PNEC) and to perform a first approach of risk characterization. For this aim, risk has been estimated by the predicted environmental concentration/PNEC ratio and the measured environmental concentration/PNEC ratio. First, regarding the PNEC, carbamazepine appears to be the more hazardous compound. Second, even though it is demonstrated that carbamazepine, clofibric acid, and diclofenac have been detected in effluents, only carbamazepine have been detected in all sewage treatment plants with the greatest concentrations. Third, risk quotients greater than unity were calculated only for carbamazepine, suggesting that risk for the water compartment is expected.

  2. Evaluation of acute and chronic toxicity of DSS and LAS surfactants undergoing the irradiation with electron beam

    International Nuclear Information System (INIS)

    Romanelli, Maria Fernanda

    2004-01-01

    Surfactants are synthetic organic compounds widely used in cosmetic, food, textile, dyers and paper production industries and in particular detergents and others cleaning products industries. The world consumption is nearly 8 million tons per year. One of the main environmental issues coming from the use of these compounds is their toxicity that compromises the biological treatment of effluents and the quality of receiving waters. The objective of this work was the application of ionizing radiation by electron beam in the degradation and reduction of acute and chronic toxicities of surfactants sodium dodecylsulfate (SDS), dodecyl p-benzenesulfonate acid (LAS) and sodium dodecyl p-benzenesulfonate (LAS). This treatment technology has been studied as a pre-treatment for effluents containing toxic and non-biodegradable compounds, before the biological treatment. Two acute toxicity assays were employed, one with the micro-crustacean Daphnia similis and the other with the luminescent bacterium Vibrio fischeri along with a chronic toxicity assay with the micro-crustacean Ceriodaphnia dubia (just for SDS and acid LAS) for the non-irradiated and irradiated samples and radiation doses 3.0 kGy, 6.0 kGy, 9.0 kGy and 12.0 kGy. Physical-chemical parameters were evaluated for the following up the degradation of the surfactant molecules. The reductions of acute toxicity varied between 72.49% and 90.98% for SDS, 18.22% and 78.98% for acid LAS and 82.66% and 94.26% for sodium LAS. For the chronic toxicity, the reduction percentages varied between 64.03% and 83.01% for SDS and 47.48% and 64.91% for acid LAS. When one considers the application of the electron beam as a pre-treatment of effluents containing high concentrations of surfactants, the toxicity is an essential parameter allowing the further biological treatment of these effluents. (author)

  3. The Infection of Cucumber (Cucumis sativus L. Roots by Meloidogyne incognita Alters the Expression of Actin-Depolymerizing Factor (ADF Genes, Particularly in Association with Giant Cell Formation

    Directory of Open Access Journals (Sweden)

    Bin Liu

    2016-09-01

    Full Text Available Cucumber (Cucumis sativus L. is threatened by substantial yield losses due to the south root-knot nematode (Meloidogyne incognita. However, understanding of the molecular mechanisms underlying the process of nematode infection is still limited. In this study, we found that M. incognita infection affected the structure of cells in cucumber roots and treatment of the cytoskeleton inhibitor (cytochalasin D reduced root-knot nematode (RKN parasitism. It is known that Actin-Depolymerizing Factor (ADF affects cell structure, as well as the organization of the cytoskeleton. To address the hypothesis that nematode-induced abnormal cell structures and cytoskeletal rearrangements might be mediated by the ADF genes, we identified and characterized eight cucumber ADF (CsADF genes. Phylogenetic analysis showed that the cucumber ADF gene family is grouped into four ancient subclasses. Expression analysis revealed that CsADF1, CsADF2-1, CsADF2-2, CsADF2-3 (Subclass I and CsADF6 (Subclass III have higher transcript levels than CsADF7-1, CsADF7-2 (Subclass II genes and CsADF5 (Subclass IV in roots. Members of subclass I genes (CsADF1, CsADF2-1, CsADF2-2 and CsADF2-3, with the exception of CsADF2-1, exhibited a induction of expression in roots 14 days after their inoculation (DAI with nematodes. However, the expression of subclass II genes (CsADF7-1 and CsADF7-2 showed no significant change after inoculation. The transcript levels of CsADF6 (Subclass III showed a specific induction at 21 DAI, while CsADF5 (Subclass IV was weakly expressed in roots, but was strongly up-regulated as early as 7 DAI. In addition, treatment of roots with cytochalasin D caused an approximately two-fold down-regulation of the CsADF genes in the treated plants. These results suggest that CsADF gene mediated actin dynamics are associated with structural changes in roots as a consequence of M. incognita infection.

  4. Macroscopic Rock Texture Image Classification Using a Hierarchical Neuro-Fuzzy Class Method

    Directory of Open Access Journals (Sweden)

    Laercio B. Gonçalves

    2010-01-01

    Full Text Available We used a Hierarchical Neuro-Fuzzy Class Method based on binary space partitioning (NFHB-Class Method for macroscopic rock texture classification. The relevance of this study is in helping Geologists in the diagnosis and planning of oil reservoir exploration. The proposed method is capable of generating its own decision structure, with automatic extraction of fuzzy rules. These rules are linguistically interpretable, thus explaining the obtained data structure. The presented image classification for macroscopic rocks is based on texture descriptors, such as spatial variation coefficient, Hurst coefficient, entropy, and cooccurrence matrix. Four rock classes have been evaluated by the NFHB-Class Method: gneiss (two subclasses, basalt (four subclasses, diabase (five subclasses, and rhyolite (five subclasses. These four rock classes are of great interest in the evaluation of oil boreholes, which is considered a complex task by geologists. We present a computer method to solve this problem. In order to evaluate system performance, we used 50 RGB images for each rock classes and subclasses, thus producing a total of 800 images. For all rock classes, the NFHB-Class Method achieved a percentage of correct hits over 73%. The proposed method converged for all tests presented in the case study.

  5. Unexpectedly higher metazoan meiofauna abundances in the Kuril-Kamchatka Trench compared to the adjacent abyssal plains

    Science.gov (United States)

    Schmidt, Christina; Martínez Arbizu, Pedro

    2015-01-01

    We studied meiofauna standing stocks and community structure in the Kuril-Kamchatka Trench and its adjacent abyssal plains in the northwestern Pacific Ocean. In general, the Nematoda were dominant (93%) followed by the Copepoda (4%). Nematode abundances ranged from 87% to 96%; those of copepods from 2% to 7%. The most diverse deployment yielded 17 taxa: Acari, Amphipoda, Annelida, Bivalvia, Coelenterata, Copepoda, Cumacea, Gastrotricha, Isopoda, Kinorhyncha, Loricifera, Nematoda, Ostracoda, Priapulida, Tanaidacea, Tantulocarida, and Tardigrada. Nauplii were also present. Generally, the trench slope and the southernmost deployments had the highest abundances (850-1392 individuals/cm2). The results of non-metric multidimensional scaling indicated that these deployments were similar to each other in meiofauna community structure. The southernmost deployments were located in a zone of higher particulate organic carbon (POC) flux (g Corg m-2 yr-1), whereas the trench slope should have low POC flux due to depth attenuation. Also, POC and abundance were significantly correlated in the abyssal plains. This correlation may explain the higher abundances at the southernmost deployments. Lateral transport was also assumed to explain high meiofauna abundances on the trench slope. Abundances were generally higher than expected from model results. ANOSIM revealed significant differences between the trench slope and the northern abyssal plains, between the central abyssal plains and the trench slope, between the trench slope and the southern abyssal plains, between the central and the southern abyssal plains, and between the central and northern deployments. The northern and southern abyssal plains did not differ significantly. In addition, a U-test revealed highly significant differences between the trench-slope and abyssal deployments. The taxa inhabited mostly the upper 0-3 cm of the sediment layer (Nematoda 80-90%; Copepoda 88-100%). The trench-slope and abyssal did not differ

  6. Families of Meromorphic Multivalent Functions Associated with the Dziok-Raina Operator

    Directory of Open Access Journals (Sweden)

    G. Murugusundaramoorthy

    2013-07-01

    Full Text Available Making use a linear operator, which is defined here by means of the Hadamard product (or convolution, involving the Wright’s generalized hypergeometric function , we introduce two novel subclassesP p(q,s,α1;A,B,λ andP+p(q,s,α1;A,B,λ of meromorphically multivalent functions oforder λ(0 ≤ λ < p in the punctured disc U∗. In this paper we investigate the various important properties and characteristics of these subclasses of meromorphically multivalent functions. We extend the familiar concept of neighborhoods of analytic functions to these subclasses of meromorphically multivalent functions . We also derive many interesting results for the Hadamard products of functions belonging to the classP+p(q,s,α1;A,B,λ.

  7. Variable beam dose rate and DMLC IMRT to moving body anatomy

    International Nuclear Information System (INIS)

    Papiez, Lech; Abolfath, Ramin M.

    2008-01-01

    Derivation of formulas relating leaf speeds and beam dose rates for delivering planned intensity profiles to static and moving targets in dynamic multileaf collimator (DMLC) intensity modulated radiation therapy (IMRT) is presented. The analysis of equations determining algorithms for DMLC IMRT delivery under a variable beam dose rate reveals a multitude of possible delivery strategies for a given intensity map and for any given target motion patterns. From among all equivalent delivery strategies for DMLC IMRT treatments specific subclasses of strategies can be selected to provide deliveries that are particularly suitable for clinical applications providing existing delivery devices are used. Special attention is devoted to the subclass of beam dose rate variable DMLC delivery strategies to moving body anatomy that generalize existing techniques of such deliveries in Varian DMLC irradiation methodology to static body anatomy. Few examples of deliveries from this subclass of DMLC IMRT irradiations are investigated to illustrate the principle and show practical benefits of proposed techniques.

  8. Variable beam dose rate and DMLC IMRT to moving body anatomy

    Energy Technology Data Exchange (ETDEWEB)

    Papiez, Lech; Abolfath, Ramin M. [Department of Radiation Oncology, UTSouthwestern Medical Center, Dallas, Texas 75390 (United States)

    2008-11-15

    Derivation of formulas relating leaf speeds and beam dose rates for delivering planned intensity profiles to static and moving targets in dynamic multileaf collimator (DMLC) intensity modulated radiation therapy (IMRT) is presented. The analysis of equations determining algorithms for DMLC IMRT delivery under a variable beam dose rate reveals a multitude of possible delivery strategies for a given intensity map and for any given target motion patterns. From among all equivalent delivery strategies for DMLC IMRT treatments specific subclasses of strategies can be selected to provide deliveries that are particularly suitable for clinical applications providing existing delivery devices are used. Special attention is devoted to the subclass of beam dose rate variable DMLC delivery strategies to moving body anatomy that generalize existing techniques of such deliveries in Varian DMLC irradiation methodology to static body anatomy. Few examples of deliveries from this subclass of DMLC IMRT irradiations are investigated to illustrate the principle and show practical benefits of proposed techniques.

  9. The Library of Congress, Dewey Decimal, and Universal Decimal Classification Systems are Incomplete and Unsystematic. A Review of: Zins, C., & Santos, P. L. V. A. C. (2011. Mapping the knowledge covered by library classification systems. Journal of the American Society for Information Science and Technology, 62(5, 877-901. doi:10.1002/asi.21481

    Directory of Open Access Journals (Sweden)

    Cari Merkley

    2011-01-01

    Full Text Available Objective – To determine the extent to which knowledge is currently addressed by the Library of Congress (LCC, Dewey Decimal (DDC, and Universal Decimal (UDC classification systems.Design – Comparative analysis of the LCC, DDC, and UDC systems using Zin’s 10 Pillars of Knowledge.Setting – The Faculty of Philosophy and Science at a Brazilian university.Subjects – Forty one subject-related classes and 386 subclasses from the first two levels of the LCC, DDC, and UDC systems.Methods – To evaluate the LCC, DDC, and UDC systems, the researchers employed the 10 Pillars of Knowledge, a “hierarchical knowledge tree” developed by the lead author of this study (p. 878. According to the authors, the 10 Pillars of Knowledge seek to illustrate relationships between fields of knowledge while capturing their breadth. The first level of the Pillars consists of the following categories: Knowledge, Supernatural, Matter and Energy, Space and Earth, Nonhuman Organizations, Body and Mind, Society, Thought and Art, Technology, and History. Each of the 10 Pillars is further subdivided, resulting in a four level hierarchical structure of 76 categories. Of the 76 categories, 55 are unique subject areas. A selection of subject-based classes and subclasses from the first two levels of the LCC, DDC, and UDC systems were then mapped to the relevant subclasses within the Pillars. Analysis was limited to the first two levels of LCC, DDC, and UDC, except for the LCC categories of BF and BL where further subclasses were analyzed. Classes or subclasses in LCC, DDC, or UDC that were not subject based (for example, those based on publication type were excluded from the study. In total, 41 main classes and 386 subclasses from LLC, DDC, and UDC were categorized using the 10 Pillars.Main Results – The LLC, DDC, and UDC systems were deemed to be complete and systematic in their coverage of only three of the 10 Pillars: Matter and Energy, Thought and Art, and History

  10. Classification of Actions or Inheritance also for Methods

    DEFF Research Database (Denmark)

    Kristensen, Bent Bruun; Madsen, Ole Lehrmann; Møller-Pedersen, Birger

    1987-01-01

    -class are specialized in sub-classes in a very primitive manner: they are simply re-defined and need not bear any resemblance of the virtual in the super-class. In BETA, a new object-oriented language, classes and methods are unified into one concept, and by an extension of the virtual concept, virtual procedures....../methods in sub-classes are defined as specializations of the virtuals in the super-class. The virtual procedures/methods of the sub-classes thus inherits the attributes (e.g. parameters) and actions from the “super-procedure/method”. In the languages mentioned above only procedures/methods may be virtual...

  11. Subclassification of newly diagnosed glioblastomas through an immunohistochemical approach.

    Directory of Open Access Journals (Sweden)

    Siobhan Conroy

    Full Text Available Molecular signatures in Glioblastoma (GBM have been described that correlate with clinical outcome and response to therapy. The Proneural (PN and Mesenchymal (MES signatures have been identified most consistently, but others including Classical (CLAS have also been reported. The molecular signatures have been detected by array techniques at RNA and DNA level, but these methods are costly and cannot take into account individual contributions of different cells within a tumor. Therefore, the aim of this study was to investigate whether subclasses of newly diagnosed GBMs could be assessed and assigned by application of standard pathology laboratory procedures. 123 newly diagnosed GBMs were analyzed for the tumor cell expression of 23 pre-identified proteins and EGFR amplification, together allowing for the subclassification of 65% of the tumors. Immunohistochemistry (IHC-based profiling was found to be analogous to transcription-based profiling using a 9-gene transcriptional signature for PN and MES subclasses. Based on these data a novel, minimal IHC-based scheme for subclass assignment for GBMs is proposed. Positive staining for IDH1R132H can be used for PN subclass assignment, high EGFR expression for the CLAS subtype and a combined high expression of PTEN, VIM and/or YKL40 for the MES subclass. The application of the proposed scheme was evaluated in an independent tumor set, which resulted in similar subclass assignment rates as those observed in the training set. The IHC-based subclassification scheme proposed in this study therefore could provide very useful in future studies for stratification of individual patient samples.

  12. Clinical and molecular sub-classification of hepatocellular carcinoma relative to alpha-fetoprotein level in an Asia-Pacific island cohort.

    Science.gov (United States)

    Nishioka, Scott T; Sato, Miles M; Wong, Linda L; Tiirikainen, Maarit; Kwee, Sandi A

    2018-01-01

    Increased serum alpha-fetoprotein (AFP) levels are associated with specific molecular sub-classes of hepatocellular carcinoma (HCC), supporting AFP as a predictive or therapeutic biomarker for precision treatment of this disease. Considering recent efforts to validate HCC molecular classification systems across different populations, we applied existing signature-based classification templates to Hawaii cohorts and examined whether associations between HCC molecular sub-class, AFP levels, and clinical features found elsewhere can also be found in Hawaii, a region with a unique demographic and risk factor profile for HCC. Whole-genome expression profiling was performed on HCC tumors collected from 40 patients following partial hepatectomy. Tumors underwent transcriptome-based categorization into 3 molecular sub-classes (S1, S2, and S3). Patient groups based on molecular sub-class and AFP level were then compared with regards to clinical features and survival. Differences associated with AFP level and other clinical parameters were also examined at the gene signature level by gene set enrichment analysis. Statistically confident (false discovery rate 400 ng/mL predicted significant tumor enrichment for genes corresponding to MYC target activation, high cell proliferation, poor clinical prognosis, and the S2 sub-class. AFP > 400 ng/mL and non-S3 tumor classification were found to be significant predictors of overall survival. Distinct sub-classes of HCC associated with different molecular features and survival outcomes can be detected with statistical confidence in a Pacific Island cohort. Molecular classification signatures and other predictive markers for HCC that are valid for all patient populations are needed to support multi-center efforts to develop targeted therapies for HCC.

  13. Superbounce and loop quantum ekpyrotic cosmologies from modified gravity: F(R) , F(G) and F(T) theories

    Science.gov (United States)

    Odintsov, S. D.; Oikonomou, V. K.; Saridakis, Emmanuel N.

    2015-12-01

    We investigate the realization of two bouncing paradigms, namely of the superbounce and the loop quantum cosmological ekpyrosis, in the framework of various modified gravities. In particular, we focus on the F(R) , F(G) and F(T) gravities, and we reconstruct their specific subclasses which lead to such universe evolutions. These subclasses constitute from power laws, polynomials, or hypergeometric ansatzes, which can be approximated by power laws. The qualitative similarity of the different effective gravities which realize the above two bouncing cosmologies, indicates that a universality might be lying behind the bounce. Finally, performing a linear perturbation analysis, we show that the obtained solutions are conditionally or fully stable.

  14. Virtual classes: a powerful mechanism in object-oriented programming

    DEFF Research Database (Denmark)

    Madsen, Ole Lehrmann; Møller-Pedersen, Birger

    1989-01-01

    The notions of class, subclass and virtual procedure are fairly well understood and recognized as some of the key concepts in object-oriented programming. The possibility of modifying a virtual procedure in a subclass is a powerful technique for specializing the general properties of the superclass....... In most object-oriented languages, the attributes of an object may be references to objects and (virtual) procedures. In Simula and BETA it is also possible to have class attributes. The power of class attributes has not yet been widely recognized. In BETA a class may also have virtual class attributes...

  15. Method of transient identification based on a possibilistic approach, optimized by genetic algorithm

    International Nuclear Information System (INIS)

    Almeida, Jose Carlos Soares de

    2001-02-01

    This work develops a method for transient identification based on a possible approach, optimized by Genetic Algorithm to optimize the number of the centroids of the classes that represent the transients. The basic idea of the proposed method is to optimize the partition of the search space, generating subsets in the classes within a partition, defined as subclasses, whose centroids are able to distinguish the classes with the maximum correct classifications. The interpretation of the subclasses as fuzzy sets and the possible approach provided a heuristic to establish influence zones of the centroids, allowing to achieve the 'don't know' answer for unknown transients, that is, outside the training set. (author)

  16. Keterkaitan Rg-aljabar Dan Struktur Grup

    OpenAIRE

    Yudi, Irwan

    2014-01-01

    In this paper is discussed an algebraic structure which is called RG-algebra. The RG-algebra is a subclass of BCI-algebra and a sub subclass of K-algebra. Therefore, everyRG-algebra is a BCI-algebra, but conversly is not true. The RG-algebra andGroup Structure have a relation. Its relation is RG-algebra can be constructed by acommutativegroup and conversly commutativegroup can be constructed by a RG-algebra. The RG-algebra is a K-algebra with commutativegroupas generator group.

  17. Passive immunization against Cryptococcus neoformans with an isotype-switch family of monoclonal antibodies reactive with cryptococcal polysaccharide.

    OpenAIRE

    Sanford, J E; Lupan, D M; Schlageter, A M; Kozel, T R

    1990-01-01

    The in vivo properties of an immunoglobulin isotype-switch family of monoclonal antibodies specific for the polysaccharide capsule of Cryptococcus neoformans were examined in a murine model of cryptococcosis. Subclass-switch variants were isolated by sequential sublining of an immunoglobulin G subclass 1 (IgG1)-secreting cell line. Antibodies of the IgG1, IgG2a, and IgG2b isotypes with identical reactivities with cryptococcal polysaccharide were prepared. The antibodies had the distinct biolo...

  18. SU (N) lattice integrable models and modular invariance

    International Nuclear Information System (INIS)

    Zuber, J.B.; Di Francesco, P.

    1989-01-01

    We first review some recent work on the construction of RSOS SU (N) critical integrable models. The models may be regarded as associated with a graph, extending from SU (2) to SU (N) an idea of Pasquier, or alternatively, with a representation of the fusion algebra over non-negative integer valued matrices. Some consistency conditions that the Boltzmann weights of these models must satisfy are then pointed out. Finally, the algebraic connections between (a subclass of) the admissible graphs and (a subclass of) modular invariants are discussed, based on the theory of C-algebras. The case of G 2 is also treated

  19. A comprehensive cytogenetic classification of 1466 Chinese patients with de novo acute lymphoblastic leukemia.

    Science.gov (United States)

    Li, Xin; Li, Juan; Hu, Yanjie; Xie, Wei; Du, Wen; Liu, Wei; Li, Xiaoqing; Chen, Xiangjun; Li, Hongrui; Wang, Junfeng; Zhang, Lannan; Huang, Shiang

    2012-06-01

    Cytogenetics and molecular cytogenetics of 1466 Chinese patients with de novo acute lymphoblastic leukemia (ALL) were studied. Cytogenetic results were available in 1175 patients. Cross-correlations of 23 subclasses of cytogenetic abnormalities were described. Childhood cases had higher incidences of normal karyotype, t(1;19), +8, 12q-, +21, +22 and high hyperdiploidy with 51-65 chromosomes, and lower incidences of t(9;22) and -5/5q- than adult ones (all pcytogenetic subclasses with immunophenotyping subgroups of ALL were studied. Our study presents the cytogenetic characteristics of a large series of Chinese ALL patients. Copyright © 2011 Elsevier Ltd. All rights reserved.

  20. Numeric invariants from multidimensional persistence

    Energy Technology Data Exchange (ETDEWEB)

    Skryzalin, Jacek [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Carlsson, Gunnar [Stanford Univ., Stanford, CA (United States)

    2017-05-19

    In this paper, we analyze the space of multidimensional persistence modules from the perspectives of algebraic geometry. We first build a moduli space of a certain subclass of easily analyzed multidimensional persistence modules, which we construct specifically to capture much of the information which can be gained by using multidimensional persistence over one-dimensional persistence. We argue that the global sections of this space provide interesting numeric invariants when evaluated against our subclass of multidimensional persistence modules. Lastly, we extend these global sections to the space of all multidimensional persistence modules and discuss how the resulting numeric invariants might be used to study data.

  1. Properties of a class of block-iterative methods

    International Nuclear Information System (INIS)

    Elfving, Tommy; Nikazad, Touraj

    2009-01-01

    We study a class of block-iterative (BI) methods proposed in image reconstruction for solving linear systems. A subclass, symmetric block-iteration (SBI), is derived such that for this subclass both semi-convergence analysis and stopping-rules developed for fully simultaneous iteration apply. Also results on asymptotic convergence are given, e.g., BI exhibit cyclic convergence irrespective of the consistency of the linear system. Further it is shown that the limit points of SBI satisfy a weighted least-squares problem. We also present numerical results obtained using a trained stopping rule on SBI

  2. Transition-Systems, Event Structures, and Unfoldings

    DEFF Research Database (Denmark)

    Nielsen, Mogens; Rozenberg, Grzegorz; Thiagarajan, P.S.

    1995-01-01

    systems. Here we show that by smoothly strengthening the regional axioms for elementary transition systems, one obtains a subclass called occurrence transition system. We then prove that occurrence transition systems are the transition system model of yet another basic model of concurrency, namely, prime......A subclass of transition systems called elementary transition systems can be identified with the help of axioms based on a structural notion called regions. Elementary transition systems have been shown to be the transition system model of a basic system model of net theory called elementary net...

  3. ヒト血清M蛋白のIgGH鎖サブクラスの型判定について -高分解能アガロースゲル等電点電気泳動法の分離と検出のための条件設定-

    OpenAIRE

    一村, 光子; 唐下, 博子; 崎山, 順子; 中田, 安成; 遠藤, 浩

    1994-01-01

    IgG Heavy-Chain subclass typing of human serum M-protein were isoelectrofocussed (IEF) in agarose gel, and then the bands of IgG were detected with peroxidase-conjugated anti-human IgG1-4 monoclonal antibodies on the same isoelectrofocussed agarose gel plate. This IEF enzyme immunodetection patterns were composed of four to eight discrete bands (The range of pI was 6.0 to 9.0). These bands were dependent on immunofixationbands. It was very specific and clear to detect the subclass of IgG Type...

  4. Humoral immune response to Plasmodium falciparum vaccine candidate GMZ2 and its components in populations naturally exposed to seasonal malaria in Ethiopia

    DEFF Research Database (Denmark)

    Mamo, Hassen; Esen, Meral; Ajua, Anthony

    2013-01-01

    for malaria infection microscopically and by the rapid diagnostic test (RDT). Sera were tested by using enzyme-linked immunosorbent assay (ELISA) for total immunoglobulin (Ig) G against P. falciparum blood-stage vaccine candidate GMZ2 and its subunits (Glutamate-rich protein (GLURP-R0), merozoite surface...... transmission in the two localities and/or genetic differences between the two populations in their response to the antigens. In both study sites, IgG subclass levels to GLURP-R0 were significantly higher than that to MSP3 for all corresponding subclasses in most individuals, indicating the higher relative...

  5. Sublittoral meiobenthic assemblages from disturbed and non-disturbed sediments in the Balearics

    Directory of Open Access Journals (Sweden)

    S. Deudero

    2000-09-01

    Full Text Available Qualitative and quantitative differences in species composition of meiobenthic communities illustrate the differences among various taxonomic assemblages in the Balearic Islands (Western Mediterranean analysed by means of multivariate analysis. Average densities ranged between 1000 and 4000 ind?10cm-2, and are in the same range as previously reported from other shallow Mediterranean areas. The dominant meiofaunal taxa were Nematoda (range 40 to 75%, Turbellaria (5-47% and Copepoda (2-14%, while other meiofaunal groups (Tardigrada and Rotifera were only represented by approximately 5% of the total abundance. The dominant nematode families were Desmodoridae, Chromadoridae and Xyalidae. The meiofaunal communities showed little variation among locations. Moreover, small-scale heterogeneity does not seem to affect nematode distribution as shown by the high similarity between replicates in the multivariate analysis.

  6. Occurrence of Ergasilus megaceros Wilson, 1916, in the sea lamprey and other fishes from North America

    Science.gov (United States)

    Muzzall, Patrick M.; Hudson, Patrick L.

    2004-01-01

    Ergasilus megaceros (Copepoda: Ergasilidae) was recovered from the nasal fossae (lamellae) of the olfactory sac in 1 (1.8%) of 56 sea lampreys, Petromyzon marinus Linne, 1758, collected in May 2002 from the Cheboygan River, Michigan. Although the sea lamprey is a new host record for E. megaceros, this fish species may not be a preferred host because of its low prevalence. Ergasilus megaceros is the second ergasilid species reported from the sea lamprey in North America. This is the third report of an ergasilid species infecting the nasal fossae of fishes in North America, with E. rhinos being the only other species reported from this site.

  7. Composición taxonómica del zooplancton del embalse de Betania, departamento del Huila, Colombia

    Directory of Open Access Journals (Sweden)

    Yimy Herrera Martinez

    1999-01-01

    Full Text Available To determine the species composition of the zooplancton in the reservoir Betania (altitude; 560 m.a.s.l.; area: 7.4 km2; vol: 1971 x 106 m3; mean depht 28 m, at seven sites and several depths, bimonthly net samples (100 and 200 microns mesh size were taken during 1991.  Alltogether 24 species were found: Thermocyclops decipiens (Crustacea, Copepoda, Moina sp., Ceriodaphnia cornuta y Allona sp. (Crustacea, Cladocera; 19 species of rotífers, of which 7 belong to the genus Brachionus, as well as larvas of the dipter Chaoborus sp. For the first time Brachionus havanaensis, B. falcatus falcatus, b. quadridentatus, y Platyias cuadricornis  f. brevispinus  were found in Colombia.  The species composition was compared with the composition of other lakes and comparison shows that the Betania reservoir has a typical species composition for warms tropical lakes.

  8. The effects of environmental parameters on zooplankton assemblages in tropical coastal estuary, South-west, Nigeria

    Directory of Open Access Journals (Sweden)

    Waidi O. Abdul

    2016-09-01

    Full Text Available The present study was carried out to examine the distribution and assemblage structure of zooplankton in relation to environmental parameters of tropical coastal estuarine ecosystem impounding Bight of Benin, Nigeria. The estuarine water samples were collected between January and December, 2014 from three sampling zones (Brushpark, Open water and Wetland then were fixed in 4% formalin. A total of twenty-eight (28 species belonging to four (4 groups were recorded in this study. These groups were rotifera, copepoda, cladocerans and ostracodas, and were all widely distributed in the three investigated zones. Higher richness, dominance and abundance indices were recorded in Zone I when compared to both Zones II and III. Cluster analysis showed five distinct species communities. The canonical correspondence analysis (CCA showed a distinct smattering positive and negative correlation on the distribution of zooplankton indicating that the relative abundance of any species was dependent on specific environmental variables.

  9. Co-infestation of gills by different parasite groups in the mullet, Mugil platanus Günther, 1880 (Osteichthyes, Mugilidae): effects on relative condition factor.

    Science.gov (United States)

    Ranzani-Paiva, M J T; Silva-Souza, A T

    2004-08-01

    This study involved 334 specimens of mullet, Mugil platanus, captured monthly in the estuarine region of Cananéia, São Paulo State, Brazil, from July 1988 to June 1989, and examined for the presence of gill parasites. Parasitological inspections revealed the occurrence of the following groups: Trichodina sp., Monogenoidea, Copepoda, and Hirudinea. Only four mullets were not parasitized. Total weight and total length of all 334 mullet specimens examined were used for adjusting the weight-length relationship curve and calculating the relative condition factor (Kn). The 118 specimens infested with monogenoideans on average had lower weights than expected (Kn 1.0. It was possible to infer that gill infestation with monogenoideans alters mullet weight, especially in the presence of co-infestation with Trichodina sp. and copepods.

  10. Co-infestation of gills by different parasite groups in the mullet, Mugil platanus Günther, 1880 (Osteichthyes, Mugilidae: effects on relative condition factor

    Directory of Open Access Journals (Sweden)

    M. J. T. Ranzani-Paiva

    Full Text Available This study involved 334 specimens of mullet, Mugil platanus, captured monthly in the estuarine region of Cananéia, São Paulo State, Brazil, from July 1988 to June 1989, and examined for the presence of gill parasites. Parasitological inspections revealed the occurrence of the following groups: Trichodina sp., Monogenoidea, Copepoda, and Hirudinea. Only four mullets were not parasitized. Total weight and total length of all 334 mullet specimens examined were used for adjusting the weight-length relationship curve and calculating the relative condition factor (Kn. The 118 specimens infested with monogenoideans on average had lower weights than expected (Kn 1.0. It was possible to infer that gill infestation with monogenoideans alters mullet weight, especially in the presence of co-infestation with Trichodina sp. and copepods.

  11. Pemanfaatan Plankton sebagai Sumber Makanan Ikan Bandeng di Waduk Ir. H. Juanda, Jawa Barat

    Directory of Open Access Journals (Sweden)

    Deden Ibnu Aqil

    2016-03-01

    Full Text Available Introducing of Milkfish (Chanos chanos was aimed to utilize natural food from plankton that were abundant in Ir. H. Juanda Reservoir, West Java. This research aimed to know plankton utilization by Milkfish in Ir. H. Juanda Reservoir, West Java. The research was conducted from February to July 2010 at 4 stations of sampling which representing the reservoir condition. The fishes collected based on the catch of fishermen. The sample was analyzed in physiology laboratory of Center Research for Limnology. The result of this research showed that the main food were plankton 43%, detritus 46%, and complement food were vegetation 11%. The domination food from the phytoplankton were Bacillariophyceae and zooplankton were Copepoda.

  12. Variaciones de abundancia y biomasa del zooplancton en un embalse tropical oligo-mesotrófico del norte de Venezuela

    Directory of Open Access Journals (Sweden)

    Sandra Merayo

    2010-06-01

    Full Text Available La abundancia del zooplancton en los embalses está determinada principalmente por la velocidad y el contenido del agua, pero se sabe relativamente poco sobre los embalses tropicales. Se estudió la distribución temporal y espacial de la abundancia y la biomasa del zooplancton en el eje longitudinal del embalse de Clavellinos, en el norte de Venezuela, entre octubre 2006 y septiembre 2007. El zooplancton fue recolectado en el estrato oxigenado con una red de plancton. Un total de 16 taxones fueron identificados: Copepoda, Cladocera, Rotifera, Ostracoda y Diptera. Thermocyclops decipiens (Copepoda, Cyclopoida dominó la comunidad, mientras que los rotíferos fueron los más diversos, con 10 especies. La abundancia del zooplancton varió de 31 a 101ind/l en E1, 36 a 84ind/l en E2, y, de 30 a 250ind/L en el E3. La biomasa varió de 97,4 a 1406.3μg/l en E1, 108,5 a 397.2μg/l en E2, y de 25,9 a 763.9μg/l en el E3. Esta comunidad de zooplancton pareciσ responder a las variaciones ambientales en el embalse, mαs que a las variaciones en la disponibilidad de recursos.Variations of zooplankton abundance and biomass in a tropical oligo-mesotrophic reservoir in Northern Venezuela. Zooplankton abundance in reservoirs is mainly determined by the speed and content of the water, but relatively little is known regarding tropical reservoirs. We studied the seasonal and spatial distribution of zooplankton abundance and biomass along the longitudinal axis of Clavellinos reservoir, northern Venezuela, from October 2006 to September 2007. Zooplankton was collected from the oxygenated layer using a plankton net. A total of 16 taxa were identified: Copepoda, Cladocera, Rotifera, Ostracoda and Diptera. Thermocyclops decipiens (Copepoda, Cyclopoida dominated the community, while rotifers were the most diverse, with 10 species. Zooplankton abundance varied from 31 to 101ind/L in E1, 36 to 84ind/L in E2, and, from 30 to 250ind/L in E3. Biomass varied from 97.4 to

  13. Diel feeding pattern and diet of rough scad Trachurus lathami Nichols, 1920 (Carangidae from the Southwestern Atlantic

    Directory of Open Access Journals (Sweden)

    Maria Raquel de Carvalho

    Full Text Available Diel changes in feeding activity and dietary composition of the rough scad Trachurus lathami were investigated through the analysis of stomach contents of 307 fish sampled over a 24-h period on the continental shelf off Ubatuba (23º 35'S 45ºW. Stomach contents were analyzed by frequency of occurrence (O%, percent number (N%, percent mass (M%, and feeding index (FI% = O% * M%. Rough scad fed on mollusks (Gastropoda, Crepidula sp., crustacean (Ostracoda, Copepoda, decapod larvae, chaetognat and teleostean fish. The main items were calanoid copepods (Eucalanus sp. and Centropages sp.. According to the analysis of the stomach fullness and prey digestion, T. lathami is both a diurnal and nocturnal feeder, showing some seasonal variation in feeding time. According to the Chronobiology concept, it was raised the hypothesis of circadian rhythm in feeding of this fish, probably synchronized by light/dark cycle.

  14. Feeding ecology of waterfowl wintering on evaporation ponds in California

    Science.gov (United States)

    Euliss, N.H.; Jarvis, R.L.; Gilmer, D.S.

    1991-01-01

    We examined the feeding ecology of Northern Pintails (Anas acuta), Northern Shovelers (A. clypeata), and Ruddy Ducks (Oxyura jamaicensis) wintering on drainwater evaporation ponds in California from 1982 through 1984. Pintails primarily consumed midges (Chironomidae) (39.3%) and widegeongrass (Ruppia maritima) nutlets (34.6%). Shovelers and Ruddy Ducks consumed 92.5% and 90.1% animal matter, respectively. Water boatmen (Corixidae) (51.6%), rotifers (Rotatoria) (20.4%), and copepods (Copepoda) (15.2%) were the most important Shoveler foods, and midges (49.7%) and water boatmen (36.0%) were the most important foods of Ruddy Ducks. All three species were opportunistic foragers, shifting their diets seasonally to the most abundant foods given their behavioral and morphological attributes.

  15. Oceanographic mechanisms that possibly explain dominance of neritic-tropical zooplankton species assemblages around the Islas Marías Archipelago, Mexico

    Directory of Open Access Journals (Sweden)

    Jaime Gómez-Gutiérrez

    2014-11-01

    Full Text Available The nearshore zooplankton species assemblage, identified per taxonomic groups (20 and per species for 12 selected groups, was analyzed from samples collected during November 2010 at four volcanic islands of the Islas Marías Archipelago (IMA, located 90-120 km offshore Nayarit, Mexico. From chlorophyll-a concentration and zooplankton biovolume perspective mesotrophic conditions prevailed in comparison with the Gulf of California during November. Crustaceans numerically dominated the zooplankton assemblage (92.3% [Copepoda (79.2%, Decapoda larvae (4.7%, Cladocera (3.7%, Mysidacea (2.7%, and Euphausiacea (2.0%]. The other 15 taxonomic groups (7.7% combined accounted each one less than 1.5% of the relative abundance. Species richness of selected taxa (~56%> included 259 taxa (121 identified to species, 117 to genus, and 21 not identified. Tropical species from neritic affinity clearly dominated zooplankton assemblage around IMA. Five tropical Copepoda species [Calanopia minor (Dana, Clausocalanus jobei Frost & Fleminger, Acrocalanus gibber Giesbrecht, Canthocalanus pauper (Giesbrecht, and Centropages furcatus (Dana], a cladoceran Pseudevadne tergestina (Claus, and a Mysidacea species (Mysidium reckettsi Harrison & Bowman dominated the zooplankton assemblage (accounting about 55% of total abundance of the identified species. Except C. furcatus, all these species are not abundant at oceanic regions of the central and northern Gulf of California. The similarity of multiple neritic and tropical species in the zooplankton assemblage from IMA and Cape Corrientes suggests strong coastal-insular plankton connectivity. Episodic current plumes associated with anomalous intense rivers discharge during rainy years, eddies generated by coastal upwelling event that move offshore, and northward regional oceanic circulation are the most likely mesoscale oceanographic processes that cause costal tropical zooplankton drift enhancing coastal-Archipelago species

  16. Differences between groundwater fauna in shallow and in deep intergranular aquifers as an indication of different characteristics of habitats and hydraulic connections

    Directory of Open Access Journals (Sweden)

    Anton Brancelj

    2016-03-01

    Full Text Available The fauna in the hyporheic zones of rivers has been relatively well studied but that from the phreatic zone remains comparatively unknown and there are few investigations into deeper intergranular aquifers (over 30 m in depth due to technical difficulties. Two shallow boreholes of 29 m depth and two deep boreholes of 100 m depth, both near Ljubljana (Slovenia, were sampled more than 30 times between 14 January 2008 and 3 March 2009.  On each occasion 14.4 to 18.0 m3 of water were abstracted using a high-capacity pump, then filtered by means of a plankton net with a mesh size of 60 µm. Organisms larger than 2 mm were damaged by the pump rotors, but their identification was still possible, while smaller representatives of the Copepoda (Crustacea passed the rotors without  damage. A near-by artesian borehole was sampled on 6 occasions. Water chemistry, physical properties and faunal composition analyses were carried out for each borehole. A total of 32 taxa, 24 of which were stygobites, were identified. Copepoda alone were represented by 16 species, 15 of which were stygobites. The shallow boreholes differ from the deep boreholes in their higher temperatures and higher concentrations of K+, Na+, Ca2+, Mg2+ and SO42- ions. The copepod communities in samples from the shallow boreholes differ sharply from those from the deep boreholes. There were also clear differences between shallow boreholes in two aquifers located a few kilometres apart, in physical and chemical characteristics as well as in fauna composition. Taxa with different ecological affinities, collected from groundwater, are indicators of hydraulic connections between different parts of an aquifer as well as of communication between surface and subsurface water bodies. The present study suggests that subterranean fauna, as well as epigean fauna, can provide effective support for classical dye/salt tracing experiments.

  17. A gene-based SNP resource and linkage map for the copepod Tigriopus californicus

    Directory of Open Access Journals (Sweden)

    Foley Brad R

    2011-11-01

    Full Text Available Abstract Background As yet, few genomic resources have been developed in crustaceans. This lack is particularly evident in Copepoda, given the extraordinary numerical abundance, and taxonomic and ecological diversity of this group. Tigriopus californicus is ideally suited to serve as a genetic model copepod and has been the subject of extensive work in environmental stress and reproductive isolation. Accordingly, we set out to develop a broadly-useful panel of genetic markers and to construct a linkage map dense enough for quantitative trait locus detection in an interval mapping framework for T. californicus--a first for copepods. Results One hundred and ninety Single Nucleotide Polymorphisms (SNPs were used to genotype our mapping population of 250 F2 larvae. We were able to construct a linkage map with an average intermarker distance of 1.8 cM, and a maximum intermarker distance of 10.3 cM. All markers were assembled into linkage groups, and the 12 linkage groups corresponded to the 12 known chromosomes of T. californicus. We estimate a total genome size of 401.0 cM, and a total coverage of 73.7%. Seventy five percent of the mapped markers were detected in 9 additional populations of T. californicus. Of available model arthropod genomes, we were able to show more colocalized pairs of homologues between T. californicus and the honeybee Apis mellifera, than expected by chance, suggesting preserved macrosynteny between Hymenoptera and Copepoda. Conclusions Our study provides an abundance of linked markers spanning all chromosomes. Many of these markers are also found in multiple populations of T. californicus, and in two other species in the genus. The genomic resource we have developed will enable mapping throughout the geographical range of this species and in closely related species. This linkage map will facilitate genome sequencing, mapping and assembly in an ecologically and taxonomically interesting group for which genomic resources are

  18. A gene-based SNP resource and linkage map for the copepod Tigriopus californicus

    Science.gov (United States)

    2011-01-01

    Background As yet, few genomic resources have been developed in crustaceans. This lack is particularly evident in Copepoda, given the extraordinary numerical abundance, and taxonomic and ecological diversity of this group. Tigriopus californicus is ideally suited to serve as a genetic model copepod and has been the subject of extensive work in environmental stress and reproductive isolation. Accordingly, we set out to develop a broadly-useful panel of genetic markers and to construct a linkage map dense enough for quantitative trait locus detection in an interval mapping framework for T. californicus--a first for copepods. Results One hundred and ninety Single Nucleotide Polymorphisms (SNPs) were used to genotype our mapping population of 250 F2 larvae. We were able to construct a linkage map with an average intermarker distance of 1.8 cM, and a maximum intermarker distance of 10.3 cM. All markers were assembled into linkage groups, and the 12 linkage groups corresponded to the 12 known chromosomes of T. californicus. We estimate a total genome size of 401.0 cM, and a total coverage of 73.7%. Seventy five percent of the mapped markers were detected in 9 additional populations of T. californicus. Of available model arthropod genomes, we were able to show more colocalized pairs of homologues between T. californicus and the honeybee Apis mellifera, than expected by chance, suggesting preserved macrosynteny between Hymenoptera and Copepoda. Conclusions Our study provides an abundance of linked markers spanning all chromosomes. Many of these markers are also found in multiple populations of T. californicus, and in two other species in the genus. The genomic resource we have developed will enable mapping throughout the geographical range of this species and in closely related species. This linkage map will facilitate genome sequencing, mapping and assembly in an ecologically and taxonomically interesting group for which genomic resources are currently under development

  19. Işıklı Gölü ve Kaynaklarının (Çivril-Denizli Crustacea Faunası.

    Directory of Open Access Journals (Sweden)

    Cem Aygen

    2015-12-01

    Full Text Available Bu çalışmada, Işıklı Gölü Crustacea faunasının taksonomik açıdan incelenmesi hedeflenmiştir. Bu amaçla Şubat 1998-Ocak 1999 ayları arasında, gölde ve göle akan kaynak bölgesinde belirlenen 6 istasyondan aylık periyotlarla biyolojik örnekler ve su örnekleri alınmıştır. Araştırma sonunda Işıklı Gölü ve Kaynağı’nda bulunan Crustacea faunasının başlıca Cladocera (16 tür, Copepoda (12 tür, Ostracoda (1 tür, Amphipoda (2 tür, Isopoda (1 tür, Mysidacea (1 tür ve Decapoda (1 tür gruplarından oluştuğu saptanmıştır. Tespit edilen türlerden Cladocera grubundan Diaphanosoma brachyurum, Diaphanosoma mongolianum, Ceriodaphnia pulchella, Simocephalus vetulus, Macrothrix laticornis, Alona rectangula, Alona guttata, Graptoleberis testudinaria, Leydigia leydigi, Biapertura affinis, Chydorus sphaericus, Pleuroxus aduncus ve Disparalona rostrata; Copepoda grubundan Macrocyclops albidus, Eucyclops serrulatus, Eucyclops speratus, Eucyclops macruroides, Metacyclops gracilis, Mesocyclops leuckarti, Cyclops vicinus, Cyclops abyssorum, Cyclops strenuus, Megacyclops viridis, Acanthocyclops robustus, Canthocamptus staphylinus; Ostracoda grubundan Psychrodromus olivaceus; Amphipoda grubundan Gammarus balcanicus, Gammarus obnixus; Isopoda grubundan Asellus aquaticus türleri Işıklı Gölü’nden ilk kez bildirilmektedir

  20. On self-similar Tolman models

    International Nuclear Information System (INIS)

    Maharaj, S.D.

    1988-01-01

    The self-similar spherically symmetric solutions of the Einstein field equation for the case of dust are identified. These form a subclass of the Tolman models. These self-similar models contain the solution recently presented by Chi [J. Math. Phys. 28, 1539 (1987)], thereby refuting the claim of having found a new solution to the Einstein field equations